F489451
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1068 | 354 | 2132 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300050507|nmdc:mga05p37_443271_c1|nmdc:mga05p37_443271_c1_40_1158 |
| Length | 372 |
| Sequence | VSPPYSAKSVGSISASTAACRSCARQHPAAALHDCKEAILKRIKRREFITLFGGAAVAWPLAVRAQQPERMRRIGVLAGGAVASDADTQERNAVFAKSLQELGWVIGRNVRIDFRYGLGDAANVRKYVEELVALRPDVVLASGASVLAPLLQATRTVPIVFVAVADPVGAGFVESMARPGGNATGFIQFEYSLSGKWLELLKEIAPGVTRAAILRDPATTAGVGQFAVIQSVASSIGLDVRPVNVRDAGEIERAVTATAGLPNAGLVVTASASSLVHSALIITLAERHKLPAVYPRRSFVAAGGLTSYGFDALDQVRQAAGYIDRILKGDKPANLPVQAPTKYELLINLKTAKALGLDIPATLLARADEVIE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 5 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 7 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 9 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 10 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 11 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 12 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 13 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 14 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 15 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 16 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 17 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 18 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 19 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 20 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 21 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 22 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 23 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 24 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 25 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 26 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 27 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 30 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 72 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 77 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 89 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 91 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 92 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 93 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 95 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 96 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 97 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 98 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 99 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 100 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 101 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 102 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 103 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 104 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 105 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 107 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 108 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 112 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 114 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 115 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 116 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 117 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 118 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 119 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 120 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 121 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 123 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 124 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 153 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 223 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 227 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 228 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 229 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 230 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 231 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 232 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 233 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 234 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 235 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 241 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 243 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 244 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 246 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 248 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 253 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 254 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 257 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 258 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 261 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 262 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 263 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 264 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 265 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 325 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 326 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 327 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 328 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 329 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 330 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 333 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 334 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 335 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 336 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 337 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 338 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 339 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 340 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 341 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 342 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 354 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.91 |
| Metatranscriptomes | 0 |
| Isolates | 0.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.75 |
| Nodule | 0 |
| Rhizoplane | 13.95 |
| Rhizosphere | 85.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga05p37_443271_c1 | 3300050507 | Bacteria | 1505 |
| 2 | SwRhRL2b_contig_907168 | 2162886007 | Bacteria | 1262 |
| 3 | MBSR1b_contig_12792658 | 2162886012 | Bacteria | 986 |
| 4 | 2214628273 | 2209111006 | Bacteria | 5074 |
| 5 | ARcpr5oldR_c000273 | 3300000041 | Bacteria | 7860 |
| 6 | ARSoilYngRDRAFT_c00245 | 3300000042 | Bacteria | 8634 |
| 7 | ARcpr5yngRDRAFT_c000126 | 3300000043 | Bacteria | 11973 |
| 8 | ARSoilOldRDRAFT_c000152 | 3300000044 | Bacteria | 11718 |
| 9 | ARCol0yngRDRAFT_1000342 | 3300000652 | Bacteria | 6695 |
| 10 | JGI24752J21851_1003298 | 3300001976 | Bacteria | 2128 |
| 11 | JGI24746J21847_1000474 | 3300001977 | Bacteria | 5984 |
| 12 | JGI24746J21847_1000629 | 3300001977 | Bacteria | 5399 |
| 13 | JGI24739J22299_10003620 | 3300001989 | Bacteria | 5901 |
| 14 | JGI24739J22299_10004255 | 3300001989 | Bacteria | 5480 |
| 15 | JGI24737J22298_10000062 | 3300001990 | Bacteria | 32348 |
| 16 | JGI24737J22298_10000073 | 3300001990 | Bacteria | 29633 |
| 17 | JGI24737J22298_10019219 | 3300001990 | Bacteria | 2186 |
| 18 | JGI24750J21931_1000377 | 3300002070 | Bacteria | 7558 |
| 19 | JGI24745J21846_1000398 | 3300002073 | Bacteria | 3817 |
| 20 | JGI24745J21846_1002321 | 3300002073 | Unclassified | 1934 |
| 21 | JGI24748J21848_1000480 | 3300002074 | Bacteria | 4395 |
| 22 | JGI24748J21848_1002694 | 3300002074 | Bacteria | 2018 |
| 23 | JGI24738J21930_10000217 | 3300002075 | Bacteria | 15544 |
| 24 | JGI24738J21930_10002341 | 3300002075 | Bacteria | 4998 |
| 25 | JGI24749J21850_1000689 | 3300002076 | Bacteria | 4866 |
| 26 | JGI24749J21850_1000849 | 3300002076 | Bacteria | 4401 |
| 27 | JGI24744J21845_10001417 | 3300002077 | Bacteria | 4757 |
| 28 | JGI24035J26624_1000036 | 3300002126 | Bacteria | 9732 |
| 29 | JGI24035J26624_1000204 | 3300002126 | Bacteria | 5367 |
| 30 | JGI24033J26618_1002646 | 3300002155 | Unclassified | 1844 |
| 31 | JGI24034J26672_10000225 | 3300002239 | Bacteria | 7445 |
| 32 | JGI24034J26672_10001370 | 3300002239 | Bacteria | 3225 |
| 33 | JGI24742J22300_10000032 | 3300002244 | Bacteria | 21385 |
| 34 | JGI24742J22300_10000049 | 3300002244 | Bacteria | 17824 |
| 35 | JGI24751J29686_10003092 | 3300002459 | Bacteria | 3352 |
| 36 | JGI25405J52794_10015577 | 3300003911 | Bacteria | 1495 |
| 37 | Ga0065717_1001953 | 3300005276 | Bacteria | 5313 |
| 38 | Ga0065716_1002765 | 3300005277 | Bacteria | 1514 |
| 39 | Ga0065704_10002996 | 3300005289 | Bacteria | 5726 |
| 40 | Ga0065712_10086330 | 3300005290 | Bacteria | 2642 |
| 41 | Ga0065712_10089240 | 3300005290 | Bacteria | 2480 |
| 42 | Ga0065715_10009470 | 3300005293 | Bacteria | 4675 |
| 43 | Ga0065715_10091967 | 3300005293 | Bacteria | 5425 |
| 44 | Ga0065715_10092041 | 3300005293 | Bacteria | 5371 |
| 45 | Ga0070676_10000251 | 3300005328 | Bacteria | 23359 |
| 46 | Ga0070676_10258621 | 3300005328 | Bacteria | 1165 |
| 47 | Ga0070683_100000344 | 3300005329 | Bacteria | 31967 |
| 48 | Ga0070683_100002231 | 3300005329 | Bacteria | 15353 |
| 49 | Ga0070683_100100054 | 3300005329 | Bacteria | 2729 |
| 50 | Ga0070683_100123307 | 3300005329 | Unclassified | 2448 |
| 51 | Ga0070690_100000588 | 3300005330 | Bacteria | 18282 |
| 52 | Ga0070690_100000616 | 3300005330 | Bacteria | 18011 |
| 53 | Ga0070690_100029125 | 3300005330 | Bacteria | 3422 |
| 54 | Ga0070670_100001740 | 3300005331 | Bacteria | 17730 |
| 55 | Ga0070670_100001768 | 3300005331 | Bacteria | 17581 |
| 56 | Ga0070670_100038401 | 3300005331 | Bacteria | 4117 |
| 57 | Ga0070677_10000076 | 3300005333 | Bacteria | 31338 |
| 58 | Ga0070677_10001576 | 3300005333 | Bacteria | 7221 |
| 59 | Ga0068869_100000078 | 3300005334 | Bacteria | 44066 |
| 60 | Ga0068869_100008854 | 3300005334 | Bacteria | 6512 |
| 61 | Ga0070666_10003799 | 3300005335 | Bacteria | 9159 |
| 62 | Ga0070666_10033485 | 3300005335 | Bacteria | 3400 |
| 63 | Ga0070666_10209024 | 3300005335 | Unclassified | 1374 |
| 64 | Ga0070680_100000333 | 3300005336 | Bacteria | 31571 |
| 65 | Ga0070680_100006554 | 3300005336 | Bacteria | 8854 |
| 66 | Ga0070680_100076036 | 3300005336 | Bacteria | 2764 |
| 67 | Ga0070680_100310650 | 3300005336 | Bacteria | 1337 |
| 68 | Ga0070682_100000285 | 3300005337 | Bacteria | 36134 |
| 69 | Ga0070682_100001569 | 3300005337 | Bacteria | 12756 |
| 70 | Ga0068868_100001627 | 3300005338 | Bacteria | 15328 |
| 71 | Ga0068868_100003400 | 3300005338 | Bacteria | 11071 |
| 72 | Ga0070660_100000474 | 3300005339 | Bacteria | 26843 |
| 73 | Ga0070660_100001115 | 3300005339 | Bacteria | 18124 |
| 74 | Ga0070660_100022012 | 3300005339 | Bacteria | 4709 |
| 75 | Ga0070660_100059229 | 3300005339 | Bacteria | 2969 |
| 76 | Ga0070660_100083185 | 3300005339 | Bacteria | 2514 |
| 77 | Ga0070689_100000252 | 3300005340 | Bacteria | 31157 |
| 78 | Ga0070689_100002086 | 3300005340 | Bacteria | 12980 |
| 79 | Ga0070691_10000476 | 3300005341 | Bacteria | 14963 |
| 80 | Ga0070691_10002482 | 3300005341 | Bacteria | 8203 |
| 81 | Ga0070687_100000476 | 3300005343 | Bacteria | 13445 |
| 82 | Ga0070661_100000605 | 3300005344 | Bacteria | 26796 |
| 83 | Ga0070661_100011032 | 3300005344 | Bacteria | 6295 |
| 84 | Ga0070661_100087137 | 3300005344 | Bacteria | 2309 |
| 85 | Ga0070692_10000127 | 3300005345 | Bacteria | 17980 |
| 86 | Ga0070692_10000227 | 3300005345 | Bacteria | 15439 |
| 87 | Ga0070692_10037540 | 3300005345 | Bacteria | 2463 |
| 88 | Ga0070692_10180539 | 3300005345 | Bacteria | 1223 |
| 89 | Ga0070668_100001035 | 3300005347 | Bacteria | 19528 |
| 90 | Ga0070668_100007791 | 3300005347 | Bacteria | 7952 |
| 91 | Ga0070668_100077010 | 3300005347 | Bacteria | 2607 |
| 92 | Ga0070668_100111172 | 3300005347 | Bacteria | 2180 |
| 93 | Ga0070669_100002096 | 3300005353 | Bacteria | 14426 |
| 94 | Ga0070669_100236895 | 3300005353 | Bacteria | 1448 |
| 95 | Ga0070675_100000522 | 3300005354 | Bacteria | 26236 |
| 96 | Ga0070675_100008366 | 3300005354 | Bacteria | 8026 |
| 97 | Ga0070675_100057814 | 3300005354 | Bacteria | 3198 |
| 98 | Ga0070675_100123510 | 3300005354 | Bacteria | 2201 |
| 99 | Ga0070671_100001132 | 3300005355 | Bacteria | 19809 |
| 100 | Ga0070671_100001344 | 3300005355 | Bacteria | 18404 |
| 101 | Ga0070671_100031885 | 3300005355 | Bacteria | 4356 |
| 102 | Ga0070671_100445550 | 3300005355 | Bacteria | 1111 |
| 103 | Ga0070674_100000240 | 3300005356 | Bacteria | 27228 |
| 104 | Ga0070674_100000603 | 3300005356 | Bacteria | 18184 |
| 105 | Ga0070674_100034347 | 3300005356 | Bacteria | 3386 |
| 106 | Ga0070674_100106942 | 3300005356 | Bacteria | 2048 |
| 107 | Ga0070674_100122367 | 3300005356 | Bacteria | 1928 |
| 108 | Ga0070673_100000164 | 3300005364 | Bacteria | 31985 |
| 109 | Ga0070673_100000666 | 3300005364 | Bacteria | 18932 |
| 110 | Ga0070688_100000162 | 3300005365 | Bacteria | 35811 |
| 111 | Ga0070688_100000961 | 3300005365 | Bacteria | 14418 |
| 112 | Ga0070688_100010001 | 3300005365 | Bacteria | 5211 |
| 113 | Ga0070688_100017036 | 3300005365 | Bacteria | 4165 |
| 114 | Ga0070688_100131813 | 3300005365 | Bacteria | 1687 |
| 115 | Ga0070688_100326582 | 3300005365 | Bacteria | 1116 |
| 116 | Ga0070659_100000720 | 3300005366 | Bacteria | 24009 |
| 117 | Ga0070659_100023047 | 3300005366 | Bacteria | 4761 |
| 118 | Ga0070659_100224466 | 3300005366 | Bacteria | 1551 |
| 119 | Ga0070659_100251249 | 3300005366 | Bacteria | 1465 |
| 120 | Ga0070667_100001046 | 3300005367 | Bacteria | 25228 |
| 121 | Ga0070667_100005648 | 3300005367 | Bacteria | 10444 |
| 122 | Ga0070667_100175685 | 3300005367 | Bacteria | 1893 |
| 123 | Ga0070667_100222406 | 3300005367 | Bacteria | 1681 |
| 124 | Ga0070703_10001840 | 3300005406 | Bacteria | 6241 |
| 125 | Ga0070703_10003412 | 3300005406 | Bacteria | 4534 |
| 126 | Ga0070709_10109983 | 3300005434 | Bacteria | 1851 |
| 127 | Ga0070714_100071576 | 3300005435 | Bacteria | 2999 |
| 128 | Ga0070713_100023176 | 3300005436 | Bacteria | 4812 |
| 129 | Ga0070713_100034835 | 3300005436 | Bacteria | 4049 |
| 130 | Ga0070710_10007557 | 3300005437 | Bacteria | 5264 |
| 131 | Ga0070710_10050308 | 3300005437 | Bacteria | 2335 |
| 132 | Ga0070710_10085609 | 3300005437 | Bacteria | 1849 |
| 133 | Ga0070701_10000860 | 3300005438 | Bacteria | 10910 |
| 134 | Ga0070701_10004311 | 3300005438 | Bacteria | 5743 |
| 135 | Ga0070701_10203060 | 3300005438 | Bacteria | 1173 |
| 136 | Ga0070711_100009305 | 3300005439 | Bacteria | 6044 |
| 137 | Ga0070711_100014237 | 3300005439 | Bacteria | 5009 |
| 138 | Ga0070711_100103672 | 3300005439 | Bacteria | 2073 |
| 139 | Ga0070705_100000321 | 3300005440 | Bacteria | 28395 |
| 140 | Ga0070705_100008646 | 3300005440 | Bacteria | 5042 |
| 141 | Ga0070700_100000654 | 3300005441 | Bacteria | 17120 |
| 142 | Ga0070700_100011814 | 3300005441 | Bacteria | 4848 |
| 143 | Ga0070700_100020746 | 3300005441 | Bacteria | 3812 |
| 144 | Ga0070694_100000554 | 3300005444 | Bacteria | 20566 |
| 145 | Ga0070694_100268475 | 3300005444 | Bacteria | 1296 |
| 146 | Ga0070694_100285896 | 3300005444 | Bacteria | 1259 |
| 147 | Ga0070708_100009300 | 3300005445 | Bacteria | 7918 |
| 148 | Ga0070708_100036023 | 3300005445 | Bacteria | 4314 |
| 149 | Ga0070708_100039455 | 3300005445 | Bacteria | 4131 |
| 150 | Ga0070708_100125601 | 3300005445 | Bacteria | 2371 |
| 151 | Ga0070663_100004739 | 3300005455 | Bacteria | 8026 |
| 152 | Ga0070663_100011128 | 3300005455 | Bacteria | 5634 |
| 153 | Ga0070663_100084630 | 3300005455 | Bacteria | 2338 |
| 154 | Ga0070663_100154433 | 3300005455 | Bacteria | 1762 |
| 155 | Ga0070663_100447617 | 3300005455 | Bacteria | 1064 |
| 156 | Ga0070678_100000228 | 3300005456 | Bacteria | 25430 |
| 157 | Ga0070678_100000570 | 3300005456 | Bacteria | 18085 |
| 158 | Ga0070678_100009473 | 3300005456 | Bacteria | 5904 |
| 159 | Ga0070678_100025375 | 3300005456 | Bacteria | 3986 |
| 160 | Ga0070678_100053064 | 3300005456 | Bacteria | 2947 |
| 161 | Ga0070662_100001178 | 3300005457 | Bacteria | 16047 |
| 162 | Ga0070662_100026848 | 3300005457 | Bacteria | 3991 |
| 163 | Ga0070662_100045270 | 3300005457 | Bacteria | 3156 |
| 164 | Ga0070662_100046488 | 3300005457 | Bacteria | 3119 |
| 165 | Ga0070662_100205836 | 3300005457 | Bacteria | 1563 |
| 166 | Ga0070681_10000446 | 3300005458 | Bacteria | 33708 |
| 167 | Ga0070681_10027394 | 3300005458 | Bacteria | 5730 |
| 168 | Ga0068867_100001229 | 3300005459 | Bacteria | 17655 |
| 169 | Ga0068867_100003347 | 3300005459 | Bacteria | 11293 |
| 170 | Ga0068867_100078925 | 3300005459 | Unclassified | 2477 |
| 171 | Ga0070685_10000768 | 3300005466 | Bacteria | 17443 |
| 172 | Ga0070685_10001094 | 3300005466 | Bacteria | 14501 |
| 173 | Ga0070706_100008477 | 3300005467 | Bacteria | 9577 |
| 174 | Ga0070706_100057654 | 3300005467 | Bacteria | 3584 |
| 175 | Ga0070706_100190833 | 3300005467 | Bacteria | 1914 |
| 176 | Ga0070706_100198167 | 3300005467 | Bacteria | 1876 |
| 177 | Ga0070706_100458086 | 3300005467 | Unclassified | 1187 |
| 178 | Ga0070706_100537033 | 3300005467 | Bacteria | 1088 |
| 179 | Ga0070707_100226693 | 3300005468 | Bacteria | 1819 |
| 180 | Ga0070698_100050289 | 3300005471 | Bacteria | 4250 |
| 181 | Ga0070698_100052632 | 3300005471 | Bacteria | 4140 |
| 182 | Ga0070698_100097098 | 3300005471 | Bacteria | 2922 |
| 183 | Ga0074259_10002483 | 3300005507 | Bacteria | 1205 |
| 184 | Ga0070699_100408392 | 3300005518 | Bacteria | 1228 |
| 185 | Ga0070679_100001839 | 3300005530 | Bacteria | 19098 |
| 186 | Ga0070679_100005106 | 3300005530 | Bacteria | 12130 |
| 187 | Ga0070679_100249166 | 3300005530 | Bacteria | 1733 |
| 188 | Ga0070679_100315649 | 3300005530 | Bacteria | 1512 |
| 189 | Ga0070684_100000411 | 3300005535 | Bacteria | 29347 |
| 190 | Ga0070684_100008904 | 3300005535 | Bacteria | 7877 |
| 191 | Ga0070684_100051289 | 3300005535 | Bacteria | 3584 |
| 192 | Ga0070684_100118415 | 3300005535 | Bacteria | 2380 |
| 193 | Ga0070697_100044711 | 3300005536 | Bacteria | 3587 |
| 194 | Ga0070697_100045090 | 3300005536 | Bacteria | 3573 |
| 195 | Ga0070697_100087885 | 3300005536 | Bacteria | 2566 |
| 196 | Ga0070697_100094651 | 3300005536 | Bacteria | 2475 |
| 197 | Ga0070672_100001539 | 3300005543 | Bacteria | 14279 |
| 198 | Ga0070672_100013692 | 3300005543 | Bacteria | 5734 |
| 199 | Ga0070686_100000379 | 3300005544 | Bacteria | 28370 |
| 200 | Ga0070686_100001252 | 3300005544 | Bacteria | 14418 |
| 201 | Ga0070686_100057138 | 3300005544 | Bacteria | 2505 |
| 202 | Ga0070686_100058334 | 3300005544 | Bacteria | 2483 |
| 203 | Ga0070695_100000294 | 3300005545 | Bacteria | 25143 |
| 204 | Ga0070695_100000341 | 3300005545 | Bacteria | 23917 |
| 205 | Ga0070695_100023224 | 3300005545 | Bacteria | 3808 |
| 206 | Ga0070695_100118133 | 3300005545 | Bacteria | 1810 |
| 207 | Ga0070696_100000594 | 3300005546 | Bacteria | 23147 |
| 208 | Ga0070696_100023629 | 3300005546 | Bacteria | 4178 |
| 209 | Ga0070696_100055145 | 3300005546 | Bacteria | 2772 |
| 210 | Ga0070696_100313823 | 3300005546 | Bacteria | 1204 |
| 211 | Ga0070693_100000031 | 3300005547 | Bacteria | 53010 |
| 212 | Ga0070693_100000345 | 3300005547 | Bacteria | 21169 |
| 213 | Ga0070693_100020113 | 3300005547 | Bacteria | 3515 |
| 214 | Ga0070665_100143954 | 3300005548 | Bacteria | 2387 |
| 215 | Ga0070665_100246968 | 3300005548 | Bacteria | 1785 |
| 216 | Ga0070704_100000481 | 3300005549 | Bacteria | 18891 |
| 217 | Ga0070704_100000911 | 3300005549 | Bacteria | 14847 |
| 218 | Ga0070704_100051612 | 3300005549 | Bacteria | 2897 |
| 219 | Ga0068855_100004006 | 3300005563 | Bacteria | 17985 |
| 220 | Ga0068855_100057969 | 3300005563 | Bacteria | 4538 |
| 221 | Ga0070664_100000874 | 3300005564 | Bacteria | 23359 |
| 222 | Ga0070664_100020100 | 3300005564 | Bacteria | 5498 |
| 223 | Ga0070664_100098089 | 3300005564 | Bacteria | 2545 |
| 224 | Ga0068857_100000249 | 3300005577 | Bacteria | 36056 |
| 225 | Ga0068857_100018629 | 3300005577 | Bacteria | 6092 |
| 226 | Ga0068857_100292332 | 3300005577 | Bacteria | 1501 |
| 227 | Ga0068854_100000146 | 3300005578 | Bacteria | 49106 |
| 228 | Ga0068854_100009557 | 3300005578 | Bacteria | 6259 |
| 229 | Ga0068856_100001251 | 3300005614 | Bacteria | 26705 |
| 230 | Ga0068856_100002466 | 3300005614 | Bacteria | 19047 |
| 231 | Ga0070702_100000134 | 3300005615 | Bacteria | 22670 |
| 232 | Ga0070702_100005638 | 3300005615 | Bacteria | 5857 |
| 233 | Ga0070702_100034973 | 3300005615 | Bacteria | 2773 |
| 234 | Ga0070702_100212870 | 3300005615 | Bacteria | 1287 |
| 235 | Ga0068852_100016912 | 3300005616 | Bacteria | 5706 |
| 236 | Ga0068852_100018965 | 3300005616 | Bacteria | 5434 |
| 237 | Ga0068859_100002043 | 3300005617 | Bacteria | 20614 |
| 238 | Ga0068859_100003259 | 3300005617 | Bacteria | 16525 |
| 239 | Ga0068859_100175910 | 3300005617 | Bacteria | 2222 |
| 240 | Ga0068864_100000674 | 3300005618 | Bacteria | 28538 |
| 241 | Ga0068864_100001986 | 3300005618 | Bacteria | 16845 |
| 242 | Ga0068864_100094332 | 3300005618 | Bacteria | 2645 |
| 243 | Ga0068864_100115595 | 3300005618 | Bacteria | 2393 |
| 244 | Ga0068866_10000348 | 3300005718 | Bacteria | 21747 |
| 245 | Ga0068866_10000557 | 3300005718 | Bacteria | 17018 |
| 246 | Ga0068861_100000958 | 3300005719 | Bacteria | 17568 |
| 247 | Ga0068861_100003474 | 3300005719 | Bacteria | 10457 |
| 248 | Ga0068870_10000032 | 3300005840 | Bacteria | 44525 |
| 249 | Ga0068870_10000115 | 3300005840 | Bacteria | 27156 |
| 250 | Ga0068870_10174368 | 3300005840 | Bacteria | 1286 |
| 251 | Ga0068863_100000150 | 3300005841 | Bacteria | 72968 |
| 252 | Ga0068863_100003793 | 3300005841 | Bacteria | 14944 |
| 253 | Ga0068863_100426209 | 3300005841 | Bacteria | 1300 |
| 254 | Ga0068858_100004191 | 3300005842 | Bacteria | 14194 |
| 255 | Ga0068858_100009937 | 3300005842 | Bacteria | 9039 |
| 256 | Ga0068858_100112167 | 3300005842 | Bacteria | 2547 |
| 257 | Ga0068858_100145530 | 3300005842 | Bacteria | 2225 |
| 258 | Ga0068858_100170093 | 3300005842 | Bacteria | 2054 |
| 259 | Ga0068858_100214853 | 3300005842 | Bacteria | 1820 |
| 260 | Ga0068860_100006010 | 3300005843 | Bacteria | 12217 |
| 261 | Ga0068860_100018645 | 3300005843 | Bacteria | 6749 |
| 262 | Ga0068860_100027186 | 3300005843 | Bacteria | 5512 |
| 263 | Ga0068860_100384724 | 3300005843 | Bacteria | 1385 |
| 264 | Ga0068860_100517880 | 3300005843 | Bacteria | 1192 |
| 265 | Ga0068862_100001121 | 3300005844 | Bacteria | 25430 |
| 266 | Ga0068862_100011074 | 3300005844 | Bacteria | 7450 |
| 267 | Ga0068862_100020884 | 3300005844 | Bacteria | 5470 |
| 268 | Ga0068862_100381384 | 3300005844 | Bacteria | 1315 |
| 269 | Ga0081455_10015729 | 3300005937 | Bacteria | 7333 |
| 270 | Ga0081455_10019828 | 3300005937 | Bacteria | 6351 |
| 271 | Ga0081455_10048669 | 3300005937 | Bacteria | 3661 |
| 272 | Ga0081455_10059262 | 3300005937 | Bacteria | 3234 |
| 273 | Ga0081455_10087603 | 3300005937 | Bacteria | 2533 |
| 274 | Ga0070717_10016433 | 3300006028 | Bacteria | 5737 |
| 275 | Ga0070717_10018063 | 3300006028 | Bacteria | 5501 |
| 276 | Ga0070717_10138468 | 3300006028 | Bacteria | 2098 |
| 277 | Ga0070717_10148079 | 3300006028 | Bacteria | 2029 |
| 278 | Ga0070717_10362541 | 3300006028 | Bacteria | 1297 |
| 279 | Ga0070717_10370530 | 3300006028 | Bacteria | 1283 |
| 280 | Ga0075365_10039910 | 3300006038 | Bacteria | 3059 |
| 281 | Ga0075365_10064947 | 3300006038 | Bacteria | 2446 |
| 282 | Ga0075365_10211164 | 3300006038 | Bacteria | 1361 |
| 283 | Ga0075432_10033002 | 3300006058 | Bacteria | 1794 |
| 284 | Ga0070715_10006272 | 3300006163 | Bacteria | 4030 |
| 285 | Ga0070716_100145792 | 3300006173 | Bacteria | 1516 |
| 286 | Ga0070712_100039213 | 3300006175 | Unclassified | 3241 |
| 287 | Ga0070712_100196062 | 3300006175 | Bacteria | 1583 |
| 288 | Ga0075362_10097929 | 3300006177 | Bacteria | 1368 |
| 289 | Ga0097621_100001205 | 3300006237 | Bacteria | 17920 |
| 290 | Ga0097621_100001322 | 3300006237 | Bacteria | 17053 |
| 291 | Ga0097621_100003473 | 3300006237 | Bacteria | 10866 |
| 292 | Ga0068871_100000676 | 3300006358 | Bacteria | 23320 |
| 293 | Ga0068871_100001279 | 3300006358 | Bacteria | 16811 |
| 294 | Ga0068871_100005001 | 3300006358 | Bacteria | 9264 |
| 295 | Ga0068871_100263330 | 3300006358 | Bacteria | 1504 |
| 296 | Ga0075428_100064067 | 3300006844 | Bacteria | 4025 |
| 297 | Ga0075428_100070279 | 3300006844 | Bacteria | 3827 |
| 298 | Ga0075428_100134538 | 3300006844 | Bacteria | 2688 |
| 299 | Ga0075428_100249558 | 3300006844 | Bacteria | 1913 |
| 300 | Ga0075428_100352555 | 3300006844 | Bacteria | 1579 |
| 301 | Ga0075428_100711459 | 3300006844 | Unclassified | 1070 |
| 302 | Ga0075430_100126811 | 3300006846 | Bacteria | 2127 |
| 303 | Ga0075431_100065799 | 3300006847 | Bacteria | 3742 |
| 304 | Ga0075431_100119293 | 3300006847 | Bacteria | 2722 |
| 305 | Ga0075431_100469939 | 3300006847 | Bacteria | 1251 |
| 306 | Ga0075433_10000718 | 3300006852 | Bacteria | 22669 |
| 307 | Ga0075433_10044101 | 3300006852 | Bacteria | 3874 |
| 308 | Ga0075433_10426040 | 3300006852 | Bacteria | 1170 |
| 309 | Ga0075434_100002238 | 3300006871 | Bacteria | 16906 |
| 310 | Ga0075434_100003393 | 3300006871 | Bacteria | 14264 |
| 311 | Ga0075434_100057976 | 3300006871 | Bacteria | 3849 |
| 312 | Ga0075434_100085099 | 3300006871 | Unclassified | 3161 |
| 313 | Ga0075434_100239695 | 3300006871 | Bacteria | 1834 |
| 314 | Ga0075434_100374436 | 3300006871 | Bacteria | 1445 |
| 315 | Ga0075429_100056298 | 3300006880 | Bacteria | 3422 |
| 316 | Ga0075429_100112230 | 3300006880 | Bacteria | 2382 |
| 317 | Ga0075429_100213992 | 3300006880 | Unclassified | 1688 |
| 318 | Ga0075429_100342136 | 3300006880 | Bacteria | 1309 |
| 319 | Ga0068865_100000085 | 3300006881 | Bacteria | 50007 |
| 320 | Ga0068865_100000348 | 3300006881 | Bacteria | 25590 |
| 321 | Ga0068865_100076507 | 3300006881 | Bacteria | 2389 |
| 322 | Ga0068865_100341889 | 3300006881 | Bacteria | 1210 |
| 323 | Ga0097620_100002042 | 3300006931 | Bacteria | 20614 |
| 324 | Ga0097620_100003259 | 3300006931 | Bacteria | 16525 |
| 325 | Ga0097620_100175898 | 3300006931 | Bacteria | 2222 |
| 326 | Ga0075435_100102202 | 3300007076 | Bacteria | 2376 |
| 327 | Ga0099795_10006038 | 3300007788 | Bacteria | 3272 |
| 328 | Ga0105244_10083655 | 3300009036 | Unclassified | 1576 |
| 329 | Ga0105250_10069850 | 3300009092 | Bacteria | 1418 |
| 330 | Ga0111539_10001107 | 3300009094 | Bacteria | 35545 |
| 331 | Ga0111539_10001814 | 3300009094 | Bacteria | 28447 |
| 332 | Ga0111539_10034613 | 3300009094 | Bacteria | 6121 |
| 333 | Ga0111539_10166030 | 3300009094 | Bacteria | 2581 |
| 334 | Ga0111539_10233437 | 3300009094 | Bacteria | 2141 |
| 335 | Ga0111539_10384088 | 3300009094 | Unclassified | 1635 |
| 336 | Ga0111539_10567241 | 3300009094 | Bacteria | 1322 |
| 337 | Ga0111539_10571092 | 3300009094 | Bacteria | 1317 |
| 338 | Ga0105245_10000235 | 3300009098 | Bacteria | 52697 |
| 339 | Ga0105245_10002164 | 3300009098 | Bacteria | 17800 |
| 340 | Ga0105245_10133701 | 3300009098 | Bacteria | 2329 |
| 341 | Ga0105247_10070818 | 3300009101 | Bacteria | 2179 |
| 342 | Ga0114129_10086876 | 3300009147 | Bacteria | 4337 |
| 343 | Ga0114129_10239574 | 3300009147 | Unclassified | 2439 |
| 344 | Ga0114129_10733320 | 3300009147 | Bacteria | 1267 |
| 345 | Ga0105243_10001256 | 3300009148 | Bacteria | 22778 |
| 346 | Ga0105243_10009126 | 3300009148 | Bacteria | 7573 |
| 347 | Ga0105243_10024145 | 3300009148 | Bacteria | 4636 |
| 348 | Ga0105243_10075283 | 3300009148 | Bacteria | 2740 |
| 349 | Ga0105243_10101070 | 3300009148 | Bacteria | 2394 |
| 350 | Ga0105241_10000414 | 3300009174 | Bacteria | 32305 |
| 351 | Ga0105241_10000702 | 3300009174 | Bacteria | 25327 |
| 352 | Ga0105242_10000134 | 3300009176 | Bacteria | 53681 |
| 353 | Ga0105242_10001674 | 3300009176 | Bacteria | 17536 |
| 354 | Ga0105242_10316978 | 3300009176 | Unclassified | 1429 |
| 355 | Ga0105242_10451255 | 3300009176 | Bacteria | 1212 |
| 356 | Ga0105248_10001347 | 3300009177 | Bacteria | 27377 |
| 357 | Ga0105248_10003880 | 3300009177 | Bacteria | 16526 |
| 358 | Ga0105248_10474452 | 3300009177 | Unclassified | 1410 |
| 359 | Ga0105237_10012335 | 3300009545 | Bacteria | 9004 |
| 360 | Ga0105237_10039808 | 3300009545 | Bacteria | 4742 |
| 361 | Ga0105237_10163133 | 3300009545 | Bacteria | 2227 |
| 362 | Ga0105238_10151943 | 3300009551 | Unclassified | 2290 |
| 363 | Ga0105249_10000325 | 3300009553 | Bacteria | 48220 |
| 364 | Ga0105249_10000627 | 3300009553 | Bacteria | 32165 |
| 365 | Ga0105249_10155371 | 3300009553 | Bacteria | 2206 |
| 366 | Ga0105249_10355796 | 3300009553 | Bacteria | 1484 |
| 367 | Ga0105249_10564967 | 3300009553 | Bacteria | 1190 |
| 368 | Ga0105239_10002328 | 3300010375 | Bacteria | 24247 |
| 369 | Ga0105239_10004832 | 3300010375 | Bacteria | 15955 |
| 370 | Ga0105239_10039843 | 3300010375 | Bacteria | 5147 |
| 371 | Ga0105239_10377058 | 3300010375 | Bacteria | 1603 |
| 372 | Ga0105246_10000041 | 3300011119 | Bacteria | 48215 |
| 373 | Ga0105246_10000168 | 3300011119 | Bacteria | 31687 |
| 374 | Ga0157373_10010744 | 3300013100 | Bacteria | 6737 |
| 375 | Ga0157373_10016002 | 3300013100 | Bacteria | 5476 |
| 376 | Ga0157371_10006558 | 3300013102 | Bacteria | 9569 |
| 377 | Ga0157371_10015556 | 3300013102 | Bacteria | 5705 |
| 378 | Ga0157374_10002115 | 3300013296 | Bacteria | 16708 |
| 379 | Ga0157374_10033139 | 3300013296 | Bacteria | 4711 |
| 380 | Ga0157374_10033189 | 3300013296 | Bacteria | 4708 |
| 381 | Ga0157374_10153782 | 3300013296 | Bacteria | 2238 |
| 382 | Ga0157378_10000434 | 3300013297 | Bacteria | 40722 |
| 383 | Ga0163162_10006347 | 3300013306 | Bacteria | 11447 |
| 384 | Ga0163162_10007869 | 3300013306 | Bacteria | 10384 |
| 385 | Ga0163162_10029055 | 3300013306 | Bacteria | 5471 |
| 386 | Ga0163162_10224025 | 3300013306 | Bacteria | 2010 |
| 387 | Ga0163162_10230871 | 3300013306 | Bacteria | 1981 |
| 388 | Ga0163162_10297104 | 3300013306 | Bacteria | 1747 |
| 389 | Ga0163162_10439316 | 3300013306 | Bacteria | 1437 |
| 390 | Ga0163162_10554047 | 3300013306 | Bacteria | 1278 |
| 391 | Ga0163162_10634260 | 3300013306 | Bacteria | 1193 |
| 392 | Ga0163162_10765485 | 3300013306 | Bacteria | 1084 |
| 393 | Ga0157372_10006948 | 3300013307 | Bacteria | 12050 |
| 394 | Ga0157372_10022013 | 3300013307 | Bacteria | 6892 |
| 395 | Ga0157372_10418443 | 3300013307 | Bacteria | 1562 |
| 396 | Ga0157375_10000181 | 3300013308 | Bacteria | 59305 |
| 397 | Ga0157375_10002241 | 3300013308 | Bacteria | 16722 |
| 398 | Ga0157375_10018144 | 3300013308 | Bacteria | 6376 |
| 399 | Ga0157375_10028214 | 3300013308 | Bacteria | 5258 |
| 400 | Ga0157375_10035469 | 3300013308 | Bacteria | 4761 |
| 401 | Ga0157375_10048041 | 3300013308 | Bacteria | 4172 |
| 402 | Ga0157375_10188920 | 3300013308 | Bacteria | 2214 |
| 403 | Ga0157375_10778888 | 3300013308 | Bacteria | 1106 |
| 404 | Ga0163163_10017949 | 3300014325 | Bacteria | 6610 |
| 405 | Ga0163163_10029491 | 3300014325 | Bacteria | 5278 |
| 406 | Ga0163163_10033676 | 3300014325 | Bacteria | 4957 |
| 407 | Ga0163163_10144482 | 3300014325 | Bacteria | 2422 |
| 408 | Ga0163163_10157443 | 3300014325 | Bacteria | 2316 |
| 409 | Ga0157380_10001449 | 3300014326 | Bacteria | 15528 |
| 410 | Ga0157380_10271538 | 3300014326 | Bacteria | 1546 |
| 411 | Ga0157377_10000101 | 3300014745 | Bacteria | 60248 |
| 412 | Ga0157377_10000284 | 3300014745 | Bacteria | 24258 |
| 413 | Ga0157379_10000364 | 3300014968 | Bacteria | 36402 |
| 414 | Ga0157379_10000554 | 3300014968 | Bacteria | 30160 |
| 415 | Ga0157379_10066772 | 3300014968 | Bacteria | 3216 |
| 416 | Ga0157379_10120313 | 3300014968 | Bacteria | 2362 |
| 417 | Ga0157379_10436707 | 3300014968 | Bacteria | 1207 |
| 418 | Ga0157376_10000142 | 3300014969 | Bacteria | 49085 |
| 419 | Ga0157376_10001203 | 3300014969 | Bacteria | 17062 |
| 420 | Ga0157376_10049164 | 3300014969 | Bacteria | 3492 |
| 421 | Ga0157376_10065221 | 3300014969 | Bacteria | 3074 |
| 422 | Ga0157376_10066488 | 3300014969 | Bacteria | 3047 |
| 423 | Ga0157376_10127807 | 3300014969 | Unclassified | 2263 |
| 424 | Ga0157376_10284061 | 3300014969 | Bacteria | 1560 |
| 425 | Ga0163161_10000081 | 3300017792 | Bacteria | 97213 |
| 426 | Ga0163161_10018167 | 3300017792 | Bacteria | 4930 |
| 427 | Ga0163161_10351564 | 3300017792 | Bacteria | 1172 |
| 428 | Ga0213876_10057756 | 3300021384 | Unclassified | 2049 |
| 429 | Ga0207666_1000031 | 3300025271 | Bacteria | 30080 |
| 430 | Ga0207666_1000042 | 3300025271 | Bacteria | 25183 |
| 431 | Ga0207673_1000069 | 3300025290 | Bacteria | 8882 |
| 432 | Ga0207673_1000121 | 3300025290 | Bacteria | 7344 |
| 433 | Ga0207697_10000045 | 3300025315 | Bacteria | 48192 |
| 434 | Ga0207697_10000416 | 3300025315 | Bacteria | 24126 |
| 435 | Ga0207697_10006171 | 3300025315 | Bacteria | 5464 |
| 436 | Ga0207653_10004447 | 3300025885 | Bacteria | 4396 |
| 437 | Ga0207653_10007306 | 3300025885 | Bacteria | 3444 |
| 438 | Ga0207682_10000153 | 3300025893 | Bacteria | 31273 |
| 439 | Ga0207682_10000314 | 3300025893 | Bacteria | 21994 |
| 440 | Ga0207692_10018416 | 3300025898 | Bacteria | 3135 |
| 441 | Ga0207692_10063838 | 3300025898 | Bacteria | 1915 |
| 442 | Ga0207692_10077256 | 3300025898 | Bacteria | 1771 |
| 443 | Ga0207692_10118336 | 3300025898 | Bacteria | 1480 |
| 444 | Ga0207642_10000262 | 3300025899 | Bacteria | 15798 |
| 445 | Ga0207642_10000438 | 3300025899 | Bacteria | 12594 |
| 446 | Ga0207710_10006396 | 3300025900 | Bacteria | 5034 |
| 447 | Ga0207710_10037976 | 3300025900 | Bacteria | 2128 |
| 448 | Ga0207688_10000044 | 3300025901 | Bacteria | 43600 |
| 449 | Ga0207688_10000606 | 3300025901 | Bacteria | 17657 |
| 450 | Ga0207688_10023542 | 3300025901 | Bacteria | 3373 |
| 451 | Ga0207680_10001543 | 3300025903 | Bacteria | 10843 |
| 452 | Ga0207680_10058823 | 3300025903 | Bacteria | 2331 |
| 453 | Ga0207647_10001666 | 3300025904 | Bacteria | 17115 |
| 454 | Ga0207647_10004187 | 3300025904 | Bacteria | 10699 |
| 455 | Ga0207647_10087508 | 3300025904 | Unclassified | 1861 |
| 456 | Ga0207685_10050462 | 3300025905 | Bacteria | 1603 |
| 457 | Ga0207685_10069725 | 3300025905 | Unclassified | 1421 |
| 458 | Ga0207699_10030946 | 3300025906 | Bacteria | 3001 |
| 459 | Ga0207699_10185382 | 3300025906 | Bacteria | 1401 |
| 460 | Ga0207645_10000945 | 3300025907 | Bacteria | 24123 |
| 461 | Ga0207645_10001816 | 3300025907 | Bacteria | 17211 |
| 462 | Ga0207645_10218126 | 3300025907 | Bacteria | 1257 |
| 463 | Ga0207643_10000025 | 3300025908 | Bacteria | 101583 |
| 464 | Ga0207643_10000345 | 3300025908 | Bacteria | 31495 |
| 465 | Ga0207684_10006956 | 3300025910 | Bacteria | 10232 |
| 466 | Ga0207684_10011951 | 3300025910 | Bacteria | 7563 |
| 467 | Ga0207684_10022595 | 3300025910 | Bacteria | 5369 |
| 468 | Ga0207684_10024910 | 3300025910 | Bacteria | 5099 |
| 469 | Ga0207684_10040998 | 3300025910 | Bacteria | 3926 |
| 470 | Ga0207684_10145035 | 3300025910 | Bacteria | 2042 |
| 471 | Ga0207684_10149198 | 3300025910 | Bacteria | 2012 |
| 472 | Ga0207654_10001478 | 3300025911 | Bacteria | 12419 |
| 473 | Ga0207654_10008394 | 3300025911 | Bacteria | 5217 |
| 474 | Ga0207707_10001635 | 3300025912 | Bacteria | 20673 |
| 475 | Ga0207707_10018614 | 3300025912 | Bacteria | 6054 |
| 476 | Ga0207671_10023238 | 3300025914 | Bacteria | 4677 |
| 477 | Ga0207671_10038138 | 3300025914 | Bacteria | 3561 |
| 478 | Ga0207693_10018855 | 3300025915 | Bacteria | 5492 |
| 479 | Ga0207693_10034249 | 3300025915 | Bacteria | 4007 |
| 480 | Ga0207693_10040180 | 3300025915 | Bacteria | 3684 |
| 481 | Ga0207693_10142078 | 3300025915 | Bacteria | 1887 |
| 482 | Ga0207693_10204987 | 3300025915 | Bacteria | 1551 |
| 483 | Ga0207663_10019695 | 3300025916 | Bacteria | 3807 |
| 484 | Ga0207663_10026811 | 3300025916 | Bacteria | 3349 |
| 485 | Ga0207663_10028158 | 3300025916 | Bacteria | 3285 |
| 486 | Ga0207663_10400450 | 3300025916 | Bacteria | 1050 |
| 487 | Ga0207660_10000131 | 3300025917 | Bacteria | 44091 |
| 488 | Ga0207660_10000318 | 3300025917 | Bacteria | 31519 |
| 489 | Ga0207660_10071944 | 3300025917 | Bacteria | 2517 |
| 490 | Ga0207660_10280266 | 3300025917 | Bacteria | 1323 |
| 491 | Ga0207662_10000100 | 3300025918 | Bacteria | 40845 |
| 492 | Ga0207662_10000668 | 3300025918 | Bacteria | 15585 |
| 493 | Ga0207657_10000699 | 3300025919 | Bacteria | 35613 |
| 494 | Ga0207657_10003089 | 3300025919 | Bacteria | 17820 |
| 495 | Ga0207657_10049279 | 3300025919 | Bacteria | 3672 |
| 496 | Ga0207657_10076905 | 3300025919 | Bacteria | 2815 |
| 497 | Ga0207657_10093242 | 3300025919 | Bacteria | 2508 |
| 498 | Ga0207649_10000310 | 3300025920 | Bacteria | 37179 |
| 499 | Ga0207649_10001217 | 3300025920 | Bacteria | 15478 |
| 500 | Ga0207649_10002591 | 3300025920 | Bacteria | 10046 |
| 501 | Ga0207652_10000785 | 3300025921 | Bacteria | 30331 |
| 502 | Ga0207652_10007477 | 3300025921 | Bacteria | 8804 |
| 503 | Ga0207652_10012572 | 3300025921 | Bacteria | 6842 |
| 504 | Ga0207652_10101697 | 3300025921 | Bacteria | 2539 |
| 505 | Ga0207681_10000131 | 3300025923 | Bacteria | 61025 |
| 506 | Ga0207681_10001247 | 3300025923 | Bacteria | 16409 |
| 507 | Ga0207681_10025153 | 3300025923 | Bacteria | 3827 |
| 508 | Ga0207681_10094541 | 3300025923 | Bacteria | 2142 |
| 509 | Ga0207694_10079794 | 3300025924 | Bacteria | 2567 |
| 510 | Ga0207650_10002469 | 3300025925 | Bacteria | 12857 |
| 511 | Ga0207650_10007605 | 3300025925 | Bacteria | 7386 |
| 512 | Ga0207650_10039061 | 3300025925 | Bacteria | 3469 |
| 513 | Ga0207659_10000040 | 3300025926 | Bacteria | 91375 |
| 514 | Ga0207659_10001096 | 3300025926 | Bacteria | 16028 |
| 515 | Ga0207687_10000122 | 3300025927 | Bacteria | 52776 |
| 516 | Ga0207687_10001549 | 3300025927 | Bacteria | 15786 |
| 517 | Ga0207687_10283911 | 3300025927 | Bacteria | 1328 |
| 518 | Ga0207700_10009919 | 3300025928 | Bacteria | 5977 |
| 519 | Ga0207700_10131826 | 3300025928 | Bacteria | 2042 |
| 520 | Ga0207700_10192672 | 3300025928 | Bacteria | 1714 |
| 521 | Ga0207700_10421931 | 3300025928 | Bacteria | 1172 |
| 522 | Ga0207664_10063010 | 3300025929 | Bacteria | 2963 |
| 523 | Ga0207664_10135631 | 3300025929 | Bacteria | 2077 |
| 524 | Ga0207644_10000393 | 3300025931 | Bacteria | 28466 |
| 525 | Ga0207644_10000828 | 3300025931 | Bacteria | 19684 |
| 526 | Ga0207690_10000277 | 3300025932 | Bacteria | 36311 |
| 527 | Ga0207690_10001276 | 3300025932 | Bacteria | 15910 |
| 528 | Ga0207690_10307509 | 3300025932 | Bacteria | 1242 |
| 529 | Ga0207706_10000311 | 3300025933 | Bacteria | 52676 |
| 530 | Ga0207706_10001343 | 3300025933 | Bacteria | 24573 |
| 531 | Ga0207706_10039346 | 3300025933 | Bacteria | 4192 |
| 532 | Ga0207706_10070126 | 3300025933 | Bacteria | 3082 |
| 533 | Ga0207706_10100063 | 3300025933 | Bacteria | 2551 |
| 534 | Ga0207686_10000407 | 3300025934 | Bacteria | 29845 |
| 535 | Ga0207686_10002434 | 3300025934 | Bacteria | 10135 |
| 536 | Ga0207709_10000322 | 3300025935 | Bacteria | 51855 |
| 537 | Ga0207709_10000591 | 3300025935 | Bacteria | 30303 |
| 538 | Ga0207709_10065022 | 3300025935 | Bacteria | 2292 |
| 539 | Ga0207709_10234801 | 3300025935 | Bacteria | 1330 |
| 540 | Ga0207670_10000240 | 3300025936 | Bacteria | 34666 |
| 541 | Ga0207670_10000509 | 3300025936 | Bacteria | 21378 |
| 542 | Ga0207669_10000191 | 3300025937 | Bacteria | 27739 |
| 543 | Ga0207669_10000484 | 3300025937 | Bacteria | 17278 |
| 544 | Ga0207669_10231076 | 3300025937 | Bacteria | 1364 |
| 545 | Ga0207669_10305221 | 3300025937 | Bacteria | 1211 |
| 546 | Ga0207704_10000071 | 3300025938 | Bacteria | 64527 |
| 547 | Ga0207704_10000289 | 3300025938 | Bacteria | 23781 |
| 548 | Ga0207704_10211853 | 3300025938 | Bacteria | 1427 |
| 549 | Ga0207704_10318896 | 3300025938 | Bacteria | 1198 |
| 550 | Ga0207665_10078058 | 3300025939 | Bacteria | 2274 |
| 551 | Ga0207665_10085025 | 3300025939 | Bacteria | 2184 |
| 552 | Ga0207665_10424939 | 3300025939 | Bacteria | 1016 |
| 553 | Ga0207691_10000257 | 3300025940 | Bacteria | 52675 |
| 554 | Ga0207691_10001202 | 3300025940 | Bacteria | 25777 |
| 555 | Ga0207711_10002577 | 3300025941 | Bacteria | 16126 |
| 556 | Ga0207711_10017003 | 3300025941 | Bacteria | 6041 |
| 557 | Ga0207689_10000134 | 3300025942 | Bacteria | 62937 |
| 558 | Ga0207689_10001584 | 3300025942 | Bacteria | 21550 |
| 559 | Ga0207661_10000191 | 3300025944 | Bacteria | 39865 |
| 560 | Ga0207661_10001224 | 3300025944 | Bacteria | 17178 |
| 561 | Ga0207661_10058414 | 3300025944 | Bacteria | 3104 |
| 562 | Ga0207679_10000099 | 3300025945 | Bacteria | 74047 |
| 563 | Ga0207679_10003586 | 3300025945 | Bacteria | 9618 |
| 564 | Ga0207679_10005866 | 3300025945 | Bacteria | 7715 |
| 565 | Ga0207667_10034555 | 3300025949 | Bacteria | 5428 |
| 566 | Ga0207667_10048127 | 3300025949 | Bacteria | 4510 |
| 567 | Ga0207651_10000017 | 3300025960 | Bacteria | 100256 |
| 568 | Ga0207651_10000393 | 3300025960 | Bacteria | 18535 |
| 569 | Ga0207712_10000114 | 3300025961 | Bacteria | 87261 |
| 570 | Ga0207712_10000591 | 3300025961 | Bacteria | 29086 |
| 571 | Ga0207712_10007853 | 3300025961 | Bacteria | 6745 |
| 572 | Ga0207712_10420943 | 3300025961 | Bacteria | 1127 |
| 573 | Ga0207668_10001667 | 3300025972 | Bacteria | 12978 |
| 574 | Ga0207668_10002065 | 3300025972 | Bacteria | 11713 |
| 575 | Ga0207668_10075803 | 3300025972 | Bacteria | 2419 |
| 576 | Ga0207640_10000336 | 3300025981 | Bacteria | 31122 |
| 577 | Ga0207640_10000604 | 3300025981 | Bacteria | 21239 |
| 578 | Ga0207658_10001624 | 3300025986 | Bacteria | 17240 |
| 579 | Ga0207658_10011285 | 3300025986 | Bacteria | 6084 |
| 580 | Ga0207677_10000412 | 3300026023 | Bacteria | 29138 |
| 581 | Ga0207677_10000974 | 3300026023 | Bacteria | 15834 |
| 582 | Ga0207677_10148370 | 3300026023 | Bacteria | 1805 |
| 583 | Ga0207703_10000863 | 3300026035 | Bacteria | 29696 |
| 584 | Ga0207639_10000646 | 3300026041 | Bacteria | 24015 |
| 585 | Ga0207639_10001290 | 3300026041 | Bacteria | 16909 |
| 586 | Ga0207639_10339432 | 3300026041 | Bacteria | 1339 |
| 587 | Ga0207678_10000131 | 3300026067 | Bacteria | 62864 |
| 588 | Ga0207678_10001120 | 3300026067 | Bacteria | 24572 |
| 589 | Ga0207678_10058037 | 3300026067 | Bacteria | 3331 |
| 590 | Ga0207678_10280703 | 3300026067 | Bacteria | 1429 |
| 591 | Ga0207708_10000192 | 3300026075 | Bacteria | 48193 |
| 592 | Ga0207708_10001629 | 3300026075 | Bacteria | 16704 |
| 593 | Ga0207708_10003560 | 3300026075 | Bacteria | 11481 |
| 594 | Ga0207702_10002469 | 3300026078 | Bacteria | 17505 |
| 595 | Ga0207702_10003256 | 3300026078 | Bacteria | 15000 |
| 596 | Ga0207641_10000246 | 3300026088 | Bacteria | 70235 |
| 597 | Ga0207641_10003176 | 3300026088 | Bacteria | 14699 |
| 598 | Ga0207641_10008853 | 3300026088 | Bacteria | 8310 |
| 599 | Ga0207648_10001831 | 3300026089 | Bacteria | 23254 |
| 600 | Ga0207648_10006095 | 3300026089 | Bacteria | 12027 |
| 601 | Ga0207648_10061876 | 3300026089 | Bacteria | 3264 |
| 602 | Ga0207648_10271720 | 3300026089 | Bacteria | 1514 |
| 603 | Ga0207676_10001655 | 3300026095 | Bacteria | 16413 |
| 604 | Ga0207676_10002691 | 3300026095 | Bacteria | 12634 |
| 605 | Ga0207676_10004872 | 3300026095 | Bacteria | 9501 |
| 606 | Ga0207676_10100626 | 3300026095 | Bacteria | 2395 |
| 607 | Ga0207676_10418017 | 3300026095 | Unclassified | 1257 |
| 608 | Ga0207674_10000355 | 3300026116 | Bacteria | 59230 |
| 609 | Ga0207674_10001638 | 3300026116 | Bacteria | 28820 |
| 610 | Ga0207674_10074643 | 3300026116 | Bacteria | 3402 |
| 611 | Ga0207675_100001893 | 3300026118 | Bacteria | 20920 |
| 612 | Ga0207675_100006563 | 3300026118 | Bacteria | 11010 |
| 613 | Ga0207675_100433759 | 3300026118 | Bacteria | 1300 |
| 614 | Ga0207683_10000924 | 3300026121 | Bacteria | 26999 |
| 615 | Ga0207683_10002127 | 3300026121 | Bacteria | 17404 |
| 616 | Ga0207683_10017822 | 3300026121 | Bacteria | 6057 |
| 617 | Ga0207683_10035097 | 3300026121 | Bacteria | 4362 |
| 618 | Ga0207683_10454663 | 3300026121 | Bacteria | 1181 |
| 619 | Ga0207698_10001234 | 3300026142 | Bacteria | 14949 |
| 620 | Ga0207698_10012369 | 3300026142 | Bacteria | 5581 |
| 621 | Ga0210002_1002756 | 3300027617 | Bacteria | 2549 |
| 622 | Ga0210002_1003909 | 3300027617 | Bacteria | 2211 |
| 623 | Ga0209998_10000477 | 3300027717 | Bacteria | 11041 |
| 624 | Ga0209998_10002044 | 3300027717 | Bacteria | 4733 |
| 625 | Ga0209998_10012552 | 3300027717 | Bacteria | 1759 |
| 626 | Ga0209974_10010866 | 3300027876 | Bacteria | 3065 |
| 627 | Ga0209974_10029499 | 3300027876 | Bacteria | 1817 |
| 628 | Ga0207428_10000469 | 3300027907 | Bacteria | 48709 |
| 629 | Ga0207428_10000944 | 3300027907 | Bacteria | 32301 |
| 630 | Ga0207428_10043183 | 3300027907 | Bacteria | 3643 |
| 631 | Ga0207428_10058774 | 3300027907 | Bacteria | 3050 |
| 632 | Ga0207428_10082724 | 3300027907 | Bacteria | 2505 |
| 633 | Ga0207428_10087049 | 3300027907 | Bacteria | 2431 |
| 634 | Ga0207428_10111715 | 3300027907 | Bacteria | 2103 |
| 635 | Ga0268266_10247949 | 3300028379 | Bacteria | 1646 |
| 636 | Ga0268266_10555713 | 3300028379 | Bacteria | 1100 |
| 637 | Ga0268265_10000312 | 3300028380 | Bacteria | 53940 |
| 638 | Ga0268265_10001746 | 3300028380 | Bacteria | 17480 |
| 639 | Ga0268265_10100349 | 3300028380 | Bacteria | 2336 |
| 640 | Ga0268265_10282753 | 3300028380 | Bacteria | 1485 |
| 641 | Ga0268264_10000412 | 3300028381 | Bacteria | 60566 |
| 642 | Ga0268264_10000751 | 3300028381 | Bacteria | 36543 |
| 643 | Ga0268264_10309421 | 3300028381 | Bacteria | 1490 |
| 644 | Ga0373930_0002725 | 3300034816 | Bacteria | 2755 |
| 645 | Ga0373930_0026828 | 3300034816 | Unclassified | 1163 |
| 646 | Ga0373948_0012313 | 3300034817 | Bacteria | 1525 |
| 647 | Ga0373950_0000747 | 3300034818 | Bacteria | 4043 |
| 648 | Ga0373950_0003891 | 3300034818 | Bacteria | 2166 |
| 649 | Ga0373950_0007394 | 3300034818 | Unclassified | 1704 |
| 650 | Ga0373958_0002202 | 3300034819 | Bacteria | 2707 |
| 651 | Ga0373959_0001785 | 3300034820 | Bacteria | 3433 |
| 652 | Ga0373959_0003277 | 3300034820 | Bacteria | 2573 |
| 653 | Ga0373959_0005041 | 3300034820 | Bacteria | 2156 |
| 654 | Ga0373938_0000291 | 3300034957 | Bacteria | 8081 |
| 655 | Ga0373938_0000451 | 3300034957 | Bacteria | 6711 |
| 656 | Ga0373938_0009384 | 3300034957 | Bacteria | 1771 |
| 657 | Ga0373926_0056981 | 3300035083 | Bacteria | 1418 |
| 658 | Ga0373928_0000699 | 3300035084 | Bacteria | 6584 |
| 659 | Ga0373928_0000806 | 3300035084 | Bacteria | 6105 |
| 660 | Ga0373928_0001248 | 3300035084 | Bacteria | 5002 |
| 661 | Ga0373929_0002281 | 3300035085 | Bacteria | 3538 |
| 662 | Ga0373929_0003591 | 3300035085 | Bacteria | 2785 |
| 663 | Ga0373934_0148708 | 3300035086 | Unclassified | 959 |
| 664 | Ga0373940_0000652 | 3300035088 | Bacteria | 5546 |
| 665 | Ga0373940_0002233 | 3300035088 | Bacteria | 3724 |
| 666 | Ga0373944_0038153 | 3300035089 | Bacteria | 1474 |
| 667 | Ga0373944_0038397 | 3300035089 | Bacteria | 1470 |
| 668 | Ga0373949_0000392 | 3300035090 | Bacteria | 15288 |
| 669 | Ga0373949_0001594 | 3300035090 | Bacteria | 6385 |
| 670 | Ga0373949_0003455 | 3300035090 | Bacteria | 3757 |
| 671 | Ga0373951_0001947 | 3300035091 | Bacteria | 5303 |
| 672 | Ga0373951_0003618 | 3300035091 | Bacteria | 3727 |
| 673 | Ga0373951_0006289 | 3300035091 | Bacteria | 2717 |
| 674 | Ga0373951_0032553 | 3300035091 | Bacteria | 1233 |
| 675 | Ga0373952_0000672 | 3300035092 | Bacteria | 6055 |
| 676 | Ga0373952_0003009 | 3300035092 | Bacteria | 3043 |
| 677 | Ga0373952_0004332 | 3300035092 | Bacteria | 2572 |
| 678 | Ga0373932_0000911 | 3300035112 | Bacteria | 8629 |
| 679 | Ga0373932_0001306 | 3300035112 | Bacteria | 7024 |
| 680 | Ga0373932_0001480 | 3300035112 | Bacteria | 6562 |
| 681 | Ga0373932_0028131 | 3300035112 | Bacteria | 1543 |
| 682 | Ga0373936_0093230 | 3300035113 | Unclassified | 1264 |
| 683 | Ga0373936_0112666 | 3300035113 | Bacteria | 1156 |
| 684 | Ga0373939_0000964 | 3300035114 | Bacteria | 7176 |
| 685 | Ga0373939_0002528 | 3300035114 | Bacteria | 4300 |
| 686 | Ga0373941_0014017 | 3300035115 | Bacteria | 2132 |
| 687 | Ga0373945_0053259 | 3300035116 | Bacteria | 1493 |
| 688 | Ga0373960_0000113 | 3300035121 | Bacteria | 12996 |
| 689 | Ga0373960_0000122 | 3300035121 | Bacteria | 12600 |
| 690 | Ga0373960_0014695 | 3300035121 | Bacteria | 1987 |
| 691 | Ga0373960_0029149 | 3300035121 | Bacteria | 1528 |
| 692 | Ga0373943_0036157 | 3300035170 | Bacteria | 2364 |
| 693 | Ga0373943_0062481 | 3300035170 | Bacteria | 1864 |
| 694 | Ga0373943_0185171 | 3300035170 | Bacteria | 1146 |
| 695 | Ga0373946_0020814 | 3300035171 | Unclassified | 2538 |
| 696 | Ga0373946_0061598 | 3300035171 | Bacteria | 1598 |
| 697 | Ga0373955_0205170 | 3300035172 | Bacteria | 1174 |
| 698 | Ga0373942_0001003 | 3300035207 | Bacteria | 7678 |
| 699 | Ga0373942_0001784 | 3300035207 | Bacteria | 5456 |
| 700 | Ga0373961_0001327 | 3300035241 | Bacteria | 7481 |
| 701 | Ga0373961_0001691 | 3300035241 | Bacteria | 6154 |
| 702 | Ga0373961_0024677 | 3300035241 | Unclassified | 1628 |
| 703 | Ga0373962_0000343 | 3300035242 | Bacteria | 10212 |
| 704 | Ga0373962_0000914 | 3300035242 | Bacteria | 6773 |
| 705 | Ga0373924_0021933 | 3300035410 | Bacteria | 2493 |
| 706 | Ga0373924_0152741 | 3300035410 | Bacteria | 1010 |
| 707 | Ga0373931_0000167 | 3300035691 | Bacteria | 28656 |
| 708 | Ga0373931_0000193 | 3300035691 | Bacteria | 26005 |
| 709 | Ga0373931_0009928 | 3300035691 | Bacteria | 4562 |
| 710 | Ga0373935_0023315 | 3300035692 | Bacteria | 3803 |
| 711 | Ga0373935_0049751 | 3300035692 | Bacteria | 2658 |
| 712 | Ga0373935_0165354 | 3300035692 | Bacteria | 1510 |
| 713 | Ga0373927_0022362 | 3300035695 | Bacteria | 4142 |
| 714 | Ga0373927_0090463 | 3300035695 | Bacteria | 1987 |
| 715 | Ga0373927_0159661 | 3300035695 | Bacteria | 1477 |
| 716 | Ga0373947_0011799 | 3300035725 | Bacteria | 5006 |
| 717 | Ga0373947_0044615 | 3300035725 | Bacteria | 2651 |
| 718 | Ga0373947_0045319 | 3300035725 | Bacteria | 2631 |
| 719 | Ga0373947_0082365 | 3300035725 | Bacteria | 1994 |
| 720 | Ga0373947_0086380 | 3300035725 | Bacteria | 1950 |
| 721 | Ga0373937_0059073 | 3300036401 | Bacteria | 3524 |
| 722 | Ga0373937_0122906 | 3300036401 | Bacteria | 2420 |
| 723 | Ga0373937_0247053 | 3300036401 | Bacteria | 1682 |
| 724 | Ga0373925_0031270 | 3300037068 | Bacteria | 3911 |
| 725 | Ga0373925_0310229 | 3300037068 | Bacteria | 1275 |
| 726 | Ga0373925_0362878 | 3300037068 | Unclassified | 1178 |
| 727 | Ga0395898_0235992 | 3300037466 | Bacteria | 1744 |
| 728 | Ga0436365_1532142 | 3300039437 | Bacteria | 7042 |
| 729 | Ga0436361_1076743 | 3300039447 | Bacteria | 1199 |
| 730 | Ga0453683_0162092 | 3300044673 | Unclassified | 1415 |
| 731 | Ga0451576_0049352 | 3300045051 | Bacteria | 4416 |
| 732 | Ga0495592_0156562 | 3300046454 | Unclassified | 1571 |
| 733 | Ga0495603_0005382 | 3300046455 | Bacteria | 7636 |
| 734 | Ga0495603_0017639 | 3300046455 | Bacteria | 4322 |
| 735 | Ga0495603_0040560 | 3300046455 | Bacteria | 2786 |
| 736 | Ga0495603_0119747 | 3300046455 | Bacteria | 1534 |
| 737 | Ga0495603_0170150 | 3300046455 | Bacteria | 1262 |
| 738 | Ga0495629_0029834 | 3300046459 | Bacteria | 3866 |
| 739 | Ga0495629_0048458 | 3300046459 | Bacteria | 2978 |
| 740 | Ga0495629_0164630 | 3300046459 | Bacteria | 1540 |
| 741 | Ga0495641_0100327 | 3300046461 | Bacteria | 1292 |
| 742 | Ga0495651_0019246 | 3300046462 | Bacteria | 5291 |
| 743 | Ga0495651_0200175 | 3300046462 | Bacteria | 1398 |
| 744 | Ga0495651_0308791 | 3300046462 | Unclassified | 1058 |
| 745 | Ga0495653_0016063 | 3300046463 | Bacteria | 6102 |
| 746 | Ga0495653_0083268 | 3300046463 | Bacteria | 2359 |
| 747 | Ga0495580_0100719 | 3300046472 | Bacteria | 2009 |
| 748 | Ga0495582_0162255 | 3300046473 | Bacteria | 1271 |
| 749 | Ga0495605_0100071 | 3300046474 | Bacteria | 1334 |
| 750 | Ga0495639_0099704 | 3300046475 | Bacteria | 1370 |
| 751 | Ga0495662_0078172 | 3300046476 | Bacteria | 1607 |
| 752 | Ga0495664_0005448 | 3300046477 | Bacteria | 6992 |
| 753 | Ga0495664_0076048 | 3300046477 | Bacteria | 2009 |
| 754 | Ga0495664_0131924 | 3300046477 | Bacteria | 1513 |
| 755 | Ga0495584_0065402 | 3300046491 | Bacteria | 1829 |
| 756 | Ga0495584_0093404 | 3300046491 | Bacteria | 1518 |
| 757 | Ga0495585_0040957 | 3300046492 | Bacteria | 2599 |
| 758 | Ga0495585_0110686 | 3300046492 | Bacteria | 1461 |
| 759 | Ga0495594_0046100 | 3300046499 | Bacteria | 2393 |
| 760 | Ga0495594_0046429 | 3300046499 | Bacteria | 2386 |
| 761 | Ga0495607_0168592 | 3300046501 | Bacteria | 1107 |
| 762 | Ga0495608_0112061 | 3300046511 | Bacteria | 1754 |
| 763 | Ga0495616_0074252 | 3300046513 | Bacteria | 1639 |
| 764 | Ga0495616_0091125 | 3300046513 | Bacteria | 1443 |
| 765 | Ga0495618_0012254 | 3300046514 | Bacteria | 5205 |
| 766 | Ga0495618_0030381 | 3300046514 | Bacteria | 3374 |
| 767 | Ga0495628_0049888 | 3300046516 | Bacteria | 3312 |
| 768 | Ga0495630_0087518 | 3300046517 | Bacteria | 2352 |
| 769 | Ga0495644_0062421 | 3300046523 | Bacteria | 1400 |
| 770 | Ga0495663_0016027 | 3300046525 | Bacteria | 2117 |
| 771 | Ga0495666_0043970 | 3300046526 | Bacteria | 2157 |
| 772 | Ga0495666_0130769 | 3300046526 | Unclassified | 1173 |
| 773 | Ga0495652_0071490 | 3300046529 | Bacteria | 2896 |
| 774 | Ga0495652_0192332 | 3300046529 | Bacteria | 1556 |
| 775 | Ga0495652_0277545 | 3300046529 | Bacteria | 1229 |
| 776 | Ga0495665_0073291 | 3300046531 | Bacteria | 1803 |
| 777 | Ga0495640_0038504 | 3300046533 | Bacteria | 3363 |
| 778 | Ga0495640_0054226 | 3300046533 | Bacteria | 2747 |
| 779 | Ga0495640_0093618 | 3300046533 | Bacteria | 1980 |
| 780 | Ga0495640_0190148 | 3300046533 | Bacteria | 1305 |
| 781 | Ga0495586_0062522 | 3300046535 | Bacteria | 2027 |
| 782 | Ga0495586_0133155 | 3300046535 | Bacteria | 1392 |
| 783 | Ga0495587_0058665 | 3300046536 | Unclassified | 2261 |
| 784 | Ga0495609_0118066 | 3300046538 | Bacteria | 1142 |
| 785 | Ga0495633_0151066 | 3300046558 | Bacteria | 1073 |
| 786 | Ga0495667_0046839 | 3300046559 | Bacteria | 2858 |
| 787 | Ga0495667_0116090 | 3300046559 | Bacteria | 1729 |
| 788 | Ga0495667_0148001 | 3300046559 | Bacteria | 1512 |
| 789 | Ga0495634_0022362 | 3300046642 | Bacteria | 4456 |
| 790 | Ga0495634_0074872 | 3300046642 | Bacteria | 2224 |
| 791 | Ga0495634_0155389 | 3300046642 | Bacteria | 1444 |
| 792 | Ga0495611_0057907 | 3300046648 | Bacteria | 1757 |
| 793 | Ga0495635_0078565 | 3300046663 | Bacteria | 2259 |
| 794 | Ga0495661_0044050 | 3300046665 | Bacteria | 2738 |
| 795 | Ga0495588_0058694 | 3300046674 | Bacteria | 1989 |
| 796 | Ga0495599_0201005 | 3300046678 | Bacteria | 1224 |
| 797 | Ga0495599_0310233 | 3300046678 | Unclassified | 951 |
| 798 | Ga0495623_0041817 | 3300046679 | Bacteria | 2922 |
| 799 | Ga0495623_0162317 | 3300046679 | Bacteria | 1312 |
| 800 | Ga0495646_0091282 | 3300046680 | Bacteria | 1758 |
| 801 | Ga0495646_0140466 | 3300046680 | Bacteria | 1351 |
| 802 | Ga0495647_0017384 | 3300046681 | Bacteria | 2543 |
| 803 | Ga0495647_0045713 | 3300046681 | Bacteria | 1683 |
| 804 | Ga0495647_0102191 | 3300046681 | Bacteria | 1188 |
| 805 | Ga0495647_0102270 | 3300046681 | Bacteria | 1188 |
| 806 | Ga0495647_0116571 | 3300046681 | Bacteria | 1119 |
| 807 | Ga0495658_0019110 | 3300046683 | Unclassified | 3572 |
| 808 | Ga0495658_0031862 | 3300046683 | Bacteria | 2875 |
| 809 | Ga0495658_0080986 | 3300046683 | Bacteria | 1905 |
| 810 | Ga0495658_0140842 | 3300046683 | Bacteria | 1475 |
| 811 | Ga0495658_0282376 | 3300046683 | Bacteria | 1048 |
| 812 | Ga0495658_0302328 | 3300046683 | Bacteria | 1012 |
| 813 | Ga0495613_0075825 | 3300046689 | Bacteria | 2448 |
| 814 | Ga0495624_0078381 | 3300046690 | Bacteria | 2049 |
| 815 | Ga0495624_0160923 | 3300046690 | Bacteria | 1371 |
| 816 | Ga0495670_0022778 | 3300046691 | Bacteria | 3093 |
| 817 | Ga0495589_0120593 | 3300046794 | Bacteria | 1263 |
| 818 | Ga0495600_0121726 | 3300046809 | Bacteria | 1697 |
| 819 | Ga0495581_0008318 | 3300047315 | Bacteria | 6014 |
| 820 | Ga0495581_0093377 | 3300047315 | Bacteria | 1747 |
| 821 | Ga0495581_0167799 | 3300047315 | Bacteria | 1284 |
| 822 | Ga0495604_0056734 | 3300047317 | Bacteria | 3013 |
| 823 | Ga0495604_0181025 | 3300047317 | Bacteria | 1474 |
| 824 | Ga0495604_0196071 | 3300047317 | Bacteria | 1404 |
| 825 | Ga0495674_0014985 | 3300047319 | Bacteria | 7256 |
| 826 | Ga0495674_0055514 | 3300047319 | Bacteria | 3473 |
| 827 | Ga0495674_0100088 | 3300047319 | Bacteria | 2467 |
| 828 | Ga0495674_0139871 | 3300047319 | Bacteria | 2035 |
| 829 | Ga0495674_0155990 | 3300047319 | Bacteria | 1912 |
| 830 | Ga0495674_0258154 | 3300047319 | Bacteria | 1432 |
| 831 | Ga0495676_0060249 | 3300047321 | Bacteria | 2976 |
| 832 | Ga0495676_0182366 | 3300047321 | Bacteria | 1470 |
| 833 | Ga0495680_0007893 | 3300047322 | Bacteria | 9714 |
| 834 | Ga0495680_0175388 | 3300047322 | Unclassified | 1550 |
| 835 | Ga0495675_0121992 | 3300047444 | Bacteria | 1623 |
| 836 | Ga0495677_0045282 | 3300047445 | Bacteria | 1614 |
| 837 | Ga0495684_0025026 | 3300047471 | Bacteria | 4591 |
| 838 | Ga0495593_0140953 | 3300047673 | Bacteria | 1221 |
| 839 | Ga0495602_0077213 | 3300048088 | Bacteria | 2819 |
| 840 | Ga0495602_0116228 | 3300048088 | Bacteria | 2162 |
| 841 | Ga0495602_0143485 | 3300048088 | Bacteria | 1887 |
| 842 | Ga0496100_0006561 | 3300048903 | Bacteria | 6353 |
| 843 | Ga0496100_0023659 | 3300048903 | Bacteria | 3735 |
| 844 | Ga0496100_0023889 | 3300048903 | Bacteria | 3721 |
| 845 | Ga0496100_0129086 | 3300048903 | Bacteria | 1778 |
| 846 | Ga0496100_0248680 | 3300048903 | Bacteria | 1314 |
| 847 | Ga0496100_0313783 | 3300048903 | Bacteria | 1176 |
| 848 | Ga0496100_0382535 | 3300048903 | Unclassified | 1069 |
| 849 | Ga0496101_0000417 | 3300048904 | Bacteria | 27418 |
| 850 | Ga0496101_0004112 | 3300048904 | Bacteria | 9106 |
| 851 | Ga0496101_0035125 | 3300048904 | Bacteria | 3545 |
| 852 | Ga0496101_0073222 | 3300048904 | Bacteria | 2516 |
| 853 | Ga0496101_0123350 | 3300048904 | Bacteria | 1961 |
| 854 | Ga0496101_0157568 | 3300048904 | Bacteria | 1740 |
| 855 | Ga0496101_0176343 | 3300048904 | Bacteria | 1644 |
| 856 | Ga0496101_0256470 | 3300048904 | Bacteria | 1363 |
| 857 | Ga0496101_0291297 | 3300048904 | Bacteria | 1277 |
| 858 | Ga0496101_0292703 | 3300048904 | Bacteria | 1274 |
| 859 | Ga0496101_0368129 | 3300048904 | Bacteria | 1130 |
| 860 | Ga0496101_0403479 | 3300048904 | Bacteria | 1076 |
| 861 | Ga0496101_0479197 | 3300048904 | Bacteria | 982 |
| 862 | Ga0496102_0000656 | 3300048905 | Bacteria | 34773 |
| 863 | Ga0496102_0009698 | 3300048905 | Bacteria | 8280 |
| 864 | Ga0496102_0017784 | 3300048905 | Bacteria | 6233 |
| 865 | Ga0496102_0055156 | 3300048905 | Bacteria | 3624 |
| 866 | Ga0496102_0067312 | 3300048905 | Bacteria | 3285 |
| 867 | Ga0496102_0094453 | 3300048905 | Bacteria | 2771 |
| 868 | Ga0496102_0316339 | 3300048905 | Bacteria | 1471 |
| 869 | Ga0496103_0000496 | 3300048906 | Bacteria | 32429 |
| 870 | Ga0496103_0000554 | 3300048906 | Bacteria | 29772 |
| 871 | Ga0496103_0012567 | 3300048906 | Bacteria | 5021 |
| 872 | Ga0496103_0018242 | 3300048906 | Bacteria | 4209 |
| 873 | Ga0496103_0032860 | 3300048906 | Bacteria | 3168 |
| 874 | Ga0496104_0003227 | 3300048907 | Bacteria | 14035 |
| 875 | Ga0496104_0012720 | 3300048907 | Bacteria | 7580 |
| 876 | Ga0496104_0019997 | 3300048907 | Bacteria | 6131 |
| 877 | Ga0496104_0025884 | 3300048907 | Bacteria | 5411 |
| 878 | Ga0496104_0040843 | 3300048907 | Bacteria | 4349 |
| 879 | Ga0496104_0044573 | 3300048907 | Bacteria | 4167 |
| 880 | Ga0496104_0058091 | 3300048907 | Bacteria | 3661 |
| 881 | Ga0496104_0066330 | 3300048907 | Unclassified | 3427 |
| 882 | Ga0496104_0070630 | 3300048907 | Bacteria | 3320 |
| 883 | Ga0496104_0072876 | 3300048907 | Bacteria | 3267 |
| 884 | Ga0496104_0075196 | 3300048907 | Bacteria | 3216 |
| 885 | Ga0496104_0100507 | 3300048907 | Bacteria | 2768 |
| 886 | Ga0496104_0108999 | 3300048907 | Bacteria | 2654 |
| 887 | Ga0496104_0140846 | 3300048907 | Bacteria | 2317 |
| 888 | Ga0496104_0172178 | 3300048907 | Bacteria | 2076 |
| 889 | Ga0496104_0172257 | 3300048907 | Bacteria | 2075 |
| 890 | Ga0496104_0332086 | 3300048907 | Bacteria | 1433 |
| 891 | Ga0496104_0382795 | 3300048907 | Bacteria | 1319 |
| 892 | Ga0496104_0574201 | 3300048907 | Unclassified | 1038 |
| 893 | Ga0496105_0019533 | 3300048908 | Bacteria | 5467 |
| 894 | Ga0496105_0024057 | 3300048908 | Bacteria | 4947 |
| 895 | Ga0496105_0028305 | 3300048908 | Bacteria | 4583 |
| 896 | Ga0496105_0054994 | 3300048908 | Bacteria | 3286 |
| 897 | Ga0496105_0119397 | 3300048908 | Bacteria | 2175 |
| 898 | Ga0496105_0257734 | 3300048908 | Bacteria | 1411 |
| 899 | Ga0496106_0000533 | 3300048909 | Bacteria | 26994 |
| 900 | Ga0496106_0006930 | 3300048909 | Bacteria | 8381 |
| 901 | Ga0496106_0008721 | 3300048909 | Bacteria | 7499 |
| 902 | Ga0496106_0015958 | 3300048909 | Bacteria | 5554 |
| 903 | Ga0496106_0164769 | 3300048909 | Bacteria | 1754 |
| 904 | Ga0496106_0186964 | 3300048909 | Unclassified | 1646 |
| 905 | Ga0496106_0407663 | 3300048909 | Bacteria | 1092 |
| 906 | Ga0496107_0000446 | 3300048910 | Bacteria | 22538 |
| 907 | Ga0496107_0000813 | 3300048910 | Bacteria | 18147 |
| 908 | Ga0496107_0017838 | 3300048910 | Bacteria | 4995 |
| 909 | Ga0496107_0034556 | 3300048910 | Bacteria | 3621 |
| 910 | Ga0496107_0038032 | 3300048910 | Bacteria | 3454 |
| 911 | Ga0496107_0119502 | 3300048910 | Bacteria | 1941 |
| 912 | Ga0496107_0134730 | 3300048910 | Bacteria | 1825 |
| 913 | Ga0496107_0161163 | 3300048910 | Bacteria | 1662 |
| 914 | Ga0496108_0001209 | 3300048911 | Bacteria | 20254 |
| 915 | Ga0496108_0013947 | 3300048911 | Bacteria | 6554 |
| 916 | Ga0496108_0014153 | 3300048911 | Bacteria | 6509 |
| 917 | Ga0496108_0017798 | 3300048911 | Bacteria | 5811 |
| 918 | Ga0496108_0018635 | 3300048911 | Bacteria | 5687 |
| 919 | Ga0496108_0054251 | 3300048911 | Bacteria | 3364 |
| 920 | Ga0496108_0056115 | 3300048911 | Bacteria | 3308 |
| 921 | Ga0496108_0085699 | 3300048911 | Bacteria | 2674 |
| 922 | Ga0496108_0103472 | 3300048911 | Unclassified | 2429 |
| 923 | Ga0496108_0203524 | 3300048911 | Bacteria | 1718 |
| 924 | Ga0496108_0223183 | 3300048911 | Bacteria | 1637 |
| 925 | Ga0496109_0000150 | 3300048912 | Bacteria | 68777 |
| 926 | Ga0496109_0003995 | 3300048912 | Bacteria | 12319 |
| 927 | Ga0496109_0009387 | 3300048912 | Bacteria | 8335 |
| 928 | Ga0496109_0023016 | 3300048912 | Bacteria | 5524 |
| 929 | Ga0496109_0046819 | 3300048912 | Bacteria | 3929 |
| 930 | Ga0496109_0054575 | 3300048912 | Bacteria | 3645 |
| 931 | Ga0496109_0067871 | 3300048912 | Bacteria | 3268 |
| 932 | Ga0496109_0100740 | 3300048912 | Bacteria | 2680 |
| 933 | Ga0496109_0125328 | 3300048912 | Bacteria | 2395 |
| 934 | Ga0496109_0178215 | 3300048912 | Bacteria | 1995 |
| 935 | Ga0496109_0280190 | 3300048912 | Bacteria | 1571 |
| 936 | Ga0496109_0345488 | 3300048912 | Bacteria | 1405 |
| 937 | Ga0496110_0007462 | 3300048913 | Bacteria | 8740 |
| 938 | Ga0496110_0007902 | 3300048913 | Bacteria | 8520 |
| 939 | Ga0496110_0045492 | 3300048913 | Bacteria | 3837 |
| 940 | Ga0496110_0048544 | 3300048913 | Bacteria | 3721 |
| 941 | Ga0496110_0103545 | 3300048913 | Bacteria | 2553 |
| 942 | Ga0496110_0149867 | 3300048913 | Bacteria | 2112 |
| 943 | Ga0496110_0209012 | 3300048913 | Bacteria | 1774 |
| 944 | Ga0496110_0256511 | 3300048913 | Bacteria | 1592 |
| 945 | Ga0496110_0293865 | 3300048913 | Bacteria | 1480 |
| 946 | Ga0496110_0320028 | 3300048913 | Bacteria | 1413 |
| 947 | Ga0496111_0159725 | 3300048914 | Bacteria | 1673 |
| 948 | Ga0496111_0181751 | 3300048914 | Bacteria | 1563 |
| 949 | Ga0496111_0224307 | 3300048914 | Bacteria | 1396 |
| 950 | Ga0496111_0289771 | 3300048914 | Unclassified | 1214 |
| 951 | Ga0496112_0005934 | 3300048915 | Bacteria | 10653 |
| 952 | Ga0496112_0009441 | 3300048915 | Bacteria | 8792 |
| 953 | Ga0496112_0024311 | 3300048915 | Bacteria | 5799 |
| 954 | Ga0496112_0055839 | 3300048915 | Bacteria | 3885 |
| 955 | Ga0496112_0057696 | 3300048915 | Bacteria | 3822 |
| 956 | Ga0496112_0062079 | 3300048915 | Bacteria | 3685 |
| 957 | Ga0496112_0123742 | 3300048915 | Bacteria | 2557 |
| 958 | Ga0496112_0176624 | 3300048915 | Bacteria | 2100 |
| 959 | Ga0496112_0182623 | 3300048915 | Bacteria | 2061 |
| 960 | Ga0496112_0241932 | 3300048915 | Bacteria | 1757 |
| 961 | Ga0496112_0258958 | 3300048915 | Bacteria | 1689 |
| 962 | Ga0496112_0335668 | 3300048915 | Bacteria | 1455 |
| 963 | Ga0496113_0009323 | 3300048916 | Bacteria | 6434 |
| 964 | Ga0496113_0015572 | 3300048916 | Bacteria | 5232 |
| 965 | Ga0496113_0029371 | 3300048916 | Bacteria | 3969 |
| 966 | Ga0496113_0067509 | 3300048916 | Plasmid | 2712 |
| 967 | Ga0496113_0119898 | 3300048916 | Bacteria | 2056 |
| 968 | Ga0496113_0141241 | 3300048916 | Bacteria | 1895 |
| 969 | Ga0496113_0148135 | 3300048916 | Bacteria | 1850 |
| 970 | Ga0496113_0163257 | 3300048916 | Bacteria | 1762 |
| 971 | Ga0496113_0266026 | 3300048916 | Bacteria | 1370 |
| 972 | Ga0496113_0281251 | 3300048916 | Bacteria | 1330 |
| 973 | Ga0496114_0000393 | 3300048917 | Bacteria | 32210 |
| 974 | Ga0496114_0008474 | 3300048917 | Bacteria | 8147 |
| 975 | Ga0496114_0076489 | 3300048917 | Bacteria | 2820 |
| 976 | Ga0496114_0264192 | 3300048917 | Bacteria | 1516 |
| 977 | Ga0496114_0412257 | 3300048917 | Bacteria | 1196 |
| 978 | Ga0496114_0610512 | 3300048917 | Bacteria | 961 |
| 979 | Ga0496115_0003544 | 3300048918 | Bacteria | 11227 |
| 980 | Ga0496115_0009564 | 3300048918 | Bacteria | 7201 |
| 981 | Ga0496115_0020461 | 3300048918 | Bacteria | 5105 |
| 982 | Ga0496115_0037161 | 3300048918 | Bacteria | 3859 |
| 983 | Ga0496115_0095691 | 3300048918 | Bacteria | 2431 |
| 984 | Ga0496115_0107263 | 3300048918 | Bacteria | 2293 |
| 985 | Ga0496115_0137188 | 3300048918 | Bacteria | 2017 |
| 986 | Ga0496115_0215274 | 3300048918 | Bacteria | 1586 |
| 987 | Ga0496115_0237242 | 3300048918 | Bacteria | 1503 |
| 988 | Ga0496115_0289028 | 3300048918 | Bacteria | 1345 |
| 989 | Ga0496115_0310437 | 3300048918 | Bacteria | 1291 |
| 990 | Ga0496115_0452874 | 3300048918 | Bacteria | 1036 |
| 991 | nmdc:mga03683_53500_c1 | 3300050489 | Bacteria | 1690 |
| 992 | nmdc:mga00v17_246562_c1 | 3300050491 | Bacteria | 1158 |
| 993 | nmdc:mga0yw44_201955_c1 | 3300050492 | Bacteria | 1313 |
| 994 | nmdc:mga06z11_7090_c1 | 3300050494 | Bacteria | 4597 |
| 995 | nmdc:mga05p37_123265_c1 | 3300050507 | Bacteria | 3184 |
| 996 | nmdc:mga05p37_242699_c1 | 3300050507 | Bacteria | 2165 |
| 997 | nmdc:mga05p37_294764_c1 | 3300050507 | Unclassified | 1930 |
| 998 | nmdc:mga05p37_346013_c1 | 3300050507 | Bacteria | 1752 |
| 999 | nmdc:mga05p37_81912_c1 | 3300050507 | Bacteria | 3976 |
| 1000 | nmdc:mga09592_10558_c1 | 3300050508 | Bacteria | 7516 |
| 1001 | nmdc:mga09592_172394_c1 | 3300050508 | Bacteria | 1871 |
| 1002 | nmdc:mga09592_191617_c1 | 3300050508 | Bacteria | 1770 |
| 1003 | nmdc:mga09592_47677_c1 | 3300050508 | Bacteria | 3612 |
| 1004 | nmdc:mga0qj67_124524_c1 | 3300050509 | Bacteria | 2086 |
| 1005 | nmdc:mga0qj67_231675_c1 | 3300050509 | Unclassified | 1499 |
| 1006 | nmdc:mga0qj67_244408_c1 | 3300050509 | Bacteria | 1456 |
| 1007 | nmdc:mga0qj67_420912_c1 | 3300050509 | Bacteria | 1077 |
| 1008 | nmdc:mga0qj67_7378_c1 | 3300050509 | Bacteria | 8128 |
| 1009 | nmdc:mga0qj67_96498_c1 | 3300050509 | Bacteria | 2380 |
| 1010 | nmdc:mga06r32_231436_c1 | 3300050510 | Bacteria | 1836 |
| 1011 | nmdc:mga06r32_425817_c1 | 3300050510 | Bacteria | 1308 |
| 1012 | nmdc:mga06r32_51599_c1 | 3300050510 | Bacteria | 3937 |
| 1013 | nmdc:mga06r32_55524_c1 | 3300050510 | Bacteria | 3799 |
| 1014 | nmdc:mga08y16_121549_c1 | 3300050511 | Bacteria | 2718 |
| 1015 | nmdc:mga08y16_286424_c1 | 3300050511 | Bacteria | 1699 |
| 1016 | nmdc:mga08y16_289250_c1 | 3300050511 | Bacteria | 1690 |
| 1017 | nmdc:mga08y16_36936_c1 | 3300050511 | Bacteria | 5131 |
| 1018 | nmdc:mga08y16_40005_c1 | 3300050511 | Bacteria | 4917 |
| 1019 | nmdc:mga08y16_406041_c1 | 3300050511 | Unclassified | 1394 |
| 1020 | nmdc:mga08y16_513130_c1 | 3300050511 | Bacteria | 1217 |
| 1021 | nmdc:mga08y16_79682_c1 | 3300050511 | Bacteria | 3414 |
| 1022 | nmdc:mga08y16_8860_c1 | 3300050511 | Bacteria | 10562 |
| 1023 | nmdc:mga0n895_183779_c1 | 3300050512 | Bacteria | 2122 |
| 1024 | nmdc:mga0n895_229152_c1 | 3300050512 | Bacteria | 1886 |
| 1025 | nmdc:mga0n895_295323_c1 | 3300050512 | Bacteria | 1643 |
| 1026 | nmdc:mga0n895_367071_c1 | 3300050512 | Bacteria | 1457 |
| 1027 | nmdc:mga0n895_4344_c1 | 3300050512 | Bacteria | 11621 |
| 1028 | nmdc:mga0n895_51683_c1 | 3300050512 | Bacteria | 4032 |
| 1029 | nmdc:mga0n895_5635_c1 | 3300050512 | Bacteria | 10493 |
| 1030 | nmdc:mga0a205_1625_c1 | 3300050515 | Bacteria | 19321 |
| 1031 | nmdc:mga0a205_39527_c1 | 3300050515 | Bacteria | 4541 |
| 1032 | nmdc:mga0a205_399688_c1 | 3300050515 | Bacteria | 1238 |
| 1033 | nmdc:mga0a205_430_c1 | 3300050515 | Bacteria | 32284 |
| 1034 | Ga0495601_0000460 | 3300053077 | Bacteria | 21389 |
| 1035 | Ga0495601_0001261 | 3300053077 | Bacteria | 13858 |
| 1036 | Ga0495601_0004351 | 3300053077 | Bacteria | 8184 |
| 1037 | Ga0495601_0023396 | 3300053077 | Bacteria | 3795 |
| 1038 | Ga0495601_0028968 | 3300053077 | Bacteria | 3432 |
| 1039 | Ga0495601_0109477 | 3300053077 | Bacteria | 1788 |
| 1040 | Ga0495601_0163979 | 3300053077 | Bacteria | 1452 |
| 1041 | Ga0495601_0275172 | 3300053077 | Bacteria | 1098 |
| 1042 | Ga0495612_0004070 | 3300053078 | Bacteria | 6056 |
| 1043 | Ga0495612_0033627 | 3300053078 | Bacteria | 2075 |
| 1044 | Ga0495612_0034504 | 3300053078 | Bacteria | 2049 |
| 1045 | Ga0495612_0035781 | 3300053078 | Unclassified | 2013 |
| 1046 | Ga0495655_0028869 | 3300053083 | Unclassified | 1329 |
| 1047 | Ga0495595_0001469 | 3300053084 | Bacteria | 9207 |
| 1048 | Ga0495595_0005222 | 3300053084 | Bacteria | 5246 |
| 1049 | Ga0495595_0058823 | 3300053084 | Bacteria | 1795 |
| 1050 | Ga0495595_0129127 | 3300053084 | Bacteria | 1234 |
| 1051 | Ga0495595_0130670 | 3300053084 | Bacteria | 1227 |
| 1052 | Ga0495619_0000510 | 3300053085 | Bacteria | 25902 |
| 1053 | Ga0495619_0004909 | 3300053085 | Bacteria | 8490 |
| 1054 | Ga0495619_0010695 | 3300053085 | Bacteria | 5777 |
| 1055 | Ga0495619_0012092 | 3300053085 | Bacteria | 5437 |
| 1056 | Ga0495619_0015380 | 3300053085 | Bacteria | 4841 |
| 1057 | Ga0495619_0026643 | 3300053085 | Bacteria | 3720 |
| 1058 | Ga0495619_0065065 | 3300053085 | Bacteria | 2432 |
| 1059 | Ga0495619_0071606 | 3300053085 | Bacteria | 2320 |
| 1060 | Ga0495619_0071642 | 3300053085 | Bacteria | 2319 |
| 1061 | Ga0495619_0090495 | 3300053085 | Bacteria | 2071 |
| 1062 | Ga0495619_0117418 | 3300053085 | Bacteria | 1822 |
| 1063 | Ga0495619_0209721 | 3300053085 | Bacteria | 1349 |
| 1064 | Ga0495619_0394560 | 3300053085 | Bacteria | 956 |
| 1065 | Ga0530510_0154780 | 3300061734 | Unclassified | 1694 |
| 1066 | 8006990170 | 8006984368 | Bacteria | 9651211 |
| 1067 | nmdc:mga05p37_443271_c1 | |||
| 1068 | SwRhRL2b_contig_907168 | |||
| 1069 | MBSR1b_contig_12792658 | |||
| 1070 | 2214628273 | |||
| 1071 | ARcpr5oldR_c000273 | |||
| 1072 | ARSoilYngRDRAFT_c00245 | |||
| 1073 | ARcpr5yngRDRAFT_c000126 | |||
| 1074 | ARSoilOldRDRAFT_c000152 | |||
| 1075 | ARCol0yngRDRAFT_1000342 | |||
| 1076 | JGI24752J21851_1003298 | |||
| 1077 | JGI24746J21847_1000474 | |||
| 1078 | JGI24746J21847_1000629 | |||
| 1079 | JGI24739J22299_10003620 | |||
| 1080 | JGI24739J22299_10004255 | |||
| 1081 | JGI24737J22298_10000062 | |||
| 1082 | JGI24737J22298_10000073 | |||
| 1083 | JGI24737J22298_10019219 | |||
| 1084 | JGI24750J21931_1000377 | |||
| 1085 | JGI24745J21846_1000398 | |||
| 1086 | JGI24745J21846_1002321 | |||
| 1087 | JGI24748J21848_1000480 | |||
| 1088 | JGI24748J21848_1002694 | |||
| 1089 | JGI24738J21930_10000217 | |||
| 1090 | JGI24738J21930_10002341 | |||
| 1091 | JGI24749J21850_1000689 | |||
| 1092 | JGI24749J21850_1000849 | |||
| 1093 | JGI24744J21845_10001417 | |||
| 1094 | JGI24035J26624_1000036 | |||
| 1095 | JGI24035J26624_1000204 | |||
| 1096 | JGI24033J26618_1002646 | |||
| 1097 | JGI24034J26672_10000225 | |||
| 1098 | JGI24034J26672_10001370 | |||
| 1099 | JGI24742J22300_10000032 | |||
| 1100 | JGI24742J22300_10000049 | |||
| 1101 | JGI24751J29686_10003092 | |||
| 1102 | JGI25405J52794_10015577 | |||
| 1103 | Ga0065717_1001953 | |||
| 1104 | Ga0065716_1002765 | |||
| 1105 | Ga0065704_10002996 | |||
| 1106 | Ga0065712_10086330 | |||
| 1107 | Ga0065712_10089240 | |||
| 1108 | Ga0065715_10009470 | |||
| 1109 | Ga0065715_10091967 | |||
| 1110 | Ga0065715_10092041 | |||
| 1111 | Ga0070676_10000251 | |||
| 1112 | Ga0070676_10258621 | |||
| 1113 | Ga0070683_100000344 | |||
| 1114 | Ga0070683_100002231 | |||
| 1115 | Ga0070683_100100054 | |||
| 1116 | Ga0070683_100123307 | |||
| 1117 | Ga0070690_100000588 | |||
| 1118 | Ga0070690_100000616 | |||
| 1119 | Ga0070690_100029125 | |||
| 1120 | Ga0070670_100001740 | |||
| 1121 | Ga0070670_100001768 | |||
| 1122 | Ga0070670_100038401 | |||
| 1123 | Ga0070677_10000076 | |||
| 1124 | Ga0070677_10001576 | |||
| 1125 | Ga0068869_100000078 | |||
| 1126 | Ga0068869_100008854 | |||
| 1127 | Ga0070666_10003799 | |||
| 1128 | Ga0070666_10033485 | |||
| 1129 | Ga0070666_10209024 | |||
| 1130 | Ga0070680_100000333 | |||
| 1131 | Ga0070680_100006554 | |||
| 1132 | Ga0070680_100076036 | |||
| 1133 | Ga0070680_100310650 | |||
| 1134 | Ga0070682_100000285 | |||
| 1135 | Ga0070682_100001569 | |||
| 1136 | Ga0068868_100001627 | |||
| 1137 | Ga0068868_100003400 | |||
| 1138 | Ga0070660_100000474 | |||
| 1139 | Ga0070660_100001115 | |||
| 1140 | Ga0070660_100022012 | |||
| 1141 | Ga0070660_100059229 | |||
| 1142 | Ga0070660_100083185 | |||
| 1143 | Ga0070689_100000252 | |||
| 1144 | Ga0070689_100002086 | |||
| 1145 | Ga0070691_10000476 | |||
| 1146 | Ga0070691_10002482 | |||
| 1147 | Ga0070687_100000476 | |||
| 1148 | Ga0070661_100000605 | |||
| 1149 | Ga0070661_100011032 | |||
| 1150 | Ga0070661_100087137 | |||
| 1151 | Ga0070692_10000127 | |||
| 1152 | Ga0070692_10000227 | |||
| 1153 | Ga0070692_10037540 | |||
| 1154 | Ga0070692_10180539 | |||
| 1155 | Ga0070668_100001035 | |||
| 1156 | Ga0070668_100007791 | |||
| 1157 | Ga0070668_100077010 | |||
| 1158 | Ga0070668_100111172 | |||
| 1159 | Ga0070669_100002096 | |||
| 1160 | Ga0070669_100236895 | |||
| 1161 | Ga0070675_100000522 | |||
| 1162 | Ga0070675_100008366 | |||
| 1163 | Ga0070675_100057814 | |||
| 1164 | Ga0070675_100123510 | |||
| 1165 | Ga0070671_100001132 | |||
| 1166 | Ga0070671_100001344 | |||
| 1167 | Ga0070671_100031885 | |||
| 1168 | Ga0070671_100445550 | |||
| 1169 | Ga0070674_100000240 | |||
| 1170 | Ga0070674_100000603 | |||
| 1171 | Ga0070674_100034347 | |||
| 1172 | Ga0070674_100106942 | |||
| 1173 | Ga0070674_100122367 | |||
| 1174 | Ga0070673_100000164 | |||
| 1175 | Ga0070673_100000666 | |||
| 1176 | Ga0070688_100000162 | |||
| 1177 | Ga0070688_100000961 | |||
| 1178 | Ga0070688_100010001 | |||
| 1179 | Ga0070688_100017036 | |||
| 1180 | Ga0070688_100131813 | |||
| 1181 | Ga0070688_100326582 | |||
| 1182 | Ga0070659_100000720 | |||
| 1183 | Ga0070659_100023047 | |||
| 1184 | Ga0070659_100224466 | |||
| 1185 | Ga0070659_100251249 | |||
| 1186 | Ga0070667_100001046 | |||
| 1187 | Ga0070667_100005648 | |||
| 1188 | Ga0070667_100175685 | |||
| 1189 | Ga0070667_100222406 | |||
| 1190 | Ga0070703_10001840 | |||
| 1191 | Ga0070703_10003412 | |||
| 1192 | Ga0070709_10109983 | |||
| 1193 | Ga0070714_100071576 | |||
| 1194 | Ga0070713_100023176 | |||
| 1195 | Ga0070713_100034835 | |||
| 1196 | Ga0070710_10007557 | |||
| 1197 | Ga0070710_10050308 | |||
| 1198 | Ga0070710_10085609 | |||
| 1199 | Ga0070701_10000860 | |||
| 1200 | Ga0070701_10004311 | |||
| 1201 | Ga0070701_10203060 | |||
| 1202 | Ga0070711_100009305 | |||
| 1203 | Ga0070711_100014237 | |||
| 1204 | Ga0070711_100103672 | |||
| 1205 | Ga0070705_100000321 | |||
| 1206 | Ga0070705_100008646 | |||
| 1207 | Ga0070700_100000654 | |||
| 1208 | Ga0070700_100011814 | |||
| 1209 | Ga0070700_100020746 | |||
| 1210 | Ga0070694_100000554 | |||
| 1211 | Ga0070694_100268475 | |||
| 1212 | Ga0070694_100285896 | |||
| 1213 | Ga0070708_100009300 | |||
| 1214 | Ga0070708_100036023 | |||
| 1215 | Ga0070708_100039455 | |||
| 1216 | Ga0070708_100125601 | |||
| 1217 | Ga0070663_100004739 | |||
| 1218 | Ga0070663_100011128 | |||
| 1219 | Ga0070663_100084630 | |||
| 1220 | Ga0070663_100154433 | |||
| 1221 | Ga0070663_100447617 | |||
| 1222 | Ga0070678_100000228 | |||
| 1223 | Ga0070678_100000570 | |||
| 1224 | Ga0070678_100009473 | |||
| 1225 | Ga0070678_100025375 | |||
| 1226 | Ga0070678_100053064 | |||
| 1227 | Ga0070662_100001178 | |||
| 1228 | Ga0070662_100026848 | |||
| 1229 | Ga0070662_100045270 | |||
| 1230 | Ga0070662_100046488 | |||
| 1231 | Ga0070662_100205836 | |||
| 1232 | Ga0070681_10000446 | |||
| 1233 | Ga0070681_10027394 | |||
| 1234 | Ga0068867_100001229 | |||
| 1235 | Ga0068867_100003347 | |||
| 1236 | Ga0068867_100078925 | |||
| 1237 | Ga0070685_10000768 | |||
| 1238 | Ga0070685_10001094 | |||
| 1239 | Ga0070706_100008477 | |||
| 1240 | Ga0070706_100057654 | |||
| 1241 | Ga0070706_100190833 | |||
| 1242 | Ga0070706_100198167 | |||
| 1243 | Ga0070706_100458086 | |||
| 1244 | Ga0070706_100537033 | |||
| 1245 | Ga0070707_100226693 | |||
| 1246 | Ga0070698_100050289 | |||
| 1247 | Ga0070698_100052632 | |||
| 1248 | Ga0070698_100097098 | |||
| 1249 | Ga0074259_10002483 | |||
| 1250 | Ga0070699_100408392 | |||
| 1251 | Ga0070679_100001839 | |||
| 1252 | Ga0070679_100005106 | |||
| 1253 | Ga0070679_100249166 | |||
| 1254 | Ga0070679_100315649 | |||
| 1255 | Ga0070684_100000411 | |||
| 1256 | Ga0070684_100008904 | |||
| 1257 | Ga0070684_100051289 | |||
| 1258 | Ga0070684_100118415 | |||
| 1259 | Ga0070697_100044711 | |||
| 1260 | Ga0070697_100045090 | |||
| 1261 | Ga0070697_100087885 | |||
| 1262 | Ga0070697_100094651 | |||
| 1263 | Ga0070672_100001539 | |||
| 1264 | Ga0070672_100013692 | |||
| 1265 | Ga0070686_100000379 | |||
| 1266 | Ga0070686_100001252 | |||
| 1267 | Ga0070686_100057138 | |||
| 1268 | Ga0070686_100058334 | |||
| 1269 | Ga0070695_100000294 | |||
| 1270 | Ga0070695_100000341 | |||
| 1271 | Ga0070695_100023224 | |||
| 1272 | Ga0070695_100118133 | |||
| 1273 | Ga0070696_100000594 | |||
| 1274 | Ga0070696_100023629 | |||
| 1275 | Ga0070696_100055145 | |||
| 1276 | Ga0070696_100313823 | |||
| 1277 | Ga0070693_100000031 | |||
| 1278 | Ga0070693_100000345 | |||
| 1279 | Ga0070693_100020113 | |||
| 1280 | Ga0070665_100143954 | |||
| 1281 | Ga0070665_100246968 | |||
| 1282 | Ga0070704_100000481 | |||
| 1283 | Ga0070704_100000911 | |||
| 1284 | Ga0070704_100051612 | |||
| 1285 | Ga0068855_100004006 | |||
| 1286 | Ga0068855_100057969 | |||
| 1287 | Ga0070664_100000874 | |||
| 1288 | Ga0070664_100020100 | |||
| 1289 | Ga0070664_100098089 | |||
| 1290 | Ga0068857_100000249 | |||
| 1291 | Ga0068857_100018629 | |||
| 1292 | Ga0068857_100292332 | |||
| 1293 | Ga0068854_100000146 | |||
| 1294 | Ga0068854_100009557 | |||
| 1295 | Ga0068856_100001251 | |||
| 1296 | Ga0068856_100002466 | |||
| 1297 | Ga0070702_100000134 | |||
| 1298 | Ga0070702_100005638 | |||
| 1299 | Ga0070702_100034973 | |||
| 1300 | Ga0070702_100212870 | |||
| 1301 | Ga0068852_100016912 | |||
| 1302 | Ga0068852_100018965 | |||
| 1303 | Ga0068859_100002043 | |||
| 1304 | Ga0068859_100003259 | |||
| 1305 | Ga0068859_100175910 | |||
| 1306 | Ga0068864_100000674 | |||
| 1307 | Ga0068864_100001986 | |||
| 1308 | Ga0068864_100094332 | |||
| 1309 | Ga0068864_100115595 | |||
| 1310 | Ga0068866_10000348 | |||
| 1311 | Ga0068866_10000557 | |||
| 1312 | Ga0068861_100000958 | |||
| 1313 | Ga0068861_100003474 | |||
| 1314 | Ga0068870_10000032 | |||
| 1315 | Ga0068870_10000115 | |||
| 1316 | Ga0068870_10174368 | |||
| 1317 | Ga0068863_100000150 | |||
| 1318 | Ga0068863_100003793 | |||
| 1319 | Ga0068863_100426209 | |||
| 1320 | Ga0068858_100004191 | |||
| 1321 | Ga0068858_100009937 | |||
| 1322 | Ga0068858_100112167 | |||
| 1323 | Ga0068858_100145530 | |||
| 1324 | Ga0068858_100170093 | |||
| 1325 | Ga0068858_100214853 | |||
| 1326 | Ga0068860_100006010 | |||
| 1327 | Ga0068860_100018645 | |||
| 1328 | Ga0068860_100027186 | |||
| 1329 | Ga0068860_100384724 | |||
| 1330 | Ga0068860_100517880 | |||
| 1331 | Ga0068862_100001121 | |||
| 1332 | Ga0068862_100011074 | |||
| 1333 | Ga0068862_100020884 | |||
| 1334 | Ga0068862_100381384 | |||
| 1335 | Ga0081455_10015729 | |||
| 1336 | Ga0081455_10019828 | |||
| 1337 | Ga0081455_10048669 | |||
| 1338 | Ga0081455_10059262 | |||
| 1339 | Ga0081455_10087603 | |||
| 1340 | Ga0070717_10016433 | |||
| 1341 | Ga0070717_10018063 | |||
| 1342 | Ga0070717_10138468 | |||
| 1343 | Ga0070717_10148079 | |||
| 1344 | Ga0070717_10362541 | |||
| 1345 | Ga0070717_10370530 | |||
| 1346 | Ga0075365_10039910 | |||
| 1347 | Ga0075365_10064947 | |||
| 1348 | Ga0075365_10211164 | |||
| 1349 | Ga0075432_10033002 | |||
| 1350 | Ga0070715_10006272 | |||
| 1351 | Ga0070716_100145792 | |||
| 1352 | Ga0070712_100039213 | |||
| 1353 | Ga0070712_100196062 | |||
| 1354 | Ga0075362_10097929 | |||
| 1355 | Ga0097621_100001205 | |||
| 1356 | Ga0097621_100001322 | |||
| 1357 | Ga0097621_100003473 | |||
| 1358 | Ga0068871_100000676 | |||
| 1359 | Ga0068871_100001279 | |||
| 1360 | Ga0068871_100005001 | |||
| 1361 | Ga0068871_100263330 | |||
| 1362 | Ga0075428_100064067 | |||
| 1363 | Ga0075428_100070279 | |||
| 1364 | Ga0075428_100134538 | |||
| 1365 | Ga0075428_100249558 | |||
| 1366 | Ga0075428_100352555 | |||
| 1367 | Ga0075428_100711459 | |||
| 1368 | Ga0075430_100126811 | |||
| 1369 | Ga0075431_100065799 | |||
| 1370 | Ga0075431_100119293 | |||
| 1371 | Ga0075431_100469939 | |||
| 1372 | Ga0075433_10000718 | |||
| 1373 | Ga0075433_10044101 | |||
| 1374 | Ga0075433_10426040 | |||
| 1375 | Ga0075434_100002238 | |||
| 1376 | Ga0075434_100003393 | |||
| 1377 | Ga0075434_100057976 | |||
| 1378 | Ga0075434_100085099 | |||
| 1379 | Ga0075434_100239695 | |||
| 1380 | Ga0075434_100374436 | |||
| 1381 | Ga0075429_100056298 | |||
| 1382 | Ga0075429_100112230 | |||
| 1383 | Ga0075429_100213992 | |||
| 1384 | Ga0075429_100342136 | |||
| 1385 | Ga0068865_100000085 | |||
| 1386 | Ga0068865_100000348 | |||
| 1387 | Ga0068865_100076507 | |||
| 1388 | Ga0068865_100341889 | |||
| 1389 | Ga0097620_100002042 | |||
| 1390 | Ga0097620_100003259 | |||
| 1391 | Ga0097620_100175898 | |||
| 1392 | Ga0075435_100102202 | |||
| 1393 | Ga0099795_10006038 | |||
| 1394 | Ga0105244_10083655 | |||
| 1395 | Ga0105250_10069850 | |||
| 1396 | Ga0111539_10001107 | |||
| 1397 | Ga0111539_10001814 | |||
| 1398 | Ga0111539_10034613 | |||
| 1399 | Ga0111539_10166030 | |||
| 1400 | Ga0111539_10233437 | |||
| 1401 | Ga0111539_10384088 | |||
| 1402 | Ga0111539_10567241 | |||
| 1403 | Ga0111539_10571092 | |||
| 1404 | Ga0105245_10000235 | |||
| 1405 | Ga0105245_10002164 | |||
| 1406 | Ga0105245_10133701 | |||
| 1407 | Ga0105247_10070818 | |||
| 1408 | Ga0114129_10086876 | |||
| 1409 | Ga0114129_10239574 | |||
| 1410 | Ga0114129_10733320 | |||
| 1411 | Ga0105243_10001256 | |||
| 1412 | Ga0105243_10009126 | |||
| 1413 | Ga0105243_10024145 | |||
| 1414 | Ga0105243_10075283 | |||
| 1415 | Ga0105243_10101070 | |||
| 1416 | Ga0105241_10000414 | |||
| 1417 | Ga0105241_10000702 | |||
| 1418 | Ga0105242_10000134 | |||
| 1419 | Ga0105242_10001674 | |||
| 1420 | Ga0105242_10316978 | |||
| 1421 | Ga0105242_10451255 | |||
| 1422 | Ga0105248_10001347 | |||
| 1423 | Ga0105248_10003880 | |||
| 1424 | Ga0105248_10474452 | |||
| 1425 | Ga0105237_10012335 | |||
| 1426 | Ga0105237_10039808 | |||
| 1427 | Ga0105237_10163133 | |||
| 1428 | Ga0105238_10151943 | |||
| 1429 | Ga0105249_10000325 | |||
| 1430 | Ga0105249_10000627 | |||
| 1431 | Ga0105249_10155371 | |||
| 1432 | Ga0105249_10355796 | |||
| 1433 | Ga0105249_10564967 | |||
| 1434 | Ga0105239_10002328 | |||
| 1435 | Ga0105239_10004832 | |||
| 1436 | Ga0105239_10039843 | |||
| 1437 | Ga0105239_10377058 | |||
| 1438 | Ga0105246_10000041 | |||
| 1439 | Ga0105246_10000168 | |||
| 1440 | Ga0157373_10010744 | |||
| 1441 | Ga0157373_10016002 | |||
| 1442 | Ga0157371_10006558 | |||
| 1443 | Ga0157371_10015556 | |||
| 1444 | Ga0157374_10002115 | |||
| 1445 | Ga0157374_10033139 | |||
| 1446 | Ga0157374_10033189 | |||
| 1447 | Ga0157374_10153782 | |||
| 1448 | Ga0157378_10000434 | |||
| 1449 | Ga0163162_10006347 | |||
| 1450 | Ga0163162_10007869 | |||
| 1451 | Ga0163162_10029055 | |||
| 1452 | Ga0163162_10224025 | |||
| 1453 | Ga0163162_10230871 | |||
| 1454 | Ga0163162_10297104 | |||
| 1455 | Ga0163162_10439316 | |||
| 1456 | Ga0163162_10554047 | |||
| 1457 | Ga0163162_10634260 | |||
| 1458 | Ga0163162_10765485 | |||
| 1459 | Ga0157372_10006948 | |||
| 1460 | Ga0157372_10022013 | |||
| 1461 | Ga0157372_10418443 | |||
| 1462 | Ga0157375_10000181 | |||
| 1463 | Ga0157375_10002241 | |||
| 1464 | Ga0157375_10018144 | |||
| 1465 | Ga0157375_10028214 | |||
| 1466 | Ga0157375_10035469 | |||
| 1467 | Ga0157375_10048041 | |||
| 1468 | Ga0157375_10188920 | |||
| 1469 | Ga0157375_10778888 | |||
| 1470 | Ga0163163_10017949 | |||
| 1471 | Ga0163163_10029491 | |||
| 1472 | Ga0163163_10033676 | |||
| 1473 | Ga0163163_10144482 | |||
| 1474 | Ga0163163_10157443 | |||
| 1475 | Ga0157380_10001449 | |||
| 1476 | Ga0157380_10271538 | |||
| 1477 | Ga0157377_10000101 | |||
| 1478 | Ga0157377_10000284 | |||
| 1479 | Ga0157379_10000364 | |||
| 1480 | Ga0157379_10000554 | |||
| 1481 | Ga0157379_10066772 | |||
| 1482 | Ga0157379_10120313 | |||
| 1483 | Ga0157379_10436707 | |||
| 1484 | Ga0157376_10000142 | |||
| 1485 | Ga0157376_10001203 | |||
| 1486 | Ga0157376_10049164 | |||
| 1487 | Ga0157376_10065221 | |||
| 1488 | Ga0157376_10066488 | |||
| 1489 | Ga0157376_10127807 | |||
| 1490 | Ga0157376_10284061 | |||
| 1491 | Ga0163161_10000081 | |||
| 1492 | Ga0163161_10018167 | |||
| 1493 | Ga0163161_10351564 | |||
| 1494 | Ga0213876_10057756 | |||
| 1495 | Ga0207666_1000031 | |||
| 1496 | Ga0207666_1000042 | |||
| 1497 | Ga0207673_1000069 | |||
| 1498 | Ga0207673_1000121 | |||
| 1499 | Ga0207697_10000045 | |||
| 1500 | Ga0207697_10000416 | |||
| 1501 | Ga0207697_10006171 | |||
| 1502 | Ga0207653_10004447 | |||
| 1503 | Ga0207653_10007306 | |||
| 1504 | Ga0207682_10000153 | |||
| 1505 | Ga0207682_10000314 | |||
| 1506 | Ga0207692_10018416 | |||
| 1507 | Ga0207692_10063838 | |||
| 1508 | Ga0207692_10077256 | |||
| 1509 | Ga0207692_10118336 | |||
| 1510 | Ga0207642_10000262 | |||
| 1511 | Ga0207642_10000438 | |||
| 1512 | Ga0207710_10006396 | |||
| 1513 | Ga0207710_10037976 | |||
| 1514 | Ga0207688_10000044 | |||
| 1515 | Ga0207688_10000606 | |||
| 1516 | Ga0207688_10023542 | |||
| 1517 | Ga0207680_10001543 | |||
| 1518 | Ga0207680_10058823 | |||
| 1519 | Ga0207647_10001666 | |||
| 1520 | Ga0207647_10004187 | |||
| 1521 | Ga0207647_10087508 | |||
| 1522 | Ga0207685_10050462 | |||
| 1523 | Ga0207685_10069725 | |||
| 1524 | Ga0207699_10030946 | |||
| 1525 | Ga0207699_10185382 | |||
| 1526 | Ga0207645_10000945 | |||
| 1527 | Ga0207645_10001816 | |||
| 1528 | Ga0207645_10218126 | |||
| 1529 | Ga0207643_10000025 | |||
| 1530 | Ga0207643_10000345 | |||
| 1531 | Ga0207684_10006956 | |||
| 1532 | Ga0207684_10011951 | |||
| 1533 | Ga0207684_10022595 | |||
| 1534 | Ga0207684_10024910 | |||
| 1535 | Ga0207684_10040998 | |||
| 1536 | Ga0207684_10145035 | |||
| 1537 | Ga0207684_10149198 | |||
| 1538 | Ga0207654_10001478 | |||
| 1539 | Ga0207654_10008394 | |||
| 1540 | Ga0207707_10001635 | |||
| 1541 | Ga0207707_10018614 | |||
| 1542 | Ga0207671_10023238 | |||
| 1543 | Ga0207671_10038138 | |||
| 1544 | Ga0207693_10018855 | |||
| 1545 | Ga0207693_10034249 | |||
| 1546 | Ga0207693_10040180 | |||
| 1547 | Ga0207693_10142078 | |||
| 1548 | Ga0207693_10204987 | |||
| 1549 | Ga0207663_10019695 | |||
| 1550 | Ga0207663_10026811 | |||
| 1551 | Ga0207663_10028158 | |||
| 1552 | Ga0207663_10400450 | |||
| 1553 | Ga0207660_10000131 | |||
| 1554 | Ga0207660_10000318 | |||
| 1555 | Ga0207660_10071944 | |||
| 1556 | Ga0207660_10280266 | |||
| 1557 | Ga0207662_10000100 | |||
| 1558 | Ga0207662_10000668 | |||
| 1559 | Ga0207657_10000699 | |||
| 1560 | Ga0207657_10003089 | |||
| 1561 | Ga0207657_10049279 | |||
| 1562 | Ga0207657_10076905 | |||
| 1563 | Ga0207657_10093242 | |||
| 1564 | Ga0207649_10000310 | |||
| 1565 | Ga0207649_10001217 | |||
| 1566 | Ga0207649_10002591 | |||
| 1567 | Ga0207652_10000785 | |||
| 1568 | Ga0207652_10007477 | |||
| 1569 | Ga0207652_10012572 | |||
| 1570 | Ga0207652_10101697 | |||
| 1571 | Ga0207681_10000131 | |||
| 1572 | Ga0207681_10001247 | |||
| 1573 | Ga0207681_10025153 | |||
| 1574 | Ga0207681_10094541 | |||
| 1575 | Ga0207694_10079794 | |||
| 1576 | Ga0207650_10002469 | |||
| 1577 | Ga0207650_10007605 | |||
| 1578 | Ga0207650_10039061 | |||
| 1579 | Ga0207659_10000040 | |||
| 1580 | Ga0207659_10001096 | |||
| 1581 | Ga0207687_10000122 | |||
| 1582 | Ga0207687_10001549 | |||
| 1583 | Ga0207687_10283911 | |||
| 1584 | Ga0207700_10009919 | |||
| 1585 | Ga0207700_10131826 | |||
| 1586 | Ga0207700_10192672 | |||
| 1587 | Ga0207700_10421931 | |||
| 1588 | Ga0207664_10063010 | |||
| 1589 | Ga0207664_10135631 | |||
| 1590 | Ga0207644_10000393 | |||
| 1591 | Ga0207644_10000828 | |||
| 1592 | Ga0207690_10000277 | |||
| 1593 | Ga0207690_10001276 | |||
| 1594 | Ga0207690_10307509 | |||
| 1595 | Ga0207706_10000311 | |||
| 1596 | Ga0207706_10001343 | |||
| 1597 | Ga0207706_10039346 | |||
| 1598 | Ga0207706_10070126 | |||
| 1599 | Ga0207706_10100063 | |||
| 1600 | Ga0207686_10000407 | |||
| 1601 | Ga0207686_10002434 | |||
| 1602 | Ga0207709_10000322 | |||
| 1603 | Ga0207709_10000591 | |||
| 1604 | Ga0207709_10065022 | |||
| 1605 | Ga0207709_10234801 | |||
| 1606 | Ga0207670_10000240 | |||
| 1607 | Ga0207670_10000509 | |||
| 1608 | Ga0207669_10000191 | |||
| 1609 | Ga0207669_10000484 | |||
| 1610 | Ga0207669_10231076 | |||
| 1611 | Ga0207669_10305221 | |||
| 1612 | Ga0207704_10000071 | |||
| 1613 | Ga0207704_10000289 | |||
| 1614 | Ga0207704_10211853 | |||
| 1615 | Ga0207704_10318896 | |||
| 1616 | Ga0207665_10078058 | |||
| 1617 | Ga0207665_10085025 | |||
| 1618 | Ga0207665_10424939 | |||
| 1619 | Ga0207691_10000257 | |||
| 1620 | Ga0207691_10001202 | |||
| 1621 | Ga0207711_10002577 | |||
| 1622 | Ga0207711_10017003 | |||
| 1623 | Ga0207689_10000134 | |||
| 1624 | Ga0207689_10001584 | |||
| 1625 | Ga0207661_10000191 | |||
| 1626 | Ga0207661_10001224 | |||
| 1627 | Ga0207661_10058414 | |||
| 1628 | Ga0207679_10000099 | |||
| 1629 | Ga0207679_10003586 | |||
| 1630 | Ga0207679_10005866 | |||
| 1631 | Ga0207667_10034555 | |||
| 1632 | Ga0207667_10048127 | |||
| 1633 | Ga0207651_10000017 | |||
| 1634 | Ga0207651_10000393 | |||
| 1635 | Ga0207712_10000114 | |||
| 1636 | Ga0207712_10000591 | |||
| 1637 | Ga0207712_10007853 | |||
| 1638 | Ga0207712_10420943 | |||
| 1639 | Ga0207668_10001667 | |||
| 1640 | Ga0207668_10002065 | |||
| 1641 | Ga0207668_10075803 | |||
| 1642 | Ga0207640_10000336 | |||
| 1643 | Ga0207640_10000604 | |||
| 1644 | Ga0207658_10001624 | |||
| 1645 | Ga0207658_10011285 | |||
| 1646 | Ga0207677_10000412 | |||
| 1647 | Ga0207677_10000974 | |||
| 1648 | Ga0207677_10148370 | |||
| 1649 | Ga0207703_10000863 | |||
| 1650 | Ga0207639_10000646 | |||
| 1651 | Ga0207639_10001290 | |||
| 1652 | Ga0207639_10339432 | |||
| 1653 | Ga0207678_10000131 | |||
| 1654 | Ga0207678_10001120 | |||
| 1655 | Ga0207678_10058037 | |||
| 1656 | Ga0207678_10280703 | |||
| 1657 | Ga0207708_10000192 | |||
| 1658 | Ga0207708_10001629 | |||
| 1659 | Ga0207708_10003560 | |||
| 1660 | Ga0207702_10002469 | |||
| 1661 | Ga0207702_10003256 | |||
| 1662 | Ga0207641_10000246 | |||
| 1663 | Ga0207641_10003176 | |||
| 1664 | Ga0207641_10008853 | |||
| 1665 | Ga0207648_10001831 | |||
| 1666 | Ga0207648_10006095 | |||
| 1667 | Ga0207648_10061876 | |||
| 1668 | Ga0207648_10271720 | |||
| 1669 | Ga0207676_10001655 | |||
| 1670 | Ga0207676_10002691 | |||
| 1671 | Ga0207676_10004872 | |||
| 1672 | Ga0207676_10100626 | |||
| 1673 | Ga0207676_10418017 | |||
| 1674 | Ga0207674_10000355 | |||
| 1675 | Ga0207674_10001638 | |||
| 1676 | Ga0207674_10074643 | |||
| 1677 | Ga0207675_100001893 | |||
| 1678 | Ga0207675_100006563 | |||
| 1679 | Ga0207675_100433759 | |||
| 1680 | Ga0207683_10000924 | |||
| 1681 | Ga0207683_10002127 | |||
| 1682 | Ga0207683_10017822 | |||
| 1683 | Ga0207683_10035097 | |||
| 1684 | Ga0207683_10454663 | |||
| 1685 | Ga0207698_10001234 | |||
| 1686 | Ga0207698_10012369 | |||
| 1687 | Ga0210002_1002756 | |||
| 1688 | Ga0210002_1003909 | |||
| 1689 | Ga0209998_10000477 | |||
| 1690 | Ga0209998_10002044 | |||
| 1691 | Ga0209998_10012552 | |||
| 1692 | Ga0209974_10010866 | |||
| 1693 | Ga0209974_10029499 | |||
| 1694 | Ga0207428_10000469 | |||
| 1695 | Ga0207428_10000944 | |||
| 1696 | Ga0207428_10043183 | |||
| 1697 | Ga0207428_10058774 | |||
| 1698 | Ga0207428_10082724 | |||
| 1699 | Ga0207428_10087049 | |||
| 1700 | Ga0207428_10111715 | |||
| 1701 | Ga0268266_10247949 | |||
| 1702 | Ga0268266_10555713 | |||
| 1703 | Ga0268265_10000312 | |||
| 1704 | Ga0268265_10001746 | |||
| 1705 | Ga0268265_10100349 | |||
| 1706 | Ga0268265_10282753 | |||
| 1707 | Ga0268264_10000412 | |||
| 1708 | Ga0268264_10000751 | |||
| 1709 | Ga0268264_10309421 | |||
| 1710 | Ga0373930_0002725 | |||
| 1711 | Ga0373930_0026828 | |||
| 1712 | Ga0373948_0012313 | |||
| 1713 | Ga0373950_0000747 | |||
| 1714 | Ga0373950_0003891 | |||
| 1715 | Ga0373950_0007394 | |||
| 1716 | Ga0373958_0002202 | |||
| 1717 | Ga0373959_0001785 | |||
| 1718 | Ga0373959_0003277 | |||
| 1719 | Ga0373959_0005041 | |||
| 1720 | Ga0373938_0000291 | |||
| 1721 | Ga0373938_0000451 | |||
| 1722 | Ga0373938_0009384 | |||
| 1723 | Ga0373926_0056981 | |||
| 1724 | Ga0373928_0000699 | |||
| 1725 | Ga0373928_0000806 | |||
| 1726 | Ga0373928_0001248 | |||
| 1727 | Ga0373929_0002281 | |||
| 1728 | Ga0373929_0003591 | |||
| 1729 | Ga0373934_0148708 | |||
| 1730 | Ga0373940_0000652 | |||
| 1731 | Ga0373940_0002233 | |||
| 1732 | Ga0373944_0038153 | |||
| 1733 | Ga0373944_0038397 | |||
| 1734 | Ga0373949_0000392 | |||
| 1735 | Ga0373949_0001594 | |||
| 1736 | Ga0373949_0003455 | |||
| 1737 | Ga0373951_0001947 | |||
| 1738 | Ga0373951_0003618 | |||
| 1739 | Ga0373951_0006289 | |||
| 1740 | Ga0373951_0032553 | |||
| 1741 | Ga0373952_0000672 | |||
| 1742 | Ga0373952_0003009 | |||
| 1743 | Ga0373952_0004332 | |||
| 1744 | Ga0373932_0000911 | |||
| 1745 | Ga0373932_0001306 | |||
| 1746 | Ga0373932_0001480 | |||
| 1747 | Ga0373932_0028131 | |||
| 1748 | Ga0373936_0093230 | |||
| 1749 | Ga0373936_0112666 | |||
| 1750 | Ga0373939_0000964 | |||
| 1751 | Ga0373939_0002528 | |||
| 1752 | Ga0373941_0014017 | |||
| 1753 | Ga0373945_0053259 | |||
| 1754 | Ga0373960_0000113 | |||
| 1755 | Ga0373960_0000122 | |||
| 1756 | Ga0373960_0014695 | |||
| 1757 | Ga0373960_0029149 | |||
| 1758 | Ga0373943_0036157 | |||
| 1759 | Ga0373943_0062481 | |||
| 1760 | Ga0373943_0185171 | |||
| 1761 | Ga0373946_0020814 | |||
| 1762 | Ga0373946_0061598 | |||
| 1763 | Ga0373955_0205170 | |||
| 1764 | Ga0373942_0001003 | |||
| 1765 | Ga0373942_0001784 | |||
| 1766 | Ga0373961_0001327 | |||
| 1767 | Ga0373961_0001691 | |||
| 1768 | Ga0373961_0024677 | |||
| 1769 | Ga0373962_0000343 | |||
| 1770 | Ga0373962_0000914 | |||
| 1771 | Ga0373924_0021933 | |||
| 1772 | Ga0373924_0152741 | |||
| 1773 | Ga0373931_0000167 | |||
| 1774 | Ga0373931_0000193 | |||
| 1775 | Ga0373931_0009928 | |||
| 1776 | Ga0373935_0023315 | |||
| 1777 | Ga0373935_0049751 | |||
| 1778 | Ga0373935_0165354 | |||
| 1779 | Ga0373927_0022362 | |||
| 1780 | Ga0373927_0090463 | |||
| 1781 | Ga0373927_0159661 | |||
| 1782 | Ga0373947_0011799 | |||
| 1783 | Ga0373947_0044615 | |||
| 1784 | Ga0373947_0045319 | |||
| 1785 | Ga0373947_0082365 | |||
| 1786 | Ga0373947_0086380 | |||
| 1787 | Ga0373937_0059073 | |||
| 1788 | Ga0373937_0122906 | |||
| 1789 | Ga0373937_0247053 | |||
| 1790 | Ga0373925_0031270 | |||
| 1791 | Ga0373925_0310229 | |||
| 1792 | Ga0373925_0362878 | |||
| 1793 | Ga0395898_0235992 | |||
| 1794 | Ga0436365_1532142 | |||
| 1795 | Ga0436361_1076743 | |||
| 1796 | Ga0453683_0162092 | |||
| 1797 | Ga0451576_0049352 | |||
| 1798 | Ga0495592_0156562 | |||
| 1799 | Ga0495603_0005382 | |||
| 1800 | Ga0495603_0017639 | |||
| 1801 | Ga0495603_0040560 | |||
| 1802 | Ga0495603_0119747 | |||
| 1803 | Ga0495603_0170150 | |||
| 1804 | Ga0495629_0029834 | |||
| 1805 | Ga0495629_0048458 | |||
| 1806 | Ga0495629_0164630 | |||
| 1807 | Ga0495641_0100327 | |||
| 1808 | Ga0495651_0019246 | |||
| 1809 | Ga0495651_0200175 | |||
| 1810 | Ga0495651_0308791 | |||
| 1811 | Ga0495653_0016063 | |||
| 1812 | Ga0495653_0083268 | |||
| 1813 | Ga0495580_0100719 | |||
| 1814 | Ga0495582_0162255 | |||
| 1815 | Ga0495605_0100071 | |||
| 1816 | Ga0495639_0099704 | |||
| 1817 | Ga0495662_0078172 | |||
| 1818 | Ga0495664_0005448 | |||
| 1819 | Ga0495664_0076048 | |||
| 1820 | Ga0495664_0131924 | |||
| 1821 | Ga0495584_0065402 | |||
| 1822 | Ga0495584_0093404 | |||
| 1823 | Ga0495585_0040957 | |||
| 1824 | Ga0495585_0110686 | |||
| 1825 | Ga0495594_0046100 | |||
| 1826 | Ga0495594_0046429 | |||
| 1827 | Ga0495607_0168592 | |||
| 1828 | Ga0495608_0112061 | |||
| 1829 | Ga0495616_0074252 | |||
| 1830 | Ga0495616_0091125 | |||
| 1831 | Ga0495618_0012254 | |||
| 1832 | Ga0495618_0030381 | |||
| 1833 | Ga0495628_0049888 | |||
| 1834 | Ga0495630_0087518 | |||
| 1835 | Ga0495644_0062421 | |||
| 1836 | Ga0495663_0016027 | |||
| 1837 | Ga0495666_0043970 | |||
| 1838 | Ga0495666_0130769 | |||
| 1839 | Ga0495652_0071490 | |||
| 1840 | Ga0495652_0192332 | |||
| 1841 | Ga0495652_0277545 | |||
| 1842 | Ga0495665_0073291 | |||
| 1843 | Ga0495640_0038504 | |||
| 1844 | Ga0495640_0054226 | |||
| 1845 | Ga0495640_0093618 | |||
| 1846 | Ga0495640_0190148 | |||
| 1847 | Ga0495586_0062522 | |||
| 1848 | Ga0495586_0133155 | |||
| 1849 | Ga0495587_0058665 | |||
| 1850 | Ga0495609_0118066 | |||
| 1851 | Ga0495633_0151066 | |||
| 1852 | Ga0495667_0046839 | |||
| 1853 | Ga0495667_0116090 | |||
| 1854 | Ga0495667_0148001 | |||
| 1855 | Ga0495634_0022362 | |||
| 1856 | Ga0495634_0074872 | |||
| 1857 | Ga0495634_0155389 | |||
| 1858 | Ga0495611_0057907 | |||
| 1859 | Ga0495635_0078565 | |||
| 1860 | Ga0495661_0044050 | |||
| 1861 | Ga0495588_0058694 | |||
| 1862 | Ga0495599_0201005 | |||
| 1863 | Ga0495599_0310233 | |||
| 1864 | Ga0495623_0041817 | |||
| 1865 | Ga0495623_0162317 | |||
| 1866 | Ga0495646_0091282 | |||
| 1867 | Ga0495646_0140466 | |||
| 1868 | Ga0495647_0017384 | |||
| 1869 | Ga0495647_0045713 | |||
| 1870 | Ga0495647_0102191 | |||
| 1871 | Ga0495647_0102270 | |||
| 1872 | Ga0495647_0116571 | |||
| 1873 | Ga0495658_0019110 | |||
| 1874 | Ga0495658_0031862 | |||
| 1875 | Ga0495658_0080986 | |||
| 1876 | Ga0495658_0140842 | |||
| 1877 | Ga0495658_0282376 | |||
| 1878 | Ga0495658_0302328 | |||
| 1879 | Ga0495613_0075825 | |||
| 1880 | Ga0495624_0078381 | |||
| 1881 | Ga0495624_0160923 | |||
| 1882 | Ga0495670_0022778 | |||
| 1883 | Ga0495589_0120593 | |||
| 1884 | Ga0495600_0121726 | |||
| 1885 | Ga0495581_0008318 | |||
| 1886 | Ga0495581_0093377 | |||
| 1887 | Ga0495581_0167799 | |||
| 1888 | Ga0495604_0056734 | |||
| 1889 | Ga0495604_0181025 | |||
| 1890 | Ga0495604_0196071 | |||
| 1891 | Ga0495674_0014985 | |||
| 1892 | Ga0495674_0055514 | |||
| 1893 | Ga0495674_0100088 | |||
| 1894 | Ga0495674_0139871 | |||
| 1895 | Ga0495674_0155990 | |||
| 1896 | Ga0495674_0258154 | |||
| 1897 | Ga0495676_0060249 | |||
| 1898 | Ga0495676_0182366 | |||
| 1899 | Ga0495680_0007893 | |||
| 1900 | Ga0495680_0175388 | |||
| 1901 | Ga0495675_0121992 | |||
| 1902 | Ga0495677_0045282 | |||
| 1903 | Ga0495684_0025026 | |||
| 1904 | Ga0495593_0140953 | |||
| 1905 | Ga0495602_0077213 | |||
| 1906 | Ga0495602_0116228 | |||
| 1907 | Ga0495602_0143485 | |||
| 1908 | Ga0496100_0006561 | |||
| 1909 | Ga0496100_0023659 | |||
| 1910 | Ga0496100_0023889 | |||
| 1911 | Ga0496100_0129086 | |||
| 1912 | Ga0496100_0248680 | |||
| 1913 | Ga0496100_0313783 | |||
| 1914 | Ga0496100_0382535 | |||
| 1915 | Ga0496101_0000417 | |||
| 1916 | Ga0496101_0004112 | |||
| 1917 | Ga0496101_0035125 | |||
| 1918 | Ga0496101_0073222 | |||
| 1919 | Ga0496101_0123350 | |||
| 1920 | Ga0496101_0157568 | |||
| 1921 | Ga0496101_0176343 | |||
| 1922 | Ga0496101_0256470 | |||
| 1923 | Ga0496101_0291297 | |||
| 1924 | Ga0496101_0292703 | |||
| 1925 | Ga0496101_0368129 | |||
| 1926 | Ga0496101_0403479 | |||
| 1927 | Ga0496101_0479197 | |||
| 1928 | Ga0496102_0000656 | |||
| 1929 | Ga0496102_0009698 | |||
| 1930 | Ga0496102_0017784 | |||
| 1931 | Ga0496102_0055156 | |||
| 1932 | Ga0496102_0067312 | |||
| 1933 | Ga0496102_0094453 | |||
| 1934 | Ga0496102_0316339 | |||
| 1935 | Ga0496103_0000496 | |||
| 1936 | Ga0496103_0000554 | |||
| 1937 | Ga0496103_0012567 | |||
| 1938 | Ga0496103_0018242 | |||
| 1939 | Ga0496103_0032860 | |||
| 1940 | Ga0496104_0003227 | |||
| 1941 | Ga0496104_0012720 | |||
| 1942 | Ga0496104_0019997 | |||
| 1943 | Ga0496104_0025884 | |||
| 1944 | Ga0496104_0040843 | |||
| 1945 | Ga0496104_0044573 | |||
| 1946 | Ga0496104_0058091 | |||
| 1947 | Ga0496104_0066330 | |||
| 1948 | Ga0496104_0070630 | |||
| 1949 | Ga0496104_0072876 | |||
| 1950 | Ga0496104_0075196 | |||
| 1951 | Ga0496104_0100507 | |||
| 1952 | Ga0496104_0108999 | |||
| 1953 | Ga0496104_0140846 | |||
| 1954 | Ga0496104_0172178 | |||
| 1955 | Ga0496104_0172257 | |||
| 1956 | Ga0496104_0332086 | |||
| 1957 | Ga0496104_0382795 | |||
| 1958 | Ga0496104_0574201 | |||
| 1959 | Ga0496105_0019533 | |||
| 1960 | Ga0496105_0024057 | |||
| 1961 | Ga0496105_0028305 | |||
| 1962 | Ga0496105_0054994 | |||
| 1963 | Ga0496105_0119397 | |||
| 1964 | Ga0496105_0257734 | |||
| 1965 | Ga0496106_0000533 | |||
| 1966 | Ga0496106_0006930 | |||
| 1967 | Ga0496106_0008721 | |||
| 1968 | Ga0496106_0015958 | |||
| 1969 | Ga0496106_0164769 | |||
| 1970 | Ga0496106_0186964 | |||
| 1971 | Ga0496106_0407663 | |||
| 1972 | Ga0496107_0000446 | |||
| 1973 | Ga0496107_0000813 | |||
| 1974 | Ga0496107_0017838 | |||
| 1975 | Ga0496107_0034556 | |||
| 1976 | Ga0496107_0038032 | |||
| 1977 | Ga0496107_0119502 | |||
| 1978 | Ga0496107_0134730 | |||
| 1979 | Ga0496107_0161163 | |||
| 1980 | Ga0496108_0001209 | |||
| 1981 | Ga0496108_0013947 | |||
| 1982 | Ga0496108_0014153 | |||
| 1983 | Ga0496108_0017798 | |||
| 1984 | Ga0496108_0018635 | |||
| 1985 | Ga0496108_0054251 | |||
| 1986 | Ga0496108_0056115 | |||
| 1987 | Ga0496108_0085699 | |||
| 1988 | Ga0496108_0103472 | |||
| 1989 | Ga0496108_0203524 | |||
| 1990 | Ga0496108_0223183 | |||
| 1991 | Ga0496109_0000150 | |||
| 1992 | Ga0496109_0003995 | |||
| 1993 | Ga0496109_0009387 | |||
| 1994 | Ga0496109_0023016 | |||
| 1995 | Ga0496109_0046819 | |||
| 1996 | Ga0496109_0054575 | |||
| 1997 | Ga0496109_0067871 | |||
| 1998 | Ga0496109_0100740 | |||
| 1999 | Ga0496109_0125328 | |||
| 2000 | Ga0496109_0178215 | |||
| 2001 | Ga0496109_0280190 | |||
| 2002 | Ga0496109_0345488 | |||
| 2003 | Ga0496110_0007462 | |||
| 2004 | Ga0496110_0007902 | |||
| 2005 | Ga0496110_0045492 | |||
| 2006 | Ga0496110_0048544 | |||
| 2007 | Ga0496110_0103545 | |||
| 2008 | Ga0496110_0149867 | |||
| 2009 | Ga0496110_0209012 | |||
| 2010 | Ga0496110_0256511 | |||
| 2011 | Ga0496110_0293865 | |||
| 2012 | Ga0496110_0320028 | |||
| 2013 | Ga0496111_0159725 | |||
| 2014 | Ga0496111_0181751 | |||
| 2015 | Ga0496111_0224307 | |||
| 2016 | Ga0496111_0289771 | |||
| 2017 | Ga0496112_0005934 | |||
| 2018 | Ga0496112_0009441 | |||
| 2019 | Ga0496112_0024311 | |||
| 2020 | Ga0496112_0055839 | |||
| 2021 | Ga0496112_0057696 | |||
| 2022 | Ga0496112_0062079 | |||
| 2023 | Ga0496112_0123742 | |||
| 2024 | Ga0496112_0176624 | |||
| 2025 | Ga0496112_0182623 | |||
| 2026 | Ga0496112_0241932 | |||
| 2027 | Ga0496112_0258958 | |||
| 2028 | Ga0496112_0335668 | |||
| 2029 | Ga0496113_0009323 | |||
| 2030 | Ga0496113_0015572 | |||
| 2031 | Ga0496113_0029371 | |||
| 2032 | Ga0496113_0067509 | |||
| 2033 | Ga0496113_0119898 | |||
| 2034 | Ga0496113_0141241 | |||
| 2035 | Ga0496113_0148135 | |||
| 2036 | Ga0496113_0163257 | |||
| 2037 | Ga0496113_0266026 | |||
| 2038 | Ga0496113_0281251 | |||
| 2039 | Ga0496114_0000393 | |||
| 2040 | Ga0496114_0008474 | |||
| 2041 | Ga0496114_0076489 | |||
| 2042 | Ga0496114_0264192 | |||
| 2043 | Ga0496114_0412257 | |||
| 2044 | Ga0496114_0610512 | |||
| 2045 | Ga0496115_0003544 | |||
| 2046 | Ga0496115_0009564 | |||
| 2047 | Ga0496115_0020461 | |||
| 2048 | Ga0496115_0037161 | |||
| 2049 | Ga0496115_0095691 | |||
| 2050 | Ga0496115_0107263 | |||
| 2051 | Ga0496115_0137188 | |||
| 2052 | Ga0496115_0215274 | |||
| 2053 | Ga0496115_0237242 | |||
| 2054 | Ga0496115_0289028 | |||
| 2055 | Ga0496115_0310437 | |||
| 2056 | Ga0496115_0452874 | |||
| 2057 | nmdc:mga03683_53500_c1 | |||
| 2058 | nmdc:mga00v17_246562_c1 | |||
| 2059 | nmdc:mga0yw44_201955_c1 | |||
| 2060 | nmdc:mga06z11_7090_c1 | |||
| 2061 | nmdc:mga05p37_123265_c1 | |||
| 2062 | nmdc:mga05p37_242699_c1 | |||
| 2063 | nmdc:mga05p37_294764_c1 | |||
| 2064 | nmdc:mga05p37_346013_c1 | |||
| 2065 | nmdc:mga05p37_81912_c1 | |||
| 2066 | nmdc:mga09592_10558_c1 | |||
| 2067 | nmdc:mga09592_172394_c1 | |||
| 2068 | nmdc:mga09592_191617_c1 | |||
| 2069 | nmdc:mga09592_47677_c1 | |||
| 2070 | nmdc:mga0qj67_124524_c1 | |||
| 2071 | nmdc:mga0qj67_231675_c1 | |||
| 2072 | nmdc:mga0qj67_244408_c1 | |||
| 2073 | nmdc:mga0qj67_420912_c1 | |||
| 2074 | nmdc:mga0qj67_7378_c1 | |||
| 2075 | nmdc:mga0qj67_96498_c1 | |||
| 2076 | nmdc:mga06r32_231436_c1 | |||
| 2077 | nmdc:mga06r32_425817_c1 | |||
| 2078 | nmdc:mga06r32_51599_c1 | |||
| 2079 | nmdc:mga06r32_55524_c1 | |||
| 2080 | nmdc:mga08y16_121549_c1 | |||
| 2081 | nmdc:mga08y16_286424_c1 | |||
| 2082 | nmdc:mga08y16_289250_c1 | |||
| 2083 | nmdc:mga08y16_36936_c1 | |||
| 2084 | nmdc:mga08y16_40005_c1 | |||
| 2085 | nmdc:mga08y16_406041_c1 | |||
| 2086 | nmdc:mga08y16_513130_c1 | |||
| 2087 | nmdc:mga08y16_79682_c1 | |||
| 2088 | nmdc:mga08y16_8860_c1 | |||
| 2089 | nmdc:mga0n895_183779_c1 | |||
| 2090 | nmdc:mga0n895_229152_c1 | |||
| 2091 | nmdc:mga0n895_295323_c1 | |||
| 2092 | nmdc:mga0n895_367071_c1 | |||
| 2093 | nmdc:mga0n895_4344_c1 | |||
| 2094 | nmdc:mga0n895_51683_c1 | |||
| 2095 | nmdc:mga0n895_5635_c1 | |||
| 2096 | nmdc:mga0a205_1625_c1 | |||
| 2097 | nmdc:mga0a205_39527_c1 | |||
| 2098 | nmdc:mga0a205_399688_c1 | |||
| 2099 | nmdc:mga0a205_430_c1 | |||
| 2100 | Ga0495601_0000460 | |||
| 2101 | Ga0495601_0001261 | |||
| 2102 | Ga0495601_0004351 | |||
| 2103 | Ga0495601_0023396 | |||
| 2104 | Ga0495601_0028968 | |||
| 2105 | Ga0495601_0109477 | |||
| 2106 | Ga0495601_0163979 | |||
| 2107 | Ga0495601_0275172 | |||
| 2108 | Ga0495612_0004070 | |||
| 2109 | Ga0495612_0033627 | |||
| 2110 | Ga0495612_0034504 | |||
| 2111 | Ga0495612_0035781 | |||
| 2112 | Ga0495655_0028869 | |||
| 2113 | Ga0495595_0001469 | |||
| 2114 | Ga0495595_0005222 | |||
| 2115 | Ga0495595_0058823 | |||
| 2116 | Ga0495595_0129127 | |||
| 2117 | Ga0495595_0130670 | |||
| 2118 | Ga0495619_0000510 | |||
| 2119 | Ga0495619_0004909 | |||
| 2120 | Ga0495619_0010695 | |||
| 2121 | Ga0495619_0012092 | |||
| 2122 | Ga0495619_0015380 | |||
| 2123 | Ga0495619_0026643 | |||
| 2124 | Ga0495619_0065065 | |||
| 2125 | Ga0495619_0071606 | |||
| 2126 | Ga0495619_0071642 | |||
| 2127 | Ga0495619_0090495 | |||
| 2128 | Ga0495619_0117418 | |||
| 2129 | Ga0495619_0209721 | |||
| 2130 | Ga0495619_0394560 | |||
| 2131 | Ga0530510_0154780 | |||
| 2132 | 8006990170 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lft-assembly1.cif.gz_A | the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a | 0.9233 | 26 | 323 |
| 3lft-assembly1.cif.gz_A | the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a | 0.9145 | 26 | 323 |
| 3lkv-assembly1.cif.gz_A-2 | crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 | 0.9097 | 24 | 323 |
| 3lkv-assembly1.cif.gz_A-2 | crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 | 0.9068 | 24 | 323 |
| 3lft-assembly2.cif.gz_B | the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a | 0.8903 | 28 | 323 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3lkvA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9345 | 24 | 294 | 3.40.50.2300 |
| 3lkvA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9286 | 24 | 294 | 3.40.50.2300 |
| 3lftB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9188 | 28 | 139 | 3.40.50.2300 |
| 3lftA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8895 | 146 | 323 | 3.40.50.2300 |
| 3lftA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8723 | 146 | 323 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9HTZ8-F1-model_v4 | ABC transporter substrate-binding protein | 0.9889 | 219 | 324 |
|
| AF-A0A537SF60-F1-model_v4 | ABC transporter substrate-binding protein | 0.9816 | 26 | 324 |
|
| AF-A0A537AKZ4-F1-model_v4 | ABC transporter substrate-binding protein | 0.9788 | 239 | 324 |
|
| AF-A0A2V7I331-F1-model_v4 | ABC transporter substrate-binding protein | 0.9752 | 217 | 324 |
|
| AF-A0A537SF60-F1-model_v4 | ABC transporter substrate-binding protein | 0.9751 | 26 | 324 |
|