F489449

General Info

Members Datasets Scaffolds Average Seq Length
1068 559 789 220

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0073023|Ga0495648_0073023_147_905
Length 252
Sequence MTGGSLPFLCQQQAYNFRPRYSVGFVLEENLMFTGIIESIGSIRALTPKGGDVRVHVETGKLDLSDVKLGDSIAVNGVCLTAVELPGNGFAADVSRETLDCTAMNDLKSGSPVNLEKALTPTTRLGGHLVSGHVDGVGEVVARTENARAVEFRIRAPKELARYIAHKGSITVDGTSLTVNAVDGAEFLLTIIPHTLSETIMASYQPGRRVNLEVDLLARYLERLLLGDKAAEPTAGSTITESFLAQNGYLKS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231004 Pseudomonas sp. GM102 Isolate Nodule
3 2511231006 Pseudomonas sp. GM17 Isolate Nodule
4 2511231007 Pseudomonas sp. GM18 Isolate Nodule
5 2511231008 Pseudomonas sp. GM21 Isolate Nodule
6 2511231010 Pseudomonas sp. GM25 Isolate Nodule
7 2511231011 Pseudomonas sp. GM30 Isolate Nodule
8 2511231012 Pseudomonas sp. GM33 Isolate Nodule
9 2511231014 Pseudomonas sp. GM48 Isolate Nodule
10 2511231015 Pseudomonas sp. GM49 Isolate Nodule
11 2511231016 Pseudomonas sp. GM50 Isolate Nodule
12 2511231017 Pseudomonas sp. GM55 Isolate Nodule
13 2511231018 Pseudomonas sp. GM60 Isolate Nodule
14 2511231019 Pseudomonas sp. GM67 Isolate Nodule
15 2511231020 Pseudomonas sp. GM74 Isolate Nodule
16 2511231021 Pseudomonas sp. GM78 Isolate Nodule
17 2511231022 Pseudomonas sp. GM79 Isolate Nodule
18 2511231023 Pseudomonas sp. GM80 Isolate Nodule
19 2511231024 Pseudomonas sp. GM84 Isolate Nodule
20 2511231031 Pseudomonas sp. GM16 Isolate Nodule
21 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
22 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
23 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
24 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
25 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
26 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
27 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
28 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
29 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
30 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
31 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
32 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
33 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
34 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
35 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
36 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
37 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
38 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
39 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
40 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
41 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
42 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
43 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
44 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
45 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
46 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
47 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
48 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
49 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
50 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
51 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
52 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
53 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
54 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
55 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
56 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
57 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
58 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
59 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
60 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
61 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
62 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
63 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
64 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
65 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
66 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
67 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
68 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
69 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
70 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
71 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
72 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
73 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
74 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
75 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
76 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
77 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
78 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
79 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
80 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
81 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
82 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
83 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
84 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
85 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
86 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
87 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
88 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
89 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
90 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
91 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
92 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
93 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
94 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
95 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
96 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
97 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
98 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
99 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
100 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
101 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
102 2643221641 Nocardioides sp. Root122 Isolate Unclassified
103 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
104 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
105 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
106 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
107 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
108 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
109 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
110 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
111 2671180694 Paenibacillus sp. A3 Isolate Unclassified
112 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
113 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
114 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
115 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
116 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
117 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
118 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
119 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
120 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
121 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
122 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
123 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
124 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
125 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
126 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
127 2738543010 Bacillus sp. YR335 Isolate Unclassified
128 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
129 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
130 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
131 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
132 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
133 2739367898 Nocardioides sp. CF479 Isolate Unclassified
134 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
135 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
136 2765235841 Pseudomonas putida AA7 Isolate Unclassified
137 2773857670 Pseudomonas sp. 478 Isolate Unclassified
138 2773857673 Pseudomonas sp. 443 Isolate Unclassified
139 2784132063 Pseudomonas sp. 424 Isolate Unclassified
140 2784132072 Pseudomonas sp. 460 Isolate Unclassified
141 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
142 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
143 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
144 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
145 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
146 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
147 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
148 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
149 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
150 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
151 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
152 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
153 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
154 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
155 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
156 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
157 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
158 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
159 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
160 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
161 2818991459 Paenibacillus sp. 597 Isolate Unclassified
162 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
163 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
164 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
165 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
166 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
167 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
168 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
169 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
170 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
171 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
172 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
173 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
174 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
175 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
176 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
177 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
178 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
179 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
180 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
181 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
182 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
183 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
184 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
185 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
186 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
187 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
188 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
189 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
190 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
191 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
192 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
193 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
194 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
195 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
196 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
197 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
198 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
199 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
200 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
201 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
202 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
203 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
204 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
205 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
206 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
207 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
208 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
209 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
210 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
211 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
212 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
213 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
214 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
215 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
216 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
217 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
218 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
219 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
220 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
221 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
222 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
223 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
224 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
225 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
226 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
227 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
228 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
229 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
230 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
231 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
232 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
233 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
234 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
235 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
236 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
237 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
238 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
239 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
240 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
241 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
242 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
243 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
244 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
245 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
246 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
247 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
248 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
249 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
250 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
251 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
252 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
253 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
254 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
255 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
256 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
257 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
258 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
259 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
260 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
261 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
262 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
263 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
264 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
265 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
266 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
267 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
268 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
269 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
270 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
271 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
272 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
273 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
274 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
275 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
276 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
277 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
278 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
279 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
280 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
281 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
282 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
283 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
284 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
285 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
286 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
287 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
288 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
289 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
290 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
291 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
292 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
293 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
294 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
295 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
296 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
297 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
298 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
299 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
300 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
301 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
302 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
303 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
304 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
305 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
306 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
307 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
308 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
309 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
310 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
311 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
312 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
313 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
314 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
315 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
316 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
317 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
318 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
319 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
320 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
321 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
322 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
323 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
324 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
325 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
326 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
344 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
345 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
346 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
347 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
348 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
349 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
350 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
351 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
352 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
354 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
355 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
356 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
357 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
358 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
359 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
360 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
361 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
362 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
363 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
364 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
365 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
366 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
367 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
368 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
369 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
370 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
371 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
372 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
373 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
374 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
375 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
377 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
378 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
379 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
380 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
381 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
382 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
383 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
384 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
385 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
386 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
387 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
388 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
389 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
390 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
391 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
392 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
393 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
394 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
395 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
396 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
397 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
398 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
399 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
400 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
401 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
402 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
403 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
404 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
405 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
406 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
407 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
408 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
409 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
410 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
411 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
412 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
413 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
414 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
415 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
416 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
417 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
418 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
419 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
420 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
421 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
422 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
423 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
424 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
425 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
426 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
427 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
428 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
429 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
430 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
431 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
432 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
433 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
434 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
435 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
436 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
437 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
438 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
439 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
440 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
441 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
442 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
443 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
444 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
445 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
446 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
447 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
448 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
449 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
450 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
451 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
452 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
453 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
454 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
455 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
456 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
457 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
458 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
459 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
460 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
461 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
462 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
463 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
464 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
465 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
466 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
467 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
468 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
469 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
470 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
471 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
472 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
473 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
474 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
475 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
476 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
477 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
478 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
479 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
480 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
481 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
482 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
483 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
484 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
485 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
486 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
487 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
488 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
489 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
490 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
491 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
492 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
493 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
494 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
495 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
496 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
497 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
498 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
499 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
500 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
501 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
502 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
503 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
504 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
505 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
506 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
507 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
508 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
509 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
510 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
511 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
512 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
513 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
514 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
515 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
516 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
517 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
518 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
519 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
520 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
521 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
522 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
523 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
524 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
525 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
526 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
527 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
528 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
529 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
530 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
531 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
532 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
533 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
534 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
535 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
536 8052494512 Pseudomonas putida LD6 Isolate Unclassified
537 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
538 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
539 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
540 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
541 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
542 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
543 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
544 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
545 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
546 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
547 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
548 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
549 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
550 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
551 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
552 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
553 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
554 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
555 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
556 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
557 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
558 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
559 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.22
Metatranscriptomes 0.66
Isolates 26.12

Biome Distribution

Category Percentage (%)
Aerial Root 0.09
Bulb 0
Endosphere 5.9
Nodule 2.9
Rhizoplane 7.49
Rhizosphere 69.66
Stem 0
Stem Tuber 0
Unclassified 13.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2478714 2162886007 Bacteria 1035
2 JGI25162J39368_1005306 3300002737 Bacteria 2591
3 JGI25162J39368_1005513 3300002737 Bacteria 2449
4 JGI25154J39366_1004759 3300002738 Bacteria 2327
5 JGI25163J39215_1001948 3300002771 Bacteria 2591
6 JGI25163J39215_1002029 3300002771 Bacteria 2449
7 JGI25164J39214_1002669 3300002772 Bacteria 2591
8 JGI25164J39214_1002812 3300002772 Bacteria 2449
9 JGI25165J46597_1005143 3300003214 Bacteria 2591
10 JGI25165J46597_1005440 3300003214 Bacteria 2449
11 rootH1_10001451 3300003323 Bacteria 19518
12 rootH1_10025242 3300003323 Bacteria 17315
13 Ga0055538_1000042 3300003751 Bacteria 164754
14 Ga0055539_1000055 3300003752 Bacteria 164754
15 Ga0055533_1000067 3300003756 Bacteria 164754
16 Ga0055532_1000053 3300003758 Bacteria 164751
17 Ga0055525_1000103 3300003759 Bacteria 134778
18 Ga0055535_1002633 3300003761 Bacteria 5971
19 Ga0055536_1002107 3300003781 Bacteria 11324
20 Ga0055536_1013930 3300003781 Bacteria 2861
21 Ga0055536_1017823 3300003781 Bacteria 2305
22 Ga0055530_10004850 3300003791 Bacteria 6722
23 Ga0055530_10015387 3300003791 Bacteria 2499
24 Ga0055530_10015585 3300003791 Bacteria 2472
25 Ga0055540_1000330 3300003792 Bacteria 41330
26 Ga0055540_1000552 3300003792 Bacteria 27915
27 Ga0055540_1009024 3300003792 Bacteria 3506
28 Ga0055540_1021543 3300003792 Bacteria 1670
29 Ga0055531_10000125 3300003794 Bacteria 86349
30 Ga0055541_1000042 3300003841 Bacteria 164754
31 Ga0058692_1017633 3300003856 Bacteria 1563
32 Ga0065714_10003334 3300005288 Bacteria 11093
33 Ga0065714_10012864 3300005288 Bacteria 2248
34 Ga0065714_10086001 3300005288 Bacteria 2120
35 Ga0065704_10009187 3300005289 Bacteria 4565
36 Ga0065704_10032660 3300005289 Bacteria 1196
37 Ga0065704_10161370 3300005289 Bacteria 1352
38 Ga0065704_10212940 3300005289 Bacteria 1102
39 Ga0065712_10011834 3300005290 Bacteria 2451
40 Ga0065712_10068081 3300005290 Bacteria 15301
41 Ga0070670_100000686 3300005331 Bacteria 26278
42 Ga0070661_100000664 3300005344 Bacteria 25245
43 Ga0070669_100000417 3300005353 Bacteria 32587
44 Ga0070669_100001254 3300005353 Bacteria 18423
45 Ga0070669_100283914 3300005353 Bacteria 1327
46 Ga0070673_100681125 3300005364 Bacteria 943
47 Ga0070663_100337175 3300005455 Bacteria 1217
48 Ga0070662_100000042 3300005457 Bacteria 72274
49 Ga0070662_100045050 3300005457 Bacteria 3163
50 Ga0070665_100031276 3300005548 Bacteria 5357
51 Ga0070665_100150735 3300005548 Bacteria 2328
52 Ga0070664_100000733 3300005564 Bacteria 25237
53 Ga0068854_100007019 3300005578 Bacteria 7185
54 Ga0068859_101243290 3300005617 Bacteria 820
55 Ga0068851_10000002 3300005834 Bacteria 302756
56 Ga0075432_10012148 3300006058 Bacteria 2927
57 Ga0075432_10018695 3300006058 Bacteria 2364
58 Ga0075432_10102147 3300006058 Bacteria 1060
59 Ga0075362_10070790 3300006177 Bacteria 1592
60 Ga0075362_10132324 3300006177 Bacteria 1187
61 Ga0075369_10089781 3300006186 Bacteria 1370
62 Ga0097620_101243042 3300006931 Bacteria 820
63 Ga0099823_1000360 3300006944 Bacteria 28884
64 Ga0079104_1000478 3300006946 Bacteria 44469
65 Ga0079104_1000630 3300006946 Bacteria 34371
66 Ga0079104_1018176 3300006946 Bacteria 1999
67 Ga0105251_10000011 3300009011 Bacteria 180176
68 Ga0105251_10000163 3300009011 Bacteria 68706
69 Ga0105251_10003296 3300009011 Bacteria 11815
70 Ga0105251_10022564 3300009011 Bacteria 3265
71 Ga0105251_10034835 3300009011 Bacteria 2488
72 Ga0105251_10047747 3300009011 Bacteria 2056
73 Ga0105251_10058309 3300009011 Bacteria 1823
74 Ga0105251_10072165 3300009011 Bacteria 1605
75 Ga0105244_10003742 3300009036 Bacteria 10742
76 Ga0105244_10007401 3300009036 Bacteria 6978
77 Ga0105244_10010383 3300009036 Bacteria 5650
78 Ga0105244_10040053 3300009036 Bacteria 2435
79 Ga0105244_10043153 3300009036 Bacteria 2328
80 Ga0105244_10044573 3300009036 Bacteria 2285
81 Ga0105244_10045278 3300009036 Bacteria 2264
82 Ga0105244_10078772 3300009036 Bacteria 1633
83 Ga0105244_10099077 3300009036 Bacteria 1427
84 Ga0105250_10001071 3300009092 Bacteria 15533
85 Ga0105250_10013916 3300009092 Bacteria 3313
86 Ga0105250_10024365 3300009092 Bacteria 2438
87 Ga0105250_10025701 3300009092 Bacteria 2373
88 Ga0105250_10027894 3300009092 Bacteria 2275
89 Ga0105250_10192138 3300009092 Bacteria 859
90 Ga0105245_10740487 3300009098 Bacteria 1018
91 Ga0105243_10000188 3300009148 Bacteria 71863
92 Ga0105243_10001384 3300009148 Bacteria 21521
93 Ga0105243_10048181 3300009148 Bacteria 3358
94 Ga0105243_10070431 3300009148 Bacteria 2824
95 Ga0105243_10102040 3300009148 Bacteria 2383
96 Ga0105242_10000489 3300009176 Bacteria 31476
97 Ga0105248_10021285 3300009177 Bacteria 7187
98 Ga0105237_10002187 3300009545 Bacteria 24489
99 Ga0105237_10201739 3300009545 Bacteria 1989
100 Ga0105249_10821813 3300009553 Bacteria 994
101 Ga0105246_10032547 3300011119 Bacteria 3458
102 Ga0105246_10038380 3300011119 Bacteria 3220
103 Ga0105246_10052541 3300011119 Bacteria 2801
104 Ga0105246_10054731 3300011119 Bacteria 2751
105 Ga0157336_1000676 3300012477 Bacteria 1592
106 Ga0157345_1000583 3300012498 Bacteria 3189
107 Ga0157373_10012234 3300013100 Bacteria 6309
108 Ga0157373_10082456 3300013100 Bacteria 2267
109 Ga0157373_10085261 3300013100 Bacteria 2226
110 Ga0157371_10000243 3300013102 Bacteria 77959
111 Ga0157371_10035661 3300013102 Bacteria 3565
112 Ga0157371_10081760 3300013102 Bacteria 2287
113 Ga0157371_10124307 3300013102 Bacteria 1835
114 Ga0157371_10396060 3300013102 Bacteria 1010
115 Ga0157371_10573519 3300013102 Bacteria 838
116 Ga0157371_10573520 3300013102 Bacteria 838
117 Ga0157370_10000199 3300013104 Bacteria 75511
118 Ga0157370_10140916 3300013104 Bacteria 2246
119 Ga0157370_10141103 3300013104 Bacteria 2245
120 Ga0157370_10919384 3300013104 Bacteria 794
121 Ga0157369_10109808 3300013105 Bacteria 2932
122 Ga0157369_10178907 3300013105 Bacteria 2232
123 Ga0157369_10648022 3300013105 Bacteria 1089
124 Ga0157369_10668585 3300013105 Bacteria 1070
125 Ga0157369_10713790 3300013105 Bacteria 1032
126 Ga0163162_10164309 3300013306 Bacteria 2343
127 Ga0163162_10176131 3300013306 Bacteria 2264
128 Ga0157372_10001840 3300013307 Bacteria 22986
129 Ga0157372_10042028 3300013307 Bacteria 5054
130 Ga0182008_10002892 3300014497 Bacteria 10626
131 Ga0182008_10043820 3300014497 Bacteria 2227
132 Ga0182008_10051354 3300014497 Bacteria 2045
133 Ga0182008_10052508 3300014497 Bacteria 2020
134 Ga0182006_1005570 3300015261 Bacteria 5980
135 Ga0182006_1031266 3300015261 Bacteria 2146
136 Ga0182006_1031761 3300015261 Bacteria 2126
137 Ga0182006_1049210 3300015261 Bacteria 1627
138 Ga0182006_1108978 3300015261 Bacteria 974
139 Ga0182007_10019444 3300015262 Bacteria 2441
140 Ga0182007_10026349 3300015262 Bacteria 2016
141 Ga0182005_1008848 3300015265 Bacteria 2955
142 Ga0182005_1014004 3300015265 Bacteria 2250
143 Ga0182005_1038979 3300015265 Bacteria 1293
144 Ga0163161_10110357 3300017792 Bacteria 2056
145 Ga0163161_10742042 3300017792 Bacteria 821
146 Ga0163161_10873663 3300017792 Bacteria 760
147 Ga0209435_103159 3300025206 Bacteria 1888
148 Ga0209760_100058 3300025207 Bacteria 98827
149 Ga0209760_100060 3300025207 Bacteria 97274
150 Ga0209784_100060 3300025224 Bacteria 164838
151 Ga0209566_100075 3300025225 Bacteria 164838
152 Ga0209566_100644 3300025225 Bacteria 21095
153 Ga0209674_100100 3300025226 Bacteria 164838
154 Ga0209147_100096 3300025229 Bacteria 164838
155 Ga0209563_100118 3300025230 Bacteria 131627
156 Ga0209563_100242 3300025230 Bacteria 26179
157 Ga0207427_100056 3300025231 Bacteria 204343
158 Ga0207427_100063 3300025231 Bacteria 177711
159 Ga0209437_100065 3300025233 Bacteria 332417
160 Ga0209437_100133 3300025233 Bacteria 178493
161 Ga0209258_100221 3300025242 Bacteria 108497
162 Ga0209646_1000230 3300025246 Bacteria 59499
163 Ga0209677_100057 3300025253 Bacteria 164838
164 Ga0209759_1001811 3300025256 Bacteria 10796
165 Ga0209233_1000085 3300025261 Bacteria 333078
166 Ga0209233_1000133 3300025261 Bacteria 202716
167 Ga0209675_1004836 3300025291 Bacteria 5837
168 Ga0209676_1000076 3300025292 Bacteria 301393
169 Ga0209676_1000314 3300025292 Bacteria 94905
170 Ga0209676_1000337 3300025292 Bacteria 89361
171 Ga0209676_1001941 3300025292 Bacteria 16658
172 Ga0209676_1018983 3300025292 Bacteria 2379
173 Ga0209050_1000063 3300025298 Bacteria 314955
174 Ga0209050_1000080 3300025298 Bacteria 275154
175 Ga0209050_1000106 3300025298 Bacteria 224396
176 Ga0209050_1002168 3300025298 Bacteria 17764
177 Ga0209051_1000045 3300025303 Bacteria 297882
178 Ga0209051_1000260 3300025303 Bacteria 88213
179 Ga0209051_1000283 3300025303 Bacteria 82731
180 Ga0209051_1023520 3300025303 Bacteria 2558
181 Ga0209257_1000185 3300025304 Bacteria 155047
182 Ga0207656_10000010 3300025321 Bacteria 192224
183 Ga0207696_1000047 3300025711 Bacteria 285005
184 Ga0207696_1000118 3300025711 Bacteria 147902
185 Ga0207696_1000168 3300025711 Bacteria 103496
186 Ga0207696_1000339 3300025711 Bacteria 48686
187 Ga0207696_1006336 3300025711 Bacteria 4778
188 Ga0207696_1007078 3300025711 Bacteria 4435
189 Ga0207696_1015131 3300025711 Bacteria 2623
190 Ga0207655_1000104 3300025728 Bacteria 184765
191 Ga0207655_1000120 3300025728 Bacteria 157018
192 Ga0207655_1000415 3300025728 Bacteria 58289
193 Ga0207655_1000606 3300025728 Bacteria 43412
194 Ga0207655_1000921 3300025728 Bacteria 30542
195 Ga0207655_1001228 3300025728 Bacteria 24726
196 Ga0207655_1001571 3300025728 Bacteria 20542
197 Ga0207655_1005549 3300025728 Bacteria 8553
198 Ga0207655_1006374 3300025728 Bacteria 7832
199 Ga0207655_1030279 3300025728 Bacteria 2519
200 Ga0207655_1037818 3300025728 Bacteria 2119
201 Ga0207655_1075129 3300025728 Bacteria 1241
202 Ga0207655_1087892 3300025728 Bacteria 1101
203 Ga0207713_1000049 3300025735 Bacteria 227882
204 Ga0207713_1000073 3300025735 Bacteria 181519
205 Ga0207713_1000261 3300025735 Bacteria 65024
206 Ga0207713_1001031 3300025735 Bacteria 24228
207 Ga0207713_1003024 3300025735 Bacteria 11729
208 Ga0207713_1004132 3300025735 Bacteria 9552
209 Ga0207713_1004152 3300025735 Bacteria 9518
210 Ga0207713_1005408 3300025735 Bacteria 7997
211 Ga0207713_1007215 3300025735 Bacteria 6611
212 Ga0207713_1008483 3300025735 Bacteria 5914
213 Ga0207713_1020756 3300025735 Bacteria 3171
214 Ga0207713_1024817 3300025735 Bacteria 2783
215 Ga0207713_1036082 3300025735 Bacteria 2125
216 Ga0207713_1039597 3300025735 Bacteria 1986
217 Ga0207713_1044187 3300025735 Bacteria 1832
218 Ga0207713_1075843 3300025735 Bacteria 1225
219 Ga0207705_10244038 3300025909 Bacteria 1369
220 Ga0207671_10000380 3300025914 Bacteria 62950
221 Ga0207649_10000041 3300025920 Bacteria 117781
222 Ga0207649_10723761 3300025920 Bacteria 773
223 Ga0207681_10000342 3300025923 Bacteria 33558
224 Ga0207681_10006860 3300025923 Bacteria 6984
225 Ga0207681_10283672 3300025923 Bacteria 1305
226 Ga0207650_10000278 3300025925 Bacteria 53364
227 Ga0207650_10000324 3300025925 Bacteria 46570
228 Ga0207706_10000128 3300025933 Bacteria 81615
229 Ga0207706_10012214 3300025933 Bacteria 7827
230 Ga0207686_10001625 3300025934 Bacteria 12587
231 Ga0207709_10000030 3300025935 Bacteria 331710
232 Ga0207709_10000343 3300025935 Bacteria 48072
233 Ga0207709_10046034 3300025935 Bacteria 2645
234 Ga0207709_10278852 3300025935 Bacteria 1234
235 Ga0207669_10130435 3300025937 Bacteria 1726
236 Ga0207711_10057873 3300025941 Bacteria 3333
237 Ga0207679_10000081 3300025945 Bacteria 84888
238 Ga0207712_10607671 3300025961 Bacteria 946
239 Ga0207640_10008549 3300025981 Bacteria 5686
240 Ga0209281_1000070 3300027111 Bacteria 277098
241 Ga0209281_1000127 3300027111 Bacteria 200036
242 Ga0209281_1002082 3300027111 Bacteria 8960
243 Ga0209281_1011659 3300027111 Bacteria 1959
244 Ga0209973_1008316 3300027252 Bacteria 1181
245 Ga0209389_1000020 3300027296 Bacteria 172003
246 Ga0209389_1065562 3300027296 Bacteria 2125
247 Ga0209371_1000228 3300027312 Bacteria 72315
248 Ga0209371_1000302 3300027312 Bacteria 55126
249 Ga0209371_1004867 3300027312 Bacteria 5619
250 Ga0209969_1007382 3300027360 Bacteria 1553
251 Ga0209996_1002060 3300027395 Bacteria 2480
252 Ga0209995_1002220 3300027471 Bacteria 3057
253 Ga0209999_1012969 3300027543 Bacteria 1511
254 Ga0209999_1042362 3300027543 Bacteria 854
255 Ga0207428_10014173 3300027907 Bacteria 6938
256 Ga0207428_10050869 3300027907 Bacteria 3312
257 Ga0207428_10101513 3300027907 Bacteria 2223
258 Ga0207428_10109854 3300027907 Bacteria 2124
259 Ga0207428_10146760 3300027907 Bacteria 1797
260 Ga0207428_10160413 3300027907 Bacteria 1708
261 Ga0268266_10007379 3300028379 Bacteria 9928
262 Ga0268266_10447827 3300028379 Bacteria 1227
263 Ga0268256_1000188 3300030500 Bacteria 72315
264 Ga0268256_1000669 3300030500 Bacteria 26000
265 Ga0268256_1006735 3300030500 Bacteria 4223
266 Ga0316177_1078431 3300030731 Bacteria 2742
267 Ga0314311_1094938 3300030733 Bacteria 6797
268 Ga0316179_1075362 3300030734 Bacteria 1196
269 Ga0316178_1011341 3300030735 Bacteria 8135
270 Ga0316183_1006673 3300030742 Bacteria 837
271 Ga0316183_1205059 3300030742 Bacteria 1714
272 Ga0316181_1020879 3300030744 Bacteria 7161
273 Ga0316181_1093595 3300030744 Bacteria 3354
274 Ga0265331_10007682 3300031250 Bacteria 6207
275 Ga0265327_10001699 3300031251 Bacteria 26311
276 Ga0265327_10003331 3300031251 Bacteria 15531
277 Ga0265327_10003570 3300031251 Bacteria 14714
278 Ga0265316_10002392 3300031344 Bacteria 19536
279 Ga0307408_100000013 3300031548 Bacteria 386212
280 Ga0307408_100000192 3300031548 Bacteria 65993
281 Ga0307408_100059501 3300031548 Bacteria 2780
282 Ga0307408_100104143 3300031548 Bacteria 2167
283 Ga0307408_101040811 3300031548 Bacteria 756
284 Ga0316575_10002085 3300031665 Bacteria 6677
285 Ga0316575_10054629 3300031665 Bacteria 1590
286 Ga0307516_10100762 3300031730 Bacteria 2704
287 Ga0307405_10079322 3300031731 Bacteria 2139
288 Ga0307405_10084243 3300031731 Bacteria 2086
289 Ga0307413_10076951 3300031824 Bacteria 2122
290 Ga0307406_10001571 3300031901 Bacteria 12584
291 Ga0307407_10060628 3300031903 Bacteria 2208
292 Ga0307412_10275955 3300031911 Bacteria 1317
293 Ga0307412_10852062 3300031911 Bacteria 795
294 Ga0307409_100164583 3300031995 Bacteria 1944
295 Ga0307416_100355594 3300032002 Bacteria 1484
296 Ga0307416_100810323 3300032002 Bacteria 1032
297 Ga0307416_101578477 3300032002 Bacteria 762
298 Ga0307414_10014793 3300032004 Bacteria 4690
299 Ga0307414_10079818 3300032004 Bacteria 2390
300 Ga0307414_10095095 3300032004 Bacteria 2225
301 Ga0307411_10032563 3300032005 Bacteria 3222
302 Ga0307411_10080529 3300032005 Bacteria 2239
303 Ga0316593_10122454 3300032168 Bacteria 935
304 Ga0307510_10067813 3300033180 Bacteria 3587
305 Ga0316574_0009395 3300035398 Bacteria 5477
306 Ga0316582_0138732 3300036647 Bacteria 1638
307 Ga0316582_0439337 3300036647 Bacteria 899
308 Ga0316584_0016769 3300036712 Bacteria 5255
309 Ga0316584_0150926 3300036712 Bacteria 1730
310 Ga0237819_00789 3300038705 Bacteria 10134
311 Ga0400485_00908 3300038735 Bacteria 2719
312 Ga0400486_03367 3300038742 Bacteria 4720
313 Ga0400483_245346 3300039062 Bacteria 1034
314 Ga0400483_271482 3300039062 Bacteria 3860
315 Ga0400489_54721 3300039093 Bacteria 1400
316 Ga0439436_0056726 3300041404 Bacteria 1099
317 Ga0439438_002874 3300041405 Bacteria 7164
318 Ga0439438_005405 3300041405 Bacteria 4705
319 Ga0439438_013588 3300041405 Bacteria 2450
320 Ga0439438_019662 3300041405 Bacteria 1906
321 Ga0439438_020305 3300041405 Bacteria 1865
322 Ga0439438_022354 3300041405 Bacteria 1754
323 Ga0439438_025244 3300041405 Bacteria 1621
324 Ga0439447_005046 3300041407 Bacteria 4442
325 Ga0439447_008010 3300041407 Bacteria 3303
326 Ga0439447_013421 3300041407 Bacteria 2323
327 Ga0439447_013584 3300041407 Bacteria 2305
328 Ga0439466_0004914 3300041411 Bacteria 5136
329 Ga0439466_0006573 3300041411 Bacteria 4416
330 Ga0439466_0020358 3300041411 Bacteria 2364
331 Ga0439466_0022380 3300041411 Bacteria 2231
332 Ga0439466_0027219 3300041411 Bacteria 1981
333 Ga0439466_0035356 3300041411 Bacteria 1690
334 Ga0439466_0050004 3300041411 Bacteria 1371
335 Ga0439466_0057743 3300041411 Bacteria 1256
336 Ga0439465_0183859 3300041413 Bacteria 757
337 Ga0451843_0221753 3300041509 Bacteria 1607
338 Ga0451855_1859058 3300041511 Bacteria 876
339 Ga0439437_000899 3300042000 Bacteria 3091
340 Ga0439432_002353 3300042006 Bacteria 7134
341 Ga0439432_006366 3300042006 Bacteria 4223
342 Ga0439432_012974 3300042006 Bacteria 2838
343 Ga0439432_020988 3300042006 Bacteria 2168
344 Ga0439432_027068 3300042006 Bacteria 1874
345 Ga0439432_126370 3300042006 Bacteria 755
346 Ga0439449_0104606 3300042007 Bacteria 1047
347 Ga0439451_000464 3300042009 Bacteria 7884
348 Ga0439452_007545 3300042010 Bacteria 3329
349 Ga0439452_013254 3300042010 Bacteria 2319
350 Ga0439452_013601 3300042010 Bacteria 2280
351 Ga0439452_013880 3300042010 Bacteria 2251
352 Ga0439452_015689 3300042010 Bacteria 2071
353 Ga0439456_000103 3300042013 Bacteria 28631
354 Ga0439456_007236 3300042013 Bacteria 2274
355 Ga0439463_000187 3300042016 Bacteria 16491
356 Ga0439463_000495 3300042016 Bacteria 11003
357 Ga0439463_008136 3300042016 Bacteria 2586
358 Ga0450911_000022 3300042115 Bacteria 91239
359 Ga0450911_002724 3300042115 Bacteria 3355
360 Ga0450911_003507 3300042115 Bacteria 2750
361 Ga0450923_053418 3300042125 Bacteria 871
362 Ga0450890_007951 3300042127 Bacteria 1356
363 Ga0450902_000456 3300042137 Bacteria 5068
364 Ga0450902_001945 3300042137 Bacteria 2881
365 Ga0450903_003615 3300042138 Bacteria 2669
366 Ga0450904_001485 3300042139 Bacteria 3253
367 Ga0450904_002387 3300042139 Bacteria 2254
368 Ga0450905_000070 3300042142 Bacteria 9618
369 Ga0450906_004475 3300042145 Bacteria 2929
370 Ga0450907_002607 3300042146 Bacteria 3376
371 Ga0450907_003068 3300042146 Bacteria 3036
372 Ga0450910_004219 3300042147 Bacteria 1937
373 Ga0439446_0000864 3300042156 Bacteria 6495
374 Ga0439446_0002450 3300042156 Bacteria 4454
375 Ga0439446_0012710 3300042156 Bacteria 2302
376 Ga0439446_0013034 3300042156 Bacteria 2276
377 Ga0439446_0017685 3300042156 Bacteria 1993
378 Ga0450908_006061 3300042184 Bacteria 2307
379 Ga0450909_002548 3300042185 Bacteria 2581
380 Ga0450909_005861 3300042185 Bacteria 1772
381 Ga0439434_0007187 3300042435 Bacteria 3262
382 Ga0439434_0025739 3300042435 Bacteria 1776
383 Ga0439459_0017311 3300042438 Bacteria 1341
384 Ga0439464_0108102 3300042439 Bacteria 849
385 Ga0439460_0001891 3300042461 Bacteria 4995
386 Ga0439460_0008816 3300042461 Bacteria 2550
387 Ga0439460_0023645 3300042461 Bacteria 1696
388 Ga0450893_0008181 3300042532 Bacteria 1701
389 Ga0451577_0077381 3300042876 Bacteria 2966
390 Ga0451577_0719363 3300042876 Bacteria 904
391 Ga0439440_0001951 3300042993 Bacteria 3833
392 Ga0466961_0148238 3300044693 Bacteria 1466
393 Ga0453684_0001596 3300044712 Bacteria 62273
394 Ga0453684_0006330 3300044712 Bacteria 22598
395 Ga0453684_0144478 3300044712 Bacteria 2836
396 Ga0453684_0215480 3300044712 Bacteria 2228
397 Ga0451576_0000174 3300045051 Bacteria 162062
398 Ga0495617_006470 3300046452 Bacteria 4104
399 Ga0495617_009460 3300046452 Bacteria 3347
400 Ga0495617_023101 3300046452 Bacteria 2101
401 Ga0495627_000037 3300046453 Bacteria 198542
402 Ga0495627_000291 3300046453 Bacteria 49966
403 Ga0495627_010669 3300046453 Bacteria 3330
404 Ga0495627_011003 3300046453 Bacteria 3261
405 Ga0495627_012131 3300046453 Bacteria 3068
406 Ga0495627_047436 3300046453 Bacteria 1302
407 Ga0495603_0038509 3300046455 Bacteria 2866
408 Ga0495603_0158086 3300046455 Bacteria 1315
409 Ga0495590_0015406 3300046457 Bacteria 2775
410 Ga0495590_0020517 3300046457 Bacteria 2347
411 Ga0495590_0029866 3300046457 Bacteria 1910
412 Ga0495591_000036 3300046458 Bacteria 167479
413 Ga0495591_000753 3300046458 Bacteria 23393
414 Ga0495591_002445 3300046458 Bacteria 10328
415 Ga0495591_002891 3300046458 Bacteria 9213
416 Ga0495591_009904 3300046458 Bacteria 3743
417 Ga0495591_010733 3300046458 Bacteria 3524
418 Ga0495591_018415 3300046458 Bacteria 2369
419 Ga0495591_019925 3300046458 Bacteria 2231
420 Ga0495629_0193868 3300046459 Bacteria 1406
421 Ga0495638_0031267 3300046460 Bacteria 3421
422 Ga0495638_0045618 3300046460 Bacteria 2756
423 Ga0495638_0049486 3300046460 Bacteria 2627
424 Ga0495638_0100145 3300046460 Bacteria 1734
425 Ga0495638_0113834 3300046460 Bacteria 1604
426 Ga0495638_0248350 3300046460 Bacteria 982
427 Ga0495653_0001298 3300046463 Bacteria 19360
428 Ga0495653_0046779 3300046463 Bacteria 3349
429 Ga0495650_0000311 3300046471 Bacteria 87755
430 Ga0495650_0003191 3300046471 Bacteria 12212
431 Ga0495650_0010347 3300046471 Bacteria 5212
432 Ga0495650_0027431 3300046471 Bacteria 2631
433 Ga0495650_0036991 3300046471 Bacteria 2129
434 Ga0495605_0000033 3300046474 Bacteria 209203
435 Ga0495605_0000209 3300046474 Bacteria 71906
436 Ga0495605_0001216 3300046474 Bacteria 17156
437 Ga0495605_0002128 3300046474 Bacteria 12385
438 Ga0495605_0016035 3300046474 Bacteria 4064
439 Ga0495605_0030986 3300046474 Bacteria 2735
440 Ga0495605_0051663 3300046474 Bacteria 2000
441 Ga0495605_0079791 3300046474 Bacteria 1532
442 Ga0495605_0166072 3300046474 Bacteria 977
443 Ga0495639_0000248 3300046475 Bacteria 26780
444 Ga0495639_0109206 3300046475 Bacteria 1311
445 Ga0495584_0038504 3300046491 Bacteria 2416
446 Ga0495584_0039709 3300046491 Bacteria 2377
447 Ga0495584_0041802 3300046491 Bacteria 2313
448 Ga0495584_0042048 3300046491 Bacteria 2306
449 Ga0495584_0044790 3300046491 Bacteria 2232
450 Ga0495584_0051173 3300046491 Bacteria 2080
451 Ga0495584_0066506 3300046491 Bacteria 1812
452 Ga0495585_0002501 3300046492 Bacteria 13087
453 Ga0495585_0022154 3300046492 Bacteria 3647
454 Ga0495585_0089473 3300046492 Bacteria 1659
455 Ga0495585_0106987 3300046492 Bacteria 1490
456 Ga0495585_0153449 3300046492 Bacteria 1199
457 Ga0495594_0016504 3300046499 Bacteria 3890
458 Ga0495594_0181063 3300046499 Bacteria 1199
459 Ga0495596_0000258 3300046500 Bacteria 35383
460 Ga0495596_0063601 3300046500 Bacteria 1435
461 Ga0495607_0000482 3300046501 Bacteria 39874
462 Ga0495607_0000938 3300046501 Bacteria 27121
463 Ga0495607_0001384 3300046501 Bacteria 21585
464 Ga0495607_0002109 3300046501 Bacteria 16605
465 Ga0495607_0002221 3300046501 Bacteria 16069
466 Ga0495607_0003809 3300046501 Bacteria 11379
467 Ga0495607_0025076 3300046501 Bacteria 3712
468 Ga0495607_0053155 3300046501 Bacteria 2342
469 Ga0495607_0060395 3300046501 Bacteria 2158
470 Ga0495607_0064082 3300046501 Bacteria 2077
471 Ga0495607_0159648 3300046501 Bacteria 1146
472 Ga0495607_0174988 3300046501 Bacteria 1080
473 Ga0495607_0180299 3300046501 Bacteria 1059
474 Ga0495583_0000031 3300046506 Bacteria 253982
475 Ga0495583_0000583 3300046506 Bacteria 50031
476 Ga0495583_0000830 3300046506 Bacteria 37819
477 Ga0495583_0006886 3300046506 Bacteria 7313
478 Ga0495583_0007941 3300046506 Bacteria 6571
479 Ga0495583_0008728 3300046506 Bacteria 6153
480 Ga0495583_0014672 3300046506 Bacteria 4308
481 Ga0495583_0045314 3300046506 Bacteria 2035
482 Ga0495606_0000271 3300046507 Bacteria 90916
483 Ga0495606_0001608 3300046507 Bacteria 29469
484 Ga0495606_0021027 3300046507 Bacteria 4790
485 Ga0495606_0030559 3300046507 Bacteria 3762
486 Ga0495606_0047696 3300046507 Bacteria 2822
487 Ga0495606_0186134 3300046507 Bacteria 1194
488 Ga0495606_0220015 3300046507 Bacteria 1070
489 Ga0495610_0007823 3300046512 Bacteria 7041
490 Ga0495610_0012332 3300046512 Bacteria 5154
491 Ga0495610_0015008 3300046512 Bacteria 4520
492 Ga0495610_0043317 3300046512 Bacteria 2243
493 Ga0495610_0044480 3300046512 Bacteria 2204
494 Ga0495616_0020878 3300046513 Bacteria 3556
495 Ga0495616_0030970 3300046513 Bacteria 2806
496 Ga0495616_0042996 3300046513 Bacteria 2297
497 Ga0495616_0043388 3300046513 Bacteria 2285
498 Ga0495616_0095238 3300046513 Bacteria 1403
499 Ga0495616_0155289 3300046513 Bacteria 1032
500 Ga0495620_0000112 3300046515 Bacteria 64688
501 Ga0495620_0000222 3300046515 Bacteria 42955
502 Ga0495620_0005934 3300046515 Bacteria 6769
503 Ga0495620_0020043 3300046515 Bacteria 3273
504 Ga0495620_0031315 3300046515 Bacteria 2438
505 Ga0495630_0108345 3300046517 Bacteria 2104
506 Ga0495631_0006265 3300046518 Bacteria 6161
507 Ga0495631_0027697 3300046518 Bacteria 2591
508 Ga0495631_0057391 3300046518 Bacteria 1694
509 Ga0495631_0066960 3300046518 Bacteria 1554
510 Ga0495632_0001173 3300046519 Bacteria 22288
511 Ga0495632_0001768 3300046519 Bacteria 17482
512 Ga0495632_0004961 3300046519 Bacteria 8914
513 Ga0495632_0028752 3300046519 Bacteria 2899
514 Ga0495632_0039577 3300046519 Bacteria 2379
515 Ga0495632_0042967 3300046519 Bacteria 2262
516 Ga0495632_0043209 3300046519 Bacteria 2254
517 Ga0495632_0050671 3300046519 Bacteria 2046
518 Ga0495632_0053357 3300046519 Bacteria 1985
519 Ga0495632_0124728 3300046519 Bacteria 1201
520 Ga0495632_0172623 3300046519 Bacteria 992
521 Ga0495637_0000064 3300046520 Bacteria 92793
522 Ga0495637_0000110 3300046520 Bacteria 59616
523 Ga0495637_0005109 3300046520 Bacteria 6730
524 Ga0495637_0008823 3300046520 Bacteria 4937
525 Ga0495637_0011594 3300046520 Bacteria 4232
526 Ga0495637_0022282 3300046520 Bacteria 2890
527 Ga0495637_0030035 3300046520 Bacteria 2413
528 Ga0495637_0031705 3300046520 Bacteria 2335
529 Ga0495637_0060345 3300046520 Bacteria 1558
530 Ga0495637_0076926 3300046520 Bacteria 1336
531 Ga0495643_0000175 3300046522 Bacteria 102200
532 Ga0495643_0001951 3300046522 Bacteria 17354
533 Ga0495643_0002575 3300046522 Bacteria 14165
534 Ga0495643_0003738 3300046522 Bacteria 11016
535 Ga0495643_0007213 3300046522 Bacteria 7203
536 Ga0495643_0030249 3300046522 Bacteria 3025
537 Ga0495643_0046696 3300046522 Bacteria 2347
538 Ga0495643_0064532 3300046522 Bacteria 1934
539 Ga0495643_0091610 3300046522 Bacteria 1567
540 Ga0495643_0099515 3300046522 Bacteria 1491
541 Ga0495644_0003744 3300046523 Bacteria 5983
542 Ga0495644_0015990 3300046523 Bacteria 2874
543 Ga0495644_0020181 3300046523 Bacteria 2542
544 Ga0495644_0025150 3300046523 Bacteria 2261
545 Ga0495648_0001400 3300046524 Bacteria 23699
546 Ga0495648_0002582 3300046524 Bacteria 16589
547 Ga0495648_0028056 3300046524 Bacteria 3755
548 Ga0495648_0032418 3300046524 Bacteria 3428
549 Ga0495648_0057222 3300046524 Bacteria 2340
550 Ga0495648_0057481 3300046524 Bacteria 2332
551 Ga0495648_0073023 3300046524 Bacteria 1982
552 Ga0495648_0077708 3300046524 Bacteria 1901
553 Ga0495648_0139014 3300046524 Bacteria 1280
554 Ga0495666_0019569 3300046526 Bacteria 3357
555 Ga0495642_0000266 3300046528 Bacteria 29529
556 Ga0495642_0027458 3300046528 Bacteria 2265
557 Ga0495654_0000773 3300046530 Bacteria 24692
558 Ga0495654_0002519 3300046530 Bacteria 11772
559 Ga0495654_0002645 3300046530 Bacteria 11383
560 Ga0495654_0002943 3300046530 Bacteria 10659
561 Ga0495654_0024207 3300046530 Bacteria 3138
562 Ga0495654_0030911 3300046530 Bacteria 2720
563 Ga0495654_0052489 3300046530 Bacteria 1985
564 Ga0495654_0061597 3300046530 Bacteria 1801
565 Ga0495654_0091541 3300046530 Bacteria 1410
566 Ga0495654_0141112 3300046530 Bacteria 1073
567 Ga0495587_0041989 3300046536 Bacteria 2728
568 Ga0495587_0045522 3300046536 Bacteria 2607
569 Ga0495609_0000018 3300046538 Bacteria 302609
570 Ga0495609_0000089 3300046538 Bacteria 107029
571 Ga0495609_0000161 3300046538 Bacteria 69842
572 Ga0495609_0061372 3300046538 Bacteria 1660
573 Ga0495597_0000026 3300046542 Bacteria 139551
574 Ga0495597_0001094 3300046542 Bacteria 20566
575 Ga0495597_0040454 3300046542 Bacteria 2083
576 Ga0495597_0055525 3300046542 Bacteria 1736
577 Ga0495622_0003910 3300046557 Bacteria 6962
578 Ga0495622_0008666 3300046557 Bacteria 4713
579 Ga0495622_0016546 3300046557 Bacteria 3435
580 Ga0495633_0000062 3300046558 Bacteria 142101
581 Ga0495633_0037387 3300046558 Bacteria 2322
582 Ga0495656_0049529 3300046615 Bacteria 1789
583 Ga0495668_0031470 3300046616 Bacteria 2990
584 Ga0495668_0033489 3300046616 Bacteria 2887
585 Ga0495668_0177243 3300046616 Bacteria 1168
586 Ga0495634_0068312 3300046642 Bacteria 2348
587 Ga0495611_0000395 3300046648 Bacteria 27443
588 Ga0495611_0035575 3300046648 Bacteria 2206
589 Ga0495625_0000194 3300046660 Bacteria 96964
590 Ga0495625_0057392 3300046660 Bacteria 2768
591 Ga0495625_0069189 3300046660 Bacteria 2480
592 Ga0495635_0107839 3300046663 Bacteria 1902
593 Ga0495659_0008033 3300046664 Bacteria 3349
594 Ga0495659_0018348 3300046664 Bacteria 2330
595 Ga0495661_0000016 3300046665 Bacteria 213593
596 Ga0495661_0000093 3300046665 Bacteria 109808
597 Ga0495661_0000115 3300046665 Bacteria 95492
598 Ga0495661_0000233 3300046665 Bacteria 64169
599 Ga0495661_0000541 3300046665 Bacteria 39054
600 Ga0495661_0085050 3300046665 Bacteria 1813
601 Ga0495661_0123173 3300046665 Bacteria 1429
602 Ga0495623_0063662 3300046679 Bacteria 2308
603 Ga0495646_0100477 3300046680 Bacteria 1659
604 Ga0495669_0027980 3300046684 Bacteria 2466
605 Ga0495669_0281982 3300046684 Bacteria 799
606 Ga0495670_0008132 3300046691 Bacteria 5154
607 Ga0495670_0029437 3300046691 Bacteria 2725
608 Ga0495670_0036942 3300046691 Bacteria 2434
609 Ga0495670_0043992 3300046691 Bacteria 2229
610 Ga0495670_0118586 3300046691 Bacteria 1374
611 Ga0495671_0001725 3300046692 Bacteria 14193
612 Ga0495671_0010701 3300046692 Bacteria 5073
613 Ga0495671_0021549 3300046692 Bacteria 3382
614 Ga0495671_0041876 3300046692 Bacteria 2304
615 Ga0495671_0042619 3300046692 Bacteria 2280
616 Ga0495671_0048067 3300046692 Bacteria 2129
617 Ga0495671_0050804 3300046692 Bacteria 2063
618 Ga0495671_0054127 3300046692 Bacteria 1990
619 Ga0495671_0076883 3300046692 Bacteria 1636
620 Ga0495649_0001210 3300046694 Bacteria 19916
621 Ga0495649_0001934 3300046694 Bacteria 15091
622 Ga0495649_0008385 3300046694 Bacteria 6218
623 Ga0495649_0032935 3300046694 Bacteria 2853
624 Ga0495649_0033119 3300046694 Bacteria 2844
625 Ga0495649_0040252 3300046694 Bacteria 2560
626 Ga0495649_0040894 3300046694 Bacteria 2536
627 Ga0495649_0045564 3300046694 Bacteria 2390
628 Ga0495649_0085978 3300046694 Bacteria 1678
629 Ga0495589_0018396 3300046794 Bacteria 3582
630 Ga0495589_0027152 3300046794 Bacteria 2895
631 Ga0495589_0178872 3300046794 Bacteria 1006
632 Ga0495600_0160842 3300046809 Bacteria 1451
633 Ga0495660_0000540 3300046810 Bacteria 30975
634 Ga0495660_0001212 3300046810 Bacteria 18042
635 Ga0495660_0001791 3300046810 Bacteria 14180
636 Ga0495660_0018356 3300046810 Bacteria 4021
637 Ga0495660_0024621 3300046810 Bacteria 3428
638 Ga0495660_0045237 3300046810 Bacteria 2417
639 Ga0495660_0063961 3300046810 Bacteria 1967
640 Ga0495660_0090833 3300046810 Bacteria 1587
641 Ga0495660_0092737 3300046810 Bacteria 1566
642 Ga0495660_0102861 3300046810 Bacteria 1468
643 Ga0495604_0077308 3300047317 Bacteria 2501
644 Ga0495604_0104275 3300047317 Bacteria 2078
645 Ga0495636_0025372 3300047318 Bacteria 2406
646 Ga0495672_0002759 3300047320 Bacteria 15720
647 Ga0495672_0004062 3300047320 Bacteria 12214
648 Ga0495672_0015156 3300047320 Bacteria 5246
649 Ga0495672_0024361 3300047320 Bacteria 3900
650 Ga0495672_0025709 3300047320 Bacteria 3763
651 Ga0495672_0026547 3300047320 Bacteria 3693
652 Ga0495672_0034982 3300047320 Bacteria 3097
653 Ga0495672_0039959 3300047320 Bacteria 2849
654 Ga0495672_0064617 3300047320 Bacteria 2094
655 Ga0495672_0258084 3300047320 Bacteria 842
656 Ga0495676_0000052 3300047321 Bacteria 97049
657 Ga0495676_0041268 3300047321 Bacteria 3799
658 Ga0495680_0054078 3300047322 Bacteria 3120
659 Ga0495680_0076800 3300047322 Bacteria 2531
660 Ga0495680_0084812 3300047322 Bacteria 2386
661 Ga0495683_0000137 3300047323 Bacteria 71500
662 Ga0495683_0000254 3300047323 Bacteria 48222
663 Ga0495683_0031552 3300047323 Bacteria 2700
664 Ga0495683_0040465 3300047323 Bacteria 2354
665 Ga0495683_0044021 3300047323 Bacteria 2245
666 Ga0495683_0049012 3300047323 Bacteria 2117
667 Ga0495683_0054943 3300047323 Bacteria 1983
668 Ga0495683_0090511 3300047323 Bacteria 1483
669 Ga0495687_019088 3300047443 Bacteria 3373
670 Ga0495687_031228 3300047443 Bacteria 2445
671 Ga0495675_0167747 3300047444 Bacteria 1349
672 Ga0495675_0177245 3300047444 Bacteria 1306
673 Ga0495677_0015191 3300047445 Bacteria 2798
674 Ga0495679_000136 3300047446 Bacteria 65848
675 Ga0495679_000368 3300047446 Bacteria 34941
676 Ga0495679_019406 3300047446 Bacteria 2389
677 Ga0495673_0000487 3300047469 Bacteria 42373
678 Ga0495673_0000858 3300047469 Bacteria 28212
679 Ga0495673_0004566 3300047469 Bacteria 8633
680 Ga0495673_0012245 3300047469 Bacteria 4561
681 Ga0495673_0024335 3300047469 Bacteria 2928
682 Ga0495673_0027595 3300047469 Bacteria 2699
683 Ga0495673_0037928 3300047469 Bacteria 2196
684 Ga0495673_0194970 3300047469 Bacteria 760
685 Ga0495673_0202809 3300047469 Bacteria 741
686 Ga0495673_0203908 3300047469 Bacteria 738
687 Ga0495681_0006934 3300047470 Bacteria 7344
688 Ga0495681_0022764 3300047470 Bacteria 3344
689 Ga0495681_0028546 3300047470 Bacteria 2868
690 Ga0495681_0037709 3300047470 Bacteria 2377
691 Ga0495681_0039118 3300047470 Bacteria 2318
692 Ga0495681_0040587 3300047470 Bacteria 2265
693 Ga0495681_0042086 3300047470 Bacteria 2213
694 Ga0495681_0044871 3300047470 Bacteria 2120
695 Ga0495681_0118793 3300047470 Bacteria 1136
696 Ga0495681_0146527 3300047470 Bacteria 993
697 Ga0495686_0041182 3300047472 Bacteria 2941
698 Ga0495686_0074046 3300047472 Bacteria 2090
699 Ga0495626_0000126 3300048091 Bacteria 99054
700 Ga0495626_0016183 3300048091 Bacteria 3795
701 Ga0495626_0019595 3300048091 Bacteria 3382
702 Ga0495626_0026996 3300048091 Bacteria 2793
703 Ga0495626_0035412 3300048091 Bacteria 2382
704 Ga0495626_0035440 3300048091 Bacteria 2381
705 Ga0495626_0038193 3300048091 Bacteria 2277
706 Ga0496102_0134254 3300048905 Bacteria 2318
707 Ga0496102_0559426 3300048905 Bacteria 1066
708 Ga0496102_0733024 3300048905 Bacteria 911
709 Ga0496103_0172472 3300048906 Bacteria 1389
710 Ga0496106_0132833 3300048909 Bacteria 1953
711 Ga0496110_0277946 3300048913 Bacteria 1525
712 Ga0496110_0319094 3300048913 Bacteria 1415
713 Ga0496110_0343334 3300048913 Bacteria 1360
714 Ga0496110_0434333 3300048913 Bacteria 1197
715 Ga0496112_0287635 3300048915 Bacteria 1590
716 Ga0496113_0401979 3300048916 Bacteria 1100
717 Ga0496114_0012182 3300048917 Bacteria 6881
718 Ga0496116_0000488 3300048919 Bacteria 54504
719 Ga0496116_0019231 3300048919 Bacteria 5235
720 Ga0496116_0037567 3300048919 Bacteria 3375
721 Ga0496116_0073735 3300048919 Bacteria 2150
722 Ga0496116_0106046 3300048919 Bacteria 1665
723 Ga0496117_0000666 3300048920 Bacteria 55020
724 Ga0496117_0004216 3300048920 Bacteria 16058
725 Ga0496117_0067351 3300048920 Bacteria 2423
726 Ga0496117_0072615 3300048920 Bacteria 2299
727 Ga0496118_0003760 3300048921 Bacteria 18753
728 Ga0496118_0004272 3300048921 Bacteria 17091
729 Ga0496118_0030186 3300048921 Bacteria 4530
730 Ga0496118_0041647 3300048921 Bacteria 3633
731 Ga0496119_0000220 3300048922 Bacteria 81054
732 Ga0496120_0002773 3300048923 Bacteria 17043
733 Ga0496121_0000867 3300048924 Bacteria 54641
734 Ga0496121_0002170 3300048924 Bacteria 30723
735 Ga0496121_0079897 3300048924 Bacteria 2594
736 Ga0496121_0103065 3300048924 Bacteria 2196
737 Ga0496122_0000434 3300048925 Bacteria 87536
738 Ga0496122_0002929 3300048925 Bacteria 23272
739 Ga0496122_0081632 3300048925 Bacteria 2249
740 Ga0496122_0093236 3300048925 Bacteria 2043
741 Ga0496122_0163129 3300048925 Bacteria 1355
742 Ga0496123_0000318 3300048926 Bacteria 91911
743 Ga0496123_0002268 3300048926 Bacteria 24237
744 Ga0496123_0003514 3300048926 Bacteria 17459
745 Ga0496123_0013642 3300048926 Bacteria 6798
746 Ga0496123_0014247 3300048926 Bacteria 6606
747 Ga0496124_0000471 3300048927 Bacteria 69533
748 Ga0496124_0005898 3300048927 Bacteria 13552
749 Ga0496124_0013915 3300048927 Bacteria 7821
750 Ga0496124_0045602 3300048927 Bacteria 3758
751 Ga0496124_0069900 3300048927 Bacteria 2913
752 Ga0496125_0001551 3300048928 Bacteria 32793
753 Ga0496125_0039422 3300048928 Bacteria 4068
754 Ga0496125_0057784 3300048928 Bacteria 3139
755 Ga0496125_0082115 3300048928 Bacteria 2458
756 Ga0496126_0027779 3300048929 Bacteria 5399
757 Ga0496126_0277065 3300048929 Bacteria 1390
758 Ga0501306_009733 3300049127 Bacteria 1197
759 Ga0501305_018629 3300049161 Bacteria 1006
760 Ga0495678_000021 3300049459 Bacteria 239150
761 Ga0495678_000169 3300049459 Bacteria 76063
762 Ga0495678_002042 3300049459 Bacteria 14448
763 Ga0495678_029007 3300049459 Bacteria 2328
764 Ga0495678_029232 3300049459 Bacteria 2316
765 Ga0495678_078603 3300049459 Bacteria 1190
766 Ga0495678_086008 3300049459 Bacteria 1118
767 Ga0495678_127788 3300049459 Bacteria 845
768 Ga0495682_0000597 3300049460 Bacteria 24443
769 Ga0495682_0001213 3300049460 Bacteria 14658
770 Ga0495682_0028092 3300049460 Bacteria 2085
771 Ga0495682_0111657 3300049460 Bacteria 979
772 Ga0501312_004226 3300049528 Bacteria 1679
773 Ga0501312_014527 3300049528 Bacteria 1107
774 Ga0501323_020451 3300049539 Bacteria 869
775 Ga0501335_008315 3300049551 Bacteria 974
776 Ga0501032_0247168 3300049569 Bacteria 1158
777 Ga0501032_0513831 3300049569 Bacteria 765
778 Ga0501034_0000214 3300049571 Bacteria 110247
779 Ga0501034_0148754 3300049571 Bacteria 2318
780 Ga0501037_0040282 3300049573 Bacteria 3438
781 Ga0501038_0363218 3300049574 Bacteria 1126
782 Ga0501039_0006128 3300049575 Bacteria 9130
783 Ga0501039_0367515 3300049575 Bacteria 1130
784 Ga0501040_0249150 3300049576 Bacteria 1267
785 Ga0501076_0229649 3300049592 Bacteria 1517
786 Ga0501230_026813 3300049667 Bacteria 1048
787 Ga0501226_000004 3300049853 Bacteria 284656
788 nmdc:mga00v17_296811_c1 3300050491 Bacteria 741
789 Ga0500573_0052401 3300053140 Bacteria 2346

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044693 Ga0466961_0148238 Ga0466961_0148238_49_642 197
2 iso_pu_bacteria 8054609563 8054613001 200
3 3300005364 Ga0070673_100681125 Ga0070673_1006811251 201
4 3300009098 Ga0105245_10740487 Ga0105245_107404872 201
5 3300041509 Ga0451843_0221753 Ga0451843_0221753_577_1182 201
6 3300049592 Ga0501076_0229649 Ga0501076_0229649_590_1201 202
7 iso_pu_bacteria 2643221641 2644232287 202
8 3300005617 Ga0068859_101243290 Ga0068859_1012432902 203
9 3300006931 Ga0097620_101243042 Ga0097620_1012430422 203
10 3300041413 Ga0439465_0183859 Ga0439465_0183859_34_663 203
11 iso_pu_bacteria 2739367898 2740169293 203
12 3300025225 Ga0209566_100644 Ga0209566_1006444 204
13 3300047446 Ga0495679_019406 Ga0495679_019406_1096_1713 205
14 3300049574 Ga0501038_0363218 Ga0501038_0363218_300_923 206
15 3300049575 Ga0501039_0006128 Ga0501039_0006128_5890_6513 206
16 3300047469 Ga0495673_0194970 Ga0495673_0194970_121_744 207
17 3300032002 Ga0307416_101578477 Ga0307416_1015784772 208
18 3300049576 Ga0501040_0249150 Ga0501040_0249150_113_778 209
19 3300049569 Ga0501032_0513831 Ga0501032_0513831_19_657 211
20 iso_pu_bacteria 2738543010 2739230446 211
21 3300017792 Ga0163161_10742042 Ga0163161_107420421 213
22 3300025728 Ga0207655_1075129 Ga0207655_10751292 213
23 3300025735 Ga0207713_1075843 Ga0207713_10758432 213
24 3300013307 Ga0157372_10001840 Ga0157372_1000184020 214
25 3300039093 Ga0400489_54721 Ga0400489_54721_559_1218 214
26 3300048922 Ga0496119_0000220 Ga0496119_0000220_35090_35755 214
27 3300048923 Ga0496120_0002773 Ga0496120_0002773_5201_5866 214
28 iso_pu_bacteria 2593339198 2595315611 214
29 iso_pu_bacteria 2738541276 2738716184 214
30 iso_pu_bacteria 2738543020 2739287047 214
31 iso_pu_bacteria 2738543021 2739292360 214
32 iso_pu_bacteria 2980125574 2980126843 214
33 iso_pu_bacteria 2989392574 2989395510 214
34 3300049528 Ga0501312_014527 Ga0501312_014527_356_1003 215
35 iso_pu_bacteria 2554235132 2554813224 215
36 iso_pu_bacteria 2585428059 2587738659 215
37 iso_pu_bacteria 2606217733 2608384038 215
38 iso_pu_bacteria 2643221676 2644426829 215
39 iso_pu_bacteria 2671180694 2673822198 215
40 iso_pu_bacteria 2818991459 2819669284 215
41 iso_pu_bacteria 2904755435 2904762018 215
42 iso_pu_bacteria 2919414237 2919418607 215
43 iso_pu_bacteria 2919425241 2919431498 215
44 iso_pu_bacteria 2990275345 2990278998 215
45 iso_pu_bacteria 2511231004 2511257980 216
46 iso_pu_bacteria 2511231006 2511264623 216
47 iso_pu_bacteria 2511231010 2511290487 216
48 iso_pu_bacteria 2511231012 2511299129 216
49 iso_pu_bacteria 2511231018 2511340787 216
50 iso_pu_bacteria 2511231019 2511346386 216
51 iso_pu_bacteria 2511231022 2511364650 216
52 iso_pu_bacteria 2512047018 2512327964 216
53 iso_pu_bacteria 2554235341 2555672417 216
54 iso_pu_bacteria 2582580891 2583794873 216
55 iso_pu_bacteria 2597489887 2597860483 216
56 iso_pu_bacteria 2597489888 2597866236 216
57 iso_pu_bacteria 2597489889 2597872070 216
58 iso_pu_bacteria 2599185160 2599358130 216
59 iso_pu_bacteria 2599185161 2599364493 216
60 iso_pu_bacteria 2599185162 2599370971 216
61 iso_pu_bacteria 2599185163 2599376993 216
62 iso_pu_bacteria 2599185164 2599383295 216
63 iso_pu_bacteria 2599185165 2599389742 216
64 iso_pu_bacteria 2599185166 2599396039 216
65 iso_pu_bacteria 2599185167 2599401278 216
66 iso_pu_bacteria 2599185168 2599407879 216
67 iso_pu_bacteria 2599185179 2599453007 216
68 iso_pu_bacteria 2599185181 2599464945 216
69 iso_pu_bacteria 2599185182 2599471270 216
70 iso_pu_bacteria 2599185185 2599486665 216
71 iso_pu_bacteria 2599185186 2599494140 216
72 iso_pu_bacteria 2599185188 2599504956 216
73 iso_pu_bacteria 2599185189 2599509755 216
74 iso_pu_bacteria 2599185190 2599516356 216
75 iso_pu_bacteria 2599185191 2599520169 216
76 iso_pu_bacteria 2599185212 2599615585 216
77 iso_pu_bacteria 2599185257 2599807200 216
78 iso_pu_bacteria 2599185288 2599881609 216
79 iso_pu_bacteria 2599185290 2599895672 216
80 iso_pu_bacteria 2599185300 2599930516 216
81 iso_pu_bacteria 2599185303 2599951872 216
82 iso_pu_bacteria 2599185311 2599996881 216
83 iso_pu_bacteria 2599185316 2600025748 216
84 iso_pu_bacteria 2599185317 2600031074 216
85 iso_pu_bacteria 2599185322 2600062018 216
86 iso_pu_bacteria 2599185325 2600079903 216
87 iso_pu_bacteria 2599185356 2600217677 216
88 iso_pu_bacteria 2600254930 2600360935 216
89 iso_pu_bacteria 2600254931 2600367866 216
90 iso_pu_bacteria 2600254954 2600445298 216
91 iso_pu_bacteria 2600255296 2601693827 216
92 iso_pu_bacteria 2600255313 2601777844 216
93 iso_pu_bacteria 2600255318 2601800589 216
94 iso_pu_bacteria 2600255389 2602007805 216
95 iso_pu_bacteria 2603880185 2606078603 216
96 iso_pu_bacteria 2603880199 2606125737 216
97 iso_pu_bacteria 2643221565 2643844973 216
98 iso_pu_bacteria 2643221571 2643870818 216
99 iso_pu_bacteria 2643221633 2644188372 216
100 iso_pu_bacteria 2643221713 2644621294 216
101 iso_pu_bacteria 2667528171 2671100667 216
102 iso_pu_bacteria 2667528176 2671129687 216
103 iso_pu_bacteria 2671180172 2671773240 216
104 iso_pu_bacteria 2675903420 2677899032 216
105 iso_pu_bacteria 2675903515 2678265746 216
106 iso_pu_bacteria 2713897148 2715752427 216
107 iso_pu_bacteria 2713897149 2715759178 216
108 iso_pu_bacteria 2718217725 2718636214 216
109 iso_pu_bacteria 2721755607 2723250971 216
110 iso_pu_bacteria 2728369097 2729145591 216
111 iso_pu_bacteria 2738541294 2738810161 216
112 iso_pu_bacteria 2738541309 2738897521 216
113 iso_pu_bacteria 2740892503 2743740038 216
114 iso_pu_bacteria 2744054620 2745006980 216
115 iso_pu_bacteria 2773857670 2774121908 216
116 iso_pu_bacteria 2773857673 2774137145 216
117 iso_pu_bacteria 2784132063 2784262230 216
118 iso_pu_bacteria 2784132072 2784314571 216
119 iso_pu_bacteria 2791355520 2794595178 216
120 iso_pu_bacteria 2808606373 2808906523 216
121 iso_pu_bacteria 2808606377 2808932321 216
122 iso_pu_bacteria 2808606379 2808941214 216
123 iso_pu_bacteria 2808606381 2808954442 216
124 iso_pu_bacteria 2808606382 2808961475 216
125 iso_pu_bacteria 2808606385 2808977483 216
126 iso_pu_bacteria 2808606388 2808992859 216
127 iso_pu_bacteria 2808606445 2809219185 216
128 iso_pu_bacteria 2811994881 2812368950 216
129 iso_pu_bacteria 2818991456 2819659296 216
130 iso_pu_bacteria 2818991464 2819706334 216
131 iso_pu_bacteria 2823421272 2823422020 216
132 iso_pu_bacteria 2826581358 2826582820 216
133 iso_pu_bacteria 2834028612 2834033154 216
134 iso_pu_bacteria 2842815866 2842819865 216
135 iso_pu_bacteria 2842826826 2842829038 216
136 iso_pu_bacteria 2842832357 2842836878 216
137 iso_pu_bacteria 2842837860 2842840523 216
138 iso_pu_bacteria 2842843487 2842847612 216
139 iso_pu_bacteria 2842849001 2842852884 216
140 iso_pu_bacteria 2852612431 2852618045 216
141 iso_pu_bacteria 2852657418 2852661124 216
142 iso_pu_bacteria 2852667396 2852673103 216
143 iso_pu_bacteria 2857453340 2857453747 216
144 iso_pu_bacteria 2860867994 2860872633 216
145 iso_pu_bacteria 2878029506 2878034940 216
146 iso_pu_bacteria 2904518522 2904522558 216
147 iso_pu_bacteria 2908446538 2908452173 216
148 iso_pu_bacteria 2917070673 2917076300 216
149 iso_pu_bacteria 2917832318 2917834514 216
150 iso_pu_bacteria 2919125081 2919127308 216
151 iso_pu_bacteria 2919385768 2919390549 216
152 iso_pu_bacteria 2919481497 2919485982 216
153 iso_pu_bacteria 2919487758 2919492668 216
154 iso_pu_bacteria 2919501602 2919506314 216
155 iso_pu_bacteria 2923153595 2923159129 216
156 iso_pu_bacteria 2923519811 2923523025 216
157 iso_pu_bacteria 2923586266 2923591100 216
158 iso_pu_bacteria 2926063275 2926067384 216
159 iso_pu_bacteria 2929144301 2929149541 216
160 iso_pu_bacteria 2929189879 2929194746 216
161 iso_pu_bacteria 2931369376 2931373056 216
162 iso_pu_bacteria 2931390751 2931396022 216
163 iso_pu_bacteria 2935353572 2935359724 216
164 iso_pu_bacteria 2939636861 2939641926 216
165 iso_pu_bacteria 2945928738 2945931311 216
166 iso_pu_bacteria 2946027586 2946033237 216
167 iso_pu_bacteria 2947233263 2947234025 216
168 iso_pu_bacteria 2969304461 2969309768 216
169 iso_pu_bacteria 2971410472 2971411019 216
170 iso_pu_bacteria 2974289157 2974294488 216
171 iso_pu_bacteria 2977254563 2977257974 216
172 iso_pu_bacteria 2984286254 2984287030 216
173 iso_pu_bacteria 2990196909 2990198218 216
174 iso_pu_bacteria 2998139840 2998144993 216
175 iso_pu_bacteria 3007252601 3007255653 216
176 iso_pu_bacteria 3007315729 3007320252 216
177 iso_pu_bacteria 3007395558 3007398779 216
178 iso_pu_bacteria 3007419365 3007425312 216
179 iso_pu_bacteria 3007619802 3007621208 216
180 iso_pu_bacteria 3007861166 3007866452 216
181 iso_pu_bacteria 637000220 637322856 216
182 iso_pu_bacteria 640427133 640486794 216
183 iso_pu_bacteria 651053060 651174645 216
184 iso_pu_bacteria 8015687852 8015693215 216
185 iso_pu_bacteria 8019769354 8019771222 216
186 iso_pu_bacteria 8029995093 8029995905 216
187 iso_pu_bacteria 8034962539 8034966880 216
188 iso_pu_bacteria 8054285046 8054289411 216
189 iso_pu_bacteria 8054347763 8054352914 216
190 iso_pu_bacteria 8054503363 8054508519 216
191 iso_pu_bacteria 8055770955 8055776465 216
192 iso_pu_bacteria 8055817908 8055823493 216
193 iso_pu_bacteria 8055878733 8055880492 216
194 iso_pu_bacteria 8056131705 8056136926 216
195 iso_pu_bacteria 8056148874 8056151887 216
196 iso_pu_bacteria 8056166840 8056171575 216
197 iso_pu_bacteria 8056177738 8056179283 216
198 iso_pu_bacteria 8056533031 8056536440 216
199 iso_pu_bacteria 8057798959 8057803878 216
200 3300031251 Ga0265327_10001699 Ga0265327_1000169924 217
201 3300031251 Ga0265327_10003331 Ga0265327_100033318 217
202 3300031344 Ga0265316_10002392 Ga0265316_1000239219 217
203 3300031665 Ga0316575_10002085 Ga0316575_100020855 217
204 3300044712 Ga0453684_0144478 Ga0453684_0144478_2016_2669 217
205 iso_pu_bacteria 2511231007 2511269428 217
206 iso_pu_bacteria 2511231008 2511276542 217
207 iso_pu_bacteria 2511231011 2511296677 217
208 iso_pu_bacteria 2511231014 2511312747 217
209 iso_pu_bacteria 2511231015 2511321343 217
210 iso_pu_bacteria 2511231016 2511325915 217
211 iso_pu_bacteria 2511231017 2511331957 217
212 iso_pu_bacteria 2511231020 2511353026 217
213 iso_pu_bacteria 2511231021 2511356683 217
214 iso_pu_bacteria 2511231024 2511374274 217
215 iso_pu_bacteria 2554235231 2555246605 217
216 iso_pu_bacteria 2599185248 2599773506 217
217 iso_pu_bacteria 2599185289 2599889993 217
218 iso_pu_bacteria 2599185291 2599901716 217
219 iso_pu_bacteria 2599185305 2599962857 217
220 iso_pu_bacteria 2599185306 2599967753 217
221 iso_pu_bacteria 2599185308 2599978985 217
222 iso_pu_bacteria 2599185313 2600008950 217
223 iso_pu_bacteria 2599185314 2600012945 217
224 iso_pu_bacteria 2599185315 2600020796 217
225 iso_pu_bacteria 2599185321 2600055576 217
226 iso_pu_bacteria 2599185324 2600073352 217
227 iso_pu_bacteria 2643221589 2643957681 217
228 iso_pu_bacteria 2643221602 2644025797 217
229 iso_pu_bacteria 2651869719 2652545064 217
230 iso_pu_bacteria 2667528170 2671094187 217
231 iso_pu_bacteria 2738543004 2739198068 217
232 iso_pu_bacteria 2738543015 2739262183 217
233 iso_pu_bacteria 2738543025 2739314957 217
234 iso_pu_bacteria 2765235841 2765586221 217
235 iso_pu_bacteria 2806310737 2807410456 217
236 iso_pu_bacteria 2806310745 2807458801 217
237 iso_pu_bacteria 2808606361 2808858073 217
238 iso_pu_bacteria 2808606376 2808926196 217
239 iso_pu_bacteria 2808606378 2808938244 217
240 iso_pu_bacteria 2808606380 2808948297 217
241 iso_pu_bacteria 2808606383 2808966559 217
242 iso_pu_bacteria 2808606389 2809001389 217
243 iso_pu_bacteria 2844665904 2844666591 217
244 iso_pu_bacteria 2860339153 2860343991 217
245 iso_pu_bacteria 2880230671 2880235581 217
246 iso_pu_bacteria 2904550169 2904554150 217
247 iso_pu_bacteria 2912963787 2912968489 217
248 iso_pu_bacteria 2919155634 2919158639 217
249 iso_pu_bacteria 2919456309 2919461651 217
250 iso_pu_bacteria 2931396565 2931397655 217
251 iso_pu_bacteria 2939651529 2939654591 217
252 iso_pu_bacteria 2980182181 2980189773 217
253 iso_pu_bacteria 2984504281 2984507044 217
254 iso_pu_bacteria 2988728565 2988731089 217
255 iso_pu_bacteria 3007511990 3007516780 217
256 iso_pu_bacteria 3007614139 3007614719 217
257 iso_pu_bacteria 3007718800 3007721306 217
258 iso_pu_bacteria 3007803356 3007809384 217
259 iso_pu_bacteria 3007855910 3007860198 217
260 iso_pu_bacteria 3007872151 3007874208 217
261 iso_pu_bacteria 8016728285 8016730889 217
262 iso_pu_bacteria 8052494512 8052499434 217
263 iso_pu_bacteria 8054929484 8054933562 217
264 iso_pu_bacteria 8056115690 8056115751 217
265 iso_pu_bacteria 8056120720 8056121295 217
266 iso_pu_bacteria 8056125926 8056131209 217
267 iso_pu_bacteria 8056137416 8056138008 217
268 iso_pu_bacteria 8056155041 8056156407 217
269 iso_pu_bacteria 8056172158 8056172245 217
270 iso_pu_bacteria 8056569372 8056572041 217
271 3300003323 rootH1_10001451 rootH1_1000145115 218
272 3300015261 Ga0182006_1005570 Ga0182006_10055708 218
273 3300031250 Ga0265331_10007682 Ga0265331_100076822 218
274 3300031251 Ga0265327_10003570 Ga0265327_100035709 218
275 3300031548 Ga0307408_100000192 Ga0307408_10000019213 218
276 3300031901 Ga0307406_10001571 Ga0307406_100015714 218
277 3300032168 Ga0316593_10122454 Ga0316593_101224541 218
278 3300042876 Ga0451577_0719363 Ga0451577_0719363_29_685 218
279 3300044712 Ga0453684_0001596 Ga0453684_0001596_20993_21649 218
280 3300044712 Ga0453684_0215480 Ga0453684_0215480_1176_1832 218
281 3300045051 Ga0451576_0000174 Ga0451576_0000174_4666_5322 218
282 3300046507 Ga0495606_0000271 Ga0495606_0000271_25321_25977 218
283 3300046522 Ga0495643_0000175 Ga0495643_0000175_76920_77576 218
284 3300046522 Ga0495643_0003738 Ga0495643_0003738_1414_2070 218
285 3300046660 Ga0495625_0069189 Ga0495625_0069189_1576_2232 218
286 3300046692 Ga0495671_0001725 Ga0495671_0001725_12805_13461 218
287 3300046694 Ga0495649_0001210 Ga0495649_0001210_1448_2104 218
288 3300046694 Ga0495649_0032935 Ga0495649_0032935_1293_1949 218
289 3300047470 Ga0495681_0028546 Ga0495681_0028546_291_947 218
290 3300049667 Ga0501230_026813 Ga0501230_026813_97_753 218
291 iso_pu_bacteria 8001522603 8001524969 218
292 iso_pu_bacteria 8011350971 8011355933 218
293 3300003323 rootH1_10025242 rootH1_100252428 219
294 3300025909 Ga0207705_10244038 Ga0207705_102440382 219
295 3300031548 Ga0307408_101040811 Ga0307408_1010408111 219
296 3300031665 Ga0316575_10054629 Ga0316575_100546293 219
297 3300031911 Ga0307412_10852062 Ga0307412_108520622 219
298 3300035398 Ga0316574_0009395 Ga0316574_0009395_1042_1704 219
299 3300036647 Ga0316582_0439337 Ga0316582_0439337_22_684 219
300 3300036712 Ga0316584_0150926 Ga0316584_0150926_282_944 219
301 3300046691 Ga0495670_0118586 Ga0495670_0118586_440_1099 219
302 3300046810 Ga0495660_0102861 Ga0495660_0102861_223_882 219
303 3300048913 Ga0496110_0319094 Ga0496110_0319094_30_689 219
304 3300048913 Ga0496110_0434333 Ga0496110_0434333_310_969 219
305 3300049127 Ga0501306_009733 Ga0501306_009733_508_1167 219
306 3300049161 Ga0501305_018629 Ga0501305_018629_35_694 219
307 3300049528 Ga0501312_004226 Ga0501312_004226_570_1229 219
308 3300049551 Ga0501335_008315 Ga0501335_008315_284_943 219
309 iso_pu_bacteria 2599185307 2599974044 219
310 iso_pu_bacteria 2600255283 2601628642 219
311 iso_pu_bacteria 2738541271 2738690995 219
312 iso_pu_bacteria 2738543016 2739266868 219
313 iso_pu_bacteria 2842805378 2842808385 219
314 3300002737 JGI25162J39368_1005306 JGI25162J39368_10053061 220
315 3300002737 JGI25162J39368_1005513 JGI25162J39368_10055131 220
316 3300002738 JGI25154J39366_1004759 JGI25154J39366_10047592 220
317 3300002771 JGI25163J39215_1001948 JGI25163J39215_10019481 220
318 3300002771 JGI25163J39215_1002029 JGI25163J39215_10020291 220
319 3300002772 JGI25164J39214_1002669 JGI25164J39214_10026691 220
320 3300002772 JGI25164J39214_1002812 JGI25164J39214_10028121 220
321 3300003214 JGI25165J46597_1005143 JGI25165J46597_10051431 220
322 3300003214 JGI25165J46597_1005440 JGI25165J46597_10054401 220
323 3300003751 Ga0055538_1000042 Ga0055538_1000042101 220
324 3300003752 Ga0055539_1000055 Ga0055539_1000055101 220
325 3300003756 Ga0055533_1000067 Ga0055533_1000067101 220
326 3300003758 Ga0055532_1000053 Ga0055532_1000053101 220
327 3300003759 Ga0055525_1000103 Ga0055525_100010335 220
328 3300003761 Ga0055535_1002633 Ga0055535_10026335 220
329 3300003781 Ga0055536_1002107 Ga0055536_100210714 220
330 3300003781 Ga0055536_1013930 Ga0055536_10139303 220
331 3300003781 Ga0055536_1017823 Ga0055536_10178233 220
332 3300003791 Ga0055530_10004850 Ga0055530_100048507 220
333 3300003791 Ga0055530_10015387 Ga0055530_100153873 220
334 3300003791 Ga0055530_10015585 Ga0055530_100155853 220
335 3300003792 Ga0055540_1000330 Ga0055540_10003301 220
336 3300003792 Ga0055540_1000552 Ga0055540_10005523 220
337 3300003792 Ga0055540_1009024 Ga0055540_10090242 220
338 3300003792 Ga0055540_1021543 Ga0055540_10215431 220
339 3300003794 Ga0055531_10000125 Ga0055531_1000012538 220
340 3300003841 Ga0055541_1000042 Ga0055541_100004276 220
341 3300005288 Ga0065714_10086001 Ga0065714_100860011 220
342 3300005289 Ga0065704_10009187 Ga0065704_100091872 220
343 3300005289 Ga0065704_10161370 Ga0065704_101613702 220
344 3300005290 Ga0065712_10011834 Ga0065712_100118342 220
345 3300005290 Ga0065712_10068081 Ga0065712_100680812 220
346 3300005331 Ga0070670_100000686 Ga0070670_10000068626 220
347 3300005344 Ga0070661_100000664 Ga0070661_10000066417 220
348 3300005353 Ga0070669_100000417 Ga0070669_10000041730 220
349 3300005455 Ga0070663_100337175 Ga0070663_1003371752 220
350 3300005457 Ga0070662_100000042 Ga0070662_1000000427 220
351 3300005457 Ga0070662_100045050 Ga0070662_1000450501 220
352 3300005548 Ga0070665_100031276 Ga0070665_1000312766 220
353 3300005564 Ga0070664_100000733 Ga0070664_10000073314 220
354 3300005578 Ga0068854_100007019 Ga0068854_1000070199 220
355 3300005834 Ga0068851_10000002 Ga0068851_1000000265 220
356 3300006177 Ga0075362_10070790 Ga0075362_100707902 220
357 3300006177 Ga0075362_10132324 Ga0075362_101323242 220
358 3300006186 Ga0075369_10089781 Ga0075369_100897812 220
359 3300006946 Ga0079104_1018176 Ga0079104_10181761 220
360 3300009011 Ga0105251_10000163 Ga0105251_1000016328 220
361 3300009011 Ga0105251_10003296 Ga0105251_100032969 220
362 3300009011 Ga0105251_10022564 Ga0105251_100225643 220
363 3300009011 Ga0105251_10047747 Ga0105251_100477473 220
364 3300009036 Ga0105244_10003742 Ga0105244_1000374211 220
365 3300009036 Ga0105244_10010383 Ga0105244_100103835 220
366 3300009036 Ga0105244_10078772 Ga0105244_100787722 220
367 3300009036 Ga0105244_10099077 Ga0105244_100990772 220
368 3300009092 Ga0105250_10001071 Ga0105250_1000107118 220
369 3300009092 Ga0105250_10013916 Ga0105250_100139163 220
370 3300009092 Ga0105250_10024365 Ga0105250_100243652 220
371 3300009092 Ga0105250_10027894 Ga0105250_100278941 220
372 3300009148 Ga0105243_10000188 Ga0105243_1000018867 220
373 3300009148 Ga0105243_10001384 Ga0105243_1000138412 220
374 3300009148 Ga0105243_10048181 Ga0105243_100481812 220
375 3300009148 Ga0105243_10070431 Ga0105243_100704313 220
376 3300009148 Ga0105243_10102040 Ga0105243_101020402 220
377 3300009176 Ga0105242_10000489 Ga0105242_1000048917 220
378 3300009177 Ga0105248_10021285 Ga0105248_1002128510 220
379 3300009545 Ga0105237_10002187 Ga0105237_1000218713 220
380 3300009545 Ga0105237_10201739 Ga0105237_102017392 220
381 3300009553 Ga0105249_10821813 Ga0105249_108218132 220
382 3300011119 Ga0105246_10032547 Ga0105246_100325472 220
383 3300011119 Ga0105246_10038380 Ga0105246_100383803 220
384 3300011119 Ga0105246_10052541 Ga0105246_100525414 220
385 3300011119 Ga0105246_10054731 Ga0105246_100547312 220
386 3300013100 Ga0157373_10082456 Ga0157373_100824563 220
387 3300013100 Ga0157373_10085261 Ga0157373_100852612 220
388 3300013102 Ga0157371_10000243 Ga0157371_1000024326 220
389 3300013102 Ga0157371_10035661 Ga0157371_100356612 220
390 3300013102 Ga0157371_10124307 Ga0157371_101243072 220
391 3300013102 Ga0157371_10396060 Ga0157371_103960602 220
392 3300013102 Ga0157371_10573519 Ga0157371_105735191 220
393 3300013102 Ga0157371_10573520 Ga0157371_105735201 220
394 3300013104 Ga0157370_10140916 Ga0157370_101409162 220
395 3300013105 Ga0157369_10109808 Ga0157369_101098082 220
396 3300013105 Ga0157369_10178907 Ga0157369_101789074 220
397 3300013105 Ga0157369_10668585 Ga0157369_106685851 220
398 3300014497 Ga0182008_10002892 Ga0182008_1000289211 220
399 3300014497 Ga0182008_10043820 Ga0182008_100438202 220
400 3300014497 Ga0182008_10051354 Ga0182008_100513541 220
401 3300015261 Ga0182006_1031761 Ga0182006_10317612 220
402 3300015262 Ga0182007_10026349 Ga0182007_100263493 220
403 3300015265 Ga0182005_1008848 Ga0182005_10088483 220
404 3300015265 Ga0182005_1038979 Ga0182005_10389792 220
405 3300017792 Ga0163161_10873663 Ga0163161_108736632 220
406 3300025206 Ga0209435_103159 Ga0209435_1031592 220
407 3300025207 Ga0209760_100058 Ga0209760_10005812 220
408 3300025207 Ga0209760_100060 Ga0209760_1000603 220
409 3300025224 Ga0209784_100060 Ga0209784_10006077 220
410 3300025225 Ga0209566_100075 Ga0209566_10007577 220
411 3300025226 Ga0209674_100100 Ga0209674_10010077 220
412 3300025229 Ga0209147_100096 Ga0209147_10009677 220
413 3300025230 Ga0209563_100118 Ga0209563_10011898 220
414 3300025230 Ga0209563_100242 Ga0209563_1002429 220
415 3300025231 Ga0207427_100056 Ga0207427_10005636 220
416 3300025231 Ga0207427_100063 Ga0207427_100063132 220
417 3300025233 Ga0209437_100065 Ga0209437_10006536 220
418 3300025233 Ga0209437_100133 Ga0209437_10013351 220
419 3300025242 Ga0209258_100221 Ga0209258_10022198 220
420 3300025246 Ga0209646_1000230 Ga0209646_100023012 220
421 3300025253 Ga0209677_100057 Ga0209677_10005777 220
422 3300025256 Ga0209759_1001811 Ga0209759_10018119 220
423 3300025261 Ga0209233_1000085 Ga0209233_100008536 220
424 3300025261 Ga0209233_1000133 Ga0209233_100013379 220
425 3300025292 Ga0209676_1000076 Ga0209676_1000076253 220
426 3300025292 Ga0209676_1000314 Ga0209676_100031439 220
427 3300025292 Ga0209676_1000337 Ga0209676_100033747 220
428 3300025292 Ga0209676_1018983 Ga0209676_10189833 220
429 3300025298 Ga0209050_1000063 Ga0209050_100006365 220
430 3300025298 Ga0209050_1000080 Ga0209050_100008034 220
431 3300025298 Ga0209050_1000106 Ga0209050_100010639 220
432 3300025303 Ga0209051_1000045 Ga0209051_100004539 220
433 3300025303 Ga0209051_1000260 Ga0209051_100026046 220
434 3300025303 Ga0209051_1000283 Ga0209051_100028335 220
435 3300025304 Ga0209257_1000185 Ga0209257_100018539 220
436 3300025321 Ga0207656_10000010 Ga0207656_1000001076 220
437 3300025711 Ga0207696_1000047 Ga0207696_1000047231 220
438 3300025711 Ga0207696_1000168 Ga0207696_100016880 220
439 3300025711 Ga0207696_1000339 Ga0207696_100033932 220
440 3300025728 Ga0207655_1000104 Ga0207655_100010441 220
441 3300025728 Ga0207655_1000120 Ga0207655_1000120142 220
442 3300025728 Ga0207655_1000606 Ga0207655_100060641 220
443 3300025728 Ga0207655_1005549 Ga0207655_100554910 220
444 3300025728 Ga0207655_1037818 Ga0207655_10378182 220
445 3300025735 Ga0207713_1000049 Ga0207713_1000049171 220
446 3300025735 Ga0207713_1000261 Ga0207713_100026144 220
447 3300025735 Ga0207713_1001031 Ga0207713_100103110 220
448 3300025735 Ga0207713_1004152 Ga0207713_100415211 220
449 3300025735 Ga0207713_1005408 Ga0207713_10054089 220
450 3300025735 Ga0207713_1020756 Ga0207713_10207564 220
451 3300025735 Ga0207713_1036082 Ga0207713_10360822 220
452 3300025914 Ga0207671_10000380 Ga0207671_1000038018 220
453 3300025920 Ga0207649_10000041 Ga0207649_1000004154 220
454 3300025920 Ga0207649_10723761 Ga0207649_107237611 220
455 3300025923 Ga0207681_10000342 Ga0207681_1000034221 220
456 3300025925 Ga0207650_10000278 Ga0207650_1000027831 220
457 3300025925 Ga0207650_10000324 Ga0207650_1000032415 220
458 3300025933 Ga0207706_10000128 Ga0207706_1000012819 220
459 3300025933 Ga0207706_10012214 Ga0207706_100122147 220
460 3300025934 Ga0207686_10001625 Ga0207686_100016255 220
461 3300025935 Ga0207709_10000030 Ga0207709_1000003059 220
462 3300025935 Ga0207709_10000343 Ga0207709_1000034337 220
463 3300025935 Ga0207709_10046034 Ga0207709_100460342 220
464 3300025937 Ga0207669_10130435 Ga0207669_101304352 220
465 3300025941 Ga0207711_10057873 Ga0207711_100578733 220
466 3300025945 Ga0207679_10000081 Ga0207679_1000008117 220
467 3300025961 Ga0207712_10607671 Ga0207712_106076712 220
468 3300025981 Ga0207640_10008549 Ga0207640_100085495 220
469 3300027111 Ga0209281_1002082 Ga0209281_10020827 220
470 3300027111 Ga0209281_1011659 Ga0209281_10116592 220
471 3300027252 Ga0209973_1008316 Ga0209973_10083162 220
472 3300027312 Ga0209371_1000228 Ga0209371_100022841 220
473 3300027312 Ga0209371_1004867 Ga0209371_10048678 220
474 3300027360 Ga0209969_1007382 Ga0209969_10073822 220
475 3300027395 Ga0209996_1002060 Ga0209996_10020601 220
476 3300027471 Ga0209995_1002220 Ga0209995_10022203 220
477 3300027543 Ga0209999_1012969 Ga0209999_10129692 220
478 3300027543 Ga0209999_1042362 Ga0209999_10423621 220
479 3300030500 Ga0268256_1000188 Ga0268256_100018838 220
480 3300030500 Ga0268256_1006735 Ga0268256_10067352 220
481 3300030731 Ga0316177_1078431 Ga0316177_10784312 220
482 3300030734 Ga0316179_1075362 Ga0316179_10753621 220
483 3300030735 Ga0316178_1011341 Ga0316178_101134112 220
484 3300030742 Ga0316183_1006673 Ga0316183_10066731 220
485 3300030744 Ga0316181_1093595 Ga0316181_10935952 220
486 3300031548 Ga0307408_100000013 Ga0307408_100000013368 220
487 3300031730 Ga0307516_10100762 Ga0307516_101007623 220
488 3300031731 Ga0307405_10084243 Ga0307405_100842431 220
489 3300032002 Ga0307416_100810323 Ga0307416_1008103232 220
490 3300032004 Ga0307414_10014793 Ga0307414_100147931 220
491 3300032005 Ga0307411_10032563 Ga0307411_100325633 220
492 3300036647 Ga0316582_0138732 Ga0316582_0138732_695_1363 220
493 3300036712 Ga0316584_0016769 Ga0316584_0016769_2199_2867 220
494 3300038735 Ga0400485_00908 Ga0400485_00908_492_1154 220
495 3300038742 Ga0400486_03367 Ga0400486_03367_1460_2122 220
496 3300039062 Ga0400483_271482 Ga0400483_271482_3003_3665 220
497 3300041404 Ga0439436_0056726 Ga0439436_0056726_365_1027 220
498 3300041405 Ga0439438_020305 Ga0439438_020305_1130_1792 220
499 3300041405 Ga0439438_022354 Ga0439438_022354_863_1525 220
500 3300041407 Ga0439447_005046 Ga0439447_005046_440_1102 220
501 3300041411 Ga0439466_0004914 Ga0439466_0004914_211_873 220
502 3300041411 Ga0439466_0006573 Ga0439466_0006573_832_1494 220
503 3300041411 Ga0439466_0020358 Ga0439466_0020358_92_754 220
504 3300041411 Ga0439466_0057743 Ga0439466_0057743_341_1003 220
505 3300042000 Ga0439437_000899 Ga0439437_000899_513_1175 220
506 3300042006 Ga0439432_006366 Ga0439432_006366_203_865 220
507 3300042006 Ga0439432_020988 Ga0439432_020988_1483_2145 220
508 3300042006 Ga0439432_126370 Ga0439432_126370_75_737 220
509 3300042007 Ga0439449_0104606 Ga0439449_0104606_25_690 220
510 3300042009 Ga0439451_000464 Ga0439451_000464_1730_2392 220
511 3300042010 Ga0439452_015689 Ga0439452_015689_1158_1820 220
512 3300042013 Ga0439456_007236 Ga0439456_007236_57_719 220
513 3300042016 Ga0439463_000495 Ga0439463_000495_9906_10568 220
514 3300042115 Ga0450911_000022 Ga0450911_000022_49039_49701 220
515 3300042115 Ga0450911_002724 Ga0450911_002724_1407_2069 220
516 3300042125 Ga0450923_053418 Ga0450923_053418_176_838 220
517 3300042139 Ga0450904_001485 Ga0450904_001485_384_1046 220
518 3300042146 Ga0450907_003068 Ga0450907_003068_1131_1793 220
519 3300042147 Ga0450910_004219 Ga0450910_004219_591_1253 220
520 3300042156 Ga0439446_0000864 Ga0439446_0000864_302_964 220
521 3300042156 Ga0439446_0002450 Ga0439446_0002450_3444_4106 220
522 3300042156 Ga0439446_0012710 Ga0439446_0012710_744_1406 220
523 3300042184 Ga0450908_006061 Ga0450908_006061_87_749 220
524 3300042185 Ga0450909_005861 Ga0450909_005861_798_1460 220
525 3300042435 Ga0439434_0025739 Ga0439434_0025739_834_1496 220
526 3300042438 Ga0439459_0017311 Ga0439459_0017311_275_937 220
527 3300042439 Ga0439464_0108102 Ga0439464_0108102_77_739 220
528 3300042532 Ga0450893_0008181 Ga0450893_0008181_241_903 220
529 3300042876 Ga0451577_0077381 Ga0451577_0077381_1905_2567 220
530 3300044712 Ga0453684_0006330 Ga0453684_0006330_1683_2345 220
531 3300046453 Ga0495627_000291 Ga0495627_000291_8894_9556 220
532 3300046453 Ga0495627_012131 Ga0495627_012131_1378_2040 220
533 3300046453 Ga0495627_047436 Ga0495627_047436_32_694 220
534 3300046458 Ga0495591_018415 Ga0495591_018415_1459_2121 220
535 3300046460 Ga0495638_0031267 Ga0495638_0031267_1182_1844 220
536 3300046460 Ga0495638_0100145 Ga0495638_0100145_115_777 220
537 3300046471 Ga0495650_0027431 Ga0495650_0027431_1442_2104 220
538 3300046471 Ga0495650_0036991 Ga0495650_0036991_1085_1747 220
539 3300046474 Ga0495605_0000033 Ga0495605_0000033_175957_176619 220
540 3300046474 Ga0495605_0030986 Ga0495605_0030986_1511_2173 220
541 3300046491 Ga0495584_0041802 Ga0495584_0041802_437_1099 220
542 3300046491 Ga0495584_0051173 Ga0495584_0051173_13_675 220
543 3300046492 Ga0495585_0089473 Ga0495585_0089473_147_809 220
544 3300046499 Ga0495594_0016504 Ga0495594_0016504_2723_3385 220
545 3300046501 Ga0495607_0002109 Ga0495607_0002109_15514_16176 220
546 3300046501 Ga0495607_0064082 Ga0495607_0064082_1293_1955 220
547 3300046506 Ga0495583_0000031 Ga0495583_0000031_64874_65536 220
548 3300046506 Ga0495583_0045314 Ga0495583_0045314_71_733 220
549 3300046512 Ga0495610_0015008 Ga0495610_0015008_65_727 220
550 3300046513 Ga0495616_0043388 Ga0495616_0043388_147_809 220
551 3300046515 Ga0495620_0000112 Ga0495620_0000112_63522_64184 220
552 3300046515 Ga0495620_0031315 Ga0495620_0031315_1503_2165 220
553 3300046518 Ga0495631_0006265 Ga0495631_0006265_172_834 220
554 3300046518 Ga0495631_0027697 Ga0495631_0027697_362_1024 220
555 3300046519 Ga0495632_0053357 Ga0495632_0053357_913_1575 220
556 3300046522 Ga0495643_0046696 Ga0495643_0046696_120_782 220
557 3300046522 Ga0495643_0099515 Ga0495643_0099515_45_707 220
558 3300046524 Ga0495648_0028056 Ga0495648_0028056_96_758 220
559 3300046524 Ga0495648_0032418 Ga0495648_0032418_1250_1912 220
560 3300046528 Ga0495642_0000266 Ga0495642_0000266_28785_29447 220
561 3300046530 Ga0495654_0000773 Ga0495654_0000773_12488_13150 220
562 3300046530 Ga0495654_0002645 Ga0495654_0002645_627_1289 220
563 3300046530 Ga0495654_0024207 Ga0495654_0024207_1150_1812 220
564 3300046530 Ga0495654_0052489 Ga0495654_0052489_648_1310 220
565 3300046536 Ga0495587_0045522 Ga0495587_0045522_380_1042 220
566 3300046538 Ga0495609_0000018 Ga0495609_0000018_275689_276351 220
567 3300046542 Ga0495597_0001094 Ga0495597_0001094_6492_7154 220
568 3300046558 Ga0495633_0000062 Ga0495633_0000062_59806_60468 220
569 3300046642 Ga0495634_0068312 Ga0495634_0068312_140_802 220
570 3300046663 Ga0495635_0107839 Ga0495635_0107839_1173_1835 220
571 3300046665 Ga0495661_0000016 Ga0495661_0000016_160629_161291 220
572 3300046665 Ga0495661_0000541 Ga0495661_0000541_1073_1735 220
573 3300046665 Ga0495661_0123173 Ga0495661_0123173_661_1323 220
574 3300046691 Ga0495670_0008132 Ga0495670_0008132_667_1329 220
575 3300046692 Ga0495671_0050804 Ga0495671_0050804_505_1167 220
576 3300046692 Ga0495671_0054127 Ga0495671_0054127_145_807 220
577 3300046794 Ga0495589_0027152 Ga0495589_0027152_331_993 220
578 3300046810 Ga0495660_0024621 Ga0495660_0024621_171_833 220
579 3300046810 Ga0495660_0045237 Ga0495660_0045237_663_1325 220
580 3300047320 Ga0495672_0015156 Ga0495672_0015156_167_829 220
581 3300047323 Ga0495683_0000137 Ga0495683_0000137_7171_7833 220
582 3300047323 Ga0495683_0031552 Ga0495683_0031552_1575_2237 220
583 3300047443 Ga0495687_031228 Ga0495687_031228_97_759 220
584 3300047446 Ga0495679_000368 Ga0495679_000368_7210_7872 220
585 3300047469 Ga0495673_0012245 Ga0495673_0012245_805_1467 220
586 3300047469 Ga0495673_0024335 Ga0495673_0024335_1574_2236 220
587 3300047470 Ga0495681_0039118 Ga0495681_0039118_220_882 220
588 3300047470 Ga0495681_0040587 Ga0495681_0040587_1575_2237 220
589 3300047470 Ga0495681_0146527 Ga0495681_0146527_225_887 220
590 3300048905 Ga0496102_0134254 Ga0496102_0134254_85_747 220
591 3300048919 Ga0496116_0000488 Ga0496116_0000488_44340_45002 220
592 3300048919 Ga0496116_0073735 Ga0496116_0073735_94_756 220
593 3300048920 Ga0496117_0000666 Ga0496117_0000666_22171_22833 220
594 3300048920 Ga0496117_0004216 Ga0496117_0004216_6011_6673 220
595 3300048921 Ga0496118_0041647 Ga0496118_0041647_1408_2070 220
596 3300048924 Ga0496121_0000867 Ga0496121_0000867_44498_45160 220
597 3300048925 Ga0496122_0081632 Ga0496122_0081632_92_754 220
598 3300048926 Ga0496123_0002268 Ga0496123_0002268_1944_2606 220
599 3300048926 Ga0496123_0014247 Ga0496123_0014247_92_754 220
600 3300048928 Ga0496125_0001551 Ga0496125_0001551_1169_1831 220
601 3300048928 Ga0496125_0057784 Ga0496125_0057784_1152_1814 220
602 3300049459 Ga0495678_000021 Ga0495678_000021_178322_178984 220
603 3300049459 Ga0495678_029007 Ga0495678_029007_1551_2213 220
604 3300049460 Ga0495682_0000597 Ga0495682_0000597_23603_24265 220
605 3300049569 Ga0501032_0247168 Ga0501032_0247168_404_1066 220
606 3300049571 Ga0501034_0148754 Ga0501034_0148754_21_683 220
607 3300049573 Ga0501037_0040282 Ga0501037_0040282_548_1210 220
608 3300049575 Ga0501039_0367515 Ga0501039_0367515_250_912 220
609 3300049853 Ga0501226_000004 Ga0501226_000004_220082_220744 220
610 iso_pu_bacteria 2599185302 2599944950 220
611 iso_pu_bacteria 2599185304 2599955321 220
612 iso_pu_bacteria 2599185309 2599984053 220
613 iso_pu_bacteria 2599185310 2599990226 220
614 iso_pu_bacteria 2599185312 2600001835 220
615 iso_pu_bacteria 2599185320 2600048760 220
616 iso_pu_bacteria 2913036834 2913042153 220
617 iso_pu_bacteria 2946006987 2946007348 220
618 iso_pu_bacteria 3007866637 3007867149 220
619 iso_pu_bacteria 8056161164 8056163196 220
620 3300003856 Ga0058692_1017633 Ga0058692_10176332 221
621 3300005289 Ga0065704_10032660 Ga0065704_100326602 221
622 3300005353 Ga0070669_100283914 Ga0070669_1002839142 221
623 3300005548 Ga0070665_100150735 Ga0070665_1001507352 221
624 3300006058 Ga0075432_10012148 Ga0075432_100121482 221
625 3300006058 Ga0075432_10018695 Ga0075432_100186951 221
626 3300006058 Ga0075432_10102147 Ga0075432_101021472 221
627 3300006944 Ga0099823_1000360 Ga0099823_100036029 221
628 3300006946 Ga0079104_1000478 Ga0079104_100047812 221
629 3300006946 Ga0079104_1000630 Ga0079104_10006302 221
630 3300009011 Ga0105251_10034835 Ga0105251_100348352 221
631 3300009011 Ga0105251_10058309 Ga0105251_100583092 221
632 3300009011 Ga0105251_10072165 Ga0105251_100721652 221
633 3300009036 Ga0105244_10043153 Ga0105244_100431533 221
634 3300009036 Ga0105244_10044573 Ga0105244_100445733 221
635 3300009036 Ga0105244_10045278 Ga0105244_100452781 221
636 3300009092 Ga0105250_10025701 Ga0105250_100257011 221
637 3300009092 Ga0105250_10192138 Ga0105250_101921382 221
638 3300012477 Ga0157336_1000676 Ga0157336_10006761 221
639 3300012498 Ga0157345_1000583 Ga0157345_10005832 221
640 3300013102 Ga0157371_10081760 Ga0157371_100817603 221
641 3300013104 Ga0157370_10919384 Ga0157370_109193841 221
642 3300013105 Ga0157369_10713790 Ga0157369_107137902 221
643 3300013306 Ga0163162_10164309 Ga0163162_101643092 221
644 3300013307 Ga0157372_10042028 Ga0157372_100420281 221
645 3300014497 Ga0182008_10052508 Ga0182008_100525082 221
646 3300015261 Ga0182006_1049210 Ga0182006_10492102 221
647 3300015261 Ga0182006_1108978 Ga0182006_11089782 221
648 3300017792 Ga0163161_10110357 Ga0163161_101103573 221
649 3300025292 Ga0209676_1001941 Ga0209676_100194119 221
650 3300025298 Ga0209050_1002168 Ga0209050_100216818 221
651 3300025303 Ga0209051_1023520 Ga0209051_10235202 221
652 3300025711 Ga0207696_1000118 Ga0207696_100011867 221
653 3300025711 Ga0207696_1007078 Ga0207696_10070783 221
654 3300025711 Ga0207696_1015131 Ga0207696_10151312 221
655 3300025728 Ga0207655_1000415 Ga0207655_100041534 221
656 3300025728 Ga0207655_1000921 Ga0207655_100092132 221
657 3300025728 Ga0207655_1006374 Ga0207655_100637410 221
658 3300025728 Ga0207655_1030279 Ga0207655_10302793 221
659 3300025728 Ga0207655_1087892 Ga0207655_10878921 221
660 3300025735 Ga0207713_1003024 Ga0207713_10030246 221
661 3300025735 Ga0207713_1007215 Ga0207713_10072155 221
662 3300025735 Ga0207713_1008483 Ga0207713_10084832 221
663 3300025735 Ga0207713_1024817 Ga0207713_10248171 221
664 3300025735 Ga0207713_1039597 Ga0207713_10395972 221
665 3300025735 Ga0207713_1044187 Ga0207713_10441872 221
666 3300025923 Ga0207681_10283672 Ga0207681_102836721 221
667 3300025935 Ga0207709_10278852 Ga0207709_102788522 221
668 3300027111 Ga0209281_1000070 Ga0209281_100007030 221
669 3300027111 Ga0209281_1000127 Ga0209281_100012730 221
670 3300027296 Ga0209389_1000020 Ga0209389_100002087 221
671 3300027296 Ga0209389_1065562 Ga0209389_10655622 221
672 3300027312 Ga0209371_1000302 Ga0209371_10003028 221
673 3300027907 Ga0207428_10014173 Ga0207428_100141732 221
674 3300027907 Ga0207428_10050869 Ga0207428_100508695 221
675 3300027907 Ga0207428_10101513 Ga0207428_101015131 221
676 3300027907 Ga0207428_10109854 Ga0207428_101098542 221
677 3300027907 Ga0207428_10146760 Ga0207428_101467601 221
678 3300027907 Ga0207428_10160413 Ga0207428_101604132 221
679 3300028379 Ga0268266_10007379 Ga0268266_100073792 221
680 3300030500 Ga0268256_1000669 Ga0268256_100066924 221
681 3300031548 Ga0307408_100059501 Ga0307408_1000595012 221
682 3300032004 Ga0307414_10079818 Ga0307414_100798183 221
683 3300038705 Ga0237819_00789 Ga0237819_00789_701_1366 221
684 3300039062 Ga0400483_245346 Ga0400483_245346_104_769 221
685 3300041405 Ga0439438_005405 Ga0439438_005405_124_789 221
686 3300041405 Ga0439438_013588 Ga0439438_013588_223_888 221
687 3300041405 Ga0439438_019662 Ga0439438_019662_1135_1800 221
688 3300041405 Ga0439438_025244 Ga0439438_025244_912_1577 221
689 3300041407 Ga0439447_008010 Ga0439447_008010_1096_1761 221
690 3300041407 Ga0439447_013421 Ga0439447_013421_107_772 221
691 3300041411 Ga0439466_0027219 Ga0439466_0027219_107_772 221
692 3300041411 Ga0439466_0035356 Ga0439466_0035356_962_1627 221
693 3300041411 Ga0439466_0050004 Ga0439466_0050004_604_1269 221
694 3300042006 Ga0439432_002353 Ga0439432_002353_5026_5691 221
695 3300042006 Ga0439432_027068 Ga0439432_027068_1103_1768 221
696 3300042010 Ga0439452_007545 Ga0439452_007545_1111_1776 221
697 3300042010 Ga0439452_013254 Ga0439452_013254_1562_2227 221
698 3300042010 Ga0439452_013880 Ga0439452_013880_419_1084 221
699 3300042013 Ga0439456_000103 Ga0439456_000103_26264_26929 221
700 3300042137 Ga0450902_000456 Ga0450902_000456_3746_4411 221
701 3300042137 Ga0450902_001945 Ga0450902_001945_531_1196 221
702 3300042139 Ga0450904_002387 Ga0450904_002387_161_826 221
703 3300042142 Ga0450905_000070 Ga0450905_000070_391_1056 221
704 3300042146 Ga0450907_002607 Ga0450907_002607_1160_1825 221
705 3300042156 Ga0439446_0013034 Ga0439446_0013034_1505_2170 221
706 3300042185 Ga0450909_002548 Ga0450909_002548_407_1072 221
707 3300042435 Ga0439434_0007187 Ga0439434_0007187_1122_1787 221
708 3300042461 Ga0439460_0008816 Ga0439460_0008816_479_1144 221
709 3300042461 Ga0439460_0023645 Ga0439460_0023645_925_1590 221
710 3300042993 Ga0439440_0001951 Ga0439440_0001951_1630_2295 221
711 3300046452 Ga0495617_023101 Ga0495617_023101_773_1438 221
712 3300046455 Ga0495603_0038509 Ga0495603_0038509_652_1317 221
713 3300046455 Ga0495603_0158086 Ga0495603_0158086_70_735 221
714 3300046457 Ga0495590_0029866 Ga0495590_0029866_661_1326 221
715 3300046458 Ga0495591_002445 Ga0495591_002445_9557_10222 221
716 3300046458 Ga0495591_019925 Ga0495591_019925_575_1240 221
717 3300046459 Ga0495629_0193868 Ga0495629_0193868_118_783 221
718 3300046460 Ga0495638_0045618 Ga0495638_0045618_671_1336 221
719 3300046460 Ga0495638_0049486 Ga0495638_0049486_654_1319 221
720 3300046460 Ga0495638_0113834 Ga0495638_0113834_311_976 221
721 3300046463 Ga0495653_0001298 Ga0495653_0001298_18177_18842 221
722 3300046463 Ga0495653_0046779 Ga0495653_0046779_1167_1832 221
723 3300046471 Ga0495650_0010347 Ga0495650_0010347_4474_5139 221
724 3300046474 Ga0495605_0079791 Ga0495605_0079791_529_1194 221
725 3300046475 Ga0495639_0109206 Ga0495639_0109206_199_864 221
726 3300046491 Ga0495584_0039709 Ga0495584_0039709_134_799 221
727 3300046491 Ga0495584_0044790 Ga0495584_0044790_107_772 221
728 3300046492 Ga0495585_0002501 Ga0495585_0002501_5819_6484 221
729 3300046492 Ga0495585_0022154 Ga0495585_0022154_1556_2221 221
730 3300046499 Ga0495594_0181063 Ga0495594_0181063_475_1140 221
731 3300046500 Ga0495596_0000258 Ga0495596_0000258_655_1320 221
732 3300046501 Ga0495607_0060395 Ga0495607_0060395_1390_2055 221
733 3300046507 Ga0495606_0021027 Ga0495606_0021027_3783_4448 221
734 3300046507 Ga0495606_0047696 Ga0495606_0047696_604_1269 221
735 3300046507 Ga0495606_0186134 Ga0495606_0186134_68_733 221
736 3300046512 Ga0495610_0043317 Ga0495610_0043317_1132_1797 221
737 3300046513 Ga0495616_0095238 Ga0495616_0095238_177_842 221
738 3300046513 Ga0495616_0155289 Ga0495616_0155289_339_1004 221
739 3300046515 Ga0495620_0000222 Ga0495620_0000222_15331_15996 221
740 3300046515 Ga0495620_0020043 Ga0495620_0020043_1436_2101 221
741 3300046517 Ga0495630_0108345 Ga0495630_0108345_139_804 221
742 3300046518 Ga0495631_0066960 Ga0495631_0066960_11_676 221
743 3300046519 Ga0495632_0001768 Ga0495632_0001768_15129_15794 221
744 3300046519 Ga0495632_0042967 Ga0495632_0042967_1496_2161 221
745 3300046519 Ga0495632_0172623 Ga0495632_0172623_133_798 221
746 3300046520 Ga0495637_0008823 Ga0495637_0008823_1391_2056 221
747 3300046520 Ga0495637_0022282 Ga0495637_0022282_1533_2198 221
748 3300046520 Ga0495637_0030035 Ga0495637_0030035_1230_1895 221
749 3300046520 Ga0495637_0031705 Ga0495637_0031705_1589_2254 221
750 3300046520 Ga0495637_0076926 Ga0495637_0076926_514_1179 221
751 3300046522 Ga0495643_0001951 Ga0495643_0001951_15405_16070 221
752 3300046522 Ga0495643_0002575 Ga0495643_0002575_1665_2330 221
753 3300046522 Ga0495643_0091610 Ga0495643_0091610_339_1004 221
754 3300046523 Ga0495644_0015990 Ga0495644_0015990_1533_2198 221
755 3300046523 Ga0495644_0020181 Ga0495644_0020181_434_1099 221
756 3300046523 Ga0495644_0025150 Ga0495644_0025150_1458_2123 221
757 3300046524 Ga0495648_0002582 Ga0495648_0002582_15457_16122 221
758 3300046524 Ga0495648_0057222 Ga0495648_0057222_108_773 221
759 3300046524 Ga0495648_0057481 Ga0495648_0057481_1154_1819 221
760 3300046524 Ga0495648_0073023 Ga0495648_0073023_147_905 221
761 3300046526 Ga0495666_0019569 Ga0495666_0019569_1450_2115 221
762 3300046530 Ga0495654_0030911 Ga0495654_0030911_1407_2072 221
763 3300046530 Ga0495654_0091541 Ga0495654_0091541_660_1325 221
764 3300046530 Ga0495654_0141112 Ga0495654_0141112_107_772 221
765 3300046536 Ga0495587_0041989 Ga0495587_0041989_570_1235 221
766 3300046542 Ga0495597_0040454 Ga0495597_0040454_1271_1936 221
767 3300046542 Ga0495597_0055525 Ga0495597_0055525_107_772 221
768 3300046557 Ga0495622_0016546 Ga0495622_0016546_1536_2201 221
769 3300046558 Ga0495633_0037387 Ga0495633_0037387_88_753 221
770 3300046616 Ga0495668_0033489 Ga0495668_0033489_646_1311 221
771 3300046660 Ga0495625_0057392 Ga0495625_0057392_584_1342 221
772 3300046665 Ga0495661_0000093 Ga0495661_0000093_83492_84157 221
773 3300046665 Ga0495661_0085050 Ga0495661_0085050_570_1235 221
774 3300046679 Ga0495623_0063662 Ga0495623_0063662_76_741 221
775 3300046680 Ga0495646_0100477 Ga0495646_0100477_105_770 221
776 3300046684 Ga0495669_0027980 Ga0495669_0027980_1769_2434 221
777 3300046691 Ga0495670_0029437 Ga0495670_0029437_1390_2055 221
778 3300046692 Ga0495671_0021549 Ga0495671_0021549_1577_2242 221
779 3300046692 Ga0495671_0042619 Ga0495671_0042619_148_813 221
780 3300046692 Ga0495671_0048067 Ga0495671_0048067_311_976 221
781 3300046692 Ga0495671_0076883 Ga0495671_0076883_865_1530 221
782 3300046694 Ga0495649_0001934 Ga0495649_0001934_182_847 221
783 3300046694 Ga0495649_0033119 Ga0495649_0033119_1533_2198 221
784 3300046694 Ga0495649_0040894 Ga0495649_0040894_345_1010 221
785 3300046694 Ga0495649_0085978 Ga0495649_0085978_302_967 221
786 3300046809 Ga0495600_0160842 Ga0495600_0160842_602_1267 221
787 3300046810 Ga0495660_0090833 Ga0495660_0090833_618_1283 221
788 3300046810 Ga0495660_0092737 Ga0495660_0092737_563_1228 221
789 3300047317 Ga0495604_0077308 Ga0495604_0077308_1562_2227 221
790 3300047317 Ga0495604_0104275 Ga0495604_0104275_1291_1956 221
791 3300047318 Ga0495636_0025372 Ga0495636_0025372_1012_1677 221
792 3300047320 Ga0495672_0024361 Ga0495672_0024361_1764_2429 221
793 3300047320 Ga0495672_0039959 Ga0495672_0039959_680_1345 221
794 3300047321 Ga0495676_0041268 Ga0495676_0041268_656_1321 221
795 3300047322 Ga0495680_0054078 Ga0495680_0054078_838_1503 221
796 3300047322 Ga0495680_0076800 Ga0495680_0076800_351_1016 221
797 3300047322 Ga0495680_0084812 Ga0495680_0084812_132_797 221
798 3300047323 Ga0495683_0000254 Ga0495683_0000254_39523_40188 221
799 3300047323 Ga0495683_0040465 Ga0495683_0040465_1543_2208 221
800 3300047323 Ga0495683_0044021 Ga0495683_0044021_1527_2192 221
801 3300047323 Ga0495683_0054943 Ga0495683_0054943_22_687 221
802 3300047323 Ga0495683_0090511 Ga0495683_0090511_132_797 221
803 3300047444 Ga0495675_0167747 Ga0495675_0167747_500_1165 221
804 3300047444 Ga0495675_0177245 Ga0495675_0177245_132_797 221
805 3300047469 Ga0495673_0027595 Ga0495673_0027595_489_1154 221
806 3300047469 Ga0495673_0203908 Ga0495673_0203908_52_717 221
807 3300047470 Ga0495681_0006934 Ga0495681_0006934_5108_5773 221
808 3300047470 Ga0495681_0042086 Ga0495681_0042086_107_772 221
809 3300047470 Ga0495681_0044871 Ga0495681_0044871_147_812 221
810 3300047470 Ga0495681_0118793 Ga0495681_0118793_133_798 221
811 3300047472 Ga0495686_0074046 Ga0495686_0074046_146_811 221
812 3300048091 Ga0495626_0016183 Ga0495626_0016183_1407_2072 221
813 3300048091 Ga0495626_0026996 Ga0495626_0026996_1564_2229 221
814 3300048091 Ga0495626_0035412 Ga0495626_0035412_147_812 221
815 3300048905 Ga0496102_0733024 Ga0496102_0733024_147_812 221
816 3300048913 Ga0496110_0343334 Ga0496110_0343334_165_830 221
817 3300048917 Ga0496114_0012182 Ga0496114_0012182_58_723 221
818 3300048919 Ga0496116_0019231 Ga0496116_0019231_85_750 221
819 3300048921 Ga0496118_0003760 Ga0496118_0003760_1536_2201 221
820 3300048921 Ga0496118_0004272 Ga0496118_0004272_14735_15400 221
821 3300048925 Ga0496122_0002929 Ga0496122_0002929_16850_17515 221
822 3300048926 Ga0496123_0003514 Ga0496123_0003514_759_1424 221
823 3300048927 Ga0496124_0005898 Ga0496124_0005898_12844_13509 221
824 3300048927 Ga0496124_0069900 Ga0496124_0069900_1563_2228 221
825 3300048928 Ga0496125_0039422 Ga0496125_0039422_48_713 221
826 3300048928 Ga0496125_0082115 Ga0496125_0082115_302_967 221
827 3300048929 Ga0496126_0027779 Ga0496126_0027779_59_724 221
828 3300049459 Ga0495678_078603 Ga0495678_078603_441_1106 221
829 3300049459 Ga0495678_127788 Ga0495678_127788_86_751 221
830 3300049571 Ga0501034_0000214 Ga0501034_0000214_93823_94488 221
831 3300050491 nmdc:mga00v17_296811_c1 nmdc:mga00v17_296811_c1_29_694 221
832 iso_pu_bacteria 2511231023 2511369245 221
833 iso_pu_bacteria 2511231031 2511412033 221
834 iso_pu_bacteria 2511231156 2511827236 221
835 iso_pu_bacteria 2599185318 2600038434 221
836 iso_pu_bacteria 2599185319 2600043766 221
837 iso_pu_bacteria 2599185323 2600067259 221
838 iso_pu_bacteria 2619619299 2621297221 221
839 iso_pu_bacteria 2623620443 2624483002 221
840 iso_pu_bacteria 2623620446 2624494531 221
841 iso_pu_bacteria 2643221650 2644286646 221
842 iso_pu_bacteria 2738541265 2738673035 221
843 iso_pu_bacteria 2738541282 2738751428 221
844 iso_pu_bacteria 2738541303 2738860469 221
845 iso_pu_bacteria 2816332298 2817493661 221
846 iso_pu_bacteria 2825651385 2825655507 221
847 iso_pu_bacteria 2842854478 2842859181 221
848 iso_pu_bacteria 2919063839 2919067685 221
849 iso_pu_bacteria 2919697872 2919701369 221
850 iso_pu_bacteria 2945961074 2945966378 221
851 iso_pu_bacteria 8019775933 8019780466 221
852 iso_pu_bacteria 8056143049 8056148360 221
853 3300009011 Ga0105251_10000011 Ga0105251_10000011136 223
854 3300009036 Ga0105244_10007401 Ga0105244_100074012 223
855 3300013100 Ga0157373_10012234 Ga0157373_100122342 223
856 3300013104 Ga0157370_10000199 Ga0157370_100001991 223
857 3300013105 Ga0157369_10648022 Ga0157369_106480222 223
858 3300025728 Ga0207655_1001571 Ga0207655_10015718 223
859 3300025735 Ga0207713_1000073 Ga0207713_1000073136 223
860 3300033180 Ga0307510_10067813 Ga0307510_100678135 223
861 3300041511 Ga0451855_1859058 Ga0451855_1859058_124_795 223
862 3300042016 Ga0439463_000187 Ga0439463_000187_533_1204 223
863 3300046452 Ga0495617_006470 Ga0495617_006470_3137_3808 223
864 3300046453 Ga0495627_000037 Ga0495627_000037_30006_30677 223
865 3300046453 Ga0495627_011003 Ga0495627_011003_70_741 223
866 3300046457 Ga0495590_0020517 Ga0495590_0020517_1260_1931 223
867 3300046458 Ga0495591_000036 Ga0495591_000036_106674_107345 223
868 3300046458 Ga0495591_000753 Ga0495591_000753_7346_8017 223
869 3300046458 Ga0495591_002891 Ga0495591_002891_4020_4691 223
870 3300046458 Ga0495591_009904 Ga0495591_009904_2976_3647 223
871 3300046458 Ga0495591_010733 Ga0495591_010733_2600_3271 223
872 3300046460 Ga0495638_0248350 Ga0495638_0248350_167_838 223
873 3300046471 Ga0495650_0000311 Ga0495650_0000311_66324_66995 223
874 3300046471 Ga0495650_0003191 Ga0495650_0003191_8724_9395 223
875 3300046474 Ga0495605_0000209 Ga0495605_0000209_43707_44378 223
876 3300046474 Ga0495605_0001216 Ga0495605_0001216_15769_16440 223
877 3300046474 Ga0495605_0002128 Ga0495605_0002128_9934_10605 223
878 3300046474 Ga0495605_0016035 Ga0495605_0016035_70_741 223
879 3300046491 Ga0495584_0066506 Ga0495584_0066506_1056_1727 223
880 3300046492 Ga0495585_0106987 Ga0495585_0106987_716_1387 223
881 3300046500 Ga0495596_0063601 Ga0495596_0063601_86_757 223
882 3300046501 Ga0495607_0000482 Ga0495607_0000482_33284_33955 223
883 3300046501 Ga0495607_0000938 Ga0495607_0000938_10576_11247 223
884 3300046501 Ga0495607_0001384 Ga0495607_0001384_19480_20151 223
885 3300046501 Ga0495607_0002221 Ga0495607_0002221_96_767 223
886 3300046501 Ga0495607_0025076 Ga0495607_0025076_2932_3603 223
887 3300046501 Ga0495607_0053155 Ga0495607_0053155_96_767 223
888 3300046501 Ga0495607_0159648 Ga0495607_0159648_132_803 223
889 3300046501 Ga0495607_0180299 Ga0495607_0180299_135_806 223
890 3300046506 Ga0495583_0000583 Ga0495583_0000583_43046_43717 223
891 3300046506 Ga0495583_0000830 Ga0495583_0000830_10480_11151 223
892 3300046506 Ga0495583_0006886 Ga0495583_0006886_447_1118 223
893 3300046506 Ga0495583_0008728 Ga0495583_0008728_4112_4783 223
894 3300046506 Ga0495583_0014672 Ga0495583_0014672_3417_4088 223
895 3300046507 Ga0495606_0001608 Ga0495606_0001608_13337_14008 223
896 3300046507 Ga0495606_0030559 Ga0495606_0030559_1094_1765 223
897 3300046507 Ga0495606_0220015 Ga0495606_0220015_296_967 223
898 3300046512 Ga0495610_0007823 Ga0495610_0007823_4220_4891 223
899 3300046512 Ga0495610_0012332 Ga0495610_0012332_426_1097 223
900 3300046513 Ga0495616_0020878 Ga0495616_0020878_553_1224 223
901 3300046515 Ga0495620_0005934 Ga0495620_0005934_5829_6500 223
902 3300046518 Ga0495631_0057391 Ga0495631_0057391_142_813 223
903 3300046519 Ga0495632_0001173 Ga0495632_0001173_10005_10676 223
904 3300046519 Ga0495632_0004961 Ga0495632_0004961_80_751 223
905 3300046519 Ga0495632_0050671 Ga0495632_0050671_98_769 223
906 3300046520 Ga0495637_0000064 Ga0495637_0000064_67153_67824 223
907 3300046520 Ga0495637_0000110 Ga0495637_0000110_34308_34979 223
908 3300046520 Ga0495637_0005109 Ga0495637_0005109_364_1035 223
909 3300046520 Ga0495637_0011594 Ga0495637_0011594_3460_4131 223
910 3300046522 Ga0495643_0007213 Ga0495643_0007213_363_1034 223
911 3300046522 Ga0495643_0030249 Ga0495643_0030249_2049_2720 223
912 3300046523 Ga0495644_0003744 Ga0495644_0003744_4570_5241 223
913 3300046524 Ga0495648_0001400 Ga0495648_0001400_22845_23516 223
914 3300046530 Ga0495654_0002519 Ga0495654_0002519_5673_6344 223
915 3300046530 Ga0495654_0002943 Ga0495654_0002943_3258_3929 223
916 3300046530 Ga0495654_0061597 Ga0495654_0061597_139_810 223
917 3300046538 Ga0495609_0000089 Ga0495609_0000089_77835_78506 223
918 3300046538 Ga0495609_0000161 Ga0495609_0000161_26753_27424 223
919 3300046542 Ga0495597_0000026 Ga0495597_0000026_29035_29706 223
920 3300046557 Ga0495622_0003910 Ga0495622_0003910_300_971 223
921 3300046616 Ga0495668_0031470 Ga0495668_0031470_1149_1820 223
922 3300046616 Ga0495668_0177243 Ga0495668_0177243_486_1157 223
923 3300046648 Ga0495611_0000395 Ga0495611_0000395_25902_26573 223
924 3300046660 Ga0495625_0000194 Ga0495625_0000194_69536_70207 223
925 3300046665 Ga0495661_0000115 Ga0495661_0000115_27186_27857 223
926 3300046665 Ga0495661_0000233 Ga0495661_0000233_24603_25274 223
927 3300046691 Ga0495670_0036942 Ga0495670_0036942_1645_2316 223
928 3300046691 Ga0495670_0043992 Ga0495670_0043992_258_929 223
929 3300046692 Ga0495671_0010701 Ga0495671_0010701_3319_3990 223
930 3300046694 Ga0495649_0008385 Ga0495649_0008385_2616_3287 223
931 3300046810 Ga0495660_0000540 Ga0495660_0000540_650_1321 223
932 3300046810 Ga0495660_0001212 Ga0495660_0001212_477_1148 223
933 3300046810 Ga0495660_0001791 Ga0495660_0001791_358_1029 223
934 3300046810 Ga0495660_0018356 Ga0495660_0018356_257_928 223
935 3300047320 Ga0495672_0002759 Ga0495672_0002759_8817_9488 223
936 3300047320 Ga0495672_0004062 Ga0495672_0004062_8809_9480 223
937 3300047320 Ga0495672_0025709 Ga0495672_0025709_2303_2974 223
938 3300047320 Ga0495672_0034982 Ga0495672_0034982_1326_1997 223
939 3300047320 Ga0495672_0258084 Ga0495672_0258084_70_741 223
940 3300047321 Ga0495676_0000052 Ga0495676_0000052_26918_27589 223
941 3300047446 Ga0495679_000136 Ga0495679_000136_49916_50587 223
942 3300047469 Ga0495673_0000487 Ga0495673_0000487_8572_9243 223
943 3300047469 Ga0495673_0000858 Ga0495673_0000858_8133_8804 223
944 3300047469 Ga0495673_0004566 Ga0495673_0004566_3215_3886 223
945 3300047469 Ga0495673_0037928 Ga0495673_0037928_1449_2120 223
946 3300047469 Ga0495673_0202809 Ga0495673_0202809_59_730 223
947 3300047470 Ga0495681_0037709 Ga0495681_0037709_1171_1842 223
948 3300047472 Ga0495686_0041182 Ga0495686_0041182_2080_2751 223
949 3300048091 Ga0495626_0000126 Ga0495626_0000126_26788_27459 223
950 3300048905 Ga0496102_0559426 Ga0496102_0559426_262_933 223
951 3300048906 Ga0496103_0172472 Ga0496103_0172472_528_1199 223
952 3300048913 Ga0496110_0277946 Ga0496110_0277946_328_999 223
953 3300048915 Ga0496112_0287635 Ga0496112_0287635_170_841 223
954 3300048916 Ga0496113_0401979 Ga0496113_0401979_14_685 223
955 3300048919 Ga0496116_0106046 Ga0496116_0106046_769_1440 223
956 3300048920 Ga0496117_0067351 Ga0496117_0067351_1604_2275 223
957 3300048920 Ga0496117_0072615 Ga0496117_0072615_1068_1739 223
958 3300048921 Ga0496118_0030186 Ga0496118_0030186_104_775 223
959 3300048924 Ga0496121_0002170 Ga0496121_0002170_9979_10650 223
960 3300048924 Ga0496121_0103065 Ga0496121_0103065_1116_1787 223
961 3300048925 Ga0496122_0000434 Ga0496122_0000434_64866_65537 223
962 3300048926 Ga0496123_0000318 Ga0496123_0000318_22000_22671 223
963 3300048926 Ga0496123_0013642 Ga0496123_0013642_6017_6688 223
964 3300048927 Ga0496124_0000471 Ga0496124_0000471_41585_42256 223
965 3300048927 Ga0496124_0013915 Ga0496124_0013915_3247_3918 223
966 3300048927 Ga0496124_0045602 Ga0496124_0045602_1547_2218 223
967 3300049459 Ga0495678_000169 Ga0495678_000169_50729_51400 223
968 3300049459 Ga0495678_002042 Ga0495678_002042_3302_3973 223
969 3300049460 Ga0495682_0001213 Ga0495682_0001213_9897_10568 223
970 3300049539 Ga0501323_020451 Ga0501323_020451_54_725 223
971 3300053140 Ga0500573_0052401 Ga0500573_0052401_1533_2204 223
972 3300030733 Ga0314311_1094938 Ga0314311_10949382 224
973 3300030742 Ga0316183_1205059 Ga0316183_12050592 224
974 3300030744 Ga0316181_1020879 Ga0316181_10208793 224
975 3300031731 Ga0307405_10079322 Ga0307405_100793223 224
976 3300031824 Ga0307413_10076951 Ga0307413_100769513 224
977 3300031903 Ga0307407_10060628 Ga0307407_100606282 224
978 3300031911 Ga0307412_10275955 Ga0307412_102759552 224
979 3300031995 Ga0307409_100164583 Ga0307409_1001645831 224
980 3300032002 Ga0307416_100355594 Ga0307416_1003555942 224
981 3300032004 Ga0307414_10095095 Ga0307414_100950953 224
982 3300032005 Ga0307411_10080529 Ga0307411_100805293 224
983 3300048925 Ga0496122_0163129 Ga0496122_0163129_647_1321 224
984 2162886007 SwRhRL2b_contig_2478714 SwRhRL2b_0770.00000170 225
985 3300005288 Ga0065714_10003334 Ga0065714_1000333412 225
986 3300005288 Ga0065714_10012864 Ga0065714_100128641 225
987 3300005289 Ga0065704_10212940 Ga0065704_102129401 225
988 3300005353 Ga0070669_100001254 Ga0070669_10000125420 225
989 3300009036 Ga0105244_10040053 Ga0105244_100400532 225
990 3300013104 Ga0157370_10141103 Ga0157370_101411033 225
991 3300013306 Ga0163162_10176131 Ga0163162_101761311 225
992 3300015261 Ga0182006_1031266 Ga0182006_10312661 225
993 3300015262 Ga0182007_10019444 Ga0182007_100194443 225
994 3300015265 Ga0182005_1014004 Ga0182005_10140043 225
995 3300025291 Ga0209675_1004836 Ga0209675_10048361 225
996 3300025711 Ga0207696_1006336 Ga0207696_10063363 225
997 3300025728 Ga0207655_1001228 Ga0207655_100122811 225
998 3300025735 Ga0207713_1004132 Ga0207713_100413211 225
999 3300025923 Ga0207681_10006860 Ga0207681_1000686011 225
1000 3300028379 Ga0268266_10447827 Ga0268266_104478272 225
1001 3300031548 Ga0307408_100104143 Ga0307408_1001041433 225
1002 3300041405 Ga0439438_002874 Ga0439438_002874_5639_6316 225
1003 3300041407 Ga0439447_013584 Ga0439447_013584_1327_2004 225
1004 3300041411 Ga0439466_0022380 Ga0439466_0022380_107_784 225
1005 3300042006 Ga0439432_012974 Ga0439432_012974_107_784 225
1006 3300042010 Ga0439452_013601 Ga0439452_013601_302_979 225
1007 3300042016 Ga0439463_008136 Ga0439463_008136_1288_1965 225
1008 3300042115 Ga0450911_003507 Ga0450911_003507_1562_2239 225
1009 3300042127 Ga0450890_007951 Ga0450890_007951_385_1062 225
1010 3300042138 Ga0450903_003615 Ga0450903_003615_1535_2212 225
1011 3300042145 Ga0450906_004475 Ga0450906_004475_1583_2260 225
1012 3300042156 Ga0439446_0017685 Ga0439446_0017685_1210_1887 225
1013 3300042461 Ga0439460_0001891 Ga0439460_0001891_4212_4889 225
1014 3300046452 Ga0495617_009460 Ga0495617_009460_1542_2219 225
1015 3300046453 Ga0495627_010669 Ga0495627_010669_1465_2142 225
1016 3300046457 Ga0495590_0015406 Ga0495590_0015406_1562_2239 225
1017 3300046474 Ga0495605_0051663 Ga0495605_0051663_458_1135 225
1018 3300046474 Ga0495605_0166072 Ga0495605_0166072_127_804 225
1019 3300046475 Ga0495639_0000248 Ga0495639_0000248_24828_25505 225
1020 3300046491 Ga0495584_0038504 Ga0495584_0038504_1633_2310 225
1021 3300046491 Ga0495584_0042048 Ga0495584_0042048_90_767 225
1022 3300046492 Ga0495585_0153449 Ga0495585_0153449_419_1096 225
1023 3300046501 Ga0495607_0003809 Ga0495607_0003809_10578_11255 225
1024 3300046501 Ga0495607_0174988 Ga0495607_0174988_91_768 225
1025 3300046506 Ga0495583_0007941 Ga0495583_0007941_1438_2115 225
1026 3300046512 Ga0495610_0044480 Ga0495610_0044480_1446_2123 225
1027 3300046513 Ga0495616_0030970 Ga0495616_0030970_568_1245 225
1028 3300046513 Ga0495616_0042996 Ga0495616_0042996_81_758 225
1029 3300046519 Ga0495632_0028752 Ga0495632_0028752_1430_2107 225
1030 3300046519 Ga0495632_0039577 Ga0495632_0039577_1569_2246 225
1031 3300046519 Ga0495632_0043209 Ga0495632_0043209_78_755 225
1032 3300046519 Ga0495632_0124728 Ga0495632_0124728_389_1069 225
1033 3300046520 Ga0495637_0060345 Ga0495637_0060345_696_1373 225
1034 3300046522 Ga0495643_0064532 Ga0495643_0064532_134_811 225
1035 3300046524 Ga0495648_0077708 Ga0495648_0077708_741_1418 225
1036 3300046524 Ga0495648_0139014 Ga0495648_0139014_159_836 225
1037 3300046528 Ga0495642_0027458 Ga0495642_0027458_83_760 225
1038 3300046538 Ga0495609_0061372 Ga0495609_0061372_33_710 225
1039 3300046557 Ga0495622_0008666 Ga0495622_0008666_1152_1829 225
1040 3300046615 Ga0495656_0049529 Ga0495656_0049529_83_760 225
1041 3300046648 Ga0495611_0035575 Ga0495611_0035575_1434_2111 225
1042 3300046664 Ga0495659_0008033 Ga0495659_0008033_1581_2258 225
1043 3300046664 Ga0495659_0018348 Ga0495659_0018348_1562_2239 225
1044 3300046684 Ga0495669_0281982 Ga0495669_0281982_90_767 225
1045 3300046692 Ga0495671_0041876 Ga0495671_0041876_79_756 225
1046 3300046694 Ga0495649_0040252 Ga0495649_0040252_1084_1761 225
1047 3300046694 Ga0495649_0045564 Ga0495649_0045564_134_811 225
1048 3300046794 Ga0495589_0018396 Ga0495589_0018396_1377_2054 225
1049 3300046794 Ga0495589_0178872 Ga0495589_0178872_156_833 225
1050 3300046810 Ga0495660_0063961 Ga0495660_0063961_104_781 225
1051 3300047320 Ga0495672_0026547 Ga0495672_0026547_1368_2045 225
1052 3300047320 Ga0495672_0064617 Ga0495672_0064617_444_1121 225
1053 3300047323 Ga0495683_0049012 Ga0495683_0049012_68_745 225
1054 3300047443 Ga0495687_019088 Ga0495687_019088_1109_1786 225
1055 3300047445 Ga0495677_0015191 Ga0495677_0015191_1523_2200 225
1056 3300047470 Ga0495681_0022764 Ga0495681_0022764_1435_2112 225
1057 3300048091 Ga0495626_0019595 Ga0495626_0019595_1118_1795 225
1058 3300048091 Ga0495626_0035440 Ga0495626_0035440_1571_2248 225
1059 3300048091 Ga0495626_0038193 Ga0495626_0038193_361_1038 225
1060 3300048909 Ga0496106_0132833 Ga0496106_0132833_1230_1907 225
1061 3300048919 Ga0496116_0037567 Ga0496116_0037567_1111_1788 225
1062 3300048924 Ga0496121_0079897 Ga0496121_0079897_1280_1957 225
1063 3300048925 Ga0496122_0093236 Ga0496122_0093236_36_713 225
1064 3300048929 Ga0496126_0277065 Ga0496126_0277065_679_1356 225
1065 3300049459 Ga0495678_029232 Ga0495678_029232_134_811 225
1066 3300049459 Ga0495678_086008 Ga0495678_086008_132_809 225
1067 3300049460 Ga0495682_0028092 Ga0495682_0028092_435_1112 225
1068 3300049460 Ga0495682_0111657 Ga0495682_0111657_232_909 225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00677

Lum_binding

Lumazine binding domain

131

215

0.98

PF00677

Lum_binding

Lumazine binding domain

34

118

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pkv-assembly1.cif.gz_B the n-terminal domain of riboflavin synthase in complex with riboflavin 0.9698 1 87
4g6i-assembly1.cif.gz_B crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with roseoflavin 0.9663 1 195
4fxu-assembly1.cif.gz_A crystallographic structure of trimeric riboflavin synthase from brucella abortus 0.9649 1 195
1pkv-assembly1.cif.gz_B the n-terminal domain of riboflavin synthase in complex with riboflavin 0.959 1 87
4fxu-assembly1.cif.gz_A crystallographic structure of trimeric riboflavin synthase from brucella abortus 0.9553 1 195
ID Description Score Start End Superfamily
4fxuC02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9651 102 192 2.40.30.20
af_Q2FXG0_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9613 1 89 2.40.30.20
af_P0AFU8_1_89_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9593 1 89 2.40.30.20
4fxuA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.959 1 89 2.40.30.20
af_A0A1D8PP67_110_218_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9558 102 194 2.40.30.20
ID Description Score Start End GO Terms
AF-A0A066RW78-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9886 1 189 GO:0004746
GO:0009231
AF-A0A0Q0CFZ6-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9865 2 202 GO:0004746
GO:0009231
AF-A0A844M1F6-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9839 1 194 GO:0004746
GO:0009231
AF-A0A066RW78-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9834 1 189 GO:0004746
GO:0009231
AF-A0A1S9CYA2-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9833 1 194 GO:0004746
GO:0009231

Feature Viewer

pLDDT pTM Quality
91.79 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map