F489451

General Info

Members Datasets Scaffolds Average Seq Length
1068 354 2132 325

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_443271_c1|nmdc:mga05p37_443271_c1_40_1158
Length 372
Sequence VSPPYSAKSVGSISASTAACRSCARQHPAAALHDCKEAILKRIKRREFITLFGGAAVAWPLAVRAQQPERMRRIGVLAGGAVASDADTQERNAVFAKSLQELGWVIGRNVRIDFRYGLGDAANVRKYVEELVALRPDVVLASGASVLAPLLQATRTVPIVFVAVADPVGAGFVESMARPGGNATGFIQFEYSLSGKWLELLKEIAPGVTRAAILRDPATTAGVGQFAVIQSVASSIGLDVRPVNVRDAGEIERAVTATAGLPNAGLVVTASASSLVHSALIITLAERHKLPAVYPRRSFVAAGGLTSYGFDALDQVRQAAGYIDRILKGDKPANLPVQAPTKYELLINLKTAKALGLDIPATLLARADEVIE

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
5 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
6 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
7 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
8 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
9 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
10 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
11 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
15 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
16 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
19 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
20 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
21 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
22 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
23 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
24 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
25 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
27 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
57 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
58 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
59 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
60 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
61 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
62 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
63 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
64 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
65 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
66 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
69 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
70 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
71 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
72 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
73 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
74 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
75 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
76 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
77 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
80 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
81 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
82 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
83 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
84 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
94 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
95 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
96 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
97 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
98 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
99 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
100 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
101 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
102 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
103 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
104 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
105 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
106 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
107 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
108 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
109 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
110 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
111 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
116 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
117 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
118 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
119 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
123 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
124 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
125 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
126 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
128 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
129 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
138 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
139 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
140 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
153 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
155 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
223 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
227 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
228 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
229 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
230 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
231 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
232 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
233 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
234 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
235 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
236 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
237 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
238 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
239 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
240 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
241 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
242 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
244 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
245 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
246 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
247 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
248 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
249 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
250 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
251 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
252 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
253 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
255 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
256 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
257 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
258 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
259 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
261 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
262 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
263 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
264 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
265 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
266 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
267 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
268 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
269 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
270 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
271 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
272 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
273 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
274 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
275 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
276 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
277 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
278 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
279 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
280 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
281 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
282 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
283 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
284 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
285 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
286 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
287 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
288 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
289 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
290 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
291 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
292 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
293 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
294 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
295 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
296 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
297 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
298 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
299 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
300 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
301 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
302 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
303 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
304 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
305 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
306 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
307 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
308 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
309 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
310 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
311 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
312 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
313 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
314 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
315 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
316 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
317 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
318 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
319 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
320 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
321 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
322 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
323 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
324 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
325 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
326 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
327 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
328 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
329 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
330 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
331 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
332 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
333 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
334 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
335 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
336 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
337 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
338 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
339 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
340 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
341 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
342 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
343 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
344 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
345 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
346 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
347 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
348 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
349 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
350 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
351 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
352 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
353 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
354 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0
Isolates 0.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 13.95
Rhizosphere 85.02
Stem 0
Stem Tuber 0
Unclassified 4.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_443271_c1 3300050507 Bacteria 1505
2 SwRhRL2b_contig_907168 2162886007 Bacteria 1262
3 MBSR1b_contig_12792658 2162886012 Bacteria 986
4 2214628273 2209111006 Bacteria 5074
5 ARcpr5oldR_c000273 3300000041 Bacteria 7860
6 ARSoilYngRDRAFT_c00245 3300000042 Bacteria 8634
7 ARcpr5yngRDRAFT_c000126 3300000043 Bacteria 11973
8 ARSoilOldRDRAFT_c000152 3300000044 Bacteria 11718
9 ARCol0yngRDRAFT_1000342 3300000652 Bacteria 6695
10 JGI24752J21851_1003298 3300001976 Bacteria 2128
11 JGI24746J21847_1000474 3300001977 Bacteria 5984
12 JGI24746J21847_1000629 3300001977 Bacteria 5399
13 JGI24739J22299_10003620 3300001989 Bacteria 5901
14 JGI24739J22299_10004255 3300001989 Bacteria 5480
15 JGI24737J22298_10000062 3300001990 Bacteria 32348
16 JGI24737J22298_10000073 3300001990 Bacteria 29633
17 JGI24737J22298_10019219 3300001990 Bacteria 2186
18 JGI24750J21931_1000377 3300002070 Bacteria 7558
19 JGI24745J21846_1000398 3300002073 Bacteria 3817
20 JGI24745J21846_1002321 3300002073 Unclassified 1934
21 JGI24748J21848_1000480 3300002074 Bacteria 4395
22 JGI24748J21848_1002694 3300002074 Bacteria 2018
23 JGI24738J21930_10000217 3300002075 Bacteria 15544
24 JGI24738J21930_10002341 3300002075 Bacteria 4998
25 JGI24749J21850_1000689 3300002076 Bacteria 4866
26 JGI24749J21850_1000849 3300002076 Bacteria 4401
27 JGI24744J21845_10001417 3300002077 Bacteria 4757
28 JGI24035J26624_1000036 3300002126 Bacteria 9732
29 JGI24035J26624_1000204 3300002126 Bacteria 5367
30 JGI24033J26618_1002646 3300002155 Unclassified 1844
31 JGI24034J26672_10000225 3300002239 Bacteria 7445
32 JGI24034J26672_10001370 3300002239 Bacteria 3225
33 JGI24742J22300_10000032 3300002244 Bacteria 21385
34 JGI24742J22300_10000049 3300002244 Bacteria 17824
35 JGI24751J29686_10003092 3300002459 Bacteria 3352
36 JGI25405J52794_10015577 3300003911 Bacteria 1495
37 Ga0065717_1001953 3300005276 Bacteria 5313
38 Ga0065716_1002765 3300005277 Bacteria 1514
39 Ga0065704_10002996 3300005289 Bacteria 5726
40 Ga0065712_10086330 3300005290 Bacteria 2642
41 Ga0065712_10089240 3300005290 Bacteria 2480
42 Ga0065715_10009470 3300005293 Bacteria 4675
43 Ga0065715_10091967 3300005293 Bacteria 5425
44 Ga0065715_10092041 3300005293 Bacteria 5371
45 Ga0070676_10000251 3300005328 Bacteria 23359
46 Ga0070676_10258621 3300005328 Bacteria 1165
47 Ga0070683_100000344 3300005329 Bacteria 31967
48 Ga0070683_100002231 3300005329 Bacteria 15353
49 Ga0070683_100100054 3300005329 Bacteria 2729
50 Ga0070683_100123307 3300005329 Unclassified 2448
51 Ga0070690_100000588 3300005330 Bacteria 18282
52 Ga0070690_100000616 3300005330 Bacteria 18011
53 Ga0070690_100029125 3300005330 Bacteria 3422
54 Ga0070670_100001740 3300005331 Bacteria 17730
55 Ga0070670_100001768 3300005331 Bacteria 17581
56 Ga0070670_100038401 3300005331 Bacteria 4117
57 Ga0070677_10000076 3300005333 Bacteria 31338
58 Ga0070677_10001576 3300005333 Bacteria 7221
59 Ga0068869_100000078 3300005334 Bacteria 44066
60 Ga0068869_100008854 3300005334 Bacteria 6512
61 Ga0070666_10003799 3300005335 Bacteria 9159
62 Ga0070666_10033485 3300005335 Bacteria 3400
63 Ga0070666_10209024 3300005335 Unclassified 1374
64 Ga0070680_100000333 3300005336 Bacteria 31571
65 Ga0070680_100006554 3300005336 Bacteria 8854
66 Ga0070680_100076036 3300005336 Bacteria 2764
67 Ga0070680_100310650 3300005336 Bacteria 1337
68 Ga0070682_100000285 3300005337 Bacteria 36134
69 Ga0070682_100001569 3300005337 Bacteria 12756
70 Ga0068868_100001627 3300005338 Bacteria 15328
71 Ga0068868_100003400 3300005338 Bacteria 11071
72 Ga0070660_100000474 3300005339 Bacteria 26843
73 Ga0070660_100001115 3300005339 Bacteria 18124
74 Ga0070660_100022012 3300005339 Bacteria 4709
75 Ga0070660_100059229 3300005339 Bacteria 2969
76 Ga0070660_100083185 3300005339 Bacteria 2514
77 Ga0070689_100000252 3300005340 Bacteria 31157
78 Ga0070689_100002086 3300005340 Bacteria 12980
79 Ga0070691_10000476 3300005341 Bacteria 14963
80 Ga0070691_10002482 3300005341 Bacteria 8203
81 Ga0070687_100000476 3300005343 Bacteria 13445
82 Ga0070661_100000605 3300005344 Bacteria 26796
83 Ga0070661_100011032 3300005344 Bacteria 6295
84 Ga0070661_100087137 3300005344 Bacteria 2309
85 Ga0070692_10000127 3300005345 Bacteria 17980
86 Ga0070692_10000227 3300005345 Bacteria 15439
87 Ga0070692_10037540 3300005345 Bacteria 2463
88 Ga0070692_10180539 3300005345 Bacteria 1223
89 Ga0070668_100001035 3300005347 Bacteria 19528
90 Ga0070668_100007791 3300005347 Bacteria 7952
91 Ga0070668_100077010 3300005347 Bacteria 2607
92 Ga0070668_100111172 3300005347 Bacteria 2180
93 Ga0070669_100002096 3300005353 Bacteria 14426
94 Ga0070669_100236895 3300005353 Bacteria 1448
95 Ga0070675_100000522 3300005354 Bacteria 26236
96 Ga0070675_100008366 3300005354 Bacteria 8026
97 Ga0070675_100057814 3300005354 Bacteria 3198
98 Ga0070675_100123510 3300005354 Bacteria 2201
99 Ga0070671_100001132 3300005355 Bacteria 19809
100 Ga0070671_100001344 3300005355 Bacteria 18404
101 Ga0070671_100031885 3300005355 Bacteria 4356
102 Ga0070671_100445550 3300005355 Bacteria 1111
103 Ga0070674_100000240 3300005356 Bacteria 27228
104 Ga0070674_100000603 3300005356 Bacteria 18184
105 Ga0070674_100034347 3300005356 Bacteria 3386
106 Ga0070674_100106942 3300005356 Bacteria 2048
107 Ga0070674_100122367 3300005356 Bacteria 1928
108 Ga0070673_100000164 3300005364 Bacteria 31985
109 Ga0070673_100000666 3300005364 Bacteria 18932
110 Ga0070688_100000162 3300005365 Bacteria 35811
111 Ga0070688_100000961 3300005365 Bacteria 14418
112 Ga0070688_100010001 3300005365 Bacteria 5211
113 Ga0070688_100017036 3300005365 Bacteria 4165
114 Ga0070688_100131813 3300005365 Bacteria 1687
115 Ga0070688_100326582 3300005365 Bacteria 1116
116 Ga0070659_100000720 3300005366 Bacteria 24009
117 Ga0070659_100023047 3300005366 Bacteria 4761
118 Ga0070659_100224466 3300005366 Bacteria 1551
119 Ga0070659_100251249 3300005366 Bacteria 1465
120 Ga0070667_100001046 3300005367 Bacteria 25228
121 Ga0070667_100005648 3300005367 Bacteria 10444
122 Ga0070667_100175685 3300005367 Bacteria 1893
123 Ga0070667_100222406 3300005367 Bacteria 1681
124 Ga0070703_10001840 3300005406 Bacteria 6241
125 Ga0070703_10003412 3300005406 Bacteria 4534
126 Ga0070709_10109983 3300005434 Bacteria 1851
127 Ga0070714_100071576 3300005435 Bacteria 2999
128 Ga0070713_100023176 3300005436 Bacteria 4812
129 Ga0070713_100034835 3300005436 Bacteria 4049
130 Ga0070710_10007557 3300005437 Bacteria 5264
131 Ga0070710_10050308 3300005437 Bacteria 2335
132 Ga0070710_10085609 3300005437 Bacteria 1849
133 Ga0070701_10000860 3300005438 Bacteria 10910
134 Ga0070701_10004311 3300005438 Bacteria 5743
135 Ga0070701_10203060 3300005438 Bacteria 1173
136 Ga0070711_100009305 3300005439 Bacteria 6044
137 Ga0070711_100014237 3300005439 Bacteria 5009
138 Ga0070711_100103672 3300005439 Bacteria 2073
139 Ga0070705_100000321 3300005440 Bacteria 28395
140 Ga0070705_100008646 3300005440 Bacteria 5042
141 Ga0070700_100000654 3300005441 Bacteria 17120
142 Ga0070700_100011814 3300005441 Bacteria 4848
143 Ga0070700_100020746 3300005441 Bacteria 3812
144 Ga0070694_100000554 3300005444 Bacteria 20566
145 Ga0070694_100268475 3300005444 Bacteria 1296
146 Ga0070694_100285896 3300005444 Bacteria 1259
147 Ga0070708_100009300 3300005445 Bacteria 7918
148 Ga0070708_100036023 3300005445 Bacteria 4314
149 Ga0070708_100039455 3300005445 Bacteria 4131
150 Ga0070708_100125601 3300005445 Bacteria 2371
151 Ga0070663_100004739 3300005455 Bacteria 8026
152 Ga0070663_100011128 3300005455 Bacteria 5634
153 Ga0070663_100084630 3300005455 Bacteria 2338
154 Ga0070663_100154433 3300005455 Bacteria 1762
155 Ga0070663_100447617 3300005455 Bacteria 1064
156 Ga0070678_100000228 3300005456 Bacteria 25430
157 Ga0070678_100000570 3300005456 Bacteria 18085
158 Ga0070678_100009473 3300005456 Bacteria 5904
159 Ga0070678_100025375 3300005456 Bacteria 3986
160 Ga0070678_100053064 3300005456 Bacteria 2947
161 Ga0070662_100001178 3300005457 Bacteria 16047
162 Ga0070662_100026848 3300005457 Bacteria 3991
163 Ga0070662_100045270 3300005457 Bacteria 3156
164 Ga0070662_100046488 3300005457 Bacteria 3119
165 Ga0070662_100205836 3300005457 Bacteria 1563
166 Ga0070681_10000446 3300005458 Bacteria 33708
167 Ga0070681_10027394 3300005458 Bacteria 5730
168 Ga0068867_100001229 3300005459 Bacteria 17655
169 Ga0068867_100003347 3300005459 Bacteria 11293
170 Ga0068867_100078925 3300005459 Unclassified 2477
171 Ga0070685_10000768 3300005466 Bacteria 17443
172 Ga0070685_10001094 3300005466 Bacteria 14501
173 Ga0070706_100008477 3300005467 Bacteria 9577
174 Ga0070706_100057654 3300005467 Bacteria 3584
175 Ga0070706_100190833 3300005467 Bacteria 1914
176 Ga0070706_100198167 3300005467 Bacteria 1876
177 Ga0070706_100458086 3300005467 Unclassified 1187
178 Ga0070706_100537033 3300005467 Bacteria 1088
179 Ga0070707_100226693 3300005468 Bacteria 1819
180 Ga0070698_100050289 3300005471 Bacteria 4250
181 Ga0070698_100052632 3300005471 Bacteria 4140
182 Ga0070698_100097098 3300005471 Bacteria 2922
183 Ga0074259_10002483 3300005507 Bacteria 1205
184 Ga0070699_100408392 3300005518 Bacteria 1228
185 Ga0070679_100001839 3300005530 Bacteria 19098
186 Ga0070679_100005106 3300005530 Bacteria 12130
187 Ga0070679_100249166 3300005530 Bacteria 1733
188 Ga0070679_100315649 3300005530 Bacteria 1512
189 Ga0070684_100000411 3300005535 Bacteria 29347
190 Ga0070684_100008904 3300005535 Bacteria 7877
191 Ga0070684_100051289 3300005535 Bacteria 3584
192 Ga0070684_100118415 3300005535 Bacteria 2380
193 Ga0070697_100044711 3300005536 Bacteria 3587
194 Ga0070697_100045090 3300005536 Bacteria 3573
195 Ga0070697_100087885 3300005536 Bacteria 2566
196 Ga0070697_100094651 3300005536 Bacteria 2475
197 Ga0070672_100001539 3300005543 Bacteria 14279
198 Ga0070672_100013692 3300005543 Bacteria 5734
199 Ga0070686_100000379 3300005544 Bacteria 28370
200 Ga0070686_100001252 3300005544 Bacteria 14418
201 Ga0070686_100057138 3300005544 Bacteria 2505
202 Ga0070686_100058334 3300005544 Bacteria 2483
203 Ga0070695_100000294 3300005545 Bacteria 25143
204 Ga0070695_100000341 3300005545 Bacteria 23917
205 Ga0070695_100023224 3300005545 Bacteria 3808
206 Ga0070695_100118133 3300005545 Bacteria 1810
207 Ga0070696_100000594 3300005546 Bacteria 23147
208 Ga0070696_100023629 3300005546 Bacteria 4178
209 Ga0070696_100055145 3300005546 Bacteria 2772
210 Ga0070696_100313823 3300005546 Bacteria 1204
211 Ga0070693_100000031 3300005547 Bacteria 53010
212 Ga0070693_100000345 3300005547 Bacteria 21169
213 Ga0070693_100020113 3300005547 Bacteria 3515
214 Ga0070665_100143954 3300005548 Bacteria 2387
215 Ga0070665_100246968 3300005548 Bacteria 1785
216 Ga0070704_100000481 3300005549 Bacteria 18891
217 Ga0070704_100000911 3300005549 Bacteria 14847
218 Ga0070704_100051612 3300005549 Bacteria 2897
219 Ga0068855_100004006 3300005563 Bacteria 17985
220 Ga0068855_100057969 3300005563 Bacteria 4538
221 Ga0070664_100000874 3300005564 Bacteria 23359
222 Ga0070664_100020100 3300005564 Bacteria 5498
223 Ga0070664_100098089 3300005564 Bacteria 2545
224 Ga0068857_100000249 3300005577 Bacteria 36056
225 Ga0068857_100018629 3300005577 Bacteria 6092
226 Ga0068857_100292332 3300005577 Bacteria 1501
227 Ga0068854_100000146 3300005578 Bacteria 49106
228 Ga0068854_100009557 3300005578 Bacteria 6259
229 Ga0068856_100001251 3300005614 Bacteria 26705
230 Ga0068856_100002466 3300005614 Bacteria 19047
231 Ga0070702_100000134 3300005615 Bacteria 22670
232 Ga0070702_100005638 3300005615 Bacteria 5857
233 Ga0070702_100034973 3300005615 Bacteria 2773
234 Ga0070702_100212870 3300005615 Bacteria 1287
235 Ga0068852_100016912 3300005616 Bacteria 5706
236 Ga0068852_100018965 3300005616 Bacteria 5434
237 Ga0068859_100002043 3300005617 Bacteria 20614
238 Ga0068859_100003259 3300005617 Bacteria 16525
239 Ga0068859_100175910 3300005617 Bacteria 2222
240 Ga0068864_100000674 3300005618 Bacteria 28538
241 Ga0068864_100001986 3300005618 Bacteria 16845
242 Ga0068864_100094332 3300005618 Bacteria 2645
243 Ga0068864_100115595 3300005618 Bacteria 2393
244 Ga0068866_10000348 3300005718 Bacteria 21747
245 Ga0068866_10000557 3300005718 Bacteria 17018
246 Ga0068861_100000958 3300005719 Bacteria 17568
247 Ga0068861_100003474 3300005719 Bacteria 10457
248 Ga0068870_10000032 3300005840 Bacteria 44525
249 Ga0068870_10000115 3300005840 Bacteria 27156
250 Ga0068870_10174368 3300005840 Bacteria 1286
251 Ga0068863_100000150 3300005841 Bacteria 72968
252 Ga0068863_100003793 3300005841 Bacteria 14944
253 Ga0068863_100426209 3300005841 Bacteria 1300
254 Ga0068858_100004191 3300005842 Bacteria 14194
255 Ga0068858_100009937 3300005842 Bacteria 9039
256 Ga0068858_100112167 3300005842 Bacteria 2547
257 Ga0068858_100145530 3300005842 Bacteria 2225
258 Ga0068858_100170093 3300005842 Bacteria 2054
259 Ga0068858_100214853 3300005842 Bacteria 1820
260 Ga0068860_100006010 3300005843 Bacteria 12217
261 Ga0068860_100018645 3300005843 Bacteria 6749
262 Ga0068860_100027186 3300005843 Bacteria 5512
263 Ga0068860_100384724 3300005843 Bacteria 1385
264 Ga0068860_100517880 3300005843 Bacteria 1192
265 Ga0068862_100001121 3300005844 Bacteria 25430
266 Ga0068862_100011074 3300005844 Bacteria 7450
267 Ga0068862_100020884 3300005844 Bacteria 5470
268 Ga0068862_100381384 3300005844 Bacteria 1315
269 Ga0081455_10015729 3300005937 Bacteria 7333
270 Ga0081455_10019828 3300005937 Bacteria 6351
271 Ga0081455_10048669 3300005937 Bacteria 3661
272 Ga0081455_10059262 3300005937 Bacteria 3234
273 Ga0081455_10087603 3300005937 Bacteria 2533
274 Ga0070717_10016433 3300006028 Bacteria 5737
275 Ga0070717_10018063 3300006028 Bacteria 5501
276 Ga0070717_10138468 3300006028 Bacteria 2098
277 Ga0070717_10148079 3300006028 Bacteria 2029
278 Ga0070717_10362541 3300006028 Bacteria 1297
279 Ga0070717_10370530 3300006028 Bacteria 1283
280 Ga0075365_10039910 3300006038 Bacteria 3059
281 Ga0075365_10064947 3300006038 Bacteria 2446
282 Ga0075365_10211164 3300006038 Bacteria 1361
283 Ga0075432_10033002 3300006058 Bacteria 1794
284 Ga0070715_10006272 3300006163 Bacteria 4030
285 Ga0070716_100145792 3300006173 Bacteria 1516
286 Ga0070712_100039213 3300006175 Unclassified 3241
287 Ga0070712_100196062 3300006175 Bacteria 1583
288 Ga0075362_10097929 3300006177 Bacteria 1368
289 Ga0097621_100001205 3300006237 Bacteria 17920
290 Ga0097621_100001322 3300006237 Bacteria 17053
291 Ga0097621_100003473 3300006237 Bacteria 10866
292 Ga0068871_100000676 3300006358 Bacteria 23320
293 Ga0068871_100001279 3300006358 Bacteria 16811
294 Ga0068871_100005001 3300006358 Bacteria 9264
295 Ga0068871_100263330 3300006358 Bacteria 1504
296 Ga0075428_100064067 3300006844 Bacteria 4025
297 Ga0075428_100070279 3300006844 Bacteria 3827
298 Ga0075428_100134538 3300006844 Bacteria 2688
299 Ga0075428_100249558 3300006844 Bacteria 1913
300 Ga0075428_100352555 3300006844 Bacteria 1579
301 Ga0075428_100711459 3300006844 Unclassified 1070
302 Ga0075430_100126811 3300006846 Bacteria 2127
303 Ga0075431_100065799 3300006847 Bacteria 3742
304 Ga0075431_100119293 3300006847 Bacteria 2722
305 Ga0075431_100469939 3300006847 Bacteria 1251
306 Ga0075433_10000718 3300006852 Bacteria 22669
307 Ga0075433_10044101 3300006852 Bacteria 3874
308 Ga0075433_10426040 3300006852 Bacteria 1170
309 Ga0075434_100002238 3300006871 Bacteria 16906
310 Ga0075434_100003393 3300006871 Bacteria 14264
311 Ga0075434_100057976 3300006871 Bacteria 3849
312 Ga0075434_100085099 3300006871 Unclassified 3161
313 Ga0075434_100239695 3300006871 Bacteria 1834
314 Ga0075434_100374436 3300006871 Bacteria 1445
315 Ga0075429_100056298 3300006880 Bacteria 3422
316 Ga0075429_100112230 3300006880 Bacteria 2382
317 Ga0075429_100213992 3300006880 Unclassified 1688
318 Ga0075429_100342136 3300006880 Bacteria 1309
319 Ga0068865_100000085 3300006881 Bacteria 50007
320 Ga0068865_100000348 3300006881 Bacteria 25590
321 Ga0068865_100076507 3300006881 Bacteria 2389
322 Ga0068865_100341889 3300006881 Bacteria 1210
323 Ga0097620_100002042 3300006931 Bacteria 20614
324 Ga0097620_100003259 3300006931 Bacteria 16525
325 Ga0097620_100175898 3300006931 Bacteria 2222
326 Ga0075435_100102202 3300007076 Bacteria 2376
327 Ga0099795_10006038 3300007788 Bacteria 3272
328 Ga0105244_10083655 3300009036 Unclassified 1576
329 Ga0105250_10069850 3300009092 Bacteria 1418
330 Ga0111539_10001107 3300009094 Bacteria 35545
331 Ga0111539_10001814 3300009094 Bacteria 28447
332 Ga0111539_10034613 3300009094 Bacteria 6121
333 Ga0111539_10166030 3300009094 Bacteria 2581
334 Ga0111539_10233437 3300009094 Bacteria 2141
335 Ga0111539_10384088 3300009094 Unclassified 1635
336 Ga0111539_10567241 3300009094 Bacteria 1322
337 Ga0111539_10571092 3300009094 Bacteria 1317
338 Ga0105245_10000235 3300009098 Bacteria 52697
339 Ga0105245_10002164 3300009098 Bacteria 17800
340 Ga0105245_10133701 3300009098 Bacteria 2329
341 Ga0105247_10070818 3300009101 Bacteria 2179
342 Ga0114129_10086876 3300009147 Bacteria 4337
343 Ga0114129_10239574 3300009147 Unclassified 2439
344 Ga0114129_10733320 3300009147 Bacteria 1267
345 Ga0105243_10001256 3300009148 Bacteria 22778
346 Ga0105243_10009126 3300009148 Bacteria 7573
347 Ga0105243_10024145 3300009148 Bacteria 4636
348 Ga0105243_10075283 3300009148 Bacteria 2740
349 Ga0105243_10101070 3300009148 Bacteria 2394
350 Ga0105241_10000414 3300009174 Bacteria 32305
351 Ga0105241_10000702 3300009174 Bacteria 25327
352 Ga0105242_10000134 3300009176 Bacteria 53681
353 Ga0105242_10001674 3300009176 Bacteria 17536
354 Ga0105242_10316978 3300009176 Unclassified 1429
355 Ga0105242_10451255 3300009176 Bacteria 1212
356 Ga0105248_10001347 3300009177 Bacteria 27377
357 Ga0105248_10003880 3300009177 Bacteria 16526
358 Ga0105248_10474452 3300009177 Unclassified 1410
359 Ga0105237_10012335 3300009545 Bacteria 9004
360 Ga0105237_10039808 3300009545 Bacteria 4742
361 Ga0105237_10163133 3300009545 Bacteria 2227
362 Ga0105238_10151943 3300009551 Unclassified 2290
363 Ga0105249_10000325 3300009553 Bacteria 48220
364 Ga0105249_10000627 3300009553 Bacteria 32165
365 Ga0105249_10155371 3300009553 Bacteria 2206
366 Ga0105249_10355796 3300009553 Bacteria 1484
367 Ga0105249_10564967 3300009553 Bacteria 1190
368 Ga0105239_10002328 3300010375 Bacteria 24247
369 Ga0105239_10004832 3300010375 Bacteria 15955
370 Ga0105239_10039843 3300010375 Bacteria 5147
371 Ga0105239_10377058 3300010375 Bacteria 1603
372 Ga0105246_10000041 3300011119 Bacteria 48215
373 Ga0105246_10000168 3300011119 Bacteria 31687
374 Ga0157373_10010744 3300013100 Bacteria 6737
375 Ga0157373_10016002 3300013100 Bacteria 5476
376 Ga0157371_10006558 3300013102 Bacteria 9569
377 Ga0157371_10015556 3300013102 Bacteria 5705
378 Ga0157374_10002115 3300013296 Bacteria 16708
379 Ga0157374_10033139 3300013296 Bacteria 4711
380 Ga0157374_10033189 3300013296 Bacteria 4708
381 Ga0157374_10153782 3300013296 Bacteria 2238
382 Ga0157378_10000434 3300013297 Bacteria 40722
383 Ga0163162_10006347 3300013306 Bacteria 11447
384 Ga0163162_10007869 3300013306 Bacteria 10384
385 Ga0163162_10029055 3300013306 Bacteria 5471
386 Ga0163162_10224025 3300013306 Bacteria 2010
387 Ga0163162_10230871 3300013306 Bacteria 1981
388 Ga0163162_10297104 3300013306 Bacteria 1747
389 Ga0163162_10439316 3300013306 Bacteria 1437
390 Ga0163162_10554047 3300013306 Bacteria 1278
391 Ga0163162_10634260 3300013306 Bacteria 1193
392 Ga0163162_10765485 3300013306 Bacteria 1084
393 Ga0157372_10006948 3300013307 Bacteria 12050
394 Ga0157372_10022013 3300013307 Bacteria 6892
395 Ga0157372_10418443 3300013307 Bacteria 1562
396 Ga0157375_10000181 3300013308 Bacteria 59305
397 Ga0157375_10002241 3300013308 Bacteria 16722
398 Ga0157375_10018144 3300013308 Bacteria 6376
399 Ga0157375_10028214 3300013308 Bacteria 5258
400 Ga0157375_10035469 3300013308 Bacteria 4761
401 Ga0157375_10048041 3300013308 Bacteria 4172
402 Ga0157375_10188920 3300013308 Bacteria 2214
403 Ga0157375_10778888 3300013308 Bacteria 1106
404 Ga0163163_10017949 3300014325 Bacteria 6610
405 Ga0163163_10029491 3300014325 Bacteria 5278
406 Ga0163163_10033676 3300014325 Bacteria 4957
407 Ga0163163_10144482 3300014325 Bacteria 2422
408 Ga0163163_10157443 3300014325 Bacteria 2316
409 Ga0157380_10001449 3300014326 Bacteria 15528
410 Ga0157380_10271538 3300014326 Bacteria 1546
411 Ga0157377_10000101 3300014745 Bacteria 60248
412 Ga0157377_10000284 3300014745 Bacteria 24258
413 Ga0157379_10000364 3300014968 Bacteria 36402
414 Ga0157379_10000554 3300014968 Bacteria 30160
415 Ga0157379_10066772 3300014968 Bacteria 3216
416 Ga0157379_10120313 3300014968 Bacteria 2362
417 Ga0157379_10436707 3300014968 Bacteria 1207
418 Ga0157376_10000142 3300014969 Bacteria 49085
419 Ga0157376_10001203 3300014969 Bacteria 17062
420 Ga0157376_10049164 3300014969 Bacteria 3492
421 Ga0157376_10065221 3300014969 Bacteria 3074
422 Ga0157376_10066488 3300014969 Bacteria 3047
423 Ga0157376_10127807 3300014969 Unclassified 2263
424 Ga0157376_10284061 3300014969 Bacteria 1560
425 Ga0163161_10000081 3300017792 Bacteria 97213
426 Ga0163161_10018167 3300017792 Bacteria 4930
427 Ga0163161_10351564 3300017792 Bacteria 1172
428 Ga0213876_10057756 3300021384 Unclassified 2049
429 Ga0207666_1000031 3300025271 Bacteria 30080
430 Ga0207666_1000042 3300025271 Bacteria 25183
431 Ga0207673_1000069 3300025290 Bacteria 8882
432 Ga0207673_1000121 3300025290 Bacteria 7344
433 Ga0207697_10000045 3300025315 Bacteria 48192
434 Ga0207697_10000416 3300025315 Bacteria 24126
435 Ga0207697_10006171 3300025315 Bacteria 5464
436 Ga0207653_10004447 3300025885 Bacteria 4396
437 Ga0207653_10007306 3300025885 Bacteria 3444
438 Ga0207682_10000153 3300025893 Bacteria 31273
439 Ga0207682_10000314 3300025893 Bacteria 21994
440 Ga0207692_10018416 3300025898 Bacteria 3135
441 Ga0207692_10063838 3300025898 Bacteria 1915
442 Ga0207692_10077256 3300025898 Bacteria 1771
443 Ga0207692_10118336 3300025898 Bacteria 1480
444 Ga0207642_10000262 3300025899 Bacteria 15798
445 Ga0207642_10000438 3300025899 Bacteria 12594
446 Ga0207710_10006396 3300025900 Bacteria 5034
447 Ga0207710_10037976 3300025900 Bacteria 2128
448 Ga0207688_10000044 3300025901 Bacteria 43600
449 Ga0207688_10000606 3300025901 Bacteria 17657
450 Ga0207688_10023542 3300025901 Bacteria 3373
451 Ga0207680_10001543 3300025903 Bacteria 10843
452 Ga0207680_10058823 3300025903 Bacteria 2331
453 Ga0207647_10001666 3300025904 Bacteria 17115
454 Ga0207647_10004187 3300025904 Bacteria 10699
455 Ga0207647_10087508 3300025904 Unclassified 1861
456 Ga0207685_10050462 3300025905 Bacteria 1603
457 Ga0207685_10069725 3300025905 Unclassified 1421
458 Ga0207699_10030946 3300025906 Bacteria 3001
459 Ga0207699_10185382 3300025906 Bacteria 1401
460 Ga0207645_10000945 3300025907 Bacteria 24123
461 Ga0207645_10001816 3300025907 Bacteria 17211
462 Ga0207645_10218126 3300025907 Bacteria 1257
463 Ga0207643_10000025 3300025908 Bacteria 101583
464 Ga0207643_10000345 3300025908 Bacteria 31495
465 Ga0207684_10006956 3300025910 Bacteria 10232
466 Ga0207684_10011951 3300025910 Bacteria 7563
467 Ga0207684_10022595 3300025910 Bacteria 5369
468 Ga0207684_10024910 3300025910 Bacteria 5099
469 Ga0207684_10040998 3300025910 Bacteria 3926
470 Ga0207684_10145035 3300025910 Bacteria 2042
471 Ga0207684_10149198 3300025910 Bacteria 2012
472 Ga0207654_10001478 3300025911 Bacteria 12419
473 Ga0207654_10008394 3300025911 Bacteria 5217
474 Ga0207707_10001635 3300025912 Bacteria 20673
475 Ga0207707_10018614 3300025912 Bacteria 6054
476 Ga0207671_10023238 3300025914 Bacteria 4677
477 Ga0207671_10038138 3300025914 Bacteria 3561
478 Ga0207693_10018855 3300025915 Bacteria 5492
479 Ga0207693_10034249 3300025915 Bacteria 4007
480 Ga0207693_10040180 3300025915 Bacteria 3684
481 Ga0207693_10142078 3300025915 Bacteria 1887
482 Ga0207693_10204987 3300025915 Bacteria 1551
483 Ga0207663_10019695 3300025916 Bacteria 3807
484 Ga0207663_10026811 3300025916 Bacteria 3349
485 Ga0207663_10028158 3300025916 Bacteria 3285
486 Ga0207663_10400450 3300025916 Bacteria 1050
487 Ga0207660_10000131 3300025917 Bacteria 44091
488 Ga0207660_10000318 3300025917 Bacteria 31519
489 Ga0207660_10071944 3300025917 Bacteria 2517
490 Ga0207660_10280266 3300025917 Bacteria 1323
491 Ga0207662_10000100 3300025918 Bacteria 40845
492 Ga0207662_10000668 3300025918 Bacteria 15585
493 Ga0207657_10000699 3300025919 Bacteria 35613
494 Ga0207657_10003089 3300025919 Bacteria 17820
495 Ga0207657_10049279 3300025919 Bacteria 3672
496 Ga0207657_10076905 3300025919 Bacteria 2815
497 Ga0207657_10093242 3300025919 Bacteria 2508
498 Ga0207649_10000310 3300025920 Bacteria 37179
499 Ga0207649_10001217 3300025920 Bacteria 15478
500 Ga0207649_10002591 3300025920 Bacteria 10046
501 Ga0207652_10000785 3300025921 Bacteria 30331
502 Ga0207652_10007477 3300025921 Bacteria 8804
503 Ga0207652_10012572 3300025921 Bacteria 6842
504 Ga0207652_10101697 3300025921 Bacteria 2539
505 Ga0207681_10000131 3300025923 Bacteria 61025
506 Ga0207681_10001247 3300025923 Bacteria 16409
507 Ga0207681_10025153 3300025923 Bacteria 3827
508 Ga0207681_10094541 3300025923 Bacteria 2142
509 Ga0207694_10079794 3300025924 Bacteria 2567
510 Ga0207650_10002469 3300025925 Bacteria 12857
511 Ga0207650_10007605 3300025925 Bacteria 7386
512 Ga0207650_10039061 3300025925 Bacteria 3469
513 Ga0207659_10000040 3300025926 Bacteria 91375
514 Ga0207659_10001096 3300025926 Bacteria 16028
515 Ga0207687_10000122 3300025927 Bacteria 52776
516 Ga0207687_10001549 3300025927 Bacteria 15786
517 Ga0207687_10283911 3300025927 Bacteria 1328
518 Ga0207700_10009919 3300025928 Bacteria 5977
519 Ga0207700_10131826 3300025928 Bacteria 2042
520 Ga0207700_10192672 3300025928 Bacteria 1714
521 Ga0207700_10421931 3300025928 Bacteria 1172
522 Ga0207664_10063010 3300025929 Bacteria 2963
523 Ga0207664_10135631 3300025929 Bacteria 2077
524 Ga0207644_10000393 3300025931 Bacteria 28466
525 Ga0207644_10000828 3300025931 Bacteria 19684
526 Ga0207690_10000277 3300025932 Bacteria 36311
527 Ga0207690_10001276 3300025932 Bacteria 15910
528 Ga0207690_10307509 3300025932 Bacteria 1242
529 Ga0207706_10000311 3300025933 Bacteria 52676
530 Ga0207706_10001343 3300025933 Bacteria 24573
531 Ga0207706_10039346 3300025933 Bacteria 4192
532 Ga0207706_10070126 3300025933 Bacteria 3082
533 Ga0207706_10100063 3300025933 Bacteria 2551
534 Ga0207686_10000407 3300025934 Bacteria 29845
535 Ga0207686_10002434 3300025934 Bacteria 10135
536 Ga0207709_10000322 3300025935 Bacteria 51855
537 Ga0207709_10000591 3300025935 Bacteria 30303
538 Ga0207709_10065022 3300025935 Bacteria 2292
539 Ga0207709_10234801 3300025935 Bacteria 1330
540 Ga0207670_10000240 3300025936 Bacteria 34666
541 Ga0207670_10000509 3300025936 Bacteria 21378
542 Ga0207669_10000191 3300025937 Bacteria 27739
543 Ga0207669_10000484 3300025937 Bacteria 17278
544 Ga0207669_10231076 3300025937 Bacteria 1364
545 Ga0207669_10305221 3300025937 Bacteria 1211
546 Ga0207704_10000071 3300025938 Bacteria 64527
547 Ga0207704_10000289 3300025938 Bacteria 23781
548 Ga0207704_10211853 3300025938 Bacteria 1427
549 Ga0207704_10318896 3300025938 Bacteria 1198
550 Ga0207665_10078058 3300025939 Bacteria 2274
551 Ga0207665_10085025 3300025939 Bacteria 2184
552 Ga0207665_10424939 3300025939 Bacteria 1016
553 Ga0207691_10000257 3300025940 Bacteria 52675
554 Ga0207691_10001202 3300025940 Bacteria 25777
555 Ga0207711_10002577 3300025941 Bacteria 16126
556 Ga0207711_10017003 3300025941 Bacteria 6041
557 Ga0207689_10000134 3300025942 Bacteria 62937
558 Ga0207689_10001584 3300025942 Bacteria 21550
559 Ga0207661_10000191 3300025944 Bacteria 39865
560 Ga0207661_10001224 3300025944 Bacteria 17178
561 Ga0207661_10058414 3300025944 Bacteria 3104
562 Ga0207679_10000099 3300025945 Bacteria 74047
563 Ga0207679_10003586 3300025945 Bacteria 9618
564 Ga0207679_10005866 3300025945 Bacteria 7715
565 Ga0207667_10034555 3300025949 Bacteria 5428
566 Ga0207667_10048127 3300025949 Bacteria 4510
567 Ga0207651_10000017 3300025960 Bacteria 100256
568 Ga0207651_10000393 3300025960 Bacteria 18535
569 Ga0207712_10000114 3300025961 Bacteria 87261
570 Ga0207712_10000591 3300025961 Bacteria 29086
571 Ga0207712_10007853 3300025961 Bacteria 6745
572 Ga0207712_10420943 3300025961 Bacteria 1127
573 Ga0207668_10001667 3300025972 Bacteria 12978
574 Ga0207668_10002065 3300025972 Bacteria 11713
575 Ga0207668_10075803 3300025972 Bacteria 2419
576 Ga0207640_10000336 3300025981 Bacteria 31122
577 Ga0207640_10000604 3300025981 Bacteria 21239
578 Ga0207658_10001624 3300025986 Bacteria 17240
579 Ga0207658_10011285 3300025986 Bacteria 6084
580 Ga0207677_10000412 3300026023 Bacteria 29138
581 Ga0207677_10000974 3300026023 Bacteria 15834
582 Ga0207677_10148370 3300026023 Bacteria 1805
583 Ga0207703_10000863 3300026035 Bacteria 29696
584 Ga0207639_10000646 3300026041 Bacteria 24015
585 Ga0207639_10001290 3300026041 Bacteria 16909
586 Ga0207639_10339432 3300026041 Bacteria 1339
587 Ga0207678_10000131 3300026067 Bacteria 62864
588 Ga0207678_10001120 3300026067 Bacteria 24572
589 Ga0207678_10058037 3300026067 Bacteria 3331
590 Ga0207678_10280703 3300026067 Bacteria 1429
591 Ga0207708_10000192 3300026075 Bacteria 48193
592 Ga0207708_10001629 3300026075 Bacteria 16704
593 Ga0207708_10003560 3300026075 Bacteria 11481
594 Ga0207702_10002469 3300026078 Bacteria 17505
595 Ga0207702_10003256 3300026078 Bacteria 15000
596 Ga0207641_10000246 3300026088 Bacteria 70235
597 Ga0207641_10003176 3300026088 Bacteria 14699
598 Ga0207641_10008853 3300026088 Bacteria 8310
599 Ga0207648_10001831 3300026089 Bacteria 23254
600 Ga0207648_10006095 3300026089 Bacteria 12027
601 Ga0207648_10061876 3300026089 Bacteria 3264
602 Ga0207648_10271720 3300026089 Bacteria 1514
603 Ga0207676_10001655 3300026095 Bacteria 16413
604 Ga0207676_10002691 3300026095 Bacteria 12634
605 Ga0207676_10004872 3300026095 Bacteria 9501
606 Ga0207676_10100626 3300026095 Bacteria 2395
607 Ga0207676_10418017 3300026095 Unclassified 1257
608 Ga0207674_10000355 3300026116 Bacteria 59230
609 Ga0207674_10001638 3300026116 Bacteria 28820
610 Ga0207674_10074643 3300026116 Bacteria 3402
611 Ga0207675_100001893 3300026118 Bacteria 20920
612 Ga0207675_100006563 3300026118 Bacteria 11010
613 Ga0207675_100433759 3300026118 Bacteria 1300
614 Ga0207683_10000924 3300026121 Bacteria 26999
615 Ga0207683_10002127 3300026121 Bacteria 17404
616 Ga0207683_10017822 3300026121 Bacteria 6057
617 Ga0207683_10035097 3300026121 Bacteria 4362
618 Ga0207683_10454663 3300026121 Bacteria 1181
619 Ga0207698_10001234 3300026142 Bacteria 14949
620 Ga0207698_10012369 3300026142 Bacteria 5581
621 Ga0210002_1002756 3300027617 Bacteria 2549
622 Ga0210002_1003909 3300027617 Bacteria 2211
623 Ga0209998_10000477 3300027717 Bacteria 11041
624 Ga0209998_10002044 3300027717 Bacteria 4733
625 Ga0209998_10012552 3300027717 Bacteria 1759
626 Ga0209974_10010866 3300027876 Bacteria 3065
627 Ga0209974_10029499 3300027876 Bacteria 1817
628 Ga0207428_10000469 3300027907 Bacteria 48709
629 Ga0207428_10000944 3300027907 Bacteria 32301
630 Ga0207428_10043183 3300027907 Bacteria 3643
631 Ga0207428_10058774 3300027907 Bacteria 3050
632 Ga0207428_10082724 3300027907 Bacteria 2505
633 Ga0207428_10087049 3300027907 Bacteria 2431
634 Ga0207428_10111715 3300027907 Bacteria 2103
635 Ga0268266_10247949 3300028379 Bacteria 1646
636 Ga0268266_10555713 3300028379 Bacteria 1100
637 Ga0268265_10000312 3300028380 Bacteria 53940
638 Ga0268265_10001746 3300028380 Bacteria 17480
639 Ga0268265_10100349 3300028380 Bacteria 2336
640 Ga0268265_10282753 3300028380 Bacteria 1485
641 Ga0268264_10000412 3300028381 Bacteria 60566
642 Ga0268264_10000751 3300028381 Bacteria 36543
643 Ga0268264_10309421 3300028381 Bacteria 1490
644 Ga0373930_0002725 3300034816 Bacteria 2755
645 Ga0373930_0026828 3300034816 Unclassified 1163
646 Ga0373948_0012313 3300034817 Bacteria 1525
647 Ga0373950_0000747 3300034818 Bacteria 4043
648 Ga0373950_0003891 3300034818 Bacteria 2166
649 Ga0373950_0007394 3300034818 Unclassified 1704
650 Ga0373958_0002202 3300034819 Bacteria 2707
651 Ga0373959_0001785 3300034820 Bacteria 3433
652 Ga0373959_0003277 3300034820 Bacteria 2573
653 Ga0373959_0005041 3300034820 Bacteria 2156
654 Ga0373938_0000291 3300034957 Bacteria 8081
655 Ga0373938_0000451 3300034957 Bacteria 6711
656 Ga0373938_0009384 3300034957 Bacteria 1771
657 Ga0373926_0056981 3300035083 Bacteria 1418
658 Ga0373928_0000699 3300035084 Bacteria 6584
659 Ga0373928_0000806 3300035084 Bacteria 6105
660 Ga0373928_0001248 3300035084 Bacteria 5002
661 Ga0373929_0002281 3300035085 Bacteria 3538
662 Ga0373929_0003591 3300035085 Bacteria 2785
663 Ga0373934_0148708 3300035086 Unclassified 959
664 Ga0373940_0000652 3300035088 Bacteria 5546
665 Ga0373940_0002233 3300035088 Bacteria 3724
666 Ga0373944_0038153 3300035089 Bacteria 1474
667 Ga0373944_0038397 3300035089 Bacteria 1470
668 Ga0373949_0000392 3300035090 Bacteria 15288
669 Ga0373949_0001594 3300035090 Bacteria 6385
670 Ga0373949_0003455 3300035090 Bacteria 3757
671 Ga0373951_0001947 3300035091 Bacteria 5303
672 Ga0373951_0003618 3300035091 Bacteria 3727
673 Ga0373951_0006289 3300035091 Bacteria 2717
674 Ga0373951_0032553 3300035091 Bacteria 1233
675 Ga0373952_0000672 3300035092 Bacteria 6055
676 Ga0373952_0003009 3300035092 Bacteria 3043
677 Ga0373952_0004332 3300035092 Bacteria 2572
678 Ga0373932_0000911 3300035112 Bacteria 8629
679 Ga0373932_0001306 3300035112 Bacteria 7024
680 Ga0373932_0001480 3300035112 Bacteria 6562
681 Ga0373932_0028131 3300035112 Bacteria 1543
682 Ga0373936_0093230 3300035113 Unclassified 1264
683 Ga0373936_0112666 3300035113 Bacteria 1156
684 Ga0373939_0000964 3300035114 Bacteria 7176
685 Ga0373939_0002528 3300035114 Bacteria 4300
686 Ga0373941_0014017 3300035115 Bacteria 2132
687 Ga0373945_0053259 3300035116 Bacteria 1493
688 Ga0373960_0000113 3300035121 Bacteria 12996
689 Ga0373960_0000122 3300035121 Bacteria 12600
690 Ga0373960_0014695 3300035121 Bacteria 1987
691 Ga0373960_0029149 3300035121 Bacteria 1528
692 Ga0373943_0036157 3300035170 Bacteria 2364
693 Ga0373943_0062481 3300035170 Bacteria 1864
694 Ga0373943_0185171 3300035170 Bacteria 1146
695 Ga0373946_0020814 3300035171 Unclassified 2538
696 Ga0373946_0061598 3300035171 Bacteria 1598
697 Ga0373955_0205170 3300035172 Bacteria 1174
698 Ga0373942_0001003 3300035207 Bacteria 7678
699 Ga0373942_0001784 3300035207 Bacteria 5456
700 Ga0373961_0001327 3300035241 Bacteria 7481
701 Ga0373961_0001691 3300035241 Bacteria 6154
702 Ga0373961_0024677 3300035241 Unclassified 1628
703 Ga0373962_0000343 3300035242 Bacteria 10212
704 Ga0373962_0000914 3300035242 Bacteria 6773
705 Ga0373924_0021933 3300035410 Bacteria 2493
706 Ga0373924_0152741 3300035410 Bacteria 1010
707 Ga0373931_0000167 3300035691 Bacteria 28656
708 Ga0373931_0000193 3300035691 Bacteria 26005
709 Ga0373931_0009928 3300035691 Bacteria 4562
710 Ga0373935_0023315 3300035692 Bacteria 3803
711 Ga0373935_0049751 3300035692 Bacteria 2658
712 Ga0373935_0165354 3300035692 Bacteria 1510
713 Ga0373927_0022362 3300035695 Bacteria 4142
714 Ga0373927_0090463 3300035695 Bacteria 1987
715 Ga0373927_0159661 3300035695 Bacteria 1477
716 Ga0373947_0011799 3300035725 Bacteria 5006
717 Ga0373947_0044615 3300035725 Bacteria 2651
718 Ga0373947_0045319 3300035725 Bacteria 2631
719 Ga0373947_0082365 3300035725 Bacteria 1994
720 Ga0373947_0086380 3300035725 Bacteria 1950
721 Ga0373937_0059073 3300036401 Bacteria 3524
722 Ga0373937_0122906 3300036401 Bacteria 2420
723 Ga0373937_0247053 3300036401 Bacteria 1682
724 Ga0373925_0031270 3300037068 Bacteria 3911
725 Ga0373925_0310229 3300037068 Bacteria 1275
726 Ga0373925_0362878 3300037068 Unclassified 1178
727 Ga0395898_0235992 3300037466 Bacteria 1744
728 Ga0436365_1532142 3300039437 Bacteria 7042
729 Ga0436361_1076743 3300039447 Bacteria 1199
730 Ga0453683_0162092 3300044673 Unclassified 1415
731 Ga0451576_0049352 3300045051 Bacteria 4416
732 Ga0495592_0156562 3300046454 Unclassified 1571
733 Ga0495603_0005382 3300046455 Bacteria 7636
734 Ga0495603_0017639 3300046455 Bacteria 4322
735 Ga0495603_0040560 3300046455 Bacteria 2786
736 Ga0495603_0119747 3300046455 Bacteria 1534
737 Ga0495603_0170150 3300046455 Bacteria 1262
738 Ga0495629_0029834 3300046459 Bacteria 3866
739 Ga0495629_0048458 3300046459 Bacteria 2978
740 Ga0495629_0164630 3300046459 Bacteria 1540
741 Ga0495641_0100327 3300046461 Bacteria 1292
742 Ga0495651_0019246 3300046462 Bacteria 5291
743 Ga0495651_0200175 3300046462 Bacteria 1398
744 Ga0495651_0308791 3300046462 Unclassified 1058
745 Ga0495653_0016063 3300046463 Bacteria 6102
746 Ga0495653_0083268 3300046463 Bacteria 2359
747 Ga0495580_0100719 3300046472 Bacteria 2009
748 Ga0495582_0162255 3300046473 Bacteria 1271
749 Ga0495605_0100071 3300046474 Bacteria 1334
750 Ga0495639_0099704 3300046475 Bacteria 1370
751 Ga0495662_0078172 3300046476 Bacteria 1607
752 Ga0495664_0005448 3300046477 Bacteria 6992
753 Ga0495664_0076048 3300046477 Bacteria 2009
754 Ga0495664_0131924 3300046477 Bacteria 1513
755 Ga0495584_0065402 3300046491 Bacteria 1829
756 Ga0495584_0093404 3300046491 Bacteria 1518
757 Ga0495585_0040957 3300046492 Bacteria 2599
758 Ga0495585_0110686 3300046492 Bacteria 1461
759 Ga0495594_0046100 3300046499 Bacteria 2393
760 Ga0495594_0046429 3300046499 Bacteria 2386
761 Ga0495607_0168592 3300046501 Bacteria 1107
762 Ga0495608_0112061 3300046511 Bacteria 1754
763 Ga0495616_0074252 3300046513 Bacteria 1639
764 Ga0495616_0091125 3300046513 Bacteria 1443
765 Ga0495618_0012254 3300046514 Bacteria 5205
766 Ga0495618_0030381 3300046514 Bacteria 3374
767 Ga0495628_0049888 3300046516 Bacteria 3312
768 Ga0495630_0087518 3300046517 Bacteria 2352
769 Ga0495644_0062421 3300046523 Bacteria 1400
770 Ga0495663_0016027 3300046525 Bacteria 2117
771 Ga0495666_0043970 3300046526 Bacteria 2157
772 Ga0495666_0130769 3300046526 Unclassified 1173
773 Ga0495652_0071490 3300046529 Bacteria 2896
774 Ga0495652_0192332 3300046529 Bacteria 1556
775 Ga0495652_0277545 3300046529 Bacteria 1229
776 Ga0495665_0073291 3300046531 Bacteria 1803
777 Ga0495640_0038504 3300046533 Bacteria 3363
778 Ga0495640_0054226 3300046533 Bacteria 2747
779 Ga0495640_0093618 3300046533 Bacteria 1980
780 Ga0495640_0190148 3300046533 Bacteria 1305
781 Ga0495586_0062522 3300046535 Bacteria 2027
782 Ga0495586_0133155 3300046535 Bacteria 1392
783 Ga0495587_0058665 3300046536 Unclassified 2261
784 Ga0495609_0118066 3300046538 Bacteria 1142
785 Ga0495633_0151066 3300046558 Bacteria 1073
786 Ga0495667_0046839 3300046559 Bacteria 2858
787 Ga0495667_0116090 3300046559 Bacteria 1729
788 Ga0495667_0148001 3300046559 Bacteria 1512
789 Ga0495634_0022362 3300046642 Bacteria 4456
790 Ga0495634_0074872 3300046642 Bacteria 2224
791 Ga0495634_0155389 3300046642 Bacteria 1444
792 Ga0495611_0057907 3300046648 Bacteria 1757
793 Ga0495635_0078565 3300046663 Bacteria 2259
794 Ga0495661_0044050 3300046665 Bacteria 2738
795 Ga0495588_0058694 3300046674 Bacteria 1989
796 Ga0495599_0201005 3300046678 Bacteria 1224
797 Ga0495599_0310233 3300046678 Unclassified 951
798 Ga0495623_0041817 3300046679 Bacteria 2922
799 Ga0495623_0162317 3300046679 Bacteria 1312
800 Ga0495646_0091282 3300046680 Bacteria 1758
801 Ga0495646_0140466 3300046680 Bacteria 1351
802 Ga0495647_0017384 3300046681 Bacteria 2543
803 Ga0495647_0045713 3300046681 Bacteria 1683
804 Ga0495647_0102191 3300046681 Bacteria 1188
805 Ga0495647_0102270 3300046681 Bacteria 1188
806 Ga0495647_0116571 3300046681 Bacteria 1119
807 Ga0495658_0019110 3300046683 Unclassified 3572
808 Ga0495658_0031862 3300046683 Bacteria 2875
809 Ga0495658_0080986 3300046683 Bacteria 1905
810 Ga0495658_0140842 3300046683 Bacteria 1475
811 Ga0495658_0282376 3300046683 Bacteria 1048
812 Ga0495658_0302328 3300046683 Bacteria 1012
813 Ga0495613_0075825 3300046689 Bacteria 2448
814 Ga0495624_0078381 3300046690 Bacteria 2049
815 Ga0495624_0160923 3300046690 Bacteria 1371
816 Ga0495670_0022778 3300046691 Bacteria 3093
817 Ga0495589_0120593 3300046794 Bacteria 1263
818 Ga0495600_0121726 3300046809 Bacteria 1697
819 Ga0495581_0008318 3300047315 Bacteria 6014
820 Ga0495581_0093377 3300047315 Bacteria 1747
821 Ga0495581_0167799 3300047315 Bacteria 1284
822 Ga0495604_0056734 3300047317 Bacteria 3013
823 Ga0495604_0181025 3300047317 Bacteria 1474
824 Ga0495604_0196071 3300047317 Bacteria 1404
825 Ga0495674_0014985 3300047319 Bacteria 7256
826 Ga0495674_0055514 3300047319 Bacteria 3473
827 Ga0495674_0100088 3300047319 Bacteria 2467
828 Ga0495674_0139871 3300047319 Bacteria 2035
829 Ga0495674_0155990 3300047319 Bacteria 1912
830 Ga0495674_0258154 3300047319 Bacteria 1432
831 Ga0495676_0060249 3300047321 Bacteria 2976
832 Ga0495676_0182366 3300047321 Bacteria 1470
833 Ga0495680_0007893 3300047322 Bacteria 9714
834 Ga0495680_0175388 3300047322 Unclassified 1550
835 Ga0495675_0121992 3300047444 Bacteria 1623
836 Ga0495677_0045282 3300047445 Bacteria 1614
837 Ga0495684_0025026 3300047471 Bacteria 4591
838 Ga0495593_0140953 3300047673 Bacteria 1221
839 Ga0495602_0077213 3300048088 Bacteria 2819
840 Ga0495602_0116228 3300048088 Bacteria 2162
841 Ga0495602_0143485 3300048088 Bacteria 1887
842 Ga0496100_0006561 3300048903 Bacteria 6353
843 Ga0496100_0023659 3300048903 Bacteria 3735
844 Ga0496100_0023889 3300048903 Bacteria 3721
845 Ga0496100_0129086 3300048903 Bacteria 1778
846 Ga0496100_0248680 3300048903 Bacteria 1314
847 Ga0496100_0313783 3300048903 Bacteria 1176
848 Ga0496100_0382535 3300048903 Unclassified 1069
849 Ga0496101_0000417 3300048904 Bacteria 27418
850 Ga0496101_0004112 3300048904 Bacteria 9106
851 Ga0496101_0035125 3300048904 Bacteria 3545
852 Ga0496101_0073222 3300048904 Bacteria 2516
853 Ga0496101_0123350 3300048904 Bacteria 1961
854 Ga0496101_0157568 3300048904 Bacteria 1740
855 Ga0496101_0176343 3300048904 Bacteria 1644
856 Ga0496101_0256470 3300048904 Bacteria 1363
857 Ga0496101_0291297 3300048904 Bacteria 1277
858 Ga0496101_0292703 3300048904 Bacteria 1274
859 Ga0496101_0368129 3300048904 Bacteria 1130
860 Ga0496101_0403479 3300048904 Bacteria 1076
861 Ga0496101_0479197 3300048904 Bacteria 982
862 Ga0496102_0000656 3300048905 Bacteria 34773
863 Ga0496102_0009698 3300048905 Bacteria 8280
864 Ga0496102_0017784 3300048905 Bacteria 6233
865 Ga0496102_0055156 3300048905 Bacteria 3624
866 Ga0496102_0067312 3300048905 Bacteria 3285
867 Ga0496102_0094453 3300048905 Bacteria 2771
868 Ga0496102_0316339 3300048905 Bacteria 1471
869 Ga0496103_0000496 3300048906 Bacteria 32429
870 Ga0496103_0000554 3300048906 Bacteria 29772
871 Ga0496103_0012567 3300048906 Bacteria 5021
872 Ga0496103_0018242 3300048906 Bacteria 4209
873 Ga0496103_0032860 3300048906 Bacteria 3168
874 Ga0496104_0003227 3300048907 Bacteria 14035
875 Ga0496104_0012720 3300048907 Bacteria 7580
876 Ga0496104_0019997 3300048907 Bacteria 6131
877 Ga0496104_0025884 3300048907 Bacteria 5411
878 Ga0496104_0040843 3300048907 Bacteria 4349
879 Ga0496104_0044573 3300048907 Bacteria 4167
880 Ga0496104_0058091 3300048907 Bacteria 3661
881 Ga0496104_0066330 3300048907 Unclassified 3427
882 Ga0496104_0070630 3300048907 Bacteria 3320
883 Ga0496104_0072876 3300048907 Bacteria 3267
884 Ga0496104_0075196 3300048907 Bacteria 3216
885 Ga0496104_0100507 3300048907 Bacteria 2768
886 Ga0496104_0108999 3300048907 Bacteria 2654
887 Ga0496104_0140846 3300048907 Bacteria 2317
888 Ga0496104_0172178 3300048907 Bacteria 2076
889 Ga0496104_0172257 3300048907 Bacteria 2075
890 Ga0496104_0332086 3300048907 Bacteria 1433
891 Ga0496104_0382795 3300048907 Bacteria 1319
892 Ga0496104_0574201 3300048907 Unclassified 1038
893 Ga0496105_0019533 3300048908 Bacteria 5467
894 Ga0496105_0024057 3300048908 Bacteria 4947
895 Ga0496105_0028305 3300048908 Bacteria 4583
896 Ga0496105_0054994 3300048908 Bacteria 3286
897 Ga0496105_0119397 3300048908 Bacteria 2175
898 Ga0496105_0257734 3300048908 Bacteria 1411
899 Ga0496106_0000533 3300048909 Bacteria 26994
900 Ga0496106_0006930 3300048909 Bacteria 8381
901 Ga0496106_0008721 3300048909 Bacteria 7499
902 Ga0496106_0015958 3300048909 Bacteria 5554
903 Ga0496106_0164769 3300048909 Bacteria 1754
904 Ga0496106_0186964 3300048909 Unclassified 1646
905 Ga0496106_0407663 3300048909 Bacteria 1092
906 Ga0496107_0000446 3300048910 Bacteria 22538
907 Ga0496107_0000813 3300048910 Bacteria 18147
908 Ga0496107_0017838 3300048910 Bacteria 4995
909 Ga0496107_0034556 3300048910 Bacteria 3621
910 Ga0496107_0038032 3300048910 Bacteria 3454
911 Ga0496107_0119502 3300048910 Bacteria 1941
912 Ga0496107_0134730 3300048910 Bacteria 1825
913 Ga0496107_0161163 3300048910 Bacteria 1662
914 Ga0496108_0001209 3300048911 Bacteria 20254
915 Ga0496108_0013947 3300048911 Bacteria 6554
916 Ga0496108_0014153 3300048911 Bacteria 6509
917 Ga0496108_0017798 3300048911 Bacteria 5811
918 Ga0496108_0018635 3300048911 Bacteria 5687
919 Ga0496108_0054251 3300048911 Bacteria 3364
920 Ga0496108_0056115 3300048911 Bacteria 3308
921 Ga0496108_0085699 3300048911 Bacteria 2674
922 Ga0496108_0103472 3300048911 Unclassified 2429
923 Ga0496108_0203524 3300048911 Bacteria 1718
924 Ga0496108_0223183 3300048911 Bacteria 1637
925 Ga0496109_0000150 3300048912 Bacteria 68777
926 Ga0496109_0003995 3300048912 Bacteria 12319
927 Ga0496109_0009387 3300048912 Bacteria 8335
928 Ga0496109_0023016 3300048912 Bacteria 5524
929 Ga0496109_0046819 3300048912 Bacteria 3929
930 Ga0496109_0054575 3300048912 Bacteria 3645
931 Ga0496109_0067871 3300048912 Bacteria 3268
932 Ga0496109_0100740 3300048912 Bacteria 2680
933 Ga0496109_0125328 3300048912 Bacteria 2395
934 Ga0496109_0178215 3300048912 Bacteria 1995
935 Ga0496109_0280190 3300048912 Bacteria 1571
936 Ga0496109_0345488 3300048912 Bacteria 1405
937 Ga0496110_0007462 3300048913 Bacteria 8740
938 Ga0496110_0007902 3300048913 Bacteria 8520
939 Ga0496110_0045492 3300048913 Bacteria 3837
940 Ga0496110_0048544 3300048913 Bacteria 3721
941 Ga0496110_0103545 3300048913 Bacteria 2553
942 Ga0496110_0149867 3300048913 Bacteria 2112
943 Ga0496110_0209012 3300048913 Bacteria 1774
944 Ga0496110_0256511 3300048913 Bacteria 1592
945 Ga0496110_0293865 3300048913 Bacteria 1480
946 Ga0496110_0320028 3300048913 Bacteria 1413
947 Ga0496111_0159725 3300048914 Bacteria 1673
948 Ga0496111_0181751 3300048914 Bacteria 1563
949 Ga0496111_0224307 3300048914 Bacteria 1396
950 Ga0496111_0289771 3300048914 Unclassified 1214
951 Ga0496112_0005934 3300048915 Bacteria 10653
952 Ga0496112_0009441 3300048915 Bacteria 8792
953 Ga0496112_0024311 3300048915 Bacteria 5799
954 Ga0496112_0055839 3300048915 Bacteria 3885
955 Ga0496112_0057696 3300048915 Bacteria 3822
956 Ga0496112_0062079 3300048915 Bacteria 3685
957 Ga0496112_0123742 3300048915 Bacteria 2557
958 Ga0496112_0176624 3300048915 Bacteria 2100
959 Ga0496112_0182623 3300048915 Bacteria 2061
960 Ga0496112_0241932 3300048915 Bacteria 1757
961 Ga0496112_0258958 3300048915 Bacteria 1689
962 Ga0496112_0335668 3300048915 Bacteria 1455
963 Ga0496113_0009323 3300048916 Bacteria 6434
964 Ga0496113_0015572 3300048916 Bacteria 5232
965 Ga0496113_0029371 3300048916 Bacteria 3969
966 Ga0496113_0067509 3300048916 Plasmid 2712
967 Ga0496113_0119898 3300048916 Bacteria 2056
968 Ga0496113_0141241 3300048916 Bacteria 1895
969 Ga0496113_0148135 3300048916 Bacteria 1850
970 Ga0496113_0163257 3300048916 Bacteria 1762
971 Ga0496113_0266026 3300048916 Bacteria 1370
972 Ga0496113_0281251 3300048916 Bacteria 1330
973 Ga0496114_0000393 3300048917 Bacteria 32210
974 Ga0496114_0008474 3300048917 Bacteria 8147
975 Ga0496114_0076489 3300048917 Bacteria 2820
976 Ga0496114_0264192 3300048917 Bacteria 1516
977 Ga0496114_0412257 3300048917 Bacteria 1196
978 Ga0496114_0610512 3300048917 Bacteria 961
979 Ga0496115_0003544 3300048918 Bacteria 11227
980 Ga0496115_0009564 3300048918 Bacteria 7201
981 Ga0496115_0020461 3300048918 Bacteria 5105
982 Ga0496115_0037161 3300048918 Bacteria 3859
983 Ga0496115_0095691 3300048918 Bacteria 2431
984 Ga0496115_0107263 3300048918 Bacteria 2293
985 Ga0496115_0137188 3300048918 Bacteria 2017
986 Ga0496115_0215274 3300048918 Bacteria 1586
987 Ga0496115_0237242 3300048918 Bacteria 1503
988 Ga0496115_0289028 3300048918 Bacteria 1345
989 Ga0496115_0310437 3300048918 Bacteria 1291
990 Ga0496115_0452874 3300048918 Bacteria 1036
991 nmdc:mga03683_53500_c1 3300050489 Bacteria 1690
992 nmdc:mga00v17_246562_c1 3300050491 Bacteria 1158
993 nmdc:mga0yw44_201955_c1 3300050492 Bacteria 1313
994 nmdc:mga06z11_7090_c1 3300050494 Bacteria 4597
995 nmdc:mga05p37_123265_c1 3300050507 Bacteria 3184
996 nmdc:mga05p37_242699_c1 3300050507 Bacteria 2165
997 nmdc:mga05p37_294764_c1 3300050507 Unclassified 1930
998 nmdc:mga05p37_346013_c1 3300050507 Bacteria 1752
999 nmdc:mga05p37_81912_c1 3300050507 Bacteria 3976
1000 nmdc:mga09592_10558_c1 3300050508 Bacteria 7516
1001 nmdc:mga09592_172394_c1 3300050508 Bacteria 1871
1002 nmdc:mga09592_191617_c1 3300050508 Bacteria 1770
1003 nmdc:mga09592_47677_c1 3300050508 Bacteria 3612
1004 nmdc:mga0qj67_124524_c1 3300050509 Bacteria 2086
1005 nmdc:mga0qj67_231675_c1 3300050509 Unclassified 1499
1006 nmdc:mga0qj67_244408_c1 3300050509 Bacteria 1456
1007 nmdc:mga0qj67_420912_c1 3300050509 Bacteria 1077
1008 nmdc:mga0qj67_7378_c1 3300050509 Bacteria 8128
1009 nmdc:mga0qj67_96498_c1 3300050509 Bacteria 2380
1010 nmdc:mga06r32_231436_c1 3300050510 Bacteria 1836
1011 nmdc:mga06r32_425817_c1 3300050510 Bacteria 1308
1012 nmdc:mga06r32_51599_c1 3300050510 Bacteria 3937
1013 nmdc:mga06r32_55524_c1 3300050510 Bacteria 3799
1014 nmdc:mga08y16_121549_c1 3300050511 Bacteria 2718
1015 nmdc:mga08y16_286424_c1 3300050511 Bacteria 1699
1016 nmdc:mga08y16_289250_c1 3300050511 Bacteria 1690
1017 nmdc:mga08y16_36936_c1 3300050511 Bacteria 5131
1018 nmdc:mga08y16_40005_c1 3300050511 Bacteria 4917
1019 nmdc:mga08y16_406041_c1 3300050511 Unclassified 1394
1020 nmdc:mga08y16_513130_c1 3300050511 Bacteria 1217
1021 nmdc:mga08y16_79682_c1 3300050511 Bacteria 3414
1022 nmdc:mga08y16_8860_c1 3300050511 Bacteria 10562
1023 nmdc:mga0n895_183779_c1 3300050512 Bacteria 2122
1024 nmdc:mga0n895_229152_c1 3300050512 Bacteria 1886
1025 nmdc:mga0n895_295323_c1 3300050512 Bacteria 1643
1026 nmdc:mga0n895_367071_c1 3300050512 Bacteria 1457
1027 nmdc:mga0n895_4344_c1 3300050512 Bacteria 11621
1028 nmdc:mga0n895_51683_c1 3300050512 Bacteria 4032
1029 nmdc:mga0n895_5635_c1 3300050512 Bacteria 10493
1030 nmdc:mga0a205_1625_c1 3300050515 Bacteria 19321
1031 nmdc:mga0a205_39527_c1 3300050515 Bacteria 4541
1032 nmdc:mga0a205_399688_c1 3300050515 Bacteria 1238
1033 nmdc:mga0a205_430_c1 3300050515 Bacteria 32284
1034 Ga0495601_0000460 3300053077 Bacteria 21389
1035 Ga0495601_0001261 3300053077 Bacteria 13858
1036 Ga0495601_0004351 3300053077 Bacteria 8184
1037 Ga0495601_0023396 3300053077 Bacteria 3795
1038 Ga0495601_0028968 3300053077 Bacteria 3432
1039 Ga0495601_0109477 3300053077 Bacteria 1788
1040 Ga0495601_0163979 3300053077 Bacteria 1452
1041 Ga0495601_0275172 3300053077 Bacteria 1098
1042 Ga0495612_0004070 3300053078 Bacteria 6056
1043 Ga0495612_0033627 3300053078 Bacteria 2075
1044 Ga0495612_0034504 3300053078 Bacteria 2049
1045 Ga0495612_0035781 3300053078 Unclassified 2013
1046 Ga0495655_0028869 3300053083 Unclassified 1329
1047 Ga0495595_0001469 3300053084 Bacteria 9207
1048 Ga0495595_0005222 3300053084 Bacteria 5246
1049 Ga0495595_0058823 3300053084 Bacteria 1795
1050 Ga0495595_0129127 3300053084 Bacteria 1234
1051 Ga0495595_0130670 3300053084 Bacteria 1227
1052 Ga0495619_0000510 3300053085 Bacteria 25902
1053 Ga0495619_0004909 3300053085 Bacteria 8490
1054 Ga0495619_0010695 3300053085 Bacteria 5777
1055 Ga0495619_0012092 3300053085 Bacteria 5437
1056 Ga0495619_0015380 3300053085 Bacteria 4841
1057 Ga0495619_0026643 3300053085 Bacteria 3720
1058 Ga0495619_0065065 3300053085 Bacteria 2432
1059 Ga0495619_0071606 3300053085 Bacteria 2320
1060 Ga0495619_0071642 3300053085 Bacteria 2319
1061 Ga0495619_0090495 3300053085 Bacteria 2071
1062 Ga0495619_0117418 3300053085 Bacteria 1822
1063 Ga0495619_0209721 3300053085 Bacteria 1349
1064 Ga0495619_0394560 3300053085 Bacteria 956
1065 Ga0530510_0154780 3300061734 Unclassified 1694
1066 8006990170 8006984368 Bacteria 9651211
1067 nmdc:mga05p37_443271_c1
1068 SwRhRL2b_contig_907168
1069 MBSR1b_contig_12792658
1070 2214628273
1071 ARcpr5oldR_c000273
1072 ARSoilYngRDRAFT_c00245
1073 ARcpr5yngRDRAFT_c000126
1074 ARSoilOldRDRAFT_c000152
1075 ARCol0yngRDRAFT_1000342
1076 JGI24752J21851_1003298
1077 JGI24746J21847_1000474
1078 JGI24746J21847_1000629
1079 JGI24739J22299_10003620
1080 JGI24739J22299_10004255
1081 JGI24737J22298_10000062
1082 JGI24737J22298_10000073
1083 JGI24737J22298_10019219
1084 JGI24750J21931_1000377
1085 JGI24745J21846_1000398
1086 JGI24745J21846_1002321
1087 JGI24748J21848_1000480
1088 JGI24748J21848_1002694
1089 JGI24738J21930_10000217
1090 JGI24738J21930_10002341
1091 JGI24749J21850_1000689
1092 JGI24749J21850_1000849
1093 JGI24744J21845_10001417
1094 JGI24035J26624_1000036
1095 JGI24035J26624_1000204
1096 JGI24033J26618_1002646
1097 JGI24034J26672_10000225
1098 JGI24034J26672_10001370
1099 JGI24742J22300_10000032
1100 JGI24742J22300_10000049
1101 JGI24751J29686_10003092
1102 JGI25405J52794_10015577
1103 Ga0065717_1001953
1104 Ga0065716_1002765
1105 Ga0065704_10002996
1106 Ga0065712_10086330
1107 Ga0065712_10089240
1108 Ga0065715_10009470
1109 Ga0065715_10091967
1110 Ga0065715_10092041
1111 Ga0070676_10000251
1112 Ga0070676_10258621
1113 Ga0070683_100000344
1114 Ga0070683_100002231
1115 Ga0070683_100100054
1116 Ga0070683_100123307
1117 Ga0070690_100000588
1118 Ga0070690_100000616
1119 Ga0070690_100029125
1120 Ga0070670_100001740
1121 Ga0070670_100001768
1122 Ga0070670_100038401
1123 Ga0070677_10000076
1124 Ga0070677_10001576
1125 Ga0068869_100000078
1126 Ga0068869_100008854
1127 Ga0070666_10003799
1128 Ga0070666_10033485
1129 Ga0070666_10209024
1130 Ga0070680_100000333
1131 Ga0070680_100006554
1132 Ga0070680_100076036
1133 Ga0070680_100310650
1134 Ga0070682_100000285
1135 Ga0070682_100001569
1136 Ga0068868_100001627
1137 Ga0068868_100003400
1138 Ga0070660_100000474
1139 Ga0070660_100001115
1140 Ga0070660_100022012
1141 Ga0070660_100059229
1142 Ga0070660_100083185
1143 Ga0070689_100000252
1144 Ga0070689_100002086
1145 Ga0070691_10000476
1146 Ga0070691_10002482
1147 Ga0070687_100000476
1148 Ga0070661_100000605
1149 Ga0070661_100011032
1150 Ga0070661_100087137
1151 Ga0070692_10000127
1152 Ga0070692_10000227
1153 Ga0070692_10037540
1154 Ga0070692_10180539
1155 Ga0070668_100001035
1156 Ga0070668_100007791
1157 Ga0070668_100077010
1158 Ga0070668_100111172
1159 Ga0070669_100002096
1160 Ga0070669_100236895
1161 Ga0070675_100000522
1162 Ga0070675_100008366
1163 Ga0070675_100057814
1164 Ga0070675_100123510
1165 Ga0070671_100001132
1166 Ga0070671_100001344
1167 Ga0070671_100031885
1168 Ga0070671_100445550
1169 Ga0070674_100000240
1170 Ga0070674_100000603
1171 Ga0070674_100034347
1172 Ga0070674_100106942
1173 Ga0070674_100122367
1174 Ga0070673_100000164
1175 Ga0070673_100000666
1176 Ga0070688_100000162
1177 Ga0070688_100000961
1178 Ga0070688_100010001
1179 Ga0070688_100017036
1180 Ga0070688_100131813
1181 Ga0070688_100326582
1182 Ga0070659_100000720
1183 Ga0070659_100023047
1184 Ga0070659_100224466
1185 Ga0070659_100251249
1186 Ga0070667_100001046
1187 Ga0070667_100005648
1188 Ga0070667_100175685
1189 Ga0070667_100222406
1190 Ga0070703_10001840
1191 Ga0070703_10003412
1192 Ga0070709_10109983
1193 Ga0070714_100071576
1194 Ga0070713_100023176
1195 Ga0070713_100034835
1196 Ga0070710_10007557
1197 Ga0070710_10050308
1198 Ga0070710_10085609
1199 Ga0070701_10000860
1200 Ga0070701_10004311
1201 Ga0070701_10203060
1202 Ga0070711_100009305
1203 Ga0070711_100014237
1204 Ga0070711_100103672
1205 Ga0070705_100000321
1206 Ga0070705_100008646
1207 Ga0070700_100000654
1208 Ga0070700_100011814
1209 Ga0070700_100020746
1210 Ga0070694_100000554
1211 Ga0070694_100268475
1212 Ga0070694_100285896
1213 Ga0070708_100009300
1214 Ga0070708_100036023
1215 Ga0070708_100039455
1216 Ga0070708_100125601
1217 Ga0070663_100004739
1218 Ga0070663_100011128
1219 Ga0070663_100084630
1220 Ga0070663_100154433
1221 Ga0070663_100447617
1222 Ga0070678_100000228
1223 Ga0070678_100000570
1224 Ga0070678_100009473
1225 Ga0070678_100025375
1226 Ga0070678_100053064
1227 Ga0070662_100001178
1228 Ga0070662_100026848
1229 Ga0070662_100045270
1230 Ga0070662_100046488
1231 Ga0070662_100205836
1232 Ga0070681_10000446
1233 Ga0070681_10027394
1234 Ga0068867_100001229
1235 Ga0068867_100003347
1236 Ga0068867_100078925
1237 Ga0070685_10000768
1238 Ga0070685_10001094
1239 Ga0070706_100008477
1240 Ga0070706_100057654
1241 Ga0070706_100190833
1242 Ga0070706_100198167
1243 Ga0070706_100458086
1244 Ga0070706_100537033
1245 Ga0070707_100226693
1246 Ga0070698_100050289
1247 Ga0070698_100052632
1248 Ga0070698_100097098
1249 Ga0074259_10002483
1250 Ga0070699_100408392
1251 Ga0070679_100001839
1252 Ga0070679_100005106
1253 Ga0070679_100249166
1254 Ga0070679_100315649
1255 Ga0070684_100000411
1256 Ga0070684_100008904
1257 Ga0070684_100051289
1258 Ga0070684_100118415
1259 Ga0070697_100044711
1260 Ga0070697_100045090
1261 Ga0070697_100087885
1262 Ga0070697_100094651
1263 Ga0070672_100001539
1264 Ga0070672_100013692
1265 Ga0070686_100000379
1266 Ga0070686_100001252
1267 Ga0070686_100057138
1268 Ga0070686_100058334
1269 Ga0070695_100000294
1270 Ga0070695_100000341
1271 Ga0070695_100023224
1272 Ga0070695_100118133
1273 Ga0070696_100000594
1274 Ga0070696_100023629
1275 Ga0070696_100055145
1276 Ga0070696_100313823
1277 Ga0070693_100000031
1278 Ga0070693_100000345
1279 Ga0070693_100020113
1280 Ga0070665_100143954
1281 Ga0070665_100246968
1282 Ga0070704_100000481
1283 Ga0070704_100000911
1284 Ga0070704_100051612
1285 Ga0068855_100004006
1286 Ga0068855_100057969
1287 Ga0070664_100000874
1288 Ga0070664_100020100
1289 Ga0070664_100098089
1290 Ga0068857_100000249
1291 Ga0068857_100018629
1292 Ga0068857_100292332
1293 Ga0068854_100000146
1294 Ga0068854_100009557
1295 Ga0068856_100001251
1296 Ga0068856_100002466
1297 Ga0070702_100000134
1298 Ga0070702_100005638
1299 Ga0070702_100034973
1300 Ga0070702_100212870
1301 Ga0068852_100016912
1302 Ga0068852_100018965
1303 Ga0068859_100002043
1304 Ga0068859_100003259
1305 Ga0068859_100175910
1306 Ga0068864_100000674
1307 Ga0068864_100001986
1308 Ga0068864_100094332
1309 Ga0068864_100115595
1310 Ga0068866_10000348
1311 Ga0068866_10000557
1312 Ga0068861_100000958
1313 Ga0068861_100003474
1314 Ga0068870_10000032
1315 Ga0068870_10000115
1316 Ga0068870_10174368
1317 Ga0068863_100000150
1318 Ga0068863_100003793
1319 Ga0068863_100426209
1320 Ga0068858_100004191
1321 Ga0068858_100009937
1322 Ga0068858_100112167
1323 Ga0068858_100145530
1324 Ga0068858_100170093
1325 Ga0068858_100214853
1326 Ga0068860_100006010
1327 Ga0068860_100018645
1328 Ga0068860_100027186
1329 Ga0068860_100384724
1330 Ga0068860_100517880
1331 Ga0068862_100001121
1332 Ga0068862_100011074
1333 Ga0068862_100020884
1334 Ga0068862_100381384
1335 Ga0081455_10015729
1336 Ga0081455_10019828
1337 Ga0081455_10048669
1338 Ga0081455_10059262
1339 Ga0081455_10087603
1340 Ga0070717_10016433
1341 Ga0070717_10018063
1342 Ga0070717_10138468
1343 Ga0070717_10148079
1344 Ga0070717_10362541
1345 Ga0070717_10370530
1346 Ga0075365_10039910
1347 Ga0075365_10064947
1348 Ga0075365_10211164
1349 Ga0075432_10033002
1350 Ga0070715_10006272
1351 Ga0070716_100145792
1352 Ga0070712_100039213
1353 Ga0070712_100196062
1354 Ga0075362_10097929
1355 Ga0097621_100001205
1356 Ga0097621_100001322
1357 Ga0097621_100003473
1358 Ga0068871_100000676
1359 Ga0068871_100001279
1360 Ga0068871_100005001
1361 Ga0068871_100263330
1362 Ga0075428_100064067
1363 Ga0075428_100070279
1364 Ga0075428_100134538
1365 Ga0075428_100249558
1366 Ga0075428_100352555
1367 Ga0075428_100711459
1368 Ga0075430_100126811
1369 Ga0075431_100065799
1370 Ga0075431_100119293
1371 Ga0075431_100469939
1372 Ga0075433_10000718
1373 Ga0075433_10044101
1374 Ga0075433_10426040
1375 Ga0075434_100002238
1376 Ga0075434_100003393
1377 Ga0075434_100057976
1378 Ga0075434_100085099
1379 Ga0075434_100239695
1380 Ga0075434_100374436
1381 Ga0075429_100056298
1382 Ga0075429_100112230
1383 Ga0075429_100213992
1384 Ga0075429_100342136
1385 Ga0068865_100000085
1386 Ga0068865_100000348
1387 Ga0068865_100076507
1388 Ga0068865_100341889
1389 Ga0097620_100002042
1390 Ga0097620_100003259
1391 Ga0097620_100175898
1392 Ga0075435_100102202
1393 Ga0099795_10006038
1394 Ga0105244_10083655
1395 Ga0105250_10069850
1396 Ga0111539_10001107
1397 Ga0111539_10001814
1398 Ga0111539_10034613
1399 Ga0111539_10166030
1400 Ga0111539_10233437
1401 Ga0111539_10384088
1402 Ga0111539_10567241
1403 Ga0111539_10571092
1404 Ga0105245_10000235
1405 Ga0105245_10002164
1406 Ga0105245_10133701
1407 Ga0105247_10070818
1408 Ga0114129_10086876
1409 Ga0114129_10239574
1410 Ga0114129_10733320
1411 Ga0105243_10001256
1412 Ga0105243_10009126
1413 Ga0105243_10024145
1414 Ga0105243_10075283
1415 Ga0105243_10101070
1416 Ga0105241_10000414
1417 Ga0105241_10000702
1418 Ga0105242_10000134
1419 Ga0105242_10001674
1420 Ga0105242_10316978
1421 Ga0105242_10451255
1422 Ga0105248_10001347
1423 Ga0105248_10003880
1424 Ga0105248_10474452
1425 Ga0105237_10012335
1426 Ga0105237_10039808
1427 Ga0105237_10163133
1428 Ga0105238_10151943
1429 Ga0105249_10000325
1430 Ga0105249_10000627
1431 Ga0105249_10155371
1432 Ga0105249_10355796
1433 Ga0105249_10564967
1434 Ga0105239_10002328
1435 Ga0105239_10004832
1436 Ga0105239_10039843
1437 Ga0105239_10377058
1438 Ga0105246_10000041
1439 Ga0105246_10000168
1440 Ga0157373_10010744
1441 Ga0157373_10016002
1442 Ga0157371_10006558
1443 Ga0157371_10015556
1444 Ga0157374_10002115
1445 Ga0157374_10033139
1446 Ga0157374_10033189
1447 Ga0157374_10153782
1448 Ga0157378_10000434
1449 Ga0163162_10006347
1450 Ga0163162_10007869
1451 Ga0163162_10029055
1452 Ga0163162_10224025
1453 Ga0163162_10230871
1454 Ga0163162_10297104
1455 Ga0163162_10439316
1456 Ga0163162_10554047
1457 Ga0163162_10634260
1458 Ga0163162_10765485
1459 Ga0157372_10006948
1460 Ga0157372_10022013
1461 Ga0157372_10418443
1462 Ga0157375_10000181
1463 Ga0157375_10002241
1464 Ga0157375_10018144
1465 Ga0157375_10028214
1466 Ga0157375_10035469
1467 Ga0157375_10048041
1468 Ga0157375_10188920
1469 Ga0157375_10778888
1470 Ga0163163_10017949
1471 Ga0163163_10029491
1472 Ga0163163_10033676
1473 Ga0163163_10144482
1474 Ga0163163_10157443
1475 Ga0157380_10001449
1476 Ga0157380_10271538
1477 Ga0157377_10000101
1478 Ga0157377_10000284
1479 Ga0157379_10000364
1480 Ga0157379_10000554
1481 Ga0157379_10066772
1482 Ga0157379_10120313
1483 Ga0157379_10436707
1484 Ga0157376_10000142
1485 Ga0157376_10001203
1486 Ga0157376_10049164
1487 Ga0157376_10065221
1488 Ga0157376_10066488
1489 Ga0157376_10127807
1490 Ga0157376_10284061
1491 Ga0163161_10000081
1492 Ga0163161_10018167
1493 Ga0163161_10351564
1494 Ga0213876_10057756
1495 Ga0207666_1000031
1496 Ga0207666_1000042
1497 Ga0207673_1000069
1498 Ga0207673_1000121
1499 Ga0207697_10000045
1500 Ga0207697_10000416
1501 Ga0207697_10006171
1502 Ga0207653_10004447
1503 Ga0207653_10007306
1504 Ga0207682_10000153
1505 Ga0207682_10000314
1506 Ga0207692_10018416
1507 Ga0207692_10063838
1508 Ga0207692_10077256
1509 Ga0207692_10118336
1510 Ga0207642_10000262
1511 Ga0207642_10000438
1512 Ga0207710_10006396
1513 Ga0207710_10037976
1514 Ga0207688_10000044
1515 Ga0207688_10000606
1516 Ga0207688_10023542
1517 Ga0207680_10001543
1518 Ga0207680_10058823
1519 Ga0207647_10001666
1520 Ga0207647_10004187
1521 Ga0207647_10087508
1522 Ga0207685_10050462
1523 Ga0207685_10069725
1524 Ga0207699_10030946
1525 Ga0207699_10185382
1526 Ga0207645_10000945
1527 Ga0207645_10001816
1528 Ga0207645_10218126
1529 Ga0207643_10000025
1530 Ga0207643_10000345
1531 Ga0207684_10006956
1532 Ga0207684_10011951
1533 Ga0207684_10022595
1534 Ga0207684_10024910
1535 Ga0207684_10040998
1536 Ga0207684_10145035
1537 Ga0207684_10149198
1538 Ga0207654_10001478
1539 Ga0207654_10008394
1540 Ga0207707_10001635
1541 Ga0207707_10018614
1542 Ga0207671_10023238
1543 Ga0207671_10038138
1544 Ga0207693_10018855
1545 Ga0207693_10034249
1546 Ga0207693_10040180
1547 Ga0207693_10142078
1548 Ga0207693_10204987
1549 Ga0207663_10019695
1550 Ga0207663_10026811
1551 Ga0207663_10028158
1552 Ga0207663_10400450
1553 Ga0207660_10000131
1554 Ga0207660_10000318
1555 Ga0207660_10071944
1556 Ga0207660_10280266
1557 Ga0207662_10000100
1558 Ga0207662_10000668
1559 Ga0207657_10000699
1560 Ga0207657_10003089
1561 Ga0207657_10049279
1562 Ga0207657_10076905
1563 Ga0207657_10093242
1564 Ga0207649_10000310
1565 Ga0207649_10001217
1566 Ga0207649_10002591
1567 Ga0207652_10000785
1568 Ga0207652_10007477
1569 Ga0207652_10012572
1570 Ga0207652_10101697
1571 Ga0207681_10000131
1572 Ga0207681_10001247
1573 Ga0207681_10025153
1574 Ga0207681_10094541
1575 Ga0207694_10079794
1576 Ga0207650_10002469
1577 Ga0207650_10007605
1578 Ga0207650_10039061
1579 Ga0207659_10000040
1580 Ga0207659_10001096
1581 Ga0207687_10000122
1582 Ga0207687_10001549
1583 Ga0207687_10283911
1584 Ga0207700_10009919
1585 Ga0207700_10131826
1586 Ga0207700_10192672
1587 Ga0207700_10421931
1588 Ga0207664_10063010
1589 Ga0207664_10135631
1590 Ga0207644_10000393
1591 Ga0207644_10000828
1592 Ga0207690_10000277
1593 Ga0207690_10001276
1594 Ga0207690_10307509
1595 Ga0207706_10000311
1596 Ga0207706_10001343
1597 Ga0207706_10039346
1598 Ga0207706_10070126
1599 Ga0207706_10100063
1600 Ga0207686_10000407
1601 Ga0207686_10002434
1602 Ga0207709_10000322
1603 Ga0207709_10000591
1604 Ga0207709_10065022
1605 Ga0207709_10234801
1606 Ga0207670_10000240
1607 Ga0207670_10000509
1608 Ga0207669_10000191
1609 Ga0207669_10000484
1610 Ga0207669_10231076
1611 Ga0207669_10305221
1612 Ga0207704_10000071
1613 Ga0207704_10000289
1614 Ga0207704_10211853
1615 Ga0207704_10318896
1616 Ga0207665_10078058
1617 Ga0207665_10085025
1618 Ga0207665_10424939
1619 Ga0207691_10000257
1620 Ga0207691_10001202
1621 Ga0207711_10002577
1622 Ga0207711_10017003
1623 Ga0207689_10000134
1624 Ga0207689_10001584
1625 Ga0207661_10000191
1626 Ga0207661_10001224
1627 Ga0207661_10058414
1628 Ga0207679_10000099
1629 Ga0207679_10003586
1630 Ga0207679_10005866
1631 Ga0207667_10034555
1632 Ga0207667_10048127
1633 Ga0207651_10000017
1634 Ga0207651_10000393
1635 Ga0207712_10000114
1636 Ga0207712_10000591
1637 Ga0207712_10007853
1638 Ga0207712_10420943
1639 Ga0207668_10001667
1640 Ga0207668_10002065
1641 Ga0207668_10075803
1642 Ga0207640_10000336
1643 Ga0207640_10000604
1644 Ga0207658_10001624
1645 Ga0207658_10011285
1646 Ga0207677_10000412
1647 Ga0207677_10000974
1648 Ga0207677_10148370
1649 Ga0207703_10000863
1650 Ga0207639_10000646
1651 Ga0207639_10001290
1652 Ga0207639_10339432
1653 Ga0207678_10000131
1654 Ga0207678_10001120
1655 Ga0207678_10058037
1656 Ga0207678_10280703
1657 Ga0207708_10000192
1658 Ga0207708_10001629
1659 Ga0207708_10003560
1660 Ga0207702_10002469
1661 Ga0207702_10003256
1662 Ga0207641_10000246
1663 Ga0207641_10003176
1664 Ga0207641_10008853
1665 Ga0207648_10001831
1666 Ga0207648_10006095
1667 Ga0207648_10061876
1668 Ga0207648_10271720
1669 Ga0207676_10001655
1670 Ga0207676_10002691
1671 Ga0207676_10004872
1672 Ga0207676_10100626
1673 Ga0207676_10418017
1674 Ga0207674_10000355
1675 Ga0207674_10001638
1676 Ga0207674_10074643
1677 Ga0207675_100001893
1678 Ga0207675_100006563
1679 Ga0207675_100433759
1680 Ga0207683_10000924
1681 Ga0207683_10002127
1682 Ga0207683_10017822
1683 Ga0207683_10035097
1684 Ga0207683_10454663
1685 Ga0207698_10001234
1686 Ga0207698_10012369
1687 Ga0210002_1002756
1688 Ga0210002_1003909
1689 Ga0209998_10000477
1690 Ga0209998_10002044
1691 Ga0209998_10012552
1692 Ga0209974_10010866
1693 Ga0209974_10029499
1694 Ga0207428_10000469
1695 Ga0207428_10000944
1696 Ga0207428_10043183
1697 Ga0207428_10058774
1698 Ga0207428_10082724
1699 Ga0207428_10087049
1700 Ga0207428_10111715
1701 Ga0268266_10247949
1702 Ga0268266_10555713
1703 Ga0268265_10000312
1704 Ga0268265_10001746
1705 Ga0268265_10100349
1706 Ga0268265_10282753
1707 Ga0268264_10000412
1708 Ga0268264_10000751
1709 Ga0268264_10309421
1710 Ga0373930_0002725
1711 Ga0373930_0026828
1712 Ga0373948_0012313
1713 Ga0373950_0000747
1714 Ga0373950_0003891
1715 Ga0373950_0007394
1716 Ga0373958_0002202
1717 Ga0373959_0001785
1718 Ga0373959_0003277
1719 Ga0373959_0005041
1720 Ga0373938_0000291
1721 Ga0373938_0000451
1722 Ga0373938_0009384
1723 Ga0373926_0056981
1724 Ga0373928_0000699
1725 Ga0373928_0000806
1726 Ga0373928_0001248
1727 Ga0373929_0002281
1728 Ga0373929_0003591
1729 Ga0373934_0148708
1730 Ga0373940_0000652
1731 Ga0373940_0002233
1732 Ga0373944_0038153
1733 Ga0373944_0038397
1734 Ga0373949_0000392
1735 Ga0373949_0001594
1736 Ga0373949_0003455
1737 Ga0373951_0001947
1738 Ga0373951_0003618
1739 Ga0373951_0006289
1740 Ga0373951_0032553
1741 Ga0373952_0000672
1742 Ga0373952_0003009
1743 Ga0373952_0004332
1744 Ga0373932_0000911
1745 Ga0373932_0001306
1746 Ga0373932_0001480
1747 Ga0373932_0028131
1748 Ga0373936_0093230
1749 Ga0373936_0112666
1750 Ga0373939_0000964
1751 Ga0373939_0002528
1752 Ga0373941_0014017
1753 Ga0373945_0053259
1754 Ga0373960_0000113
1755 Ga0373960_0000122
1756 Ga0373960_0014695
1757 Ga0373960_0029149
1758 Ga0373943_0036157
1759 Ga0373943_0062481
1760 Ga0373943_0185171
1761 Ga0373946_0020814
1762 Ga0373946_0061598
1763 Ga0373955_0205170
1764 Ga0373942_0001003
1765 Ga0373942_0001784
1766 Ga0373961_0001327
1767 Ga0373961_0001691
1768 Ga0373961_0024677
1769 Ga0373962_0000343
1770 Ga0373962_0000914
1771 Ga0373924_0021933
1772 Ga0373924_0152741
1773 Ga0373931_0000167
1774 Ga0373931_0000193
1775 Ga0373931_0009928
1776 Ga0373935_0023315
1777 Ga0373935_0049751
1778 Ga0373935_0165354
1779 Ga0373927_0022362
1780 Ga0373927_0090463
1781 Ga0373927_0159661
1782 Ga0373947_0011799
1783 Ga0373947_0044615
1784 Ga0373947_0045319
1785 Ga0373947_0082365
1786 Ga0373947_0086380
1787 Ga0373937_0059073
1788 Ga0373937_0122906
1789 Ga0373937_0247053
1790 Ga0373925_0031270
1791 Ga0373925_0310229
1792 Ga0373925_0362878
1793 Ga0395898_0235992
1794 Ga0436365_1532142
1795 Ga0436361_1076743
1796 Ga0453683_0162092
1797 Ga0451576_0049352
1798 Ga0495592_0156562
1799 Ga0495603_0005382
1800 Ga0495603_0017639
1801 Ga0495603_0040560
1802 Ga0495603_0119747
1803 Ga0495603_0170150
1804 Ga0495629_0029834
1805 Ga0495629_0048458
1806 Ga0495629_0164630
1807 Ga0495641_0100327
1808 Ga0495651_0019246
1809 Ga0495651_0200175
1810 Ga0495651_0308791
1811 Ga0495653_0016063
1812 Ga0495653_0083268
1813 Ga0495580_0100719
1814 Ga0495582_0162255
1815 Ga0495605_0100071
1816 Ga0495639_0099704
1817 Ga0495662_0078172
1818 Ga0495664_0005448
1819 Ga0495664_0076048
1820 Ga0495664_0131924
1821 Ga0495584_0065402
1822 Ga0495584_0093404
1823 Ga0495585_0040957
1824 Ga0495585_0110686
1825 Ga0495594_0046100
1826 Ga0495594_0046429
1827 Ga0495607_0168592
1828 Ga0495608_0112061
1829 Ga0495616_0074252
1830 Ga0495616_0091125
1831 Ga0495618_0012254
1832 Ga0495618_0030381
1833 Ga0495628_0049888
1834 Ga0495630_0087518
1835 Ga0495644_0062421
1836 Ga0495663_0016027
1837 Ga0495666_0043970
1838 Ga0495666_0130769
1839 Ga0495652_0071490
1840 Ga0495652_0192332
1841 Ga0495652_0277545
1842 Ga0495665_0073291
1843 Ga0495640_0038504
1844 Ga0495640_0054226
1845 Ga0495640_0093618
1846 Ga0495640_0190148
1847 Ga0495586_0062522
1848 Ga0495586_0133155
1849 Ga0495587_0058665
1850 Ga0495609_0118066
1851 Ga0495633_0151066
1852 Ga0495667_0046839
1853 Ga0495667_0116090
1854 Ga0495667_0148001
1855 Ga0495634_0022362
1856 Ga0495634_0074872
1857 Ga0495634_0155389
1858 Ga0495611_0057907
1859 Ga0495635_0078565
1860 Ga0495661_0044050
1861 Ga0495588_0058694
1862 Ga0495599_0201005
1863 Ga0495599_0310233
1864 Ga0495623_0041817
1865 Ga0495623_0162317
1866 Ga0495646_0091282
1867 Ga0495646_0140466
1868 Ga0495647_0017384
1869 Ga0495647_0045713
1870 Ga0495647_0102191
1871 Ga0495647_0102270
1872 Ga0495647_0116571
1873 Ga0495658_0019110
1874 Ga0495658_0031862
1875 Ga0495658_0080986
1876 Ga0495658_0140842
1877 Ga0495658_0282376
1878 Ga0495658_0302328
1879 Ga0495613_0075825
1880 Ga0495624_0078381
1881 Ga0495624_0160923
1882 Ga0495670_0022778
1883 Ga0495589_0120593
1884 Ga0495600_0121726
1885 Ga0495581_0008318
1886 Ga0495581_0093377
1887 Ga0495581_0167799
1888 Ga0495604_0056734
1889 Ga0495604_0181025
1890 Ga0495604_0196071
1891 Ga0495674_0014985
1892 Ga0495674_0055514
1893 Ga0495674_0100088
1894 Ga0495674_0139871
1895 Ga0495674_0155990
1896 Ga0495674_0258154
1897 Ga0495676_0060249
1898 Ga0495676_0182366
1899 Ga0495680_0007893
1900 Ga0495680_0175388
1901 Ga0495675_0121992
1902 Ga0495677_0045282
1903 Ga0495684_0025026
1904 Ga0495593_0140953
1905 Ga0495602_0077213
1906 Ga0495602_0116228
1907 Ga0495602_0143485
1908 Ga0496100_0006561
1909 Ga0496100_0023659
1910 Ga0496100_0023889
1911 Ga0496100_0129086
1912 Ga0496100_0248680
1913 Ga0496100_0313783
1914 Ga0496100_0382535
1915 Ga0496101_0000417
1916 Ga0496101_0004112
1917 Ga0496101_0035125
1918 Ga0496101_0073222
1919 Ga0496101_0123350
1920 Ga0496101_0157568
1921 Ga0496101_0176343
1922 Ga0496101_0256470
1923 Ga0496101_0291297
1924 Ga0496101_0292703
1925 Ga0496101_0368129
1926 Ga0496101_0403479
1927 Ga0496101_0479197
1928 Ga0496102_0000656
1929 Ga0496102_0009698
1930 Ga0496102_0017784
1931 Ga0496102_0055156
1932 Ga0496102_0067312
1933 Ga0496102_0094453
1934 Ga0496102_0316339
1935 Ga0496103_0000496
1936 Ga0496103_0000554
1937 Ga0496103_0012567
1938 Ga0496103_0018242
1939 Ga0496103_0032860
1940 Ga0496104_0003227
1941 Ga0496104_0012720
1942 Ga0496104_0019997
1943 Ga0496104_0025884
1944 Ga0496104_0040843
1945 Ga0496104_0044573
1946 Ga0496104_0058091
1947 Ga0496104_0066330
1948 Ga0496104_0070630
1949 Ga0496104_0072876
1950 Ga0496104_0075196
1951 Ga0496104_0100507
1952 Ga0496104_0108999
1953 Ga0496104_0140846
1954 Ga0496104_0172178
1955 Ga0496104_0172257
1956 Ga0496104_0332086
1957 Ga0496104_0382795
1958 Ga0496104_0574201
1959 Ga0496105_0019533
1960 Ga0496105_0024057
1961 Ga0496105_0028305
1962 Ga0496105_0054994
1963 Ga0496105_0119397
1964 Ga0496105_0257734
1965 Ga0496106_0000533
1966 Ga0496106_0006930
1967 Ga0496106_0008721
1968 Ga0496106_0015958
1969 Ga0496106_0164769
1970 Ga0496106_0186964
1971 Ga0496106_0407663
1972 Ga0496107_0000446
1973 Ga0496107_0000813
1974 Ga0496107_0017838
1975 Ga0496107_0034556
1976 Ga0496107_0038032
1977 Ga0496107_0119502
1978 Ga0496107_0134730
1979 Ga0496107_0161163
1980 Ga0496108_0001209
1981 Ga0496108_0013947
1982 Ga0496108_0014153
1983 Ga0496108_0017798
1984 Ga0496108_0018635
1985 Ga0496108_0054251
1986 Ga0496108_0056115
1987 Ga0496108_0085699
1988 Ga0496108_0103472
1989 Ga0496108_0203524
1990 Ga0496108_0223183
1991 Ga0496109_0000150
1992 Ga0496109_0003995
1993 Ga0496109_0009387
1994 Ga0496109_0023016
1995 Ga0496109_0046819
1996 Ga0496109_0054575
1997 Ga0496109_0067871
1998 Ga0496109_0100740
1999 Ga0496109_0125328
2000 Ga0496109_0178215
2001 Ga0496109_0280190
2002 Ga0496109_0345488
2003 Ga0496110_0007462
2004 Ga0496110_0007902
2005 Ga0496110_0045492
2006 Ga0496110_0048544
2007 Ga0496110_0103545
2008 Ga0496110_0149867
2009 Ga0496110_0209012
2010 Ga0496110_0256511
2011 Ga0496110_0293865
2012 Ga0496110_0320028
2013 Ga0496111_0159725
2014 Ga0496111_0181751
2015 Ga0496111_0224307
2016 Ga0496111_0289771
2017 Ga0496112_0005934
2018 Ga0496112_0009441
2019 Ga0496112_0024311
2020 Ga0496112_0055839
2021 Ga0496112_0057696
2022 Ga0496112_0062079
2023 Ga0496112_0123742
2024 Ga0496112_0176624
2025 Ga0496112_0182623
2026 Ga0496112_0241932
2027 Ga0496112_0258958
2028 Ga0496112_0335668
2029 Ga0496113_0009323
2030 Ga0496113_0015572
2031 Ga0496113_0029371
2032 Ga0496113_0067509
2033 Ga0496113_0119898
2034 Ga0496113_0141241
2035 Ga0496113_0148135
2036 Ga0496113_0163257
2037 Ga0496113_0266026
2038 Ga0496113_0281251
2039 Ga0496114_0000393
2040 Ga0496114_0008474
2041 Ga0496114_0076489
2042 Ga0496114_0264192
2043 Ga0496114_0412257
2044 Ga0496114_0610512
2045 Ga0496115_0003544
2046 Ga0496115_0009564
2047 Ga0496115_0020461
2048 Ga0496115_0037161
2049 Ga0496115_0095691
2050 Ga0496115_0107263
2051 Ga0496115_0137188
2052 Ga0496115_0215274
2053 Ga0496115_0237242
2054 Ga0496115_0289028
2055 Ga0496115_0310437
2056 Ga0496115_0452874
2057 nmdc:mga03683_53500_c1
2058 nmdc:mga00v17_246562_c1
2059 nmdc:mga0yw44_201955_c1
2060 nmdc:mga06z11_7090_c1
2061 nmdc:mga05p37_123265_c1
2062 nmdc:mga05p37_242699_c1
2063 nmdc:mga05p37_294764_c1
2064 nmdc:mga05p37_346013_c1
2065 nmdc:mga05p37_81912_c1
2066 nmdc:mga09592_10558_c1
2067 nmdc:mga09592_172394_c1
2068 nmdc:mga09592_191617_c1
2069 nmdc:mga09592_47677_c1
2070 nmdc:mga0qj67_124524_c1
2071 nmdc:mga0qj67_231675_c1
2072 nmdc:mga0qj67_244408_c1
2073 nmdc:mga0qj67_420912_c1
2074 nmdc:mga0qj67_7378_c1
2075 nmdc:mga0qj67_96498_c1
2076 nmdc:mga06r32_231436_c1
2077 nmdc:mga06r32_425817_c1
2078 nmdc:mga06r32_51599_c1
2079 nmdc:mga06r32_55524_c1
2080 nmdc:mga08y16_121549_c1
2081 nmdc:mga08y16_286424_c1
2082 nmdc:mga08y16_289250_c1
2083 nmdc:mga08y16_36936_c1
2084 nmdc:mga08y16_40005_c1
2085 nmdc:mga08y16_406041_c1
2086 nmdc:mga08y16_513130_c1
2087 nmdc:mga08y16_79682_c1
2088 nmdc:mga08y16_8860_c1
2089 nmdc:mga0n895_183779_c1
2090 nmdc:mga0n895_229152_c1
2091 nmdc:mga0n895_295323_c1
2092 nmdc:mga0n895_367071_c1
2093 nmdc:mga0n895_4344_c1
2094 nmdc:mga0n895_51683_c1
2095 nmdc:mga0n895_5635_c1
2096 nmdc:mga0a205_1625_c1
2097 nmdc:mga0a205_39527_c1
2098 nmdc:mga0a205_399688_c1
2099 nmdc:mga0a205_430_c1
2100 Ga0495601_0000460
2101 Ga0495601_0001261
2102 Ga0495601_0004351
2103 Ga0495601_0023396
2104 Ga0495601_0028968
2105 Ga0495601_0109477
2106 Ga0495601_0163979
2107 Ga0495601_0275172
2108 Ga0495612_0004070
2109 Ga0495612_0033627
2110 Ga0495612_0034504
2111 Ga0495612_0035781
2112 Ga0495655_0028869
2113 Ga0495595_0001469
2114 Ga0495595_0005222
2115 Ga0495595_0058823
2116 Ga0495595_0129127
2117 Ga0495595_0130670
2118 Ga0495619_0000510
2119 Ga0495619_0004909
2120 Ga0495619_0010695
2121 Ga0495619_0012092
2122 Ga0495619_0015380
2123 Ga0495619_0026643
2124 Ga0495619_0065065
2125 Ga0495619_0071606
2126 Ga0495619_0071642
2127 Ga0495619_0090495
2128 Ga0495619_0117418
2129 Ga0495619_0209721
2130 Ga0495619_0394560
2131 Ga0530510_0154780
2132 8006990170

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

77

371

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9233 26 323
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9145 26 323
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9097 24 323
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9068 24 323
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8903 28 323
ID Description Score Start End Superfamily
3lkvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9345 24 294 3.40.50.2300
3lkvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9286 24 294 3.40.50.2300
3lftB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9188 28 139 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8895 146 323 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8723 146 323 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7V9HTZ8-F1-model_v4 ABC transporter substrate-binding protein 0.9889 219 324
AF-A0A537SF60-F1-model_v4 ABC transporter substrate-binding protein 0.9816 26 324
AF-A0A537AKZ4-F1-model_v4 ABC transporter substrate-binding protein 0.9788 239 324
AF-A0A2V7I331-F1-model_v4 ABC transporter substrate-binding protein 0.9752 217 324
AF-A0A537SF60-F1-model_v4 ABC transporter substrate-binding protein 0.9751 26 324

Map