F489449
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1068 | 559 | 789 | 220 |
Family's Representative Sequence
| Representative Sequence | 3300046524|Ga0495648_0073023|Ga0495648_0073023_147_905 |
| Length | 252 |
| Sequence | MTGGSLPFLCQQQAYNFRPRYSVGFVLEENLMFTGIIESIGSIRALTPKGGDVRVHVETGKLDLSDVKLGDSIAVNGVCLTAVELPGNGFAADVSRETLDCTAMNDLKSGSPVNLEKALTPTTRLGGHLVSGHVDGVGEVVARTENARAVEFRIRAPKELARYIAHKGSITVDGTSLTVNAVDGAEFLLTIIPHTLSETIMASYQPGRRVNLEVDLLARYLERLLLGDKAAEPTAGSTITESFLAQNGYLKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 3 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 4 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 5 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 6 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 7 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 8 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 9 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 10 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 11 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 12 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 13 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 14 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 15 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 16 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 17 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 18 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 19 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 20 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 21 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 22 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 23 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 24 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 25 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 26 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 27 | 2585428059 | Paenibacillus chondroitinus OK414 | Isolate | Rhizosphere |
| 28 | 2593339198 | Paenibacillus sp. UNCCL117 | Isolate | Unclassified |
| 29 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 30 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 31 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 32 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 33 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 34 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 35 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 36 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 37 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 38 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 39 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 40 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 41 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 42 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 43 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 44 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 45 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 46 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 47 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 48 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 49 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 50 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 51 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 52 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 53 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 54 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 55 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 56 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 57 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 58 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 59 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 60 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 61 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 62 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 63 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 64 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 65 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 66 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 67 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 68 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 69 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 70 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 71 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 72 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 73 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 74 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 75 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 76 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 77 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 78 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 79 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 80 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 81 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 82 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 83 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 84 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 85 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 86 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 87 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 88 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 89 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 90 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 91 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 92 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 93 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 94 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 95 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 96 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 97 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 98 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 99 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 100 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 101 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 102 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 103 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 104 | 2643221676 | Paenibacillus sp. Root444D2 | Isolate | Unclassified |
| 105 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 106 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 107 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 108 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 109 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 110 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 111 | 2671180694 | Paenibacillus sp. A3 | Isolate | Unclassified |
| 112 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 113 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 114 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 115 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 116 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 117 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 118 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 119 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 120 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 121 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 122 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 123 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 124 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 125 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 126 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 127 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 128 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 129 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 130 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 131 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 132 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 133 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 134 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 135 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 136 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 137 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 138 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 139 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 140 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 141 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 142 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 143 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 144 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 145 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 146 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 147 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 148 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 149 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 150 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 151 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 152 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 153 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 154 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 155 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 156 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 157 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 158 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 159 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 160 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 161 | 2818991459 | Paenibacillus sp. 597 | Isolate | Unclassified |
| 162 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 163 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 164 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 165 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 166 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 167 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 168 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 169 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 170 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 171 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 172 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 173 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 174 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 175 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 176 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 177 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 178 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 179 | 2857453340 | Paenibacillus sp. R-74130 | Isolate | Unclassified |
| 180 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 181 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 182 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 183 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 184 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 185 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 186 | 2904755435 | Paenibacillus aceris KACC 19194 | Isolate | Rhizosphere |
| 187 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 188 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 189 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 190 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 191 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 192 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 193 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 194 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 195 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 196 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 197 | 2919425241 | Bacillus sp. 3255 | Isolate | Rhizosphere |
| 198 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 199 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 200 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 201 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 202 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 203 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 204 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 205 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 206 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 207 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 208 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 209 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 210 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 211 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 212 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 213 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 214 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 215 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 216 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 217 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 218 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 219 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 220 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 221 | 2971410472 | Paenibacillus oryzisoli 1ZS3-15 | Isolate | Unclassified |
| 222 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 223 | 2977254563 | Bacillus sp. SORGH_AS 510 | Isolate | Unclassified |
| 224 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 225 | 2980182181 | Paenibacillus cymbidii R196 | Isolate | Unclassified |
| 226 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 227 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 228 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 229 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
| 230 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 231 | 2990275345 | Bacillus sp. SLBN-46 | Isolate | Unclassified |
| 232 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 233 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 234 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 235 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 236 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 237 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 238 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 239 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 240 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 241 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 242 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 243 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 244 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 245 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 246 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 247 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 248 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 249 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 250 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 251 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 252 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 253 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 254 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 255 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 256 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 257 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 258 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 259 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 260 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 261 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 262 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 263 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 264 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 265 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 266 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 267 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 268 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 269 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 270 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 271 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 272 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 273 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 274 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 275 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 276 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 277 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 278 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 279 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 280 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 281 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 283 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 284 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 285 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 286 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 287 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 288 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 289 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 290 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 291 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 292 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 293 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 294 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 295 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 296 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 297 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 298 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 299 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 300 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 301 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 302 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 303 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 304 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 305 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 306 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 307 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 308 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 309 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 310 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 311 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 312 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 313 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 314 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 315 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 316 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 317 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 318 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 319 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 320 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 321 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 322 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 323 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 324 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 325 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 326 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 344 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 346 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 352 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 354 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 355 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 356 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 357 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 358 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 359 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 360 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 361 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 362 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 363 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 364 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 365 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 366 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 367 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 368 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 369 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 370 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 371 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 372 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 373 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 374 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 375 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 377 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 378 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 379 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 380 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 381 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 382 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 383 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 384 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 385 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 386 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 387 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 388 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 389 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 390 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 391 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 392 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 393 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 394 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 395 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 396 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 397 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 398 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 399 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 400 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 401 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 402 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 403 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 404 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 405 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 406 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 407 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 408 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 409 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 410 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 411 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 412 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 413 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 414 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 415 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 416 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 417 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 418 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 419 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 420 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 421 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 422 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 490 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 491 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 492 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 493 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 494 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 495 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 496 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 497 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 498 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 499 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 500 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 501 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 502 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 503 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 504 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 505 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 506 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 507 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 508 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 509 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 512 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 513 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 514 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 515 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 516 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 517 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 518 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 519 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 520 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 521 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 522 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 523 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 524 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 525 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 526 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 527 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 528 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
| 529 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 530 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 531 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 532 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 533 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 534 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 535 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 536 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 537 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 538 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 539 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 540 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 541 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 542 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 543 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 544 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 545 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 546 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 547 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 548 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 549 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 550 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 551 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 552 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 553 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 554 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 555 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 556 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 557 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
| 558 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 559 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.22 |
| Metatranscriptomes | 0.66 |
| Isolates | 26.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.09 |
| Bulb | 0 |
| Endosphere | 5.9 |
| Nodule | 2.9 |
| Rhizoplane | 7.49 |
| Rhizosphere | 69.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2478714 | 2162886007 | Bacteria | 1035 |
| 2 | JGI25162J39368_1005306 | 3300002737 | Bacteria | 2591 |
| 3 | JGI25162J39368_1005513 | 3300002737 | Bacteria | 2449 |
| 4 | JGI25154J39366_1004759 | 3300002738 | Bacteria | 2327 |
| 5 | JGI25163J39215_1001948 | 3300002771 | Bacteria | 2591 |
| 6 | JGI25163J39215_1002029 | 3300002771 | Bacteria | 2449 |
| 7 | JGI25164J39214_1002669 | 3300002772 | Bacteria | 2591 |
| 8 | JGI25164J39214_1002812 | 3300002772 | Bacteria | 2449 |
| 9 | JGI25165J46597_1005143 | 3300003214 | Bacteria | 2591 |
| 10 | JGI25165J46597_1005440 | 3300003214 | Bacteria | 2449 |
| 11 | rootH1_10001451 | 3300003323 | Bacteria | 19518 |
| 12 | rootH1_10025242 | 3300003323 | Bacteria | 17315 |
| 13 | Ga0055538_1000042 | 3300003751 | Bacteria | 164754 |
| 14 | Ga0055539_1000055 | 3300003752 | Bacteria | 164754 |
| 15 | Ga0055533_1000067 | 3300003756 | Bacteria | 164754 |
| 16 | Ga0055532_1000053 | 3300003758 | Bacteria | 164751 |
| 17 | Ga0055525_1000103 | 3300003759 | Bacteria | 134778 |
| 18 | Ga0055535_1002633 | 3300003761 | Bacteria | 5971 |
| 19 | Ga0055536_1002107 | 3300003781 | Bacteria | 11324 |
| 20 | Ga0055536_1013930 | 3300003781 | Bacteria | 2861 |
| 21 | Ga0055536_1017823 | 3300003781 | Bacteria | 2305 |
| 22 | Ga0055530_10004850 | 3300003791 | Bacteria | 6722 |
| 23 | Ga0055530_10015387 | 3300003791 | Bacteria | 2499 |
| 24 | Ga0055530_10015585 | 3300003791 | Bacteria | 2472 |
| 25 | Ga0055540_1000330 | 3300003792 | Bacteria | 41330 |
| 26 | Ga0055540_1000552 | 3300003792 | Bacteria | 27915 |
| 27 | Ga0055540_1009024 | 3300003792 | Bacteria | 3506 |
| 28 | Ga0055540_1021543 | 3300003792 | Bacteria | 1670 |
| 29 | Ga0055531_10000125 | 3300003794 | Bacteria | 86349 |
| 30 | Ga0055541_1000042 | 3300003841 | Bacteria | 164754 |
| 31 | Ga0058692_1017633 | 3300003856 | Bacteria | 1563 |
| 32 | Ga0065714_10003334 | 3300005288 | Bacteria | 11093 |
| 33 | Ga0065714_10012864 | 3300005288 | Bacteria | 2248 |
| 34 | Ga0065714_10086001 | 3300005288 | Bacteria | 2120 |
| 35 | Ga0065704_10009187 | 3300005289 | Bacteria | 4565 |
| 36 | Ga0065704_10032660 | 3300005289 | Bacteria | 1196 |
| 37 | Ga0065704_10161370 | 3300005289 | Bacteria | 1352 |
| 38 | Ga0065704_10212940 | 3300005289 | Bacteria | 1102 |
| 39 | Ga0065712_10011834 | 3300005290 | Bacteria | 2451 |
| 40 | Ga0065712_10068081 | 3300005290 | Bacteria | 15301 |
| 41 | Ga0070670_100000686 | 3300005331 | Bacteria | 26278 |
| 42 | Ga0070661_100000664 | 3300005344 | Bacteria | 25245 |
| 43 | Ga0070669_100000417 | 3300005353 | Bacteria | 32587 |
| 44 | Ga0070669_100001254 | 3300005353 | Bacteria | 18423 |
| 45 | Ga0070669_100283914 | 3300005353 | Bacteria | 1327 |
| 46 | Ga0070673_100681125 | 3300005364 | Bacteria | 943 |
| 47 | Ga0070663_100337175 | 3300005455 | Bacteria | 1217 |
| 48 | Ga0070662_100000042 | 3300005457 | Bacteria | 72274 |
| 49 | Ga0070662_100045050 | 3300005457 | Bacteria | 3163 |
| 50 | Ga0070665_100031276 | 3300005548 | Bacteria | 5357 |
| 51 | Ga0070665_100150735 | 3300005548 | Bacteria | 2328 |
| 52 | Ga0070664_100000733 | 3300005564 | Bacteria | 25237 |
| 53 | Ga0068854_100007019 | 3300005578 | Bacteria | 7185 |
| 54 | Ga0068859_101243290 | 3300005617 | Bacteria | 820 |
| 55 | Ga0068851_10000002 | 3300005834 | Bacteria | 302756 |
| 56 | Ga0075432_10012148 | 3300006058 | Bacteria | 2927 |
| 57 | Ga0075432_10018695 | 3300006058 | Bacteria | 2364 |
| 58 | Ga0075432_10102147 | 3300006058 | Bacteria | 1060 |
| 59 | Ga0075362_10070790 | 3300006177 | Bacteria | 1592 |
| 60 | Ga0075362_10132324 | 3300006177 | Bacteria | 1187 |
| 61 | Ga0075369_10089781 | 3300006186 | Bacteria | 1370 |
| 62 | Ga0097620_101243042 | 3300006931 | Bacteria | 820 |
| 63 | Ga0099823_1000360 | 3300006944 | Bacteria | 28884 |
| 64 | Ga0079104_1000478 | 3300006946 | Bacteria | 44469 |
| 65 | Ga0079104_1000630 | 3300006946 | Bacteria | 34371 |
| 66 | Ga0079104_1018176 | 3300006946 | Bacteria | 1999 |
| 67 | Ga0105251_10000011 | 3300009011 | Bacteria | 180176 |
| 68 | Ga0105251_10000163 | 3300009011 | Bacteria | 68706 |
| 69 | Ga0105251_10003296 | 3300009011 | Bacteria | 11815 |
| 70 | Ga0105251_10022564 | 3300009011 | Bacteria | 3265 |
| 71 | Ga0105251_10034835 | 3300009011 | Bacteria | 2488 |
| 72 | Ga0105251_10047747 | 3300009011 | Bacteria | 2056 |
| 73 | Ga0105251_10058309 | 3300009011 | Bacteria | 1823 |
| 74 | Ga0105251_10072165 | 3300009011 | Bacteria | 1605 |
| 75 | Ga0105244_10003742 | 3300009036 | Bacteria | 10742 |
| 76 | Ga0105244_10007401 | 3300009036 | Bacteria | 6978 |
| 77 | Ga0105244_10010383 | 3300009036 | Bacteria | 5650 |
| 78 | Ga0105244_10040053 | 3300009036 | Bacteria | 2435 |
| 79 | Ga0105244_10043153 | 3300009036 | Bacteria | 2328 |
| 80 | Ga0105244_10044573 | 3300009036 | Bacteria | 2285 |
| 81 | Ga0105244_10045278 | 3300009036 | Bacteria | 2264 |
| 82 | Ga0105244_10078772 | 3300009036 | Bacteria | 1633 |
| 83 | Ga0105244_10099077 | 3300009036 | Bacteria | 1427 |
| 84 | Ga0105250_10001071 | 3300009092 | Bacteria | 15533 |
| 85 | Ga0105250_10013916 | 3300009092 | Bacteria | 3313 |
| 86 | Ga0105250_10024365 | 3300009092 | Bacteria | 2438 |
| 87 | Ga0105250_10025701 | 3300009092 | Bacteria | 2373 |
| 88 | Ga0105250_10027894 | 3300009092 | Bacteria | 2275 |
| 89 | Ga0105250_10192138 | 3300009092 | Bacteria | 859 |
| 90 | Ga0105245_10740487 | 3300009098 | Bacteria | 1018 |
| 91 | Ga0105243_10000188 | 3300009148 | Bacteria | 71863 |
| 92 | Ga0105243_10001384 | 3300009148 | Bacteria | 21521 |
| 93 | Ga0105243_10048181 | 3300009148 | Bacteria | 3358 |
| 94 | Ga0105243_10070431 | 3300009148 | Bacteria | 2824 |
| 95 | Ga0105243_10102040 | 3300009148 | Bacteria | 2383 |
| 96 | Ga0105242_10000489 | 3300009176 | Bacteria | 31476 |
| 97 | Ga0105248_10021285 | 3300009177 | Bacteria | 7187 |
| 98 | Ga0105237_10002187 | 3300009545 | Bacteria | 24489 |
| 99 | Ga0105237_10201739 | 3300009545 | Bacteria | 1989 |
| 100 | Ga0105249_10821813 | 3300009553 | Bacteria | 994 |
| 101 | Ga0105246_10032547 | 3300011119 | Bacteria | 3458 |
| 102 | Ga0105246_10038380 | 3300011119 | Bacteria | 3220 |
| 103 | Ga0105246_10052541 | 3300011119 | Bacteria | 2801 |
| 104 | Ga0105246_10054731 | 3300011119 | Bacteria | 2751 |
| 105 | Ga0157336_1000676 | 3300012477 | Bacteria | 1592 |
| 106 | Ga0157345_1000583 | 3300012498 | Bacteria | 3189 |
| 107 | Ga0157373_10012234 | 3300013100 | Bacteria | 6309 |
| 108 | Ga0157373_10082456 | 3300013100 | Bacteria | 2267 |
| 109 | Ga0157373_10085261 | 3300013100 | Bacteria | 2226 |
| 110 | Ga0157371_10000243 | 3300013102 | Bacteria | 77959 |
| 111 | Ga0157371_10035661 | 3300013102 | Bacteria | 3565 |
| 112 | Ga0157371_10081760 | 3300013102 | Bacteria | 2287 |
| 113 | Ga0157371_10124307 | 3300013102 | Bacteria | 1835 |
| 114 | Ga0157371_10396060 | 3300013102 | Bacteria | 1010 |
| 115 | Ga0157371_10573519 | 3300013102 | Bacteria | 838 |
| 116 | Ga0157371_10573520 | 3300013102 | Bacteria | 838 |
| 117 | Ga0157370_10000199 | 3300013104 | Bacteria | 75511 |
| 118 | Ga0157370_10140916 | 3300013104 | Bacteria | 2246 |
| 119 | Ga0157370_10141103 | 3300013104 | Bacteria | 2245 |
| 120 | Ga0157370_10919384 | 3300013104 | Bacteria | 794 |
| 121 | Ga0157369_10109808 | 3300013105 | Bacteria | 2932 |
| 122 | Ga0157369_10178907 | 3300013105 | Bacteria | 2232 |
| 123 | Ga0157369_10648022 | 3300013105 | Bacteria | 1089 |
| 124 | Ga0157369_10668585 | 3300013105 | Bacteria | 1070 |
| 125 | Ga0157369_10713790 | 3300013105 | Bacteria | 1032 |
| 126 | Ga0163162_10164309 | 3300013306 | Bacteria | 2343 |
| 127 | Ga0163162_10176131 | 3300013306 | Bacteria | 2264 |
| 128 | Ga0157372_10001840 | 3300013307 | Bacteria | 22986 |
| 129 | Ga0157372_10042028 | 3300013307 | Bacteria | 5054 |
| 130 | Ga0182008_10002892 | 3300014497 | Bacteria | 10626 |
| 131 | Ga0182008_10043820 | 3300014497 | Bacteria | 2227 |
| 132 | Ga0182008_10051354 | 3300014497 | Bacteria | 2045 |
| 133 | Ga0182008_10052508 | 3300014497 | Bacteria | 2020 |
| 134 | Ga0182006_1005570 | 3300015261 | Bacteria | 5980 |
| 135 | Ga0182006_1031266 | 3300015261 | Bacteria | 2146 |
| 136 | Ga0182006_1031761 | 3300015261 | Bacteria | 2126 |
| 137 | Ga0182006_1049210 | 3300015261 | Bacteria | 1627 |
| 138 | Ga0182006_1108978 | 3300015261 | Bacteria | 974 |
| 139 | Ga0182007_10019444 | 3300015262 | Bacteria | 2441 |
| 140 | Ga0182007_10026349 | 3300015262 | Bacteria | 2016 |
| 141 | Ga0182005_1008848 | 3300015265 | Bacteria | 2955 |
| 142 | Ga0182005_1014004 | 3300015265 | Bacteria | 2250 |
| 143 | Ga0182005_1038979 | 3300015265 | Bacteria | 1293 |
| 144 | Ga0163161_10110357 | 3300017792 | Bacteria | 2056 |
| 145 | Ga0163161_10742042 | 3300017792 | Bacteria | 821 |
| 146 | Ga0163161_10873663 | 3300017792 | Bacteria | 760 |
| 147 | Ga0209435_103159 | 3300025206 | Bacteria | 1888 |
| 148 | Ga0209760_100058 | 3300025207 | Bacteria | 98827 |
| 149 | Ga0209760_100060 | 3300025207 | Bacteria | 97274 |
| 150 | Ga0209784_100060 | 3300025224 | Bacteria | 164838 |
| 151 | Ga0209566_100075 | 3300025225 | Bacteria | 164838 |
| 152 | Ga0209566_100644 | 3300025225 | Bacteria | 21095 |
| 153 | Ga0209674_100100 | 3300025226 | Bacteria | 164838 |
| 154 | Ga0209147_100096 | 3300025229 | Bacteria | 164838 |
| 155 | Ga0209563_100118 | 3300025230 | Bacteria | 131627 |
| 156 | Ga0209563_100242 | 3300025230 | Bacteria | 26179 |
| 157 | Ga0207427_100056 | 3300025231 | Bacteria | 204343 |
| 158 | Ga0207427_100063 | 3300025231 | Bacteria | 177711 |
| 159 | Ga0209437_100065 | 3300025233 | Bacteria | 332417 |
| 160 | Ga0209437_100133 | 3300025233 | Bacteria | 178493 |
| 161 | Ga0209258_100221 | 3300025242 | Bacteria | 108497 |
| 162 | Ga0209646_1000230 | 3300025246 | Bacteria | 59499 |
| 163 | Ga0209677_100057 | 3300025253 | Bacteria | 164838 |
| 164 | Ga0209759_1001811 | 3300025256 | Bacteria | 10796 |
| 165 | Ga0209233_1000085 | 3300025261 | Bacteria | 333078 |
| 166 | Ga0209233_1000133 | 3300025261 | Bacteria | 202716 |
| 167 | Ga0209675_1004836 | 3300025291 | Bacteria | 5837 |
| 168 | Ga0209676_1000076 | 3300025292 | Bacteria | 301393 |
| 169 | Ga0209676_1000314 | 3300025292 | Bacteria | 94905 |
| 170 | Ga0209676_1000337 | 3300025292 | Bacteria | 89361 |
| 171 | Ga0209676_1001941 | 3300025292 | Bacteria | 16658 |
| 172 | Ga0209676_1018983 | 3300025292 | Bacteria | 2379 |
| 173 | Ga0209050_1000063 | 3300025298 | Bacteria | 314955 |
| 174 | Ga0209050_1000080 | 3300025298 | Bacteria | 275154 |
| 175 | Ga0209050_1000106 | 3300025298 | Bacteria | 224396 |
| 176 | Ga0209050_1002168 | 3300025298 | Bacteria | 17764 |
| 177 | Ga0209051_1000045 | 3300025303 | Bacteria | 297882 |
| 178 | Ga0209051_1000260 | 3300025303 | Bacteria | 88213 |
| 179 | Ga0209051_1000283 | 3300025303 | Bacteria | 82731 |
| 180 | Ga0209051_1023520 | 3300025303 | Bacteria | 2558 |
| 181 | Ga0209257_1000185 | 3300025304 | Bacteria | 155047 |
| 182 | Ga0207656_10000010 | 3300025321 | Bacteria | 192224 |
| 183 | Ga0207696_1000047 | 3300025711 | Bacteria | 285005 |
| 184 | Ga0207696_1000118 | 3300025711 | Bacteria | 147902 |
| 185 | Ga0207696_1000168 | 3300025711 | Bacteria | 103496 |
| 186 | Ga0207696_1000339 | 3300025711 | Bacteria | 48686 |
| 187 | Ga0207696_1006336 | 3300025711 | Bacteria | 4778 |
| 188 | Ga0207696_1007078 | 3300025711 | Bacteria | 4435 |
| 189 | Ga0207696_1015131 | 3300025711 | Bacteria | 2623 |
| 190 | Ga0207655_1000104 | 3300025728 | Bacteria | 184765 |
| 191 | Ga0207655_1000120 | 3300025728 | Bacteria | 157018 |
| 192 | Ga0207655_1000415 | 3300025728 | Bacteria | 58289 |
| 193 | Ga0207655_1000606 | 3300025728 | Bacteria | 43412 |
| 194 | Ga0207655_1000921 | 3300025728 | Bacteria | 30542 |
| 195 | Ga0207655_1001228 | 3300025728 | Bacteria | 24726 |
| 196 | Ga0207655_1001571 | 3300025728 | Bacteria | 20542 |
| 197 | Ga0207655_1005549 | 3300025728 | Bacteria | 8553 |
| 198 | Ga0207655_1006374 | 3300025728 | Bacteria | 7832 |
| 199 | Ga0207655_1030279 | 3300025728 | Bacteria | 2519 |
| 200 | Ga0207655_1037818 | 3300025728 | Bacteria | 2119 |
| 201 | Ga0207655_1075129 | 3300025728 | Bacteria | 1241 |
| 202 | Ga0207655_1087892 | 3300025728 | Bacteria | 1101 |
| 203 | Ga0207713_1000049 | 3300025735 | Bacteria | 227882 |
| 204 | Ga0207713_1000073 | 3300025735 | Bacteria | 181519 |
| 205 | Ga0207713_1000261 | 3300025735 | Bacteria | 65024 |
| 206 | Ga0207713_1001031 | 3300025735 | Bacteria | 24228 |
| 207 | Ga0207713_1003024 | 3300025735 | Bacteria | 11729 |
| 208 | Ga0207713_1004132 | 3300025735 | Bacteria | 9552 |
| 209 | Ga0207713_1004152 | 3300025735 | Bacteria | 9518 |
| 210 | Ga0207713_1005408 | 3300025735 | Bacteria | 7997 |
| 211 | Ga0207713_1007215 | 3300025735 | Bacteria | 6611 |
| 212 | Ga0207713_1008483 | 3300025735 | Bacteria | 5914 |
| 213 | Ga0207713_1020756 | 3300025735 | Bacteria | 3171 |
| 214 | Ga0207713_1024817 | 3300025735 | Bacteria | 2783 |
| 215 | Ga0207713_1036082 | 3300025735 | Bacteria | 2125 |
| 216 | Ga0207713_1039597 | 3300025735 | Bacteria | 1986 |
| 217 | Ga0207713_1044187 | 3300025735 | Bacteria | 1832 |
| 218 | Ga0207713_1075843 | 3300025735 | Bacteria | 1225 |
| 219 | Ga0207705_10244038 | 3300025909 | Bacteria | 1369 |
| 220 | Ga0207671_10000380 | 3300025914 | Bacteria | 62950 |
| 221 | Ga0207649_10000041 | 3300025920 | Bacteria | 117781 |
| 222 | Ga0207649_10723761 | 3300025920 | Bacteria | 773 |
| 223 | Ga0207681_10000342 | 3300025923 | Bacteria | 33558 |
| 224 | Ga0207681_10006860 | 3300025923 | Bacteria | 6984 |
| 225 | Ga0207681_10283672 | 3300025923 | Bacteria | 1305 |
| 226 | Ga0207650_10000278 | 3300025925 | Bacteria | 53364 |
| 227 | Ga0207650_10000324 | 3300025925 | Bacteria | 46570 |
| 228 | Ga0207706_10000128 | 3300025933 | Bacteria | 81615 |
| 229 | Ga0207706_10012214 | 3300025933 | Bacteria | 7827 |
| 230 | Ga0207686_10001625 | 3300025934 | Bacteria | 12587 |
| 231 | Ga0207709_10000030 | 3300025935 | Bacteria | 331710 |
| 232 | Ga0207709_10000343 | 3300025935 | Bacteria | 48072 |
| 233 | Ga0207709_10046034 | 3300025935 | Bacteria | 2645 |
| 234 | Ga0207709_10278852 | 3300025935 | Bacteria | 1234 |
| 235 | Ga0207669_10130435 | 3300025937 | Bacteria | 1726 |
| 236 | Ga0207711_10057873 | 3300025941 | Bacteria | 3333 |
| 237 | Ga0207679_10000081 | 3300025945 | Bacteria | 84888 |
| 238 | Ga0207712_10607671 | 3300025961 | Bacteria | 946 |
| 239 | Ga0207640_10008549 | 3300025981 | Bacteria | 5686 |
| 240 | Ga0209281_1000070 | 3300027111 | Bacteria | 277098 |
| 241 | Ga0209281_1000127 | 3300027111 | Bacteria | 200036 |
| 242 | Ga0209281_1002082 | 3300027111 | Bacteria | 8960 |
| 243 | Ga0209281_1011659 | 3300027111 | Bacteria | 1959 |
| 244 | Ga0209973_1008316 | 3300027252 | Bacteria | 1181 |
| 245 | Ga0209389_1000020 | 3300027296 | Bacteria | 172003 |
| 246 | Ga0209389_1065562 | 3300027296 | Bacteria | 2125 |
| 247 | Ga0209371_1000228 | 3300027312 | Bacteria | 72315 |
| 248 | Ga0209371_1000302 | 3300027312 | Bacteria | 55126 |
| 249 | Ga0209371_1004867 | 3300027312 | Bacteria | 5619 |
| 250 | Ga0209969_1007382 | 3300027360 | Bacteria | 1553 |
| 251 | Ga0209996_1002060 | 3300027395 | Bacteria | 2480 |
| 252 | Ga0209995_1002220 | 3300027471 | Bacteria | 3057 |
| 253 | Ga0209999_1012969 | 3300027543 | Bacteria | 1511 |
| 254 | Ga0209999_1042362 | 3300027543 | Bacteria | 854 |
| 255 | Ga0207428_10014173 | 3300027907 | Bacteria | 6938 |
| 256 | Ga0207428_10050869 | 3300027907 | Bacteria | 3312 |
| 257 | Ga0207428_10101513 | 3300027907 | Bacteria | 2223 |
| 258 | Ga0207428_10109854 | 3300027907 | Bacteria | 2124 |
| 259 | Ga0207428_10146760 | 3300027907 | Bacteria | 1797 |
| 260 | Ga0207428_10160413 | 3300027907 | Bacteria | 1708 |
| 261 | Ga0268266_10007379 | 3300028379 | Bacteria | 9928 |
| 262 | Ga0268266_10447827 | 3300028379 | Bacteria | 1227 |
| 263 | Ga0268256_1000188 | 3300030500 | Bacteria | 72315 |
| 264 | Ga0268256_1000669 | 3300030500 | Bacteria | 26000 |
| 265 | Ga0268256_1006735 | 3300030500 | Bacteria | 4223 |
| 266 | Ga0316177_1078431 | 3300030731 | Bacteria | 2742 |
| 267 | Ga0314311_1094938 | 3300030733 | Bacteria | 6797 |
| 268 | Ga0316179_1075362 | 3300030734 | Bacteria | 1196 |
| 269 | Ga0316178_1011341 | 3300030735 | Bacteria | 8135 |
| 270 | Ga0316183_1006673 | 3300030742 | Bacteria | 837 |
| 271 | Ga0316183_1205059 | 3300030742 | Bacteria | 1714 |
| 272 | Ga0316181_1020879 | 3300030744 | Bacteria | 7161 |
| 273 | Ga0316181_1093595 | 3300030744 | Bacteria | 3354 |
| 274 | Ga0265331_10007682 | 3300031250 | Bacteria | 6207 |
| 275 | Ga0265327_10001699 | 3300031251 | Bacteria | 26311 |
| 276 | Ga0265327_10003331 | 3300031251 | Bacteria | 15531 |
| 277 | Ga0265327_10003570 | 3300031251 | Bacteria | 14714 |
| 278 | Ga0265316_10002392 | 3300031344 | Bacteria | 19536 |
| 279 | Ga0307408_100000013 | 3300031548 | Bacteria | 386212 |
| 280 | Ga0307408_100000192 | 3300031548 | Bacteria | 65993 |
| 281 | Ga0307408_100059501 | 3300031548 | Bacteria | 2780 |
| 282 | Ga0307408_100104143 | 3300031548 | Bacteria | 2167 |
| 283 | Ga0307408_101040811 | 3300031548 | Bacteria | 756 |
| 284 | Ga0316575_10002085 | 3300031665 | Bacteria | 6677 |
| 285 | Ga0316575_10054629 | 3300031665 | Bacteria | 1590 |
| 286 | Ga0307516_10100762 | 3300031730 | Bacteria | 2704 |
| 287 | Ga0307405_10079322 | 3300031731 | Bacteria | 2139 |
| 288 | Ga0307405_10084243 | 3300031731 | Bacteria | 2086 |
| 289 | Ga0307413_10076951 | 3300031824 | Bacteria | 2122 |
| 290 | Ga0307406_10001571 | 3300031901 | Bacteria | 12584 |
| 291 | Ga0307407_10060628 | 3300031903 | Bacteria | 2208 |
| 292 | Ga0307412_10275955 | 3300031911 | Bacteria | 1317 |
| 293 | Ga0307412_10852062 | 3300031911 | Bacteria | 795 |
| 294 | Ga0307409_100164583 | 3300031995 | Bacteria | 1944 |
| 295 | Ga0307416_100355594 | 3300032002 | Bacteria | 1484 |
| 296 | Ga0307416_100810323 | 3300032002 | Bacteria | 1032 |
| 297 | Ga0307416_101578477 | 3300032002 | Bacteria | 762 |
| 298 | Ga0307414_10014793 | 3300032004 | Bacteria | 4690 |
| 299 | Ga0307414_10079818 | 3300032004 | Bacteria | 2390 |
| 300 | Ga0307414_10095095 | 3300032004 | Bacteria | 2225 |
| 301 | Ga0307411_10032563 | 3300032005 | Bacteria | 3222 |
| 302 | Ga0307411_10080529 | 3300032005 | Bacteria | 2239 |
| 303 | Ga0316593_10122454 | 3300032168 | Bacteria | 935 |
| 304 | Ga0307510_10067813 | 3300033180 | Bacteria | 3587 |
| 305 | Ga0316574_0009395 | 3300035398 | Bacteria | 5477 |
| 306 | Ga0316582_0138732 | 3300036647 | Bacteria | 1638 |
| 307 | Ga0316582_0439337 | 3300036647 | Bacteria | 899 |
| 308 | Ga0316584_0016769 | 3300036712 | Bacteria | 5255 |
| 309 | Ga0316584_0150926 | 3300036712 | Bacteria | 1730 |
| 310 | Ga0237819_00789 | 3300038705 | Bacteria | 10134 |
| 311 | Ga0400485_00908 | 3300038735 | Bacteria | 2719 |
| 312 | Ga0400486_03367 | 3300038742 | Bacteria | 4720 |
| 313 | Ga0400483_245346 | 3300039062 | Bacteria | 1034 |
| 314 | Ga0400483_271482 | 3300039062 | Bacteria | 3860 |
| 315 | Ga0400489_54721 | 3300039093 | Bacteria | 1400 |
| 316 | Ga0439436_0056726 | 3300041404 | Bacteria | 1099 |
| 317 | Ga0439438_002874 | 3300041405 | Bacteria | 7164 |
| 318 | Ga0439438_005405 | 3300041405 | Bacteria | 4705 |
| 319 | Ga0439438_013588 | 3300041405 | Bacteria | 2450 |
| 320 | Ga0439438_019662 | 3300041405 | Bacteria | 1906 |
| 321 | Ga0439438_020305 | 3300041405 | Bacteria | 1865 |
| 322 | Ga0439438_022354 | 3300041405 | Bacteria | 1754 |
| 323 | Ga0439438_025244 | 3300041405 | Bacteria | 1621 |
| 324 | Ga0439447_005046 | 3300041407 | Bacteria | 4442 |
| 325 | Ga0439447_008010 | 3300041407 | Bacteria | 3303 |
| 326 | Ga0439447_013421 | 3300041407 | Bacteria | 2323 |
| 327 | Ga0439447_013584 | 3300041407 | Bacteria | 2305 |
| 328 | Ga0439466_0004914 | 3300041411 | Bacteria | 5136 |
| 329 | Ga0439466_0006573 | 3300041411 | Bacteria | 4416 |
| 330 | Ga0439466_0020358 | 3300041411 | Bacteria | 2364 |
| 331 | Ga0439466_0022380 | 3300041411 | Bacteria | 2231 |
| 332 | Ga0439466_0027219 | 3300041411 | Bacteria | 1981 |
| 333 | Ga0439466_0035356 | 3300041411 | Bacteria | 1690 |
| 334 | Ga0439466_0050004 | 3300041411 | Bacteria | 1371 |
| 335 | Ga0439466_0057743 | 3300041411 | Bacteria | 1256 |
| 336 | Ga0439465_0183859 | 3300041413 | Bacteria | 757 |
| 337 | Ga0451843_0221753 | 3300041509 | Bacteria | 1607 |
| 338 | Ga0451855_1859058 | 3300041511 | Bacteria | 876 |
| 339 | Ga0439437_000899 | 3300042000 | Bacteria | 3091 |
| 340 | Ga0439432_002353 | 3300042006 | Bacteria | 7134 |
| 341 | Ga0439432_006366 | 3300042006 | Bacteria | 4223 |
| 342 | Ga0439432_012974 | 3300042006 | Bacteria | 2838 |
| 343 | Ga0439432_020988 | 3300042006 | Bacteria | 2168 |
| 344 | Ga0439432_027068 | 3300042006 | Bacteria | 1874 |
| 345 | Ga0439432_126370 | 3300042006 | Bacteria | 755 |
| 346 | Ga0439449_0104606 | 3300042007 | Bacteria | 1047 |
| 347 | Ga0439451_000464 | 3300042009 | Bacteria | 7884 |
| 348 | Ga0439452_007545 | 3300042010 | Bacteria | 3329 |
| 349 | Ga0439452_013254 | 3300042010 | Bacteria | 2319 |
| 350 | Ga0439452_013601 | 3300042010 | Bacteria | 2280 |
| 351 | Ga0439452_013880 | 3300042010 | Bacteria | 2251 |
| 352 | Ga0439452_015689 | 3300042010 | Bacteria | 2071 |
| 353 | Ga0439456_000103 | 3300042013 | Bacteria | 28631 |
| 354 | Ga0439456_007236 | 3300042013 | Bacteria | 2274 |
| 355 | Ga0439463_000187 | 3300042016 | Bacteria | 16491 |
| 356 | Ga0439463_000495 | 3300042016 | Bacteria | 11003 |
| 357 | Ga0439463_008136 | 3300042016 | Bacteria | 2586 |
| 358 | Ga0450911_000022 | 3300042115 | Bacteria | 91239 |
| 359 | Ga0450911_002724 | 3300042115 | Bacteria | 3355 |
| 360 | Ga0450911_003507 | 3300042115 | Bacteria | 2750 |
| 361 | Ga0450923_053418 | 3300042125 | Bacteria | 871 |
| 362 | Ga0450890_007951 | 3300042127 | Bacteria | 1356 |
| 363 | Ga0450902_000456 | 3300042137 | Bacteria | 5068 |
| 364 | Ga0450902_001945 | 3300042137 | Bacteria | 2881 |
| 365 | Ga0450903_003615 | 3300042138 | Bacteria | 2669 |
| 366 | Ga0450904_001485 | 3300042139 | Bacteria | 3253 |
| 367 | Ga0450904_002387 | 3300042139 | Bacteria | 2254 |
| 368 | Ga0450905_000070 | 3300042142 | Bacteria | 9618 |
| 369 | Ga0450906_004475 | 3300042145 | Bacteria | 2929 |
| 370 | Ga0450907_002607 | 3300042146 | Bacteria | 3376 |
| 371 | Ga0450907_003068 | 3300042146 | Bacteria | 3036 |
| 372 | Ga0450910_004219 | 3300042147 | Bacteria | 1937 |
| 373 | Ga0439446_0000864 | 3300042156 | Bacteria | 6495 |
| 374 | Ga0439446_0002450 | 3300042156 | Bacteria | 4454 |
| 375 | Ga0439446_0012710 | 3300042156 | Bacteria | 2302 |
| 376 | Ga0439446_0013034 | 3300042156 | Bacteria | 2276 |
| 377 | Ga0439446_0017685 | 3300042156 | Bacteria | 1993 |
| 378 | Ga0450908_006061 | 3300042184 | Bacteria | 2307 |
| 379 | Ga0450909_002548 | 3300042185 | Bacteria | 2581 |
| 380 | Ga0450909_005861 | 3300042185 | Bacteria | 1772 |
| 381 | Ga0439434_0007187 | 3300042435 | Bacteria | 3262 |
| 382 | Ga0439434_0025739 | 3300042435 | Bacteria | 1776 |
| 383 | Ga0439459_0017311 | 3300042438 | Bacteria | 1341 |
| 384 | Ga0439464_0108102 | 3300042439 | Bacteria | 849 |
| 385 | Ga0439460_0001891 | 3300042461 | Bacteria | 4995 |
| 386 | Ga0439460_0008816 | 3300042461 | Bacteria | 2550 |
| 387 | Ga0439460_0023645 | 3300042461 | Bacteria | 1696 |
| 388 | Ga0450893_0008181 | 3300042532 | Bacteria | 1701 |
| 389 | Ga0451577_0077381 | 3300042876 | Bacteria | 2966 |
| 390 | Ga0451577_0719363 | 3300042876 | Bacteria | 904 |
| 391 | Ga0439440_0001951 | 3300042993 | Bacteria | 3833 |
| 392 | Ga0466961_0148238 | 3300044693 | Bacteria | 1466 |
| 393 | Ga0453684_0001596 | 3300044712 | Bacteria | 62273 |
| 394 | Ga0453684_0006330 | 3300044712 | Bacteria | 22598 |
| 395 | Ga0453684_0144478 | 3300044712 | Bacteria | 2836 |
| 396 | Ga0453684_0215480 | 3300044712 | Bacteria | 2228 |
| 397 | Ga0451576_0000174 | 3300045051 | Bacteria | 162062 |
| 398 | Ga0495617_006470 | 3300046452 | Bacteria | 4104 |
| 399 | Ga0495617_009460 | 3300046452 | Bacteria | 3347 |
| 400 | Ga0495617_023101 | 3300046452 | Bacteria | 2101 |
| 401 | Ga0495627_000037 | 3300046453 | Bacteria | 198542 |
| 402 | Ga0495627_000291 | 3300046453 | Bacteria | 49966 |
| 403 | Ga0495627_010669 | 3300046453 | Bacteria | 3330 |
| 404 | Ga0495627_011003 | 3300046453 | Bacteria | 3261 |
| 405 | Ga0495627_012131 | 3300046453 | Bacteria | 3068 |
| 406 | Ga0495627_047436 | 3300046453 | Bacteria | 1302 |
| 407 | Ga0495603_0038509 | 3300046455 | Bacteria | 2866 |
| 408 | Ga0495603_0158086 | 3300046455 | Bacteria | 1315 |
| 409 | Ga0495590_0015406 | 3300046457 | Bacteria | 2775 |
| 410 | Ga0495590_0020517 | 3300046457 | Bacteria | 2347 |
| 411 | Ga0495590_0029866 | 3300046457 | Bacteria | 1910 |
| 412 | Ga0495591_000036 | 3300046458 | Bacteria | 167479 |
| 413 | Ga0495591_000753 | 3300046458 | Bacteria | 23393 |
| 414 | Ga0495591_002445 | 3300046458 | Bacteria | 10328 |
| 415 | Ga0495591_002891 | 3300046458 | Bacteria | 9213 |
| 416 | Ga0495591_009904 | 3300046458 | Bacteria | 3743 |
| 417 | Ga0495591_010733 | 3300046458 | Bacteria | 3524 |
| 418 | Ga0495591_018415 | 3300046458 | Bacteria | 2369 |
| 419 | Ga0495591_019925 | 3300046458 | Bacteria | 2231 |
| 420 | Ga0495629_0193868 | 3300046459 | Bacteria | 1406 |
| 421 | Ga0495638_0031267 | 3300046460 | Bacteria | 3421 |
| 422 | Ga0495638_0045618 | 3300046460 | Bacteria | 2756 |
| 423 | Ga0495638_0049486 | 3300046460 | Bacteria | 2627 |
| 424 | Ga0495638_0100145 | 3300046460 | Bacteria | 1734 |
| 425 | Ga0495638_0113834 | 3300046460 | Bacteria | 1604 |
| 426 | Ga0495638_0248350 | 3300046460 | Bacteria | 982 |
| 427 | Ga0495653_0001298 | 3300046463 | Bacteria | 19360 |
| 428 | Ga0495653_0046779 | 3300046463 | Bacteria | 3349 |
| 429 | Ga0495650_0000311 | 3300046471 | Bacteria | 87755 |
| 430 | Ga0495650_0003191 | 3300046471 | Bacteria | 12212 |
| 431 | Ga0495650_0010347 | 3300046471 | Bacteria | 5212 |
| 432 | Ga0495650_0027431 | 3300046471 | Bacteria | 2631 |
| 433 | Ga0495650_0036991 | 3300046471 | Bacteria | 2129 |
| 434 | Ga0495605_0000033 | 3300046474 | Bacteria | 209203 |
| 435 | Ga0495605_0000209 | 3300046474 | Bacteria | 71906 |
| 436 | Ga0495605_0001216 | 3300046474 | Bacteria | 17156 |
| 437 | Ga0495605_0002128 | 3300046474 | Bacteria | 12385 |
| 438 | Ga0495605_0016035 | 3300046474 | Bacteria | 4064 |
| 439 | Ga0495605_0030986 | 3300046474 | Bacteria | 2735 |
| 440 | Ga0495605_0051663 | 3300046474 | Bacteria | 2000 |
| 441 | Ga0495605_0079791 | 3300046474 | Bacteria | 1532 |
| 442 | Ga0495605_0166072 | 3300046474 | Bacteria | 977 |
| 443 | Ga0495639_0000248 | 3300046475 | Bacteria | 26780 |
| 444 | Ga0495639_0109206 | 3300046475 | Bacteria | 1311 |
| 445 | Ga0495584_0038504 | 3300046491 | Bacteria | 2416 |
| 446 | Ga0495584_0039709 | 3300046491 | Bacteria | 2377 |
| 447 | Ga0495584_0041802 | 3300046491 | Bacteria | 2313 |
| 448 | Ga0495584_0042048 | 3300046491 | Bacteria | 2306 |
| 449 | Ga0495584_0044790 | 3300046491 | Bacteria | 2232 |
| 450 | Ga0495584_0051173 | 3300046491 | Bacteria | 2080 |
| 451 | Ga0495584_0066506 | 3300046491 | Bacteria | 1812 |
| 452 | Ga0495585_0002501 | 3300046492 | Bacteria | 13087 |
| 453 | Ga0495585_0022154 | 3300046492 | Bacteria | 3647 |
| 454 | Ga0495585_0089473 | 3300046492 | Bacteria | 1659 |
| 455 | Ga0495585_0106987 | 3300046492 | Bacteria | 1490 |
| 456 | Ga0495585_0153449 | 3300046492 | Bacteria | 1199 |
| 457 | Ga0495594_0016504 | 3300046499 | Bacteria | 3890 |
| 458 | Ga0495594_0181063 | 3300046499 | Bacteria | 1199 |
| 459 | Ga0495596_0000258 | 3300046500 | Bacteria | 35383 |
| 460 | Ga0495596_0063601 | 3300046500 | Bacteria | 1435 |
| 461 | Ga0495607_0000482 | 3300046501 | Bacteria | 39874 |
| 462 | Ga0495607_0000938 | 3300046501 | Bacteria | 27121 |
| 463 | Ga0495607_0001384 | 3300046501 | Bacteria | 21585 |
| 464 | Ga0495607_0002109 | 3300046501 | Bacteria | 16605 |
| 465 | Ga0495607_0002221 | 3300046501 | Bacteria | 16069 |
| 466 | Ga0495607_0003809 | 3300046501 | Bacteria | 11379 |
| 467 | Ga0495607_0025076 | 3300046501 | Bacteria | 3712 |
| 468 | Ga0495607_0053155 | 3300046501 | Bacteria | 2342 |
| 469 | Ga0495607_0060395 | 3300046501 | Bacteria | 2158 |
| 470 | Ga0495607_0064082 | 3300046501 | Bacteria | 2077 |
| 471 | Ga0495607_0159648 | 3300046501 | Bacteria | 1146 |
| 472 | Ga0495607_0174988 | 3300046501 | Bacteria | 1080 |
| 473 | Ga0495607_0180299 | 3300046501 | Bacteria | 1059 |
| 474 | Ga0495583_0000031 | 3300046506 | Bacteria | 253982 |
| 475 | Ga0495583_0000583 | 3300046506 | Bacteria | 50031 |
| 476 | Ga0495583_0000830 | 3300046506 | Bacteria | 37819 |
| 477 | Ga0495583_0006886 | 3300046506 | Bacteria | 7313 |
| 478 | Ga0495583_0007941 | 3300046506 | Bacteria | 6571 |
| 479 | Ga0495583_0008728 | 3300046506 | Bacteria | 6153 |
| 480 | Ga0495583_0014672 | 3300046506 | Bacteria | 4308 |
| 481 | Ga0495583_0045314 | 3300046506 | Bacteria | 2035 |
| 482 | Ga0495606_0000271 | 3300046507 | Bacteria | 90916 |
| 483 | Ga0495606_0001608 | 3300046507 | Bacteria | 29469 |
| 484 | Ga0495606_0021027 | 3300046507 | Bacteria | 4790 |
| 485 | Ga0495606_0030559 | 3300046507 | Bacteria | 3762 |
| 486 | Ga0495606_0047696 | 3300046507 | Bacteria | 2822 |
| 487 | Ga0495606_0186134 | 3300046507 | Bacteria | 1194 |
| 488 | Ga0495606_0220015 | 3300046507 | Bacteria | 1070 |
| 489 | Ga0495610_0007823 | 3300046512 | Bacteria | 7041 |
| 490 | Ga0495610_0012332 | 3300046512 | Bacteria | 5154 |
| 491 | Ga0495610_0015008 | 3300046512 | Bacteria | 4520 |
| 492 | Ga0495610_0043317 | 3300046512 | Bacteria | 2243 |
| 493 | Ga0495610_0044480 | 3300046512 | Bacteria | 2204 |
| 494 | Ga0495616_0020878 | 3300046513 | Bacteria | 3556 |
| 495 | Ga0495616_0030970 | 3300046513 | Bacteria | 2806 |
| 496 | Ga0495616_0042996 | 3300046513 | Bacteria | 2297 |
| 497 | Ga0495616_0043388 | 3300046513 | Bacteria | 2285 |
| 498 | Ga0495616_0095238 | 3300046513 | Bacteria | 1403 |
| 499 | Ga0495616_0155289 | 3300046513 | Bacteria | 1032 |
| 500 | Ga0495620_0000112 | 3300046515 | Bacteria | 64688 |
| 501 | Ga0495620_0000222 | 3300046515 | Bacteria | 42955 |
| 502 | Ga0495620_0005934 | 3300046515 | Bacteria | 6769 |
| 503 | Ga0495620_0020043 | 3300046515 | Bacteria | 3273 |
| 504 | Ga0495620_0031315 | 3300046515 | Bacteria | 2438 |
| 505 | Ga0495630_0108345 | 3300046517 | Bacteria | 2104 |
| 506 | Ga0495631_0006265 | 3300046518 | Bacteria | 6161 |
| 507 | Ga0495631_0027697 | 3300046518 | Bacteria | 2591 |
| 508 | Ga0495631_0057391 | 3300046518 | Bacteria | 1694 |
| 509 | Ga0495631_0066960 | 3300046518 | Bacteria | 1554 |
| 510 | Ga0495632_0001173 | 3300046519 | Bacteria | 22288 |
| 511 | Ga0495632_0001768 | 3300046519 | Bacteria | 17482 |
| 512 | Ga0495632_0004961 | 3300046519 | Bacteria | 8914 |
| 513 | Ga0495632_0028752 | 3300046519 | Bacteria | 2899 |
| 514 | Ga0495632_0039577 | 3300046519 | Bacteria | 2379 |
| 515 | Ga0495632_0042967 | 3300046519 | Bacteria | 2262 |
| 516 | Ga0495632_0043209 | 3300046519 | Bacteria | 2254 |
| 517 | Ga0495632_0050671 | 3300046519 | Bacteria | 2046 |
| 518 | Ga0495632_0053357 | 3300046519 | Bacteria | 1985 |
| 519 | Ga0495632_0124728 | 3300046519 | Bacteria | 1201 |
| 520 | Ga0495632_0172623 | 3300046519 | Bacteria | 992 |
| 521 | Ga0495637_0000064 | 3300046520 | Bacteria | 92793 |
| 522 | Ga0495637_0000110 | 3300046520 | Bacteria | 59616 |
| 523 | Ga0495637_0005109 | 3300046520 | Bacteria | 6730 |
| 524 | Ga0495637_0008823 | 3300046520 | Bacteria | 4937 |
| 525 | Ga0495637_0011594 | 3300046520 | Bacteria | 4232 |
| 526 | Ga0495637_0022282 | 3300046520 | Bacteria | 2890 |
| 527 | Ga0495637_0030035 | 3300046520 | Bacteria | 2413 |
| 528 | Ga0495637_0031705 | 3300046520 | Bacteria | 2335 |
| 529 | Ga0495637_0060345 | 3300046520 | Bacteria | 1558 |
| 530 | Ga0495637_0076926 | 3300046520 | Bacteria | 1336 |
| 531 | Ga0495643_0000175 | 3300046522 | Bacteria | 102200 |
| 532 | Ga0495643_0001951 | 3300046522 | Bacteria | 17354 |
| 533 | Ga0495643_0002575 | 3300046522 | Bacteria | 14165 |
| 534 | Ga0495643_0003738 | 3300046522 | Bacteria | 11016 |
| 535 | Ga0495643_0007213 | 3300046522 | Bacteria | 7203 |
| 536 | Ga0495643_0030249 | 3300046522 | Bacteria | 3025 |
| 537 | Ga0495643_0046696 | 3300046522 | Bacteria | 2347 |
| 538 | Ga0495643_0064532 | 3300046522 | Bacteria | 1934 |
| 539 | Ga0495643_0091610 | 3300046522 | Bacteria | 1567 |
| 540 | Ga0495643_0099515 | 3300046522 | Bacteria | 1491 |
| 541 | Ga0495644_0003744 | 3300046523 | Bacteria | 5983 |
| 542 | Ga0495644_0015990 | 3300046523 | Bacteria | 2874 |
| 543 | Ga0495644_0020181 | 3300046523 | Bacteria | 2542 |
| 544 | Ga0495644_0025150 | 3300046523 | Bacteria | 2261 |
| 545 | Ga0495648_0001400 | 3300046524 | Bacteria | 23699 |
| 546 | Ga0495648_0002582 | 3300046524 | Bacteria | 16589 |
| 547 | Ga0495648_0028056 | 3300046524 | Bacteria | 3755 |
| 548 | Ga0495648_0032418 | 3300046524 | Bacteria | 3428 |
| 549 | Ga0495648_0057222 | 3300046524 | Bacteria | 2340 |
| 550 | Ga0495648_0057481 | 3300046524 | Bacteria | 2332 |
| 551 | Ga0495648_0073023 | 3300046524 | Bacteria | 1982 |
| 552 | Ga0495648_0077708 | 3300046524 | Bacteria | 1901 |
| 553 | Ga0495648_0139014 | 3300046524 | Bacteria | 1280 |
| 554 | Ga0495666_0019569 | 3300046526 | Bacteria | 3357 |
| 555 | Ga0495642_0000266 | 3300046528 | Bacteria | 29529 |
| 556 | Ga0495642_0027458 | 3300046528 | Bacteria | 2265 |
| 557 | Ga0495654_0000773 | 3300046530 | Bacteria | 24692 |
| 558 | Ga0495654_0002519 | 3300046530 | Bacteria | 11772 |
| 559 | Ga0495654_0002645 | 3300046530 | Bacteria | 11383 |
| 560 | Ga0495654_0002943 | 3300046530 | Bacteria | 10659 |
| 561 | Ga0495654_0024207 | 3300046530 | Bacteria | 3138 |
| 562 | Ga0495654_0030911 | 3300046530 | Bacteria | 2720 |
| 563 | Ga0495654_0052489 | 3300046530 | Bacteria | 1985 |
| 564 | Ga0495654_0061597 | 3300046530 | Bacteria | 1801 |
| 565 | Ga0495654_0091541 | 3300046530 | Bacteria | 1410 |
| 566 | Ga0495654_0141112 | 3300046530 | Bacteria | 1073 |
| 567 | Ga0495587_0041989 | 3300046536 | Bacteria | 2728 |
| 568 | Ga0495587_0045522 | 3300046536 | Bacteria | 2607 |
| 569 | Ga0495609_0000018 | 3300046538 | Bacteria | 302609 |
| 570 | Ga0495609_0000089 | 3300046538 | Bacteria | 107029 |
| 571 | Ga0495609_0000161 | 3300046538 | Bacteria | 69842 |
| 572 | Ga0495609_0061372 | 3300046538 | Bacteria | 1660 |
| 573 | Ga0495597_0000026 | 3300046542 | Bacteria | 139551 |
| 574 | Ga0495597_0001094 | 3300046542 | Bacteria | 20566 |
| 575 | Ga0495597_0040454 | 3300046542 | Bacteria | 2083 |
| 576 | Ga0495597_0055525 | 3300046542 | Bacteria | 1736 |
| 577 | Ga0495622_0003910 | 3300046557 | Bacteria | 6962 |
| 578 | Ga0495622_0008666 | 3300046557 | Bacteria | 4713 |
| 579 | Ga0495622_0016546 | 3300046557 | Bacteria | 3435 |
| 580 | Ga0495633_0000062 | 3300046558 | Bacteria | 142101 |
| 581 | Ga0495633_0037387 | 3300046558 | Bacteria | 2322 |
| 582 | Ga0495656_0049529 | 3300046615 | Bacteria | 1789 |
| 583 | Ga0495668_0031470 | 3300046616 | Bacteria | 2990 |
| 584 | Ga0495668_0033489 | 3300046616 | Bacteria | 2887 |
| 585 | Ga0495668_0177243 | 3300046616 | Bacteria | 1168 |
| 586 | Ga0495634_0068312 | 3300046642 | Bacteria | 2348 |
| 587 | Ga0495611_0000395 | 3300046648 | Bacteria | 27443 |
| 588 | Ga0495611_0035575 | 3300046648 | Bacteria | 2206 |
| 589 | Ga0495625_0000194 | 3300046660 | Bacteria | 96964 |
| 590 | Ga0495625_0057392 | 3300046660 | Bacteria | 2768 |
| 591 | Ga0495625_0069189 | 3300046660 | Bacteria | 2480 |
| 592 | Ga0495635_0107839 | 3300046663 | Bacteria | 1902 |
| 593 | Ga0495659_0008033 | 3300046664 | Bacteria | 3349 |
| 594 | Ga0495659_0018348 | 3300046664 | Bacteria | 2330 |
| 595 | Ga0495661_0000016 | 3300046665 | Bacteria | 213593 |
| 596 | Ga0495661_0000093 | 3300046665 | Bacteria | 109808 |
| 597 | Ga0495661_0000115 | 3300046665 | Bacteria | 95492 |
| 598 | Ga0495661_0000233 | 3300046665 | Bacteria | 64169 |
| 599 | Ga0495661_0000541 | 3300046665 | Bacteria | 39054 |
| 600 | Ga0495661_0085050 | 3300046665 | Bacteria | 1813 |
| 601 | Ga0495661_0123173 | 3300046665 | Bacteria | 1429 |
| 602 | Ga0495623_0063662 | 3300046679 | Bacteria | 2308 |
| 603 | Ga0495646_0100477 | 3300046680 | Bacteria | 1659 |
| 604 | Ga0495669_0027980 | 3300046684 | Bacteria | 2466 |
| 605 | Ga0495669_0281982 | 3300046684 | Bacteria | 799 |
| 606 | Ga0495670_0008132 | 3300046691 | Bacteria | 5154 |
| 607 | Ga0495670_0029437 | 3300046691 | Bacteria | 2725 |
| 608 | Ga0495670_0036942 | 3300046691 | Bacteria | 2434 |
| 609 | Ga0495670_0043992 | 3300046691 | Bacteria | 2229 |
| 610 | Ga0495670_0118586 | 3300046691 | Bacteria | 1374 |
| 611 | Ga0495671_0001725 | 3300046692 | Bacteria | 14193 |
| 612 | Ga0495671_0010701 | 3300046692 | Bacteria | 5073 |
| 613 | Ga0495671_0021549 | 3300046692 | Bacteria | 3382 |
| 614 | Ga0495671_0041876 | 3300046692 | Bacteria | 2304 |
| 615 | Ga0495671_0042619 | 3300046692 | Bacteria | 2280 |
| 616 | Ga0495671_0048067 | 3300046692 | Bacteria | 2129 |
| 617 | Ga0495671_0050804 | 3300046692 | Bacteria | 2063 |
| 618 | Ga0495671_0054127 | 3300046692 | Bacteria | 1990 |
| 619 | Ga0495671_0076883 | 3300046692 | Bacteria | 1636 |
| 620 | Ga0495649_0001210 | 3300046694 | Bacteria | 19916 |
| 621 | Ga0495649_0001934 | 3300046694 | Bacteria | 15091 |
| 622 | Ga0495649_0008385 | 3300046694 | Bacteria | 6218 |
| 623 | Ga0495649_0032935 | 3300046694 | Bacteria | 2853 |
| 624 | Ga0495649_0033119 | 3300046694 | Bacteria | 2844 |
| 625 | Ga0495649_0040252 | 3300046694 | Bacteria | 2560 |
| 626 | Ga0495649_0040894 | 3300046694 | Bacteria | 2536 |
| 627 | Ga0495649_0045564 | 3300046694 | Bacteria | 2390 |
| 628 | Ga0495649_0085978 | 3300046694 | Bacteria | 1678 |
| 629 | Ga0495589_0018396 | 3300046794 | Bacteria | 3582 |
| 630 | Ga0495589_0027152 | 3300046794 | Bacteria | 2895 |
| 631 | Ga0495589_0178872 | 3300046794 | Bacteria | 1006 |
| 632 | Ga0495600_0160842 | 3300046809 | Bacteria | 1451 |
| 633 | Ga0495660_0000540 | 3300046810 | Bacteria | 30975 |
| 634 | Ga0495660_0001212 | 3300046810 | Bacteria | 18042 |
| 635 | Ga0495660_0001791 | 3300046810 | Bacteria | 14180 |
| 636 | Ga0495660_0018356 | 3300046810 | Bacteria | 4021 |
| 637 | Ga0495660_0024621 | 3300046810 | Bacteria | 3428 |
| 638 | Ga0495660_0045237 | 3300046810 | Bacteria | 2417 |
| 639 | Ga0495660_0063961 | 3300046810 | Bacteria | 1967 |
| 640 | Ga0495660_0090833 | 3300046810 | Bacteria | 1587 |
| 641 | Ga0495660_0092737 | 3300046810 | Bacteria | 1566 |
| 642 | Ga0495660_0102861 | 3300046810 | Bacteria | 1468 |
| 643 | Ga0495604_0077308 | 3300047317 | Bacteria | 2501 |
| 644 | Ga0495604_0104275 | 3300047317 | Bacteria | 2078 |
| 645 | Ga0495636_0025372 | 3300047318 | Bacteria | 2406 |
| 646 | Ga0495672_0002759 | 3300047320 | Bacteria | 15720 |
| 647 | Ga0495672_0004062 | 3300047320 | Bacteria | 12214 |
| 648 | Ga0495672_0015156 | 3300047320 | Bacteria | 5246 |
| 649 | Ga0495672_0024361 | 3300047320 | Bacteria | 3900 |
| 650 | Ga0495672_0025709 | 3300047320 | Bacteria | 3763 |
| 651 | Ga0495672_0026547 | 3300047320 | Bacteria | 3693 |
| 652 | Ga0495672_0034982 | 3300047320 | Bacteria | 3097 |
| 653 | Ga0495672_0039959 | 3300047320 | Bacteria | 2849 |
| 654 | Ga0495672_0064617 | 3300047320 | Bacteria | 2094 |
| 655 | Ga0495672_0258084 | 3300047320 | Bacteria | 842 |
| 656 | Ga0495676_0000052 | 3300047321 | Bacteria | 97049 |
| 657 | Ga0495676_0041268 | 3300047321 | Bacteria | 3799 |
| 658 | Ga0495680_0054078 | 3300047322 | Bacteria | 3120 |
| 659 | Ga0495680_0076800 | 3300047322 | Bacteria | 2531 |
| 660 | Ga0495680_0084812 | 3300047322 | Bacteria | 2386 |
| 661 | Ga0495683_0000137 | 3300047323 | Bacteria | 71500 |
| 662 | Ga0495683_0000254 | 3300047323 | Bacteria | 48222 |
| 663 | Ga0495683_0031552 | 3300047323 | Bacteria | 2700 |
| 664 | Ga0495683_0040465 | 3300047323 | Bacteria | 2354 |
| 665 | Ga0495683_0044021 | 3300047323 | Bacteria | 2245 |
| 666 | Ga0495683_0049012 | 3300047323 | Bacteria | 2117 |
| 667 | Ga0495683_0054943 | 3300047323 | Bacteria | 1983 |
| 668 | Ga0495683_0090511 | 3300047323 | Bacteria | 1483 |
| 669 | Ga0495687_019088 | 3300047443 | Bacteria | 3373 |
| 670 | Ga0495687_031228 | 3300047443 | Bacteria | 2445 |
| 671 | Ga0495675_0167747 | 3300047444 | Bacteria | 1349 |
| 672 | Ga0495675_0177245 | 3300047444 | Bacteria | 1306 |
| 673 | Ga0495677_0015191 | 3300047445 | Bacteria | 2798 |
| 674 | Ga0495679_000136 | 3300047446 | Bacteria | 65848 |
| 675 | Ga0495679_000368 | 3300047446 | Bacteria | 34941 |
| 676 | Ga0495679_019406 | 3300047446 | Bacteria | 2389 |
| 677 | Ga0495673_0000487 | 3300047469 | Bacteria | 42373 |
| 678 | Ga0495673_0000858 | 3300047469 | Bacteria | 28212 |
| 679 | Ga0495673_0004566 | 3300047469 | Bacteria | 8633 |
| 680 | Ga0495673_0012245 | 3300047469 | Bacteria | 4561 |
| 681 | Ga0495673_0024335 | 3300047469 | Bacteria | 2928 |
| 682 | Ga0495673_0027595 | 3300047469 | Bacteria | 2699 |
| 683 | Ga0495673_0037928 | 3300047469 | Bacteria | 2196 |
| 684 | Ga0495673_0194970 | 3300047469 | Bacteria | 760 |
| 685 | Ga0495673_0202809 | 3300047469 | Bacteria | 741 |
| 686 | Ga0495673_0203908 | 3300047469 | Bacteria | 738 |
| 687 | Ga0495681_0006934 | 3300047470 | Bacteria | 7344 |
| 688 | Ga0495681_0022764 | 3300047470 | Bacteria | 3344 |
| 689 | Ga0495681_0028546 | 3300047470 | Bacteria | 2868 |
| 690 | Ga0495681_0037709 | 3300047470 | Bacteria | 2377 |
| 691 | Ga0495681_0039118 | 3300047470 | Bacteria | 2318 |
| 692 | Ga0495681_0040587 | 3300047470 | Bacteria | 2265 |
| 693 | Ga0495681_0042086 | 3300047470 | Bacteria | 2213 |
| 694 | Ga0495681_0044871 | 3300047470 | Bacteria | 2120 |
| 695 | Ga0495681_0118793 | 3300047470 | Bacteria | 1136 |
| 696 | Ga0495681_0146527 | 3300047470 | Bacteria | 993 |
| 697 | Ga0495686_0041182 | 3300047472 | Bacteria | 2941 |
| 698 | Ga0495686_0074046 | 3300047472 | Bacteria | 2090 |
| 699 | Ga0495626_0000126 | 3300048091 | Bacteria | 99054 |
| 700 | Ga0495626_0016183 | 3300048091 | Bacteria | 3795 |
| 701 | Ga0495626_0019595 | 3300048091 | Bacteria | 3382 |
| 702 | Ga0495626_0026996 | 3300048091 | Bacteria | 2793 |
| 703 | Ga0495626_0035412 | 3300048091 | Bacteria | 2382 |
| 704 | Ga0495626_0035440 | 3300048091 | Bacteria | 2381 |
| 705 | Ga0495626_0038193 | 3300048091 | Bacteria | 2277 |
| 706 | Ga0496102_0134254 | 3300048905 | Bacteria | 2318 |
| 707 | Ga0496102_0559426 | 3300048905 | Bacteria | 1066 |
| 708 | Ga0496102_0733024 | 3300048905 | Bacteria | 911 |
| 709 | Ga0496103_0172472 | 3300048906 | Bacteria | 1389 |
| 710 | Ga0496106_0132833 | 3300048909 | Bacteria | 1953 |
| 711 | Ga0496110_0277946 | 3300048913 | Bacteria | 1525 |
| 712 | Ga0496110_0319094 | 3300048913 | Bacteria | 1415 |
| 713 | Ga0496110_0343334 | 3300048913 | Bacteria | 1360 |
| 714 | Ga0496110_0434333 | 3300048913 | Bacteria | 1197 |
| 715 | Ga0496112_0287635 | 3300048915 | Bacteria | 1590 |
| 716 | Ga0496113_0401979 | 3300048916 | Bacteria | 1100 |
| 717 | Ga0496114_0012182 | 3300048917 | Bacteria | 6881 |
| 718 | Ga0496116_0000488 | 3300048919 | Bacteria | 54504 |
| 719 | Ga0496116_0019231 | 3300048919 | Bacteria | 5235 |
| 720 | Ga0496116_0037567 | 3300048919 | Bacteria | 3375 |
| 721 | Ga0496116_0073735 | 3300048919 | Bacteria | 2150 |
| 722 | Ga0496116_0106046 | 3300048919 | Bacteria | 1665 |
| 723 | Ga0496117_0000666 | 3300048920 | Bacteria | 55020 |
| 724 | Ga0496117_0004216 | 3300048920 | Bacteria | 16058 |
| 725 | Ga0496117_0067351 | 3300048920 | Bacteria | 2423 |
| 726 | Ga0496117_0072615 | 3300048920 | Bacteria | 2299 |
| 727 | Ga0496118_0003760 | 3300048921 | Bacteria | 18753 |
| 728 | Ga0496118_0004272 | 3300048921 | Bacteria | 17091 |
| 729 | Ga0496118_0030186 | 3300048921 | Bacteria | 4530 |
| 730 | Ga0496118_0041647 | 3300048921 | Bacteria | 3633 |
| 731 | Ga0496119_0000220 | 3300048922 | Bacteria | 81054 |
| 732 | Ga0496120_0002773 | 3300048923 | Bacteria | 17043 |
| 733 | Ga0496121_0000867 | 3300048924 | Bacteria | 54641 |
| 734 | Ga0496121_0002170 | 3300048924 | Bacteria | 30723 |
| 735 | Ga0496121_0079897 | 3300048924 | Bacteria | 2594 |
| 736 | Ga0496121_0103065 | 3300048924 | Bacteria | 2196 |
| 737 | Ga0496122_0000434 | 3300048925 | Bacteria | 87536 |
| 738 | Ga0496122_0002929 | 3300048925 | Bacteria | 23272 |
| 739 | Ga0496122_0081632 | 3300048925 | Bacteria | 2249 |
| 740 | Ga0496122_0093236 | 3300048925 | Bacteria | 2043 |
| 741 | Ga0496122_0163129 | 3300048925 | Bacteria | 1355 |
| 742 | Ga0496123_0000318 | 3300048926 | Bacteria | 91911 |
| 743 | Ga0496123_0002268 | 3300048926 | Bacteria | 24237 |
| 744 | Ga0496123_0003514 | 3300048926 | Bacteria | 17459 |
| 745 | Ga0496123_0013642 | 3300048926 | Bacteria | 6798 |
| 746 | Ga0496123_0014247 | 3300048926 | Bacteria | 6606 |
| 747 | Ga0496124_0000471 | 3300048927 | Bacteria | 69533 |
| 748 | Ga0496124_0005898 | 3300048927 | Bacteria | 13552 |
| 749 | Ga0496124_0013915 | 3300048927 | Bacteria | 7821 |
| 750 | Ga0496124_0045602 | 3300048927 | Bacteria | 3758 |
| 751 | Ga0496124_0069900 | 3300048927 | Bacteria | 2913 |
| 752 | Ga0496125_0001551 | 3300048928 | Bacteria | 32793 |
| 753 | Ga0496125_0039422 | 3300048928 | Bacteria | 4068 |
| 754 | Ga0496125_0057784 | 3300048928 | Bacteria | 3139 |
| 755 | Ga0496125_0082115 | 3300048928 | Bacteria | 2458 |
| 756 | Ga0496126_0027779 | 3300048929 | Bacteria | 5399 |
| 757 | Ga0496126_0277065 | 3300048929 | Bacteria | 1390 |
| 758 | Ga0501306_009733 | 3300049127 | Bacteria | 1197 |
| 759 | Ga0501305_018629 | 3300049161 | Bacteria | 1006 |
| 760 | Ga0495678_000021 | 3300049459 | Bacteria | 239150 |
| 761 | Ga0495678_000169 | 3300049459 | Bacteria | 76063 |
| 762 | Ga0495678_002042 | 3300049459 | Bacteria | 14448 |
| 763 | Ga0495678_029007 | 3300049459 | Bacteria | 2328 |
| 764 | Ga0495678_029232 | 3300049459 | Bacteria | 2316 |
| 765 | Ga0495678_078603 | 3300049459 | Bacteria | 1190 |
| 766 | Ga0495678_086008 | 3300049459 | Bacteria | 1118 |
| 767 | Ga0495678_127788 | 3300049459 | Bacteria | 845 |
| 768 | Ga0495682_0000597 | 3300049460 | Bacteria | 24443 |
| 769 | Ga0495682_0001213 | 3300049460 | Bacteria | 14658 |
| 770 | Ga0495682_0028092 | 3300049460 | Bacteria | 2085 |
| 771 | Ga0495682_0111657 | 3300049460 | Bacteria | 979 |
| 772 | Ga0501312_004226 | 3300049528 | Bacteria | 1679 |
| 773 | Ga0501312_014527 | 3300049528 | Bacteria | 1107 |
| 774 | Ga0501323_020451 | 3300049539 | Bacteria | 869 |
| 775 | Ga0501335_008315 | 3300049551 | Bacteria | 974 |
| 776 | Ga0501032_0247168 | 3300049569 | Bacteria | 1158 |
| 777 | Ga0501032_0513831 | 3300049569 | Bacteria | 765 |
| 778 | Ga0501034_0000214 | 3300049571 | Bacteria | 110247 |
| 779 | Ga0501034_0148754 | 3300049571 | Bacteria | 2318 |
| 780 | Ga0501037_0040282 | 3300049573 | Bacteria | 3438 |
| 781 | Ga0501038_0363218 | 3300049574 | Bacteria | 1126 |
| 782 | Ga0501039_0006128 | 3300049575 | Bacteria | 9130 |
| 783 | Ga0501039_0367515 | 3300049575 | Bacteria | 1130 |
| 784 | Ga0501040_0249150 | 3300049576 | Bacteria | 1267 |
| 785 | Ga0501076_0229649 | 3300049592 | Bacteria | 1517 |
| 786 | Ga0501230_026813 | 3300049667 | Bacteria | 1048 |
| 787 | Ga0501226_000004 | 3300049853 | Bacteria | 284656 |
| 788 | nmdc:mga00v17_296811_c1 | 3300050491 | Bacteria | 741 |
| 789 | Ga0500573_0052401 | 3300053140 | Bacteria | 2346 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044693 | Ga0466961_0148238 | Ga0466961_0148238_49_642 | 197 |
| 2 | iso_pu_bacteria | 8054609563 | 8054613001 | 200 |
| 3 | 3300005364 | Ga0070673_100681125 | Ga0070673_1006811251 | 201 |
| 4 | 3300009098 | Ga0105245_10740487 | Ga0105245_107404872 | 201 |
| 5 | 3300041509 | Ga0451843_0221753 | Ga0451843_0221753_577_1182 | 201 |
| 6 | 3300049592 | Ga0501076_0229649 | Ga0501076_0229649_590_1201 | 202 |
| 7 | iso_pu_bacteria | 2643221641 | 2644232287 | 202 |
| 8 | 3300005617 | Ga0068859_101243290 | Ga0068859_1012432902 | 203 |
| 9 | 3300006931 | Ga0097620_101243042 | Ga0097620_1012430422 | 203 |
| 10 | 3300041413 | Ga0439465_0183859 | Ga0439465_0183859_34_663 | 203 |
| 11 | iso_pu_bacteria | 2739367898 | 2740169293 | 203 |
| 12 | 3300025225 | Ga0209566_100644 | Ga0209566_1006444 | 204 |
| 13 | 3300047446 | Ga0495679_019406 | Ga0495679_019406_1096_1713 | 205 |
| 14 | 3300049574 | Ga0501038_0363218 | Ga0501038_0363218_300_923 | 206 |
| 15 | 3300049575 | Ga0501039_0006128 | Ga0501039_0006128_5890_6513 | 206 |
| 16 | 3300047469 | Ga0495673_0194970 | Ga0495673_0194970_121_744 | 207 |
| 17 | 3300032002 | Ga0307416_101578477 | Ga0307416_1015784772 | 208 |
| 18 | 3300049576 | Ga0501040_0249150 | Ga0501040_0249150_113_778 | 209 |
| 19 | 3300049569 | Ga0501032_0513831 | Ga0501032_0513831_19_657 | 211 |
| 20 | iso_pu_bacteria | 2738543010 | 2739230446 | 211 |
| 21 | 3300017792 | Ga0163161_10742042 | Ga0163161_107420421 | 213 |
| 22 | 3300025728 | Ga0207655_1075129 | Ga0207655_10751292 | 213 |
| 23 | 3300025735 | Ga0207713_1075843 | Ga0207713_10758432 | 213 |
| 24 | 3300013307 | Ga0157372_10001840 | Ga0157372_1000184020 | 214 |
| 25 | 3300039093 | Ga0400489_54721 | Ga0400489_54721_559_1218 | 214 |
| 26 | 3300048922 | Ga0496119_0000220 | Ga0496119_0000220_35090_35755 | 214 |
| 27 | 3300048923 | Ga0496120_0002773 | Ga0496120_0002773_5201_5866 | 214 |
| 28 | iso_pu_bacteria | 2593339198 | 2595315611 | 214 |
| 29 | iso_pu_bacteria | 2738541276 | 2738716184 | 214 |
| 30 | iso_pu_bacteria | 2738543020 | 2739287047 | 214 |
| 31 | iso_pu_bacteria | 2738543021 | 2739292360 | 214 |
| 32 | iso_pu_bacteria | 2980125574 | 2980126843 | 214 |
| 33 | iso_pu_bacteria | 2989392574 | 2989395510 | 214 |
| 34 | 3300049528 | Ga0501312_014527 | Ga0501312_014527_356_1003 | 215 |
| 35 | iso_pu_bacteria | 2554235132 | 2554813224 | 215 |
| 36 | iso_pu_bacteria | 2585428059 | 2587738659 | 215 |
| 37 | iso_pu_bacteria | 2606217733 | 2608384038 | 215 |
| 38 | iso_pu_bacteria | 2643221676 | 2644426829 | 215 |
| 39 | iso_pu_bacteria | 2671180694 | 2673822198 | 215 |
| 40 | iso_pu_bacteria | 2818991459 | 2819669284 | 215 |
| 41 | iso_pu_bacteria | 2904755435 | 2904762018 | 215 |
| 42 | iso_pu_bacteria | 2919414237 | 2919418607 | 215 |
| 43 | iso_pu_bacteria | 2919425241 | 2919431498 | 215 |
| 44 | iso_pu_bacteria | 2990275345 | 2990278998 | 215 |
| 45 | iso_pu_bacteria | 2511231004 | 2511257980 | 216 |
| 46 | iso_pu_bacteria | 2511231006 | 2511264623 | 216 |
| 47 | iso_pu_bacteria | 2511231010 | 2511290487 | 216 |
| 48 | iso_pu_bacteria | 2511231012 | 2511299129 | 216 |
| 49 | iso_pu_bacteria | 2511231018 | 2511340787 | 216 |
| 50 | iso_pu_bacteria | 2511231019 | 2511346386 | 216 |
| 51 | iso_pu_bacteria | 2511231022 | 2511364650 | 216 |
| 52 | iso_pu_bacteria | 2512047018 | 2512327964 | 216 |
| 53 | iso_pu_bacteria | 2554235341 | 2555672417 | 216 |
| 54 | iso_pu_bacteria | 2582580891 | 2583794873 | 216 |
| 55 | iso_pu_bacteria | 2597489887 | 2597860483 | 216 |
| 56 | iso_pu_bacteria | 2597489888 | 2597866236 | 216 |
| 57 | iso_pu_bacteria | 2597489889 | 2597872070 | 216 |
| 58 | iso_pu_bacteria | 2599185160 | 2599358130 | 216 |
| 59 | iso_pu_bacteria | 2599185161 | 2599364493 | 216 |
| 60 | iso_pu_bacteria | 2599185162 | 2599370971 | 216 |
| 61 | iso_pu_bacteria | 2599185163 | 2599376993 | 216 |
| 62 | iso_pu_bacteria | 2599185164 | 2599383295 | 216 |
| 63 | iso_pu_bacteria | 2599185165 | 2599389742 | 216 |
| 64 | iso_pu_bacteria | 2599185166 | 2599396039 | 216 |
| 65 | iso_pu_bacteria | 2599185167 | 2599401278 | 216 |
| 66 | iso_pu_bacteria | 2599185168 | 2599407879 | 216 |
| 67 | iso_pu_bacteria | 2599185179 | 2599453007 | 216 |
| 68 | iso_pu_bacteria | 2599185181 | 2599464945 | 216 |
| 69 | iso_pu_bacteria | 2599185182 | 2599471270 | 216 |
| 70 | iso_pu_bacteria | 2599185185 | 2599486665 | 216 |
| 71 | iso_pu_bacteria | 2599185186 | 2599494140 | 216 |
| 72 | iso_pu_bacteria | 2599185188 | 2599504956 | 216 |
| 73 | iso_pu_bacteria | 2599185189 | 2599509755 | 216 |
| 74 | iso_pu_bacteria | 2599185190 | 2599516356 | 216 |
| 75 | iso_pu_bacteria | 2599185191 | 2599520169 | 216 |
| 76 | iso_pu_bacteria | 2599185212 | 2599615585 | 216 |
| 77 | iso_pu_bacteria | 2599185257 | 2599807200 | 216 |
| 78 | iso_pu_bacteria | 2599185288 | 2599881609 | 216 |
| 79 | iso_pu_bacteria | 2599185290 | 2599895672 | 216 |
| 80 | iso_pu_bacteria | 2599185300 | 2599930516 | 216 |
| 81 | iso_pu_bacteria | 2599185303 | 2599951872 | 216 |
| 82 | iso_pu_bacteria | 2599185311 | 2599996881 | 216 |
| 83 | iso_pu_bacteria | 2599185316 | 2600025748 | 216 |
| 84 | iso_pu_bacteria | 2599185317 | 2600031074 | 216 |
| 85 | iso_pu_bacteria | 2599185322 | 2600062018 | 216 |
| 86 | iso_pu_bacteria | 2599185325 | 2600079903 | 216 |
| 87 | iso_pu_bacteria | 2599185356 | 2600217677 | 216 |
| 88 | iso_pu_bacteria | 2600254930 | 2600360935 | 216 |
| 89 | iso_pu_bacteria | 2600254931 | 2600367866 | 216 |
| 90 | iso_pu_bacteria | 2600254954 | 2600445298 | 216 |
| 91 | iso_pu_bacteria | 2600255296 | 2601693827 | 216 |
| 92 | iso_pu_bacteria | 2600255313 | 2601777844 | 216 |
| 93 | iso_pu_bacteria | 2600255318 | 2601800589 | 216 |
| 94 | iso_pu_bacteria | 2600255389 | 2602007805 | 216 |
| 95 | iso_pu_bacteria | 2603880185 | 2606078603 | 216 |
| 96 | iso_pu_bacteria | 2603880199 | 2606125737 | 216 |
| 97 | iso_pu_bacteria | 2643221565 | 2643844973 | 216 |
| 98 | iso_pu_bacteria | 2643221571 | 2643870818 | 216 |
| 99 | iso_pu_bacteria | 2643221633 | 2644188372 | 216 |
| 100 | iso_pu_bacteria | 2643221713 | 2644621294 | 216 |
| 101 | iso_pu_bacteria | 2667528171 | 2671100667 | 216 |
| 102 | iso_pu_bacteria | 2667528176 | 2671129687 | 216 |
| 103 | iso_pu_bacteria | 2671180172 | 2671773240 | 216 |
| 104 | iso_pu_bacteria | 2675903420 | 2677899032 | 216 |
| 105 | iso_pu_bacteria | 2675903515 | 2678265746 | 216 |
| 106 | iso_pu_bacteria | 2713897148 | 2715752427 | 216 |
| 107 | iso_pu_bacteria | 2713897149 | 2715759178 | 216 |
| 108 | iso_pu_bacteria | 2718217725 | 2718636214 | 216 |
| 109 | iso_pu_bacteria | 2721755607 | 2723250971 | 216 |
| 110 | iso_pu_bacteria | 2728369097 | 2729145591 | 216 |
| 111 | iso_pu_bacteria | 2738541294 | 2738810161 | 216 |
| 112 | iso_pu_bacteria | 2738541309 | 2738897521 | 216 |
| 113 | iso_pu_bacteria | 2740892503 | 2743740038 | 216 |
| 114 | iso_pu_bacteria | 2744054620 | 2745006980 | 216 |
| 115 | iso_pu_bacteria | 2773857670 | 2774121908 | 216 |
| 116 | iso_pu_bacteria | 2773857673 | 2774137145 | 216 |
| 117 | iso_pu_bacteria | 2784132063 | 2784262230 | 216 |
| 118 | iso_pu_bacteria | 2784132072 | 2784314571 | 216 |
| 119 | iso_pu_bacteria | 2791355520 | 2794595178 | 216 |
| 120 | iso_pu_bacteria | 2808606373 | 2808906523 | 216 |
| 121 | iso_pu_bacteria | 2808606377 | 2808932321 | 216 |
| 122 | iso_pu_bacteria | 2808606379 | 2808941214 | 216 |
| 123 | iso_pu_bacteria | 2808606381 | 2808954442 | 216 |
| 124 | iso_pu_bacteria | 2808606382 | 2808961475 | 216 |
| 125 | iso_pu_bacteria | 2808606385 | 2808977483 | 216 |
| 126 | iso_pu_bacteria | 2808606388 | 2808992859 | 216 |
| 127 | iso_pu_bacteria | 2808606445 | 2809219185 | 216 |
| 128 | iso_pu_bacteria | 2811994881 | 2812368950 | 216 |
| 129 | iso_pu_bacteria | 2818991456 | 2819659296 | 216 |
| 130 | iso_pu_bacteria | 2818991464 | 2819706334 | 216 |
| 131 | iso_pu_bacteria | 2823421272 | 2823422020 | 216 |
| 132 | iso_pu_bacteria | 2826581358 | 2826582820 | 216 |
| 133 | iso_pu_bacteria | 2834028612 | 2834033154 | 216 |
| 134 | iso_pu_bacteria | 2842815866 | 2842819865 | 216 |
| 135 | iso_pu_bacteria | 2842826826 | 2842829038 | 216 |
| 136 | iso_pu_bacteria | 2842832357 | 2842836878 | 216 |
| 137 | iso_pu_bacteria | 2842837860 | 2842840523 | 216 |
| 138 | iso_pu_bacteria | 2842843487 | 2842847612 | 216 |
| 139 | iso_pu_bacteria | 2842849001 | 2842852884 | 216 |
| 140 | iso_pu_bacteria | 2852612431 | 2852618045 | 216 |
| 141 | iso_pu_bacteria | 2852657418 | 2852661124 | 216 |
| 142 | iso_pu_bacteria | 2852667396 | 2852673103 | 216 |
| 143 | iso_pu_bacteria | 2857453340 | 2857453747 | 216 |
| 144 | iso_pu_bacteria | 2860867994 | 2860872633 | 216 |
| 145 | iso_pu_bacteria | 2878029506 | 2878034940 | 216 |
| 146 | iso_pu_bacteria | 2904518522 | 2904522558 | 216 |
| 147 | iso_pu_bacteria | 2908446538 | 2908452173 | 216 |
| 148 | iso_pu_bacteria | 2917070673 | 2917076300 | 216 |
| 149 | iso_pu_bacteria | 2917832318 | 2917834514 | 216 |
| 150 | iso_pu_bacteria | 2919125081 | 2919127308 | 216 |
| 151 | iso_pu_bacteria | 2919385768 | 2919390549 | 216 |
| 152 | iso_pu_bacteria | 2919481497 | 2919485982 | 216 |
| 153 | iso_pu_bacteria | 2919487758 | 2919492668 | 216 |
| 154 | iso_pu_bacteria | 2919501602 | 2919506314 | 216 |
| 155 | iso_pu_bacteria | 2923153595 | 2923159129 | 216 |
| 156 | iso_pu_bacteria | 2923519811 | 2923523025 | 216 |
| 157 | iso_pu_bacteria | 2923586266 | 2923591100 | 216 |
| 158 | iso_pu_bacteria | 2926063275 | 2926067384 | 216 |
| 159 | iso_pu_bacteria | 2929144301 | 2929149541 | 216 |
| 160 | iso_pu_bacteria | 2929189879 | 2929194746 | 216 |
| 161 | iso_pu_bacteria | 2931369376 | 2931373056 | 216 |
| 162 | iso_pu_bacteria | 2931390751 | 2931396022 | 216 |
| 163 | iso_pu_bacteria | 2935353572 | 2935359724 | 216 |
| 164 | iso_pu_bacteria | 2939636861 | 2939641926 | 216 |
| 165 | iso_pu_bacteria | 2945928738 | 2945931311 | 216 |
| 166 | iso_pu_bacteria | 2946027586 | 2946033237 | 216 |
| 167 | iso_pu_bacteria | 2947233263 | 2947234025 | 216 |
| 168 | iso_pu_bacteria | 2969304461 | 2969309768 | 216 |
| 169 | iso_pu_bacteria | 2971410472 | 2971411019 | 216 |
| 170 | iso_pu_bacteria | 2974289157 | 2974294488 | 216 |
| 171 | iso_pu_bacteria | 2977254563 | 2977257974 | 216 |
| 172 | iso_pu_bacteria | 2984286254 | 2984287030 | 216 |
| 173 | iso_pu_bacteria | 2990196909 | 2990198218 | 216 |
| 174 | iso_pu_bacteria | 2998139840 | 2998144993 | 216 |
| 175 | iso_pu_bacteria | 3007252601 | 3007255653 | 216 |
| 176 | iso_pu_bacteria | 3007315729 | 3007320252 | 216 |
| 177 | iso_pu_bacteria | 3007395558 | 3007398779 | 216 |
| 178 | iso_pu_bacteria | 3007419365 | 3007425312 | 216 |
| 179 | iso_pu_bacteria | 3007619802 | 3007621208 | 216 |
| 180 | iso_pu_bacteria | 3007861166 | 3007866452 | 216 |
| 181 | iso_pu_bacteria | 637000220 | 637322856 | 216 |
| 182 | iso_pu_bacteria | 640427133 | 640486794 | 216 |
| 183 | iso_pu_bacteria | 651053060 | 651174645 | 216 |
| 184 | iso_pu_bacteria | 8015687852 | 8015693215 | 216 |
| 185 | iso_pu_bacteria | 8019769354 | 8019771222 | 216 |
| 186 | iso_pu_bacteria | 8029995093 | 8029995905 | 216 |
| 187 | iso_pu_bacteria | 8034962539 | 8034966880 | 216 |
| 188 | iso_pu_bacteria | 8054285046 | 8054289411 | 216 |
| 189 | iso_pu_bacteria | 8054347763 | 8054352914 | 216 |
| 190 | iso_pu_bacteria | 8054503363 | 8054508519 | 216 |
| 191 | iso_pu_bacteria | 8055770955 | 8055776465 | 216 |
| 192 | iso_pu_bacteria | 8055817908 | 8055823493 | 216 |
| 193 | iso_pu_bacteria | 8055878733 | 8055880492 | 216 |
| 194 | iso_pu_bacteria | 8056131705 | 8056136926 | 216 |
| 195 | iso_pu_bacteria | 8056148874 | 8056151887 | 216 |
| 196 | iso_pu_bacteria | 8056166840 | 8056171575 | 216 |
| 197 | iso_pu_bacteria | 8056177738 | 8056179283 | 216 |
| 198 | iso_pu_bacteria | 8056533031 | 8056536440 | 216 |
| 199 | iso_pu_bacteria | 8057798959 | 8057803878 | 216 |
| 200 | 3300031251 | Ga0265327_10001699 | Ga0265327_1000169924 | 217 |
| 201 | 3300031251 | Ga0265327_10003331 | Ga0265327_100033318 | 217 |
| 202 | 3300031344 | Ga0265316_10002392 | Ga0265316_1000239219 | 217 |
| 203 | 3300031665 | Ga0316575_10002085 | Ga0316575_100020855 | 217 |
| 204 | 3300044712 | Ga0453684_0144478 | Ga0453684_0144478_2016_2669 | 217 |
| 205 | iso_pu_bacteria | 2511231007 | 2511269428 | 217 |
| 206 | iso_pu_bacteria | 2511231008 | 2511276542 | 217 |
| 207 | iso_pu_bacteria | 2511231011 | 2511296677 | 217 |
| 208 | iso_pu_bacteria | 2511231014 | 2511312747 | 217 |
| 209 | iso_pu_bacteria | 2511231015 | 2511321343 | 217 |
| 210 | iso_pu_bacteria | 2511231016 | 2511325915 | 217 |
| 211 | iso_pu_bacteria | 2511231017 | 2511331957 | 217 |
| 212 | iso_pu_bacteria | 2511231020 | 2511353026 | 217 |
| 213 | iso_pu_bacteria | 2511231021 | 2511356683 | 217 |
| 214 | iso_pu_bacteria | 2511231024 | 2511374274 | 217 |
| 215 | iso_pu_bacteria | 2554235231 | 2555246605 | 217 |
| 216 | iso_pu_bacteria | 2599185248 | 2599773506 | 217 |
| 217 | iso_pu_bacteria | 2599185289 | 2599889993 | 217 |
| 218 | iso_pu_bacteria | 2599185291 | 2599901716 | 217 |
| 219 | iso_pu_bacteria | 2599185305 | 2599962857 | 217 |
| 220 | iso_pu_bacteria | 2599185306 | 2599967753 | 217 |
| 221 | iso_pu_bacteria | 2599185308 | 2599978985 | 217 |
| 222 | iso_pu_bacteria | 2599185313 | 2600008950 | 217 |
| 223 | iso_pu_bacteria | 2599185314 | 2600012945 | 217 |
| 224 | iso_pu_bacteria | 2599185315 | 2600020796 | 217 |
| 225 | iso_pu_bacteria | 2599185321 | 2600055576 | 217 |
| 226 | iso_pu_bacteria | 2599185324 | 2600073352 | 217 |
| 227 | iso_pu_bacteria | 2643221589 | 2643957681 | 217 |
| 228 | iso_pu_bacteria | 2643221602 | 2644025797 | 217 |
| 229 | iso_pu_bacteria | 2651869719 | 2652545064 | 217 |
| 230 | iso_pu_bacteria | 2667528170 | 2671094187 | 217 |
| 231 | iso_pu_bacteria | 2738543004 | 2739198068 | 217 |
| 232 | iso_pu_bacteria | 2738543015 | 2739262183 | 217 |
| 233 | iso_pu_bacteria | 2738543025 | 2739314957 | 217 |
| 234 | iso_pu_bacteria | 2765235841 | 2765586221 | 217 |
| 235 | iso_pu_bacteria | 2806310737 | 2807410456 | 217 |
| 236 | iso_pu_bacteria | 2806310745 | 2807458801 | 217 |
| 237 | iso_pu_bacteria | 2808606361 | 2808858073 | 217 |
| 238 | iso_pu_bacteria | 2808606376 | 2808926196 | 217 |
| 239 | iso_pu_bacteria | 2808606378 | 2808938244 | 217 |
| 240 | iso_pu_bacteria | 2808606380 | 2808948297 | 217 |
| 241 | iso_pu_bacteria | 2808606383 | 2808966559 | 217 |
| 242 | iso_pu_bacteria | 2808606389 | 2809001389 | 217 |
| 243 | iso_pu_bacteria | 2844665904 | 2844666591 | 217 |
| 244 | iso_pu_bacteria | 2860339153 | 2860343991 | 217 |
| 245 | iso_pu_bacteria | 2880230671 | 2880235581 | 217 |
| 246 | iso_pu_bacteria | 2904550169 | 2904554150 | 217 |
| 247 | iso_pu_bacteria | 2912963787 | 2912968489 | 217 |
| 248 | iso_pu_bacteria | 2919155634 | 2919158639 | 217 |
| 249 | iso_pu_bacteria | 2919456309 | 2919461651 | 217 |
| 250 | iso_pu_bacteria | 2931396565 | 2931397655 | 217 |
| 251 | iso_pu_bacteria | 2939651529 | 2939654591 | 217 |
| 252 | iso_pu_bacteria | 2980182181 | 2980189773 | 217 |
| 253 | iso_pu_bacteria | 2984504281 | 2984507044 | 217 |
| 254 | iso_pu_bacteria | 2988728565 | 2988731089 | 217 |
| 255 | iso_pu_bacteria | 3007511990 | 3007516780 | 217 |
| 256 | iso_pu_bacteria | 3007614139 | 3007614719 | 217 |
| 257 | iso_pu_bacteria | 3007718800 | 3007721306 | 217 |
| 258 | iso_pu_bacteria | 3007803356 | 3007809384 | 217 |
| 259 | iso_pu_bacteria | 3007855910 | 3007860198 | 217 |
| 260 | iso_pu_bacteria | 3007872151 | 3007874208 | 217 |
| 261 | iso_pu_bacteria | 8016728285 | 8016730889 | 217 |
| 262 | iso_pu_bacteria | 8052494512 | 8052499434 | 217 |
| 263 | iso_pu_bacteria | 8054929484 | 8054933562 | 217 |
| 264 | iso_pu_bacteria | 8056115690 | 8056115751 | 217 |
| 265 | iso_pu_bacteria | 8056120720 | 8056121295 | 217 |
| 266 | iso_pu_bacteria | 8056125926 | 8056131209 | 217 |
| 267 | iso_pu_bacteria | 8056137416 | 8056138008 | 217 |
| 268 | iso_pu_bacteria | 8056155041 | 8056156407 | 217 |
| 269 | iso_pu_bacteria | 8056172158 | 8056172245 | 217 |
| 270 | iso_pu_bacteria | 8056569372 | 8056572041 | 217 |
| 271 | 3300003323 | rootH1_10001451 | rootH1_1000145115 | 218 |
| 272 | 3300015261 | Ga0182006_1005570 | Ga0182006_10055708 | 218 |
| 273 | 3300031250 | Ga0265331_10007682 | Ga0265331_100076822 | 218 |
| 274 | 3300031251 | Ga0265327_10003570 | Ga0265327_100035709 | 218 |
| 275 | 3300031548 | Ga0307408_100000192 | Ga0307408_10000019213 | 218 |
| 276 | 3300031901 | Ga0307406_10001571 | Ga0307406_100015714 | 218 |
| 277 | 3300032168 | Ga0316593_10122454 | Ga0316593_101224541 | 218 |
| 278 | 3300042876 | Ga0451577_0719363 | Ga0451577_0719363_29_685 | 218 |
| 279 | 3300044712 | Ga0453684_0001596 | Ga0453684_0001596_20993_21649 | 218 |
| 280 | 3300044712 | Ga0453684_0215480 | Ga0453684_0215480_1176_1832 | 218 |
| 281 | 3300045051 | Ga0451576_0000174 | Ga0451576_0000174_4666_5322 | 218 |
| 282 | 3300046507 | Ga0495606_0000271 | Ga0495606_0000271_25321_25977 | 218 |
| 283 | 3300046522 | Ga0495643_0000175 | Ga0495643_0000175_76920_77576 | 218 |
| 284 | 3300046522 | Ga0495643_0003738 | Ga0495643_0003738_1414_2070 | 218 |
| 285 | 3300046660 | Ga0495625_0069189 | Ga0495625_0069189_1576_2232 | 218 |
| 286 | 3300046692 | Ga0495671_0001725 | Ga0495671_0001725_12805_13461 | 218 |
| 287 | 3300046694 | Ga0495649_0001210 | Ga0495649_0001210_1448_2104 | 218 |
| 288 | 3300046694 | Ga0495649_0032935 | Ga0495649_0032935_1293_1949 | 218 |
| 289 | 3300047470 | Ga0495681_0028546 | Ga0495681_0028546_291_947 | 218 |
| 290 | 3300049667 | Ga0501230_026813 | Ga0501230_026813_97_753 | 218 |
| 291 | iso_pu_bacteria | 8001522603 | 8001524969 | 218 |
| 292 | iso_pu_bacteria | 8011350971 | 8011355933 | 218 |
| 293 | 3300003323 | rootH1_10025242 | rootH1_100252428 | 219 |
| 294 | 3300025909 | Ga0207705_10244038 | Ga0207705_102440382 | 219 |
| 295 | 3300031548 | Ga0307408_101040811 | Ga0307408_1010408111 | 219 |
| 296 | 3300031665 | Ga0316575_10054629 | Ga0316575_100546293 | 219 |
| 297 | 3300031911 | Ga0307412_10852062 | Ga0307412_108520622 | 219 |
| 298 | 3300035398 | Ga0316574_0009395 | Ga0316574_0009395_1042_1704 | 219 |
| 299 | 3300036647 | Ga0316582_0439337 | Ga0316582_0439337_22_684 | 219 |
| 300 | 3300036712 | Ga0316584_0150926 | Ga0316584_0150926_282_944 | 219 |
| 301 | 3300046691 | Ga0495670_0118586 | Ga0495670_0118586_440_1099 | 219 |
| 302 | 3300046810 | Ga0495660_0102861 | Ga0495660_0102861_223_882 | 219 |
| 303 | 3300048913 | Ga0496110_0319094 | Ga0496110_0319094_30_689 | 219 |
| 304 | 3300048913 | Ga0496110_0434333 | Ga0496110_0434333_310_969 | 219 |
| 305 | 3300049127 | Ga0501306_009733 | Ga0501306_009733_508_1167 | 219 |
| 306 | 3300049161 | Ga0501305_018629 | Ga0501305_018629_35_694 | 219 |
| 307 | 3300049528 | Ga0501312_004226 | Ga0501312_004226_570_1229 | 219 |
| 308 | 3300049551 | Ga0501335_008315 | Ga0501335_008315_284_943 | 219 |
| 309 | iso_pu_bacteria | 2599185307 | 2599974044 | 219 |
| 310 | iso_pu_bacteria | 2600255283 | 2601628642 | 219 |
| 311 | iso_pu_bacteria | 2738541271 | 2738690995 | 219 |
| 312 | iso_pu_bacteria | 2738543016 | 2739266868 | 219 |
| 313 | iso_pu_bacteria | 2842805378 | 2842808385 | 219 |
| 314 | 3300002737 | JGI25162J39368_1005306 | JGI25162J39368_10053061 | 220 |
| 315 | 3300002737 | JGI25162J39368_1005513 | JGI25162J39368_10055131 | 220 |
| 316 | 3300002738 | JGI25154J39366_1004759 | JGI25154J39366_10047592 | 220 |
| 317 | 3300002771 | JGI25163J39215_1001948 | JGI25163J39215_10019481 | 220 |
| 318 | 3300002771 | JGI25163J39215_1002029 | JGI25163J39215_10020291 | 220 |
| 319 | 3300002772 | JGI25164J39214_1002669 | JGI25164J39214_10026691 | 220 |
| 320 | 3300002772 | JGI25164J39214_1002812 | JGI25164J39214_10028121 | 220 |
| 321 | 3300003214 | JGI25165J46597_1005143 | JGI25165J46597_10051431 | 220 |
| 322 | 3300003214 | JGI25165J46597_1005440 | JGI25165J46597_10054401 | 220 |
| 323 | 3300003751 | Ga0055538_1000042 | Ga0055538_1000042101 | 220 |
| 324 | 3300003752 | Ga0055539_1000055 | Ga0055539_1000055101 | 220 |
| 325 | 3300003756 | Ga0055533_1000067 | Ga0055533_1000067101 | 220 |
| 326 | 3300003758 | Ga0055532_1000053 | Ga0055532_1000053101 | 220 |
| 327 | 3300003759 | Ga0055525_1000103 | Ga0055525_100010335 | 220 |
| 328 | 3300003761 | Ga0055535_1002633 | Ga0055535_10026335 | 220 |
| 329 | 3300003781 | Ga0055536_1002107 | Ga0055536_100210714 | 220 |
| 330 | 3300003781 | Ga0055536_1013930 | Ga0055536_10139303 | 220 |
| 331 | 3300003781 | Ga0055536_1017823 | Ga0055536_10178233 | 220 |
| 332 | 3300003791 | Ga0055530_10004850 | Ga0055530_100048507 | 220 |
| 333 | 3300003791 | Ga0055530_10015387 | Ga0055530_100153873 | 220 |
| 334 | 3300003791 | Ga0055530_10015585 | Ga0055530_100155853 | 220 |
| 335 | 3300003792 | Ga0055540_1000330 | Ga0055540_10003301 | 220 |
| 336 | 3300003792 | Ga0055540_1000552 | Ga0055540_10005523 | 220 |
| 337 | 3300003792 | Ga0055540_1009024 | Ga0055540_10090242 | 220 |
| 338 | 3300003792 | Ga0055540_1021543 | Ga0055540_10215431 | 220 |
| 339 | 3300003794 | Ga0055531_10000125 | Ga0055531_1000012538 | 220 |
| 340 | 3300003841 | Ga0055541_1000042 | Ga0055541_100004276 | 220 |
| 341 | 3300005288 | Ga0065714_10086001 | Ga0065714_100860011 | 220 |
| 342 | 3300005289 | Ga0065704_10009187 | Ga0065704_100091872 | 220 |
| 343 | 3300005289 | Ga0065704_10161370 | Ga0065704_101613702 | 220 |
| 344 | 3300005290 | Ga0065712_10011834 | Ga0065712_100118342 | 220 |
| 345 | 3300005290 | Ga0065712_10068081 | Ga0065712_100680812 | 220 |
| 346 | 3300005331 | Ga0070670_100000686 | Ga0070670_10000068626 | 220 |
| 347 | 3300005344 | Ga0070661_100000664 | Ga0070661_10000066417 | 220 |
| 348 | 3300005353 | Ga0070669_100000417 | Ga0070669_10000041730 | 220 |
| 349 | 3300005455 | Ga0070663_100337175 | Ga0070663_1003371752 | 220 |
| 350 | 3300005457 | Ga0070662_100000042 | Ga0070662_1000000427 | 220 |
| 351 | 3300005457 | Ga0070662_100045050 | Ga0070662_1000450501 | 220 |
| 352 | 3300005548 | Ga0070665_100031276 | Ga0070665_1000312766 | 220 |
| 353 | 3300005564 | Ga0070664_100000733 | Ga0070664_10000073314 | 220 |
| 354 | 3300005578 | Ga0068854_100007019 | Ga0068854_1000070199 | 220 |
| 355 | 3300005834 | Ga0068851_10000002 | Ga0068851_1000000265 | 220 |
| 356 | 3300006177 | Ga0075362_10070790 | Ga0075362_100707902 | 220 |
| 357 | 3300006177 | Ga0075362_10132324 | Ga0075362_101323242 | 220 |
| 358 | 3300006186 | Ga0075369_10089781 | Ga0075369_100897812 | 220 |
| 359 | 3300006946 | Ga0079104_1018176 | Ga0079104_10181761 | 220 |
| 360 | 3300009011 | Ga0105251_10000163 | Ga0105251_1000016328 | 220 |
| 361 | 3300009011 | Ga0105251_10003296 | Ga0105251_100032969 | 220 |
| 362 | 3300009011 | Ga0105251_10022564 | Ga0105251_100225643 | 220 |
| 363 | 3300009011 | Ga0105251_10047747 | Ga0105251_100477473 | 220 |
| 364 | 3300009036 | Ga0105244_10003742 | Ga0105244_1000374211 | 220 |
| 365 | 3300009036 | Ga0105244_10010383 | Ga0105244_100103835 | 220 |
| 366 | 3300009036 | Ga0105244_10078772 | Ga0105244_100787722 | 220 |
| 367 | 3300009036 | Ga0105244_10099077 | Ga0105244_100990772 | 220 |
| 368 | 3300009092 | Ga0105250_10001071 | Ga0105250_1000107118 | 220 |
| 369 | 3300009092 | Ga0105250_10013916 | Ga0105250_100139163 | 220 |
| 370 | 3300009092 | Ga0105250_10024365 | Ga0105250_100243652 | 220 |
| 371 | 3300009092 | Ga0105250_10027894 | Ga0105250_100278941 | 220 |
| 372 | 3300009148 | Ga0105243_10000188 | Ga0105243_1000018867 | 220 |
| 373 | 3300009148 | Ga0105243_10001384 | Ga0105243_1000138412 | 220 |
| 374 | 3300009148 | Ga0105243_10048181 | Ga0105243_100481812 | 220 |
| 375 | 3300009148 | Ga0105243_10070431 | Ga0105243_100704313 | 220 |
| 376 | 3300009148 | Ga0105243_10102040 | Ga0105243_101020402 | 220 |
| 377 | 3300009176 | Ga0105242_10000489 | Ga0105242_1000048917 | 220 |
| 378 | 3300009177 | Ga0105248_10021285 | Ga0105248_1002128510 | 220 |
| 379 | 3300009545 | Ga0105237_10002187 | Ga0105237_1000218713 | 220 |
| 380 | 3300009545 | Ga0105237_10201739 | Ga0105237_102017392 | 220 |
| 381 | 3300009553 | Ga0105249_10821813 | Ga0105249_108218132 | 220 |
| 382 | 3300011119 | Ga0105246_10032547 | Ga0105246_100325472 | 220 |
| 383 | 3300011119 | Ga0105246_10038380 | Ga0105246_100383803 | 220 |
| 384 | 3300011119 | Ga0105246_10052541 | Ga0105246_100525414 | 220 |
| 385 | 3300011119 | Ga0105246_10054731 | Ga0105246_100547312 | 220 |
| 386 | 3300013100 | Ga0157373_10082456 | Ga0157373_100824563 | 220 |
| 387 | 3300013100 | Ga0157373_10085261 | Ga0157373_100852612 | 220 |
| 388 | 3300013102 | Ga0157371_10000243 | Ga0157371_1000024326 | 220 |
| 389 | 3300013102 | Ga0157371_10035661 | Ga0157371_100356612 | 220 |
| 390 | 3300013102 | Ga0157371_10124307 | Ga0157371_101243072 | 220 |
| 391 | 3300013102 | Ga0157371_10396060 | Ga0157371_103960602 | 220 |
| 392 | 3300013102 | Ga0157371_10573519 | Ga0157371_105735191 | 220 |
| 393 | 3300013102 | Ga0157371_10573520 | Ga0157371_105735201 | 220 |
| 394 | 3300013104 | Ga0157370_10140916 | Ga0157370_101409162 | 220 |
| 395 | 3300013105 | Ga0157369_10109808 | Ga0157369_101098082 | 220 |
| 396 | 3300013105 | Ga0157369_10178907 | Ga0157369_101789074 | 220 |
| 397 | 3300013105 | Ga0157369_10668585 | Ga0157369_106685851 | 220 |
| 398 | 3300014497 | Ga0182008_10002892 | Ga0182008_1000289211 | 220 |
| 399 | 3300014497 | Ga0182008_10043820 | Ga0182008_100438202 | 220 |
| 400 | 3300014497 | Ga0182008_10051354 | Ga0182008_100513541 | 220 |
| 401 | 3300015261 | Ga0182006_1031761 | Ga0182006_10317612 | 220 |
| 402 | 3300015262 | Ga0182007_10026349 | Ga0182007_100263493 | 220 |
| 403 | 3300015265 | Ga0182005_1008848 | Ga0182005_10088483 | 220 |
| 404 | 3300015265 | Ga0182005_1038979 | Ga0182005_10389792 | 220 |
| 405 | 3300017792 | Ga0163161_10873663 | Ga0163161_108736632 | 220 |
| 406 | 3300025206 | Ga0209435_103159 | Ga0209435_1031592 | 220 |
| 407 | 3300025207 | Ga0209760_100058 | Ga0209760_10005812 | 220 |
| 408 | 3300025207 | Ga0209760_100060 | Ga0209760_1000603 | 220 |
| 409 | 3300025224 | Ga0209784_100060 | Ga0209784_10006077 | 220 |
| 410 | 3300025225 | Ga0209566_100075 | Ga0209566_10007577 | 220 |
| 411 | 3300025226 | Ga0209674_100100 | Ga0209674_10010077 | 220 |
| 412 | 3300025229 | Ga0209147_100096 | Ga0209147_10009677 | 220 |
| 413 | 3300025230 | Ga0209563_100118 | Ga0209563_10011898 | 220 |
| 414 | 3300025230 | Ga0209563_100242 | Ga0209563_1002429 | 220 |
| 415 | 3300025231 | Ga0207427_100056 | Ga0207427_10005636 | 220 |
| 416 | 3300025231 | Ga0207427_100063 | Ga0207427_100063132 | 220 |
| 417 | 3300025233 | Ga0209437_100065 | Ga0209437_10006536 | 220 |
| 418 | 3300025233 | Ga0209437_100133 | Ga0209437_10013351 | 220 |
| 419 | 3300025242 | Ga0209258_100221 | Ga0209258_10022198 | 220 |
| 420 | 3300025246 | Ga0209646_1000230 | Ga0209646_100023012 | 220 |
| 421 | 3300025253 | Ga0209677_100057 | Ga0209677_10005777 | 220 |
| 422 | 3300025256 | Ga0209759_1001811 | Ga0209759_10018119 | 220 |
| 423 | 3300025261 | Ga0209233_1000085 | Ga0209233_100008536 | 220 |
| 424 | 3300025261 | Ga0209233_1000133 | Ga0209233_100013379 | 220 |
| 425 | 3300025292 | Ga0209676_1000076 | Ga0209676_1000076253 | 220 |
| 426 | 3300025292 | Ga0209676_1000314 | Ga0209676_100031439 | 220 |
| 427 | 3300025292 | Ga0209676_1000337 | Ga0209676_100033747 | 220 |
| 428 | 3300025292 | Ga0209676_1018983 | Ga0209676_10189833 | 220 |
| 429 | 3300025298 | Ga0209050_1000063 | Ga0209050_100006365 | 220 |
| 430 | 3300025298 | Ga0209050_1000080 | Ga0209050_100008034 | 220 |
| 431 | 3300025298 | Ga0209050_1000106 | Ga0209050_100010639 | 220 |
| 432 | 3300025303 | Ga0209051_1000045 | Ga0209051_100004539 | 220 |
| 433 | 3300025303 | Ga0209051_1000260 | Ga0209051_100026046 | 220 |
| 434 | 3300025303 | Ga0209051_1000283 | Ga0209051_100028335 | 220 |
| 435 | 3300025304 | Ga0209257_1000185 | Ga0209257_100018539 | 220 |
| 436 | 3300025321 | Ga0207656_10000010 | Ga0207656_1000001076 | 220 |
| 437 | 3300025711 | Ga0207696_1000047 | Ga0207696_1000047231 | 220 |
| 438 | 3300025711 | Ga0207696_1000168 | Ga0207696_100016880 | 220 |
| 439 | 3300025711 | Ga0207696_1000339 | Ga0207696_100033932 | 220 |
| 440 | 3300025728 | Ga0207655_1000104 | Ga0207655_100010441 | 220 |
| 441 | 3300025728 | Ga0207655_1000120 | Ga0207655_1000120142 | 220 |
| 442 | 3300025728 | Ga0207655_1000606 | Ga0207655_100060641 | 220 |
| 443 | 3300025728 | Ga0207655_1005549 | Ga0207655_100554910 | 220 |
| 444 | 3300025728 | Ga0207655_1037818 | Ga0207655_10378182 | 220 |
| 445 | 3300025735 | Ga0207713_1000049 | Ga0207713_1000049171 | 220 |
| 446 | 3300025735 | Ga0207713_1000261 | Ga0207713_100026144 | 220 |
| 447 | 3300025735 | Ga0207713_1001031 | Ga0207713_100103110 | 220 |
| 448 | 3300025735 | Ga0207713_1004152 | Ga0207713_100415211 | 220 |
| 449 | 3300025735 | Ga0207713_1005408 | Ga0207713_10054089 | 220 |
| 450 | 3300025735 | Ga0207713_1020756 | Ga0207713_10207564 | 220 |
| 451 | 3300025735 | Ga0207713_1036082 | Ga0207713_10360822 | 220 |
| 452 | 3300025914 | Ga0207671_10000380 | Ga0207671_1000038018 | 220 |
| 453 | 3300025920 | Ga0207649_10000041 | Ga0207649_1000004154 | 220 |
| 454 | 3300025920 | Ga0207649_10723761 | Ga0207649_107237611 | 220 |
| 455 | 3300025923 | Ga0207681_10000342 | Ga0207681_1000034221 | 220 |
| 456 | 3300025925 | Ga0207650_10000278 | Ga0207650_1000027831 | 220 |
| 457 | 3300025925 | Ga0207650_10000324 | Ga0207650_1000032415 | 220 |
| 458 | 3300025933 | Ga0207706_10000128 | Ga0207706_1000012819 | 220 |
| 459 | 3300025933 | Ga0207706_10012214 | Ga0207706_100122147 | 220 |
| 460 | 3300025934 | Ga0207686_10001625 | Ga0207686_100016255 | 220 |
| 461 | 3300025935 | Ga0207709_10000030 | Ga0207709_1000003059 | 220 |
| 462 | 3300025935 | Ga0207709_10000343 | Ga0207709_1000034337 | 220 |
| 463 | 3300025935 | Ga0207709_10046034 | Ga0207709_100460342 | 220 |
| 464 | 3300025937 | Ga0207669_10130435 | Ga0207669_101304352 | 220 |
| 465 | 3300025941 | Ga0207711_10057873 | Ga0207711_100578733 | 220 |
| 466 | 3300025945 | Ga0207679_10000081 | Ga0207679_1000008117 | 220 |
| 467 | 3300025961 | Ga0207712_10607671 | Ga0207712_106076712 | 220 |
| 468 | 3300025981 | Ga0207640_10008549 | Ga0207640_100085495 | 220 |
| 469 | 3300027111 | Ga0209281_1002082 | Ga0209281_10020827 | 220 |
| 470 | 3300027111 | Ga0209281_1011659 | Ga0209281_10116592 | 220 |
| 471 | 3300027252 | Ga0209973_1008316 | Ga0209973_10083162 | 220 |
| 472 | 3300027312 | Ga0209371_1000228 | Ga0209371_100022841 | 220 |
| 473 | 3300027312 | Ga0209371_1004867 | Ga0209371_10048678 | 220 |
| 474 | 3300027360 | Ga0209969_1007382 | Ga0209969_10073822 | 220 |
| 475 | 3300027395 | Ga0209996_1002060 | Ga0209996_10020601 | 220 |
| 476 | 3300027471 | Ga0209995_1002220 | Ga0209995_10022203 | 220 |
| 477 | 3300027543 | Ga0209999_1012969 | Ga0209999_10129692 | 220 |
| 478 | 3300027543 | Ga0209999_1042362 | Ga0209999_10423621 | 220 |
| 479 | 3300030500 | Ga0268256_1000188 | Ga0268256_100018838 | 220 |
| 480 | 3300030500 | Ga0268256_1006735 | Ga0268256_10067352 | 220 |
| 481 | 3300030731 | Ga0316177_1078431 | Ga0316177_10784312 | 220 |
| 482 | 3300030734 | Ga0316179_1075362 | Ga0316179_10753621 | 220 |
| 483 | 3300030735 | Ga0316178_1011341 | Ga0316178_101134112 | 220 |
| 484 | 3300030742 | Ga0316183_1006673 | Ga0316183_10066731 | 220 |
| 485 | 3300030744 | Ga0316181_1093595 | Ga0316181_10935952 | 220 |
| 486 | 3300031548 | Ga0307408_100000013 | Ga0307408_100000013368 | 220 |
| 487 | 3300031730 | Ga0307516_10100762 | Ga0307516_101007623 | 220 |
| 488 | 3300031731 | Ga0307405_10084243 | Ga0307405_100842431 | 220 |
| 489 | 3300032002 | Ga0307416_100810323 | Ga0307416_1008103232 | 220 |
| 490 | 3300032004 | Ga0307414_10014793 | Ga0307414_100147931 | 220 |
| 491 | 3300032005 | Ga0307411_10032563 | Ga0307411_100325633 | 220 |
| 492 | 3300036647 | Ga0316582_0138732 | Ga0316582_0138732_695_1363 | 220 |
| 493 | 3300036712 | Ga0316584_0016769 | Ga0316584_0016769_2199_2867 | 220 |
| 494 | 3300038735 | Ga0400485_00908 | Ga0400485_00908_492_1154 | 220 |
| 495 | 3300038742 | Ga0400486_03367 | Ga0400486_03367_1460_2122 | 220 |
| 496 | 3300039062 | Ga0400483_271482 | Ga0400483_271482_3003_3665 | 220 |
| 497 | 3300041404 | Ga0439436_0056726 | Ga0439436_0056726_365_1027 | 220 |
| 498 | 3300041405 | Ga0439438_020305 | Ga0439438_020305_1130_1792 | 220 |
| 499 | 3300041405 | Ga0439438_022354 | Ga0439438_022354_863_1525 | 220 |
| 500 | 3300041407 | Ga0439447_005046 | Ga0439447_005046_440_1102 | 220 |
| 501 | 3300041411 | Ga0439466_0004914 | Ga0439466_0004914_211_873 | 220 |
| 502 | 3300041411 | Ga0439466_0006573 | Ga0439466_0006573_832_1494 | 220 |
| 503 | 3300041411 | Ga0439466_0020358 | Ga0439466_0020358_92_754 | 220 |
| 504 | 3300041411 | Ga0439466_0057743 | Ga0439466_0057743_341_1003 | 220 |
| 505 | 3300042000 | Ga0439437_000899 | Ga0439437_000899_513_1175 | 220 |
| 506 | 3300042006 | Ga0439432_006366 | Ga0439432_006366_203_865 | 220 |
| 507 | 3300042006 | Ga0439432_020988 | Ga0439432_020988_1483_2145 | 220 |
| 508 | 3300042006 | Ga0439432_126370 | Ga0439432_126370_75_737 | 220 |
| 509 | 3300042007 | Ga0439449_0104606 | Ga0439449_0104606_25_690 | 220 |
| 510 | 3300042009 | Ga0439451_000464 | Ga0439451_000464_1730_2392 | 220 |
| 511 | 3300042010 | Ga0439452_015689 | Ga0439452_015689_1158_1820 | 220 |
| 512 | 3300042013 | Ga0439456_007236 | Ga0439456_007236_57_719 | 220 |
| 513 | 3300042016 | Ga0439463_000495 | Ga0439463_000495_9906_10568 | 220 |
| 514 | 3300042115 | Ga0450911_000022 | Ga0450911_000022_49039_49701 | 220 |
| 515 | 3300042115 | Ga0450911_002724 | Ga0450911_002724_1407_2069 | 220 |
| 516 | 3300042125 | Ga0450923_053418 | Ga0450923_053418_176_838 | 220 |
| 517 | 3300042139 | Ga0450904_001485 | Ga0450904_001485_384_1046 | 220 |
| 518 | 3300042146 | Ga0450907_003068 | Ga0450907_003068_1131_1793 | 220 |
| 519 | 3300042147 | Ga0450910_004219 | Ga0450910_004219_591_1253 | 220 |
| 520 | 3300042156 | Ga0439446_0000864 | Ga0439446_0000864_302_964 | 220 |
| 521 | 3300042156 | Ga0439446_0002450 | Ga0439446_0002450_3444_4106 | 220 |
| 522 | 3300042156 | Ga0439446_0012710 | Ga0439446_0012710_744_1406 | 220 |
| 523 | 3300042184 | Ga0450908_006061 | Ga0450908_006061_87_749 | 220 |
| 524 | 3300042185 | Ga0450909_005861 | Ga0450909_005861_798_1460 | 220 |
| 525 | 3300042435 | Ga0439434_0025739 | Ga0439434_0025739_834_1496 | 220 |
| 526 | 3300042438 | Ga0439459_0017311 | Ga0439459_0017311_275_937 | 220 |
| 527 | 3300042439 | Ga0439464_0108102 | Ga0439464_0108102_77_739 | 220 |
| 528 | 3300042532 | Ga0450893_0008181 | Ga0450893_0008181_241_903 | 220 |
| 529 | 3300042876 | Ga0451577_0077381 | Ga0451577_0077381_1905_2567 | 220 |
| 530 | 3300044712 | Ga0453684_0006330 | Ga0453684_0006330_1683_2345 | 220 |
| 531 | 3300046453 | Ga0495627_000291 | Ga0495627_000291_8894_9556 | 220 |
| 532 | 3300046453 | Ga0495627_012131 | Ga0495627_012131_1378_2040 | 220 |
| 533 | 3300046453 | Ga0495627_047436 | Ga0495627_047436_32_694 | 220 |
| 534 | 3300046458 | Ga0495591_018415 | Ga0495591_018415_1459_2121 | 220 |
| 535 | 3300046460 | Ga0495638_0031267 | Ga0495638_0031267_1182_1844 | 220 |
| 536 | 3300046460 | Ga0495638_0100145 | Ga0495638_0100145_115_777 | 220 |
| 537 | 3300046471 | Ga0495650_0027431 | Ga0495650_0027431_1442_2104 | 220 |
| 538 | 3300046471 | Ga0495650_0036991 | Ga0495650_0036991_1085_1747 | 220 |
| 539 | 3300046474 | Ga0495605_0000033 | Ga0495605_0000033_175957_176619 | 220 |
| 540 | 3300046474 | Ga0495605_0030986 | Ga0495605_0030986_1511_2173 | 220 |
| 541 | 3300046491 | Ga0495584_0041802 | Ga0495584_0041802_437_1099 | 220 |
| 542 | 3300046491 | Ga0495584_0051173 | Ga0495584_0051173_13_675 | 220 |
| 543 | 3300046492 | Ga0495585_0089473 | Ga0495585_0089473_147_809 | 220 |
| 544 | 3300046499 | Ga0495594_0016504 | Ga0495594_0016504_2723_3385 | 220 |
| 545 | 3300046501 | Ga0495607_0002109 | Ga0495607_0002109_15514_16176 | 220 |
| 546 | 3300046501 | Ga0495607_0064082 | Ga0495607_0064082_1293_1955 | 220 |
| 547 | 3300046506 | Ga0495583_0000031 | Ga0495583_0000031_64874_65536 | 220 |
| 548 | 3300046506 | Ga0495583_0045314 | Ga0495583_0045314_71_733 | 220 |
| 549 | 3300046512 | Ga0495610_0015008 | Ga0495610_0015008_65_727 | 220 |
| 550 | 3300046513 | Ga0495616_0043388 | Ga0495616_0043388_147_809 | 220 |
| 551 | 3300046515 | Ga0495620_0000112 | Ga0495620_0000112_63522_64184 | 220 |
| 552 | 3300046515 | Ga0495620_0031315 | Ga0495620_0031315_1503_2165 | 220 |
| 553 | 3300046518 | Ga0495631_0006265 | Ga0495631_0006265_172_834 | 220 |
| 554 | 3300046518 | Ga0495631_0027697 | Ga0495631_0027697_362_1024 | 220 |
| 555 | 3300046519 | Ga0495632_0053357 | Ga0495632_0053357_913_1575 | 220 |
| 556 | 3300046522 | Ga0495643_0046696 | Ga0495643_0046696_120_782 | 220 |
| 557 | 3300046522 | Ga0495643_0099515 | Ga0495643_0099515_45_707 | 220 |
| 558 | 3300046524 | Ga0495648_0028056 | Ga0495648_0028056_96_758 | 220 |
| 559 | 3300046524 | Ga0495648_0032418 | Ga0495648_0032418_1250_1912 | 220 |
| 560 | 3300046528 | Ga0495642_0000266 | Ga0495642_0000266_28785_29447 | 220 |
| 561 | 3300046530 | Ga0495654_0000773 | Ga0495654_0000773_12488_13150 | 220 |
| 562 | 3300046530 | Ga0495654_0002645 | Ga0495654_0002645_627_1289 | 220 |
| 563 | 3300046530 | Ga0495654_0024207 | Ga0495654_0024207_1150_1812 | 220 |
| 564 | 3300046530 | Ga0495654_0052489 | Ga0495654_0052489_648_1310 | 220 |
| 565 | 3300046536 | Ga0495587_0045522 | Ga0495587_0045522_380_1042 | 220 |
| 566 | 3300046538 | Ga0495609_0000018 | Ga0495609_0000018_275689_276351 | 220 |
| 567 | 3300046542 | Ga0495597_0001094 | Ga0495597_0001094_6492_7154 | 220 |
| 568 | 3300046558 | Ga0495633_0000062 | Ga0495633_0000062_59806_60468 | 220 |
| 569 | 3300046642 | Ga0495634_0068312 | Ga0495634_0068312_140_802 | 220 |
| 570 | 3300046663 | Ga0495635_0107839 | Ga0495635_0107839_1173_1835 | 220 |
| 571 | 3300046665 | Ga0495661_0000016 | Ga0495661_0000016_160629_161291 | 220 |
| 572 | 3300046665 | Ga0495661_0000541 | Ga0495661_0000541_1073_1735 | 220 |
| 573 | 3300046665 | Ga0495661_0123173 | Ga0495661_0123173_661_1323 | 220 |
| 574 | 3300046691 | Ga0495670_0008132 | Ga0495670_0008132_667_1329 | 220 |
| 575 | 3300046692 | Ga0495671_0050804 | Ga0495671_0050804_505_1167 | 220 |
| 576 | 3300046692 | Ga0495671_0054127 | Ga0495671_0054127_145_807 | 220 |
| 577 | 3300046794 | Ga0495589_0027152 | Ga0495589_0027152_331_993 | 220 |
| 578 | 3300046810 | Ga0495660_0024621 | Ga0495660_0024621_171_833 | 220 |
| 579 | 3300046810 | Ga0495660_0045237 | Ga0495660_0045237_663_1325 | 220 |
| 580 | 3300047320 | Ga0495672_0015156 | Ga0495672_0015156_167_829 | 220 |
| 581 | 3300047323 | Ga0495683_0000137 | Ga0495683_0000137_7171_7833 | 220 |
| 582 | 3300047323 | Ga0495683_0031552 | Ga0495683_0031552_1575_2237 | 220 |
| 583 | 3300047443 | Ga0495687_031228 | Ga0495687_031228_97_759 | 220 |
| 584 | 3300047446 | Ga0495679_000368 | Ga0495679_000368_7210_7872 | 220 |
| 585 | 3300047469 | Ga0495673_0012245 | Ga0495673_0012245_805_1467 | 220 |
| 586 | 3300047469 | Ga0495673_0024335 | Ga0495673_0024335_1574_2236 | 220 |
| 587 | 3300047470 | Ga0495681_0039118 | Ga0495681_0039118_220_882 | 220 |
| 588 | 3300047470 | Ga0495681_0040587 | Ga0495681_0040587_1575_2237 | 220 |
| 589 | 3300047470 | Ga0495681_0146527 | Ga0495681_0146527_225_887 | 220 |
| 590 | 3300048905 | Ga0496102_0134254 | Ga0496102_0134254_85_747 | 220 |
| 591 | 3300048919 | Ga0496116_0000488 | Ga0496116_0000488_44340_45002 | 220 |
| 592 | 3300048919 | Ga0496116_0073735 | Ga0496116_0073735_94_756 | 220 |
| 593 | 3300048920 | Ga0496117_0000666 | Ga0496117_0000666_22171_22833 | 220 |
| 594 | 3300048920 | Ga0496117_0004216 | Ga0496117_0004216_6011_6673 | 220 |
| 595 | 3300048921 | Ga0496118_0041647 | Ga0496118_0041647_1408_2070 | 220 |
| 596 | 3300048924 | Ga0496121_0000867 | Ga0496121_0000867_44498_45160 | 220 |
| 597 | 3300048925 | Ga0496122_0081632 | Ga0496122_0081632_92_754 | 220 |
| 598 | 3300048926 | Ga0496123_0002268 | Ga0496123_0002268_1944_2606 | 220 |
| 599 | 3300048926 | Ga0496123_0014247 | Ga0496123_0014247_92_754 | 220 |
| 600 | 3300048928 | Ga0496125_0001551 | Ga0496125_0001551_1169_1831 | 220 |
| 601 | 3300048928 | Ga0496125_0057784 | Ga0496125_0057784_1152_1814 | 220 |
| 602 | 3300049459 | Ga0495678_000021 | Ga0495678_000021_178322_178984 | 220 |
| 603 | 3300049459 | Ga0495678_029007 | Ga0495678_029007_1551_2213 | 220 |
| 604 | 3300049460 | Ga0495682_0000597 | Ga0495682_0000597_23603_24265 | 220 |
| 605 | 3300049569 | Ga0501032_0247168 | Ga0501032_0247168_404_1066 | 220 |
| 606 | 3300049571 | Ga0501034_0148754 | Ga0501034_0148754_21_683 | 220 |
| 607 | 3300049573 | Ga0501037_0040282 | Ga0501037_0040282_548_1210 | 220 |
| 608 | 3300049575 | Ga0501039_0367515 | Ga0501039_0367515_250_912 | 220 |
| 609 | 3300049853 | Ga0501226_000004 | Ga0501226_000004_220082_220744 | 220 |
| 610 | iso_pu_bacteria | 2599185302 | 2599944950 | 220 |
| 611 | iso_pu_bacteria | 2599185304 | 2599955321 | 220 |
| 612 | iso_pu_bacteria | 2599185309 | 2599984053 | 220 |
| 613 | iso_pu_bacteria | 2599185310 | 2599990226 | 220 |
| 614 | iso_pu_bacteria | 2599185312 | 2600001835 | 220 |
| 615 | iso_pu_bacteria | 2599185320 | 2600048760 | 220 |
| 616 | iso_pu_bacteria | 2913036834 | 2913042153 | 220 |
| 617 | iso_pu_bacteria | 2946006987 | 2946007348 | 220 |
| 618 | iso_pu_bacteria | 3007866637 | 3007867149 | 220 |
| 619 | iso_pu_bacteria | 8056161164 | 8056163196 | 220 |
| 620 | 3300003856 | Ga0058692_1017633 | Ga0058692_10176332 | 221 |
| 621 | 3300005289 | Ga0065704_10032660 | Ga0065704_100326602 | 221 |
| 622 | 3300005353 | Ga0070669_100283914 | Ga0070669_1002839142 | 221 |
| 623 | 3300005548 | Ga0070665_100150735 | Ga0070665_1001507352 | 221 |
| 624 | 3300006058 | Ga0075432_10012148 | Ga0075432_100121482 | 221 |
| 625 | 3300006058 | Ga0075432_10018695 | Ga0075432_100186951 | 221 |
| 626 | 3300006058 | Ga0075432_10102147 | Ga0075432_101021472 | 221 |
| 627 | 3300006944 | Ga0099823_1000360 | Ga0099823_100036029 | 221 |
| 628 | 3300006946 | Ga0079104_1000478 | Ga0079104_100047812 | 221 |
| 629 | 3300006946 | Ga0079104_1000630 | Ga0079104_10006302 | 221 |
| 630 | 3300009011 | Ga0105251_10034835 | Ga0105251_100348352 | 221 |
| 631 | 3300009011 | Ga0105251_10058309 | Ga0105251_100583092 | 221 |
| 632 | 3300009011 | Ga0105251_10072165 | Ga0105251_100721652 | 221 |
| 633 | 3300009036 | Ga0105244_10043153 | Ga0105244_100431533 | 221 |
| 634 | 3300009036 | Ga0105244_10044573 | Ga0105244_100445733 | 221 |
| 635 | 3300009036 | Ga0105244_10045278 | Ga0105244_100452781 | 221 |
| 636 | 3300009092 | Ga0105250_10025701 | Ga0105250_100257011 | 221 |
| 637 | 3300009092 | Ga0105250_10192138 | Ga0105250_101921382 | 221 |
| 638 | 3300012477 | Ga0157336_1000676 | Ga0157336_10006761 | 221 |
| 639 | 3300012498 | Ga0157345_1000583 | Ga0157345_10005832 | 221 |
| 640 | 3300013102 | Ga0157371_10081760 | Ga0157371_100817603 | 221 |
| 641 | 3300013104 | Ga0157370_10919384 | Ga0157370_109193841 | 221 |
| 642 | 3300013105 | Ga0157369_10713790 | Ga0157369_107137902 | 221 |
| 643 | 3300013306 | Ga0163162_10164309 | Ga0163162_101643092 | 221 |
| 644 | 3300013307 | Ga0157372_10042028 | Ga0157372_100420281 | 221 |
| 645 | 3300014497 | Ga0182008_10052508 | Ga0182008_100525082 | 221 |
| 646 | 3300015261 | Ga0182006_1049210 | Ga0182006_10492102 | 221 |
| 647 | 3300015261 | Ga0182006_1108978 | Ga0182006_11089782 | 221 |
| 648 | 3300017792 | Ga0163161_10110357 | Ga0163161_101103573 | 221 |
| 649 | 3300025292 | Ga0209676_1001941 | Ga0209676_100194119 | 221 |
| 650 | 3300025298 | Ga0209050_1002168 | Ga0209050_100216818 | 221 |
| 651 | 3300025303 | Ga0209051_1023520 | Ga0209051_10235202 | 221 |
| 652 | 3300025711 | Ga0207696_1000118 | Ga0207696_100011867 | 221 |
| 653 | 3300025711 | Ga0207696_1007078 | Ga0207696_10070783 | 221 |
| 654 | 3300025711 | Ga0207696_1015131 | Ga0207696_10151312 | 221 |
| 655 | 3300025728 | Ga0207655_1000415 | Ga0207655_100041534 | 221 |
| 656 | 3300025728 | Ga0207655_1000921 | Ga0207655_100092132 | 221 |
| 657 | 3300025728 | Ga0207655_1006374 | Ga0207655_100637410 | 221 |
| 658 | 3300025728 | Ga0207655_1030279 | Ga0207655_10302793 | 221 |
| 659 | 3300025728 | Ga0207655_1087892 | Ga0207655_10878921 | 221 |
| 660 | 3300025735 | Ga0207713_1003024 | Ga0207713_10030246 | 221 |
| 661 | 3300025735 | Ga0207713_1007215 | Ga0207713_10072155 | 221 |
| 662 | 3300025735 | Ga0207713_1008483 | Ga0207713_10084832 | 221 |
| 663 | 3300025735 | Ga0207713_1024817 | Ga0207713_10248171 | 221 |
| 664 | 3300025735 | Ga0207713_1039597 | Ga0207713_10395972 | 221 |
| 665 | 3300025735 | Ga0207713_1044187 | Ga0207713_10441872 | 221 |
| 666 | 3300025923 | Ga0207681_10283672 | Ga0207681_102836721 | 221 |
| 667 | 3300025935 | Ga0207709_10278852 | Ga0207709_102788522 | 221 |
| 668 | 3300027111 | Ga0209281_1000070 | Ga0209281_100007030 | 221 |
| 669 | 3300027111 | Ga0209281_1000127 | Ga0209281_100012730 | 221 |
| 670 | 3300027296 | Ga0209389_1000020 | Ga0209389_100002087 | 221 |
| 671 | 3300027296 | Ga0209389_1065562 | Ga0209389_10655622 | 221 |
| 672 | 3300027312 | Ga0209371_1000302 | Ga0209371_10003028 | 221 |
| 673 | 3300027907 | Ga0207428_10014173 | Ga0207428_100141732 | 221 |
| 674 | 3300027907 | Ga0207428_10050869 | Ga0207428_100508695 | 221 |
| 675 | 3300027907 | Ga0207428_10101513 | Ga0207428_101015131 | 221 |
| 676 | 3300027907 | Ga0207428_10109854 | Ga0207428_101098542 | 221 |
| 677 | 3300027907 | Ga0207428_10146760 | Ga0207428_101467601 | 221 |
| 678 | 3300027907 | Ga0207428_10160413 | Ga0207428_101604132 | 221 |
| 679 | 3300028379 | Ga0268266_10007379 | Ga0268266_100073792 | 221 |
| 680 | 3300030500 | Ga0268256_1000669 | Ga0268256_100066924 | 221 |
| 681 | 3300031548 | Ga0307408_100059501 | Ga0307408_1000595012 | 221 |
| 682 | 3300032004 | Ga0307414_10079818 | Ga0307414_100798183 | 221 |
| 683 | 3300038705 | Ga0237819_00789 | Ga0237819_00789_701_1366 | 221 |
| 684 | 3300039062 | Ga0400483_245346 | Ga0400483_245346_104_769 | 221 |
| 685 | 3300041405 | Ga0439438_005405 | Ga0439438_005405_124_789 | 221 |
| 686 | 3300041405 | Ga0439438_013588 | Ga0439438_013588_223_888 | 221 |
| 687 | 3300041405 | Ga0439438_019662 | Ga0439438_019662_1135_1800 | 221 |
| 688 | 3300041405 | Ga0439438_025244 | Ga0439438_025244_912_1577 | 221 |
| 689 | 3300041407 | Ga0439447_008010 | Ga0439447_008010_1096_1761 | 221 |
| 690 | 3300041407 | Ga0439447_013421 | Ga0439447_013421_107_772 | 221 |
| 691 | 3300041411 | Ga0439466_0027219 | Ga0439466_0027219_107_772 | 221 |
| 692 | 3300041411 | Ga0439466_0035356 | Ga0439466_0035356_962_1627 | 221 |
| 693 | 3300041411 | Ga0439466_0050004 | Ga0439466_0050004_604_1269 | 221 |
| 694 | 3300042006 | Ga0439432_002353 | Ga0439432_002353_5026_5691 | 221 |
| 695 | 3300042006 | Ga0439432_027068 | Ga0439432_027068_1103_1768 | 221 |
| 696 | 3300042010 | Ga0439452_007545 | Ga0439452_007545_1111_1776 | 221 |
| 697 | 3300042010 | Ga0439452_013254 | Ga0439452_013254_1562_2227 | 221 |
| 698 | 3300042010 | Ga0439452_013880 | Ga0439452_013880_419_1084 | 221 |
| 699 | 3300042013 | Ga0439456_000103 | Ga0439456_000103_26264_26929 | 221 |
| 700 | 3300042137 | Ga0450902_000456 | Ga0450902_000456_3746_4411 | 221 |
| 701 | 3300042137 | Ga0450902_001945 | Ga0450902_001945_531_1196 | 221 |
| 702 | 3300042139 | Ga0450904_002387 | Ga0450904_002387_161_826 | 221 |
| 703 | 3300042142 | Ga0450905_000070 | Ga0450905_000070_391_1056 | 221 |
| 704 | 3300042146 | Ga0450907_002607 | Ga0450907_002607_1160_1825 | 221 |
| 705 | 3300042156 | Ga0439446_0013034 | Ga0439446_0013034_1505_2170 | 221 |
| 706 | 3300042185 | Ga0450909_002548 | Ga0450909_002548_407_1072 | 221 |
| 707 | 3300042435 | Ga0439434_0007187 | Ga0439434_0007187_1122_1787 | 221 |
| 708 | 3300042461 | Ga0439460_0008816 | Ga0439460_0008816_479_1144 | 221 |
| 709 | 3300042461 | Ga0439460_0023645 | Ga0439460_0023645_925_1590 | 221 |
| 710 | 3300042993 | Ga0439440_0001951 | Ga0439440_0001951_1630_2295 | 221 |
| 711 | 3300046452 | Ga0495617_023101 | Ga0495617_023101_773_1438 | 221 |
| 712 | 3300046455 | Ga0495603_0038509 | Ga0495603_0038509_652_1317 | 221 |
| 713 | 3300046455 | Ga0495603_0158086 | Ga0495603_0158086_70_735 | 221 |
| 714 | 3300046457 | Ga0495590_0029866 | Ga0495590_0029866_661_1326 | 221 |
| 715 | 3300046458 | Ga0495591_002445 | Ga0495591_002445_9557_10222 | 221 |
| 716 | 3300046458 | Ga0495591_019925 | Ga0495591_019925_575_1240 | 221 |
| 717 | 3300046459 | Ga0495629_0193868 | Ga0495629_0193868_118_783 | 221 |
| 718 | 3300046460 | Ga0495638_0045618 | Ga0495638_0045618_671_1336 | 221 |
| 719 | 3300046460 | Ga0495638_0049486 | Ga0495638_0049486_654_1319 | 221 |
| 720 | 3300046460 | Ga0495638_0113834 | Ga0495638_0113834_311_976 | 221 |
| 721 | 3300046463 | Ga0495653_0001298 | Ga0495653_0001298_18177_18842 | 221 |
| 722 | 3300046463 | Ga0495653_0046779 | Ga0495653_0046779_1167_1832 | 221 |
| 723 | 3300046471 | Ga0495650_0010347 | Ga0495650_0010347_4474_5139 | 221 |
| 724 | 3300046474 | Ga0495605_0079791 | Ga0495605_0079791_529_1194 | 221 |
| 725 | 3300046475 | Ga0495639_0109206 | Ga0495639_0109206_199_864 | 221 |
| 726 | 3300046491 | Ga0495584_0039709 | Ga0495584_0039709_134_799 | 221 |
| 727 | 3300046491 | Ga0495584_0044790 | Ga0495584_0044790_107_772 | 221 |
| 728 | 3300046492 | Ga0495585_0002501 | Ga0495585_0002501_5819_6484 | 221 |
| 729 | 3300046492 | Ga0495585_0022154 | Ga0495585_0022154_1556_2221 | 221 |
| 730 | 3300046499 | Ga0495594_0181063 | Ga0495594_0181063_475_1140 | 221 |
| 731 | 3300046500 | Ga0495596_0000258 | Ga0495596_0000258_655_1320 | 221 |
| 732 | 3300046501 | Ga0495607_0060395 | Ga0495607_0060395_1390_2055 | 221 |
| 733 | 3300046507 | Ga0495606_0021027 | Ga0495606_0021027_3783_4448 | 221 |
| 734 | 3300046507 | Ga0495606_0047696 | Ga0495606_0047696_604_1269 | 221 |
| 735 | 3300046507 | Ga0495606_0186134 | Ga0495606_0186134_68_733 | 221 |
| 736 | 3300046512 | Ga0495610_0043317 | Ga0495610_0043317_1132_1797 | 221 |
| 737 | 3300046513 | Ga0495616_0095238 | Ga0495616_0095238_177_842 | 221 |
| 738 | 3300046513 | Ga0495616_0155289 | Ga0495616_0155289_339_1004 | 221 |
| 739 | 3300046515 | Ga0495620_0000222 | Ga0495620_0000222_15331_15996 | 221 |
| 740 | 3300046515 | Ga0495620_0020043 | Ga0495620_0020043_1436_2101 | 221 |
| 741 | 3300046517 | Ga0495630_0108345 | Ga0495630_0108345_139_804 | 221 |
| 742 | 3300046518 | Ga0495631_0066960 | Ga0495631_0066960_11_676 | 221 |
| 743 | 3300046519 | Ga0495632_0001768 | Ga0495632_0001768_15129_15794 | 221 |
| 744 | 3300046519 | Ga0495632_0042967 | Ga0495632_0042967_1496_2161 | 221 |
| 745 | 3300046519 | Ga0495632_0172623 | Ga0495632_0172623_133_798 | 221 |
| 746 | 3300046520 | Ga0495637_0008823 | Ga0495637_0008823_1391_2056 | 221 |
| 747 | 3300046520 | Ga0495637_0022282 | Ga0495637_0022282_1533_2198 | 221 |
| 748 | 3300046520 | Ga0495637_0030035 | Ga0495637_0030035_1230_1895 | 221 |
| 749 | 3300046520 | Ga0495637_0031705 | Ga0495637_0031705_1589_2254 | 221 |
| 750 | 3300046520 | Ga0495637_0076926 | Ga0495637_0076926_514_1179 | 221 |
| 751 | 3300046522 | Ga0495643_0001951 | Ga0495643_0001951_15405_16070 | 221 |
| 752 | 3300046522 | Ga0495643_0002575 | Ga0495643_0002575_1665_2330 | 221 |
| 753 | 3300046522 | Ga0495643_0091610 | Ga0495643_0091610_339_1004 | 221 |
| 754 | 3300046523 | Ga0495644_0015990 | Ga0495644_0015990_1533_2198 | 221 |
| 755 | 3300046523 | Ga0495644_0020181 | Ga0495644_0020181_434_1099 | 221 |
| 756 | 3300046523 | Ga0495644_0025150 | Ga0495644_0025150_1458_2123 | 221 |
| 757 | 3300046524 | Ga0495648_0002582 | Ga0495648_0002582_15457_16122 | 221 |
| 758 | 3300046524 | Ga0495648_0057222 | Ga0495648_0057222_108_773 | 221 |
| 759 | 3300046524 | Ga0495648_0057481 | Ga0495648_0057481_1154_1819 | 221 |
| 760 | 3300046524 | Ga0495648_0073023 | Ga0495648_0073023_147_905 | 221 |
| 761 | 3300046526 | Ga0495666_0019569 | Ga0495666_0019569_1450_2115 | 221 |
| 762 | 3300046530 | Ga0495654_0030911 | Ga0495654_0030911_1407_2072 | 221 |
| 763 | 3300046530 | Ga0495654_0091541 | Ga0495654_0091541_660_1325 | 221 |
| 764 | 3300046530 | Ga0495654_0141112 | Ga0495654_0141112_107_772 | 221 |
| 765 | 3300046536 | Ga0495587_0041989 | Ga0495587_0041989_570_1235 | 221 |
| 766 | 3300046542 | Ga0495597_0040454 | Ga0495597_0040454_1271_1936 | 221 |
| 767 | 3300046542 | Ga0495597_0055525 | Ga0495597_0055525_107_772 | 221 |
| 768 | 3300046557 | Ga0495622_0016546 | Ga0495622_0016546_1536_2201 | 221 |
| 769 | 3300046558 | Ga0495633_0037387 | Ga0495633_0037387_88_753 | 221 |
| 770 | 3300046616 | Ga0495668_0033489 | Ga0495668_0033489_646_1311 | 221 |
| 771 | 3300046660 | Ga0495625_0057392 | Ga0495625_0057392_584_1342 | 221 |
| 772 | 3300046665 | Ga0495661_0000093 | Ga0495661_0000093_83492_84157 | 221 |
| 773 | 3300046665 | Ga0495661_0085050 | Ga0495661_0085050_570_1235 | 221 |
| 774 | 3300046679 | Ga0495623_0063662 | Ga0495623_0063662_76_741 | 221 |
| 775 | 3300046680 | Ga0495646_0100477 | Ga0495646_0100477_105_770 | 221 |
| 776 | 3300046684 | Ga0495669_0027980 | Ga0495669_0027980_1769_2434 | 221 |
| 777 | 3300046691 | Ga0495670_0029437 | Ga0495670_0029437_1390_2055 | 221 |
| 778 | 3300046692 | Ga0495671_0021549 | Ga0495671_0021549_1577_2242 | 221 |
| 779 | 3300046692 | Ga0495671_0042619 | Ga0495671_0042619_148_813 | 221 |
| 780 | 3300046692 | Ga0495671_0048067 | Ga0495671_0048067_311_976 | 221 |
| 781 | 3300046692 | Ga0495671_0076883 | Ga0495671_0076883_865_1530 | 221 |
| 782 | 3300046694 | Ga0495649_0001934 | Ga0495649_0001934_182_847 | 221 |
| 783 | 3300046694 | Ga0495649_0033119 | Ga0495649_0033119_1533_2198 | 221 |
| 784 | 3300046694 | Ga0495649_0040894 | Ga0495649_0040894_345_1010 | 221 |
| 785 | 3300046694 | Ga0495649_0085978 | Ga0495649_0085978_302_967 | 221 |
| 786 | 3300046809 | Ga0495600_0160842 | Ga0495600_0160842_602_1267 | 221 |
| 787 | 3300046810 | Ga0495660_0090833 | Ga0495660_0090833_618_1283 | 221 |
| 788 | 3300046810 | Ga0495660_0092737 | Ga0495660_0092737_563_1228 | 221 |
| 789 | 3300047317 | Ga0495604_0077308 | Ga0495604_0077308_1562_2227 | 221 |
| 790 | 3300047317 | Ga0495604_0104275 | Ga0495604_0104275_1291_1956 | 221 |
| 791 | 3300047318 | Ga0495636_0025372 | Ga0495636_0025372_1012_1677 | 221 |
| 792 | 3300047320 | Ga0495672_0024361 | Ga0495672_0024361_1764_2429 | 221 |
| 793 | 3300047320 | Ga0495672_0039959 | Ga0495672_0039959_680_1345 | 221 |
| 794 | 3300047321 | Ga0495676_0041268 | Ga0495676_0041268_656_1321 | 221 |
| 795 | 3300047322 | Ga0495680_0054078 | Ga0495680_0054078_838_1503 | 221 |
| 796 | 3300047322 | Ga0495680_0076800 | Ga0495680_0076800_351_1016 | 221 |
| 797 | 3300047322 | Ga0495680_0084812 | Ga0495680_0084812_132_797 | 221 |
| 798 | 3300047323 | Ga0495683_0000254 | Ga0495683_0000254_39523_40188 | 221 |
| 799 | 3300047323 | Ga0495683_0040465 | Ga0495683_0040465_1543_2208 | 221 |
| 800 | 3300047323 | Ga0495683_0044021 | Ga0495683_0044021_1527_2192 | 221 |
| 801 | 3300047323 | Ga0495683_0054943 | Ga0495683_0054943_22_687 | 221 |
| 802 | 3300047323 | Ga0495683_0090511 | Ga0495683_0090511_132_797 | 221 |
| 803 | 3300047444 | Ga0495675_0167747 | Ga0495675_0167747_500_1165 | 221 |
| 804 | 3300047444 | Ga0495675_0177245 | Ga0495675_0177245_132_797 | 221 |
| 805 | 3300047469 | Ga0495673_0027595 | Ga0495673_0027595_489_1154 | 221 |
| 806 | 3300047469 | Ga0495673_0203908 | Ga0495673_0203908_52_717 | 221 |
| 807 | 3300047470 | Ga0495681_0006934 | Ga0495681_0006934_5108_5773 | 221 |
| 808 | 3300047470 | Ga0495681_0042086 | Ga0495681_0042086_107_772 | 221 |
| 809 | 3300047470 | Ga0495681_0044871 | Ga0495681_0044871_147_812 | 221 |
| 810 | 3300047470 | Ga0495681_0118793 | Ga0495681_0118793_133_798 | 221 |
| 811 | 3300047472 | Ga0495686_0074046 | Ga0495686_0074046_146_811 | 221 |
| 812 | 3300048091 | Ga0495626_0016183 | Ga0495626_0016183_1407_2072 | 221 |
| 813 | 3300048091 | Ga0495626_0026996 | Ga0495626_0026996_1564_2229 | 221 |
| 814 | 3300048091 | Ga0495626_0035412 | Ga0495626_0035412_147_812 | 221 |
| 815 | 3300048905 | Ga0496102_0733024 | Ga0496102_0733024_147_812 | 221 |
| 816 | 3300048913 | Ga0496110_0343334 | Ga0496110_0343334_165_830 | 221 |
| 817 | 3300048917 | Ga0496114_0012182 | Ga0496114_0012182_58_723 | 221 |
| 818 | 3300048919 | Ga0496116_0019231 | Ga0496116_0019231_85_750 | 221 |
| 819 | 3300048921 | Ga0496118_0003760 | Ga0496118_0003760_1536_2201 | 221 |
| 820 | 3300048921 | Ga0496118_0004272 | Ga0496118_0004272_14735_15400 | 221 |
| 821 | 3300048925 | Ga0496122_0002929 | Ga0496122_0002929_16850_17515 | 221 |
| 822 | 3300048926 | Ga0496123_0003514 | Ga0496123_0003514_759_1424 | 221 |
| 823 | 3300048927 | Ga0496124_0005898 | Ga0496124_0005898_12844_13509 | 221 |
| 824 | 3300048927 | Ga0496124_0069900 | Ga0496124_0069900_1563_2228 | 221 |
| 825 | 3300048928 | Ga0496125_0039422 | Ga0496125_0039422_48_713 | 221 |
| 826 | 3300048928 | Ga0496125_0082115 | Ga0496125_0082115_302_967 | 221 |
| 827 | 3300048929 | Ga0496126_0027779 | Ga0496126_0027779_59_724 | 221 |
| 828 | 3300049459 | Ga0495678_078603 | Ga0495678_078603_441_1106 | 221 |
| 829 | 3300049459 | Ga0495678_127788 | Ga0495678_127788_86_751 | 221 |
| 830 | 3300049571 | Ga0501034_0000214 | Ga0501034_0000214_93823_94488 | 221 |
| 831 | 3300050491 | nmdc:mga00v17_296811_c1 | nmdc:mga00v17_296811_c1_29_694 | 221 |
| 832 | iso_pu_bacteria | 2511231023 | 2511369245 | 221 |
| 833 | iso_pu_bacteria | 2511231031 | 2511412033 | 221 |
| 834 | iso_pu_bacteria | 2511231156 | 2511827236 | 221 |
| 835 | iso_pu_bacteria | 2599185318 | 2600038434 | 221 |
| 836 | iso_pu_bacteria | 2599185319 | 2600043766 | 221 |
| 837 | iso_pu_bacteria | 2599185323 | 2600067259 | 221 |
| 838 | iso_pu_bacteria | 2619619299 | 2621297221 | 221 |
| 839 | iso_pu_bacteria | 2623620443 | 2624483002 | 221 |
| 840 | iso_pu_bacteria | 2623620446 | 2624494531 | 221 |
| 841 | iso_pu_bacteria | 2643221650 | 2644286646 | 221 |
| 842 | iso_pu_bacteria | 2738541265 | 2738673035 | 221 |
| 843 | iso_pu_bacteria | 2738541282 | 2738751428 | 221 |
| 844 | iso_pu_bacteria | 2738541303 | 2738860469 | 221 |
| 845 | iso_pu_bacteria | 2816332298 | 2817493661 | 221 |
| 846 | iso_pu_bacteria | 2825651385 | 2825655507 | 221 |
| 847 | iso_pu_bacteria | 2842854478 | 2842859181 | 221 |
| 848 | iso_pu_bacteria | 2919063839 | 2919067685 | 221 |
| 849 | iso_pu_bacteria | 2919697872 | 2919701369 | 221 |
| 850 | iso_pu_bacteria | 2945961074 | 2945966378 | 221 |
| 851 | iso_pu_bacteria | 8019775933 | 8019780466 | 221 |
| 852 | iso_pu_bacteria | 8056143049 | 8056148360 | 221 |
| 853 | 3300009011 | Ga0105251_10000011 | Ga0105251_10000011136 | 223 |
| 854 | 3300009036 | Ga0105244_10007401 | Ga0105244_100074012 | 223 |
| 855 | 3300013100 | Ga0157373_10012234 | Ga0157373_100122342 | 223 |
| 856 | 3300013104 | Ga0157370_10000199 | Ga0157370_100001991 | 223 |
| 857 | 3300013105 | Ga0157369_10648022 | Ga0157369_106480222 | 223 |
| 858 | 3300025728 | Ga0207655_1001571 | Ga0207655_10015718 | 223 |
| 859 | 3300025735 | Ga0207713_1000073 | Ga0207713_1000073136 | 223 |
| 860 | 3300033180 | Ga0307510_10067813 | Ga0307510_100678135 | 223 |
| 861 | 3300041511 | Ga0451855_1859058 | Ga0451855_1859058_124_795 | 223 |
| 862 | 3300042016 | Ga0439463_000187 | Ga0439463_000187_533_1204 | 223 |
| 863 | 3300046452 | Ga0495617_006470 | Ga0495617_006470_3137_3808 | 223 |
| 864 | 3300046453 | Ga0495627_000037 | Ga0495627_000037_30006_30677 | 223 |
| 865 | 3300046453 | Ga0495627_011003 | Ga0495627_011003_70_741 | 223 |
| 866 | 3300046457 | Ga0495590_0020517 | Ga0495590_0020517_1260_1931 | 223 |
| 867 | 3300046458 | Ga0495591_000036 | Ga0495591_000036_106674_107345 | 223 |
| 868 | 3300046458 | Ga0495591_000753 | Ga0495591_000753_7346_8017 | 223 |
| 869 | 3300046458 | Ga0495591_002891 | Ga0495591_002891_4020_4691 | 223 |
| 870 | 3300046458 | Ga0495591_009904 | Ga0495591_009904_2976_3647 | 223 |
| 871 | 3300046458 | Ga0495591_010733 | Ga0495591_010733_2600_3271 | 223 |
| 872 | 3300046460 | Ga0495638_0248350 | Ga0495638_0248350_167_838 | 223 |
| 873 | 3300046471 | Ga0495650_0000311 | Ga0495650_0000311_66324_66995 | 223 |
| 874 | 3300046471 | Ga0495650_0003191 | Ga0495650_0003191_8724_9395 | 223 |
| 875 | 3300046474 | Ga0495605_0000209 | Ga0495605_0000209_43707_44378 | 223 |
| 876 | 3300046474 | Ga0495605_0001216 | Ga0495605_0001216_15769_16440 | 223 |
| 877 | 3300046474 | Ga0495605_0002128 | Ga0495605_0002128_9934_10605 | 223 |
| 878 | 3300046474 | Ga0495605_0016035 | Ga0495605_0016035_70_741 | 223 |
| 879 | 3300046491 | Ga0495584_0066506 | Ga0495584_0066506_1056_1727 | 223 |
| 880 | 3300046492 | Ga0495585_0106987 | Ga0495585_0106987_716_1387 | 223 |
| 881 | 3300046500 | Ga0495596_0063601 | Ga0495596_0063601_86_757 | 223 |
| 882 | 3300046501 | Ga0495607_0000482 | Ga0495607_0000482_33284_33955 | 223 |
| 883 | 3300046501 | Ga0495607_0000938 | Ga0495607_0000938_10576_11247 | 223 |
| 884 | 3300046501 | Ga0495607_0001384 | Ga0495607_0001384_19480_20151 | 223 |
| 885 | 3300046501 | Ga0495607_0002221 | Ga0495607_0002221_96_767 | 223 |
| 886 | 3300046501 | Ga0495607_0025076 | Ga0495607_0025076_2932_3603 | 223 |
| 887 | 3300046501 | Ga0495607_0053155 | Ga0495607_0053155_96_767 | 223 |
| 888 | 3300046501 | Ga0495607_0159648 | Ga0495607_0159648_132_803 | 223 |
| 889 | 3300046501 | Ga0495607_0180299 | Ga0495607_0180299_135_806 | 223 |
| 890 | 3300046506 | Ga0495583_0000583 | Ga0495583_0000583_43046_43717 | 223 |
| 891 | 3300046506 | Ga0495583_0000830 | Ga0495583_0000830_10480_11151 | 223 |
| 892 | 3300046506 | Ga0495583_0006886 | Ga0495583_0006886_447_1118 | 223 |
| 893 | 3300046506 | Ga0495583_0008728 | Ga0495583_0008728_4112_4783 | 223 |
| 894 | 3300046506 | Ga0495583_0014672 | Ga0495583_0014672_3417_4088 | 223 |
| 895 | 3300046507 | Ga0495606_0001608 | Ga0495606_0001608_13337_14008 | 223 |
| 896 | 3300046507 | Ga0495606_0030559 | Ga0495606_0030559_1094_1765 | 223 |
| 897 | 3300046507 | Ga0495606_0220015 | Ga0495606_0220015_296_967 | 223 |
| 898 | 3300046512 | Ga0495610_0007823 | Ga0495610_0007823_4220_4891 | 223 |
| 899 | 3300046512 | Ga0495610_0012332 | Ga0495610_0012332_426_1097 | 223 |
| 900 | 3300046513 | Ga0495616_0020878 | Ga0495616_0020878_553_1224 | 223 |
| 901 | 3300046515 | Ga0495620_0005934 | Ga0495620_0005934_5829_6500 | 223 |
| 902 | 3300046518 | Ga0495631_0057391 | Ga0495631_0057391_142_813 | 223 |
| 903 | 3300046519 | Ga0495632_0001173 | Ga0495632_0001173_10005_10676 | 223 |
| 904 | 3300046519 | Ga0495632_0004961 | Ga0495632_0004961_80_751 | 223 |
| 905 | 3300046519 | Ga0495632_0050671 | Ga0495632_0050671_98_769 | 223 |
| 906 | 3300046520 | Ga0495637_0000064 | Ga0495637_0000064_67153_67824 | 223 |
| 907 | 3300046520 | Ga0495637_0000110 | Ga0495637_0000110_34308_34979 | 223 |
| 908 | 3300046520 | Ga0495637_0005109 | Ga0495637_0005109_364_1035 | 223 |
| 909 | 3300046520 | Ga0495637_0011594 | Ga0495637_0011594_3460_4131 | 223 |
| 910 | 3300046522 | Ga0495643_0007213 | Ga0495643_0007213_363_1034 | 223 |
| 911 | 3300046522 | Ga0495643_0030249 | Ga0495643_0030249_2049_2720 | 223 |
| 912 | 3300046523 | Ga0495644_0003744 | Ga0495644_0003744_4570_5241 | 223 |
| 913 | 3300046524 | Ga0495648_0001400 | Ga0495648_0001400_22845_23516 | 223 |
| 914 | 3300046530 | Ga0495654_0002519 | Ga0495654_0002519_5673_6344 | 223 |
| 915 | 3300046530 | Ga0495654_0002943 | Ga0495654_0002943_3258_3929 | 223 |
| 916 | 3300046530 | Ga0495654_0061597 | Ga0495654_0061597_139_810 | 223 |
| 917 | 3300046538 | Ga0495609_0000089 | Ga0495609_0000089_77835_78506 | 223 |
| 918 | 3300046538 | Ga0495609_0000161 | Ga0495609_0000161_26753_27424 | 223 |
| 919 | 3300046542 | Ga0495597_0000026 | Ga0495597_0000026_29035_29706 | 223 |
| 920 | 3300046557 | Ga0495622_0003910 | Ga0495622_0003910_300_971 | 223 |
| 921 | 3300046616 | Ga0495668_0031470 | Ga0495668_0031470_1149_1820 | 223 |
| 922 | 3300046616 | Ga0495668_0177243 | Ga0495668_0177243_486_1157 | 223 |
| 923 | 3300046648 | Ga0495611_0000395 | Ga0495611_0000395_25902_26573 | 223 |
| 924 | 3300046660 | Ga0495625_0000194 | Ga0495625_0000194_69536_70207 | 223 |
| 925 | 3300046665 | Ga0495661_0000115 | Ga0495661_0000115_27186_27857 | 223 |
| 926 | 3300046665 | Ga0495661_0000233 | Ga0495661_0000233_24603_25274 | 223 |
| 927 | 3300046691 | Ga0495670_0036942 | Ga0495670_0036942_1645_2316 | 223 |
| 928 | 3300046691 | Ga0495670_0043992 | Ga0495670_0043992_258_929 | 223 |
| 929 | 3300046692 | Ga0495671_0010701 | Ga0495671_0010701_3319_3990 | 223 |
| 930 | 3300046694 | Ga0495649_0008385 | Ga0495649_0008385_2616_3287 | 223 |
| 931 | 3300046810 | Ga0495660_0000540 | Ga0495660_0000540_650_1321 | 223 |
| 932 | 3300046810 | Ga0495660_0001212 | Ga0495660_0001212_477_1148 | 223 |
| 933 | 3300046810 | Ga0495660_0001791 | Ga0495660_0001791_358_1029 | 223 |
| 934 | 3300046810 | Ga0495660_0018356 | Ga0495660_0018356_257_928 | 223 |
| 935 | 3300047320 | Ga0495672_0002759 | Ga0495672_0002759_8817_9488 | 223 |
| 936 | 3300047320 | Ga0495672_0004062 | Ga0495672_0004062_8809_9480 | 223 |
| 937 | 3300047320 | Ga0495672_0025709 | Ga0495672_0025709_2303_2974 | 223 |
| 938 | 3300047320 | Ga0495672_0034982 | Ga0495672_0034982_1326_1997 | 223 |
| 939 | 3300047320 | Ga0495672_0258084 | Ga0495672_0258084_70_741 | 223 |
| 940 | 3300047321 | Ga0495676_0000052 | Ga0495676_0000052_26918_27589 | 223 |
| 941 | 3300047446 | Ga0495679_000136 | Ga0495679_000136_49916_50587 | 223 |
| 942 | 3300047469 | Ga0495673_0000487 | Ga0495673_0000487_8572_9243 | 223 |
| 943 | 3300047469 | Ga0495673_0000858 | Ga0495673_0000858_8133_8804 | 223 |
| 944 | 3300047469 | Ga0495673_0004566 | Ga0495673_0004566_3215_3886 | 223 |
| 945 | 3300047469 | Ga0495673_0037928 | Ga0495673_0037928_1449_2120 | 223 |
| 946 | 3300047469 | Ga0495673_0202809 | Ga0495673_0202809_59_730 | 223 |
| 947 | 3300047470 | Ga0495681_0037709 | Ga0495681_0037709_1171_1842 | 223 |
| 948 | 3300047472 | Ga0495686_0041182 | Ga0495686_0041182_2080_2751 | 223 |
| 949 | 3300048091 | Ga0495626_0000126 | Ga0495626_0000126_26788_27459 | 223 |
| 950 | 3300048905 | Ga0496102_0559426 | Ga0496102_0559426_262_933 | 223 |
| 951 | 3300048906 | Ga0496103_0172472 | Ga0496103_0172472_528_1199 | 223 |
| 952 | 3300048913 | Ga0496110_0277946 | Ga0496110_0277946_328_999 | 223 |
| 953 | 3300048915 | Ga0496112_0287635 | Ga0496112_0287635_170_841 | 223 |
| 954 | 3300048916 | Ga0496113_0401979 | Ga0496113_0401979_14_685 | 223 |
| 955 | 3300048919 | Ga0496116_0106046 | Ga0496116_0106046_769_1440 | 223 |
| 956 | 3300048920 | Ga0496117_0067351 | Ga0496117_0067351_1604_2275 | 223 |
| 957 | 3300048920 | Ga0496117_0072615 | Ga0496117_0072615_1068_1739 | 223 |
| 958 | 3300048921 | Ga0496118_0030186 | Ga0496118_0030186_104_775 | 223 |
| 959 | 3300048924 | Ga0496121_0002170 | Ga0496121_0002170_9979_10650 | 223 |
| 960 | 3300048924 | Ga0496121_0103065 | Ga0496121_0103065_1116_1787 | 223 |
| 961 | 3300048925 | Ga0496122_0000434 | Ga0496122_0000434_64866_65537 | 223 |
| 962 | 3300048926 | Ga0496123_0000318 | Ga0496123_0000318_22000_22671 | 223 |
| 963 | 3300048926 | Ga0496123_0013642 | Ga0496123_0013642_6017_6688 | 223 |
| 964 | 3300048927 | Ga0496124_0000471 | Ga0496124_0000471_41585_42256 | 223 |
| 965 | 3300048927 | Ga0496124_0013915 | Ga0496124_0013915_3247_3918 | 223 |
| 966 | 3300048927 | Ga0496124_0045602 | Ga0496124_0045602_1547_2218 | 223 |
| 967 | 3300049459 | Ga0495678_000169 | Ga0495678_000169_50729_51400 | 223 |
| 968 | 3300049459 | Ga0495678_002042 | Ga0495678_002042_3302_3973 | 223 |
| 969 | 3300049460 | Ga0495682_0001213 | Ga0495682_0001213_9897_10568 | 223 |
| 970 | 3300049539 | Ga0501323_020451 | Ga0501323_020451_54_725 | 223 |
| 971 | 3300053140 | Ga0500573_0052401 | Ga0500573_0052401_1533_2204 | 223 |
| 972 | 3300030733 | Ga0314311_1094938 | Ga0314311_10949382 | 224 |
| 973 | 3300030742 | Ga0316183_1205059 | Ga0316183_12050592 | 224 |
| 974 | 3300030744 | Ga0316181_1020879 | Ga0316181_10208793 | 224 |
| 975 | 3300031731 | Ga0307405_10079322 | Ga0307405_100793223 | 224 |
| 976 | 3300031824 | Ga0307413_10076951 | Ga0307413_100769513 | 224 |
| 977 | 3300031903 | Ga0307407_10060628 | Ga0307407_100606282 | 224 |
| 978 | 3300031911 | Ga0307412_10275955 | Ga0307412_102759552 | 224 |
| 979 | 3300031995 | Ga0307409_100164583 | Ga0307409_1001645831 | 224 |
| 980 | 3300032002 | Ga0307416_100355594 | Ga0307416_1003555942 | 224 |
| 981 | 3300032004 | Ga0307414_10095095 | Ga0307414_100950953 | 224 |
| 982 | 3300032005 | Ga0307411_10080529 | Ga0307411_100805293 | 224 |
| 983 | 3300048925 | Ga0496122_0163129 | Ga0496122_0163129_647_1321 | 224 |
| 984 | 2162886007 | SwRhRL2b_contig_2478714 | SwRhRL2b_0770.00000170 | 225 |
| 985 | 3300005288 | Ga0065714_10003334 | Ga0065714_1000333412 | 225 |
| 986 | 3300005288 | Ga0065714_10012864 | Ga0065714_100128641 | 225 |
| 987 | 3300005289 | Ga0065704_10212940 | Ga0065704_102129401 | 225 |
| 988 | 3300005353 | Ga0070669_100001254 | Ga0070669_10000125420 | 225 |
| 989 | 3300009036 | Ga0105244_10040053 | Ga0105244_100400532 | 225 |
| 990 | 3300013104 | Ga0157370_10141103 | Ga0157370_101411033 | 225 |
| 991 | 3300013306 | Ga0163162_10176131 | Ga0163162_101761311 | 225 |
| 992 | 3300015261 | Ga0182006_1031266 | Ga0182006_10312661 | 225 |
| 993 | 3300015262 | Ga0182007_10019444 | Ga0182007_100194443 | 225 |
| 994 | 3300015265 | Ga0182005_1014004 | Ga0182005_10140043 | 225 |
| 995 | 3300025291 | Ga0209675_1004836 | Ga0209675_10048361 | 225 |
| 996 | 3300025711 | Ga0207696_1006336 | Ga0207696_10063363 | 225 |
| 997 | 3300025728 | Ga0207655_1001228 | Ga0207655_100122811 | 225 |
| 998 | 3300025735 | Ga0207713_1004132 | Ga0207713_100413211 | 225 |
| 999 | 3300025923 | Ga0207681_10006860 | Ga0207681_1000686011 | 225 |
| 1000 | 3300028379 | Ga0268266_10447827 | Ga0268266_104478272 | 225 |
| 1001 | 3300031548 | Ga0307408_100104143 | Ga0307408_1001041433 | 225 |
| 1002 | 3300041405 | Ga0439438_002874 | Ga0439438_002874_5639_6316 | 225 |
| 1003 | 3300041407 | Ga0439447_013584 | Ga0439447_013584_1327_2004 | 225 |
| 1004 | 3300041411 | Ga0439466_0022380 | Ga0439466_0022380_107_784 | 225 |
| 1005 | 3300042006 | Ga0439432_012974 | Ga0439432_012974_107_784 | 225 |
| 1006 | 3300042010 | Ga0439452_013601 | Ga0439452_013601_302_979 | 225 |
| 1007 | 3300042016 | Ga0439463_008136 | Ga0439463_008136_1288_1965 | 225 |
| 1008 | 3300042115 | Ga0450911_003507 | Ga0450911_003507_1562_2239 | 225 |
| 1009 | 3300042127 | Ga0450890_007951 | Ga0450890_007951_385_1062 | 225 |
| 1010 | 3300042138 | Ga0450903_003615 | Ga0450903_003615_1535_2212 | 225 |
| 1011 | 3300042145 | Ga0450906_004475 | Ga0450906_004475_1583_2260 | 225 |
| 1012 | 3300042156 | Ga0439446_0017685 | Ga0439446_0017685_1210_1887 | 225 |
| 1013 | 3300042461 | Ga0439460_0001891 | Ga0439460_0001891_4212_4889 | 225 |
| 1014 | 3300046452 | Ga0495617_009460 | Ga0495617_009460_1542_2219 | 225 |
| 1015 | 3300046453 | Ga0495627_010669 | Ga0495627_010669_1465_2142 | 225 |
| 1016 | 3300046457 | Ga0495590_0015406 | Ga0495590_0015406_1562_2239 | 225 |
| 1017 | 3300046474 | Ga0495605_0051663 | Ga0495605_0051663_458_1135 | 225 |
| 1018 | 3300046474 | Ga0495605_0166072 | Ga0495605_0166072_127_804 | 225 |
| 1019 | 3300046475 | Ga0495639_0000248 | Ga0495639_0000248_24828_25505 | 225 |
| 1020 | 3300046491 | Ga0495584_0038504 | Ga0495584_0038504_1633_2310 | 225 |
| 1021 | 3300046491 | Ga0495584_0042048 | Ga0495584_0042048_90_767 | 225 |
| 1022 | 3300046492 | Ga0495585_0153449 | Ga0495585_0153449_419_1096 | 225 |
| 1023 | 3300046501 | Ga0495607_0003809 | Ga0495607_0003809_10578_11255 | 225 |
| 1024 | 3300046501 | Ga0495607_0174988 | Ga0495607_0174988_91_768 | 225 |
| 1025 | 3300046506 | Ga0495583_0007941 | Ga0495583_0007941_1438_2115 | 225 |
| 1026 | 3300046512 | Ga0495610_0044480 | Ga0495610_0044480_1446_2123 | 225 |
| 1027 | 3300046513 | Ga0495616_0030970 | Ga0495616_0030970_568_1245 | 225 |
| 1028 | 3300046513 | Ga0495616_0042996 | Ga0495616_0042996_81_758 | 225 |
| 1029 | 3300046519 | Ga0495632_0028752 | Ga0495632_0028752_1430_2107 | 225 |
| 1030 | 3300046519 | Ga0495632_0039577 | Ga0495632_0039577_1569_2246 | 225 |
| 1031 | 3300046519 | Ga0495632_0043209 | Ga0495632_0043209_78_755 | 225 |
| 1032 | 3300046519 | Ga0495632_0124728 | Ga0495632_0124728_389_1069 | 225 |
| 1033 | 3300046520 | Ga0495637_0060345 | Ga0495637_0060345_696_1373 | 225 |
| 1034 | 3300046522 | Ga0495643_0064532 | Ga0495643_0064532_134_811 | 225 |
| 1035 | 3300046524 | Ga0495648_0077708 | Ga0495648_0077708_741_1418 | 225 |
| 1036 | 3300046524 | Ga0495648_0139014 | Ga0495648_0139014_159_836 | 225 |
| 1037 | 3300046528 | Ga0495642_0027458 | Ga0495642_0027458_83_760 | 225 |
| 1038 | 3300046538 | Ga0495609_0061372 | Ga0495609_0061372_33_710 | 225 |
| 1039 | 3300046557 | Ga0495622_0008666 | Ga0495622_0008666_1152_1829 | 225 |
| 1040 | 3300046615 | Ga0495656_0049529 | Ga0495656_0049529_83_760 | 225 |
| 1041 | 3300046648 | Ga0495611_0035575 | Ga0495611_0035575_1434_2111 | 225 |
| 1042 | 3300046664 | Ga0495659_0008033 | Ga0495659_0008033_1581_2258 | 225 |
| 1043 | 3300046664 | Ga0495659_0018348 | Ga0495659_0018348_1562_2239 | 225 |
| 1044 | 3300046684 | Ga0495669_0281982 | Ga0495669_0281982_90_767 | 225 |
| 1045 | 3300046692 | Ga0495671_0041876 | Ga0495671_0041876_79_756 | 225 |
| 1046 | 3300046694 | Ga0495649_0040252 | Ga0495649_0040252_1084_1761 | 225 |
| 1047 | 3300046694 | Ga0495649_0045564 | Ga0495649_0045564_134_811 | 225 |
| 1048 | 3300046794 | Ga0495589_0018396 | Ga0495589_0018396_1377_2054 | 225 |
| 1049 | 3300046794 | Ga0495589_0178872 | Ga0495589_0178872_156_833 | 225 |
| 1050 | 3300046810 | Ga0495660_0063961 | Ga0495660_0063961_104_781 | 225 |
| 1051 | 3300047320 | Ga0495672_0026547 | Ga0495672_0026547_1368_2045 | 225 |
| 1052 | 3300047320 | Ga0495672_0064617 | Ga0495672_0064617_444_1121 | 225 |
| 1053 | 3300047323 | Ga0495683_0049012 | Ga0495683_0049012_68_745 | 225 |
| 1054 | 3300047443 | Ga0495687_019088 | Ga0495687_019088_1109_1786 | 225 |
| 1055 | 3300047445 | Ga0495677_0015191 | Ga0495677_0015191_1523_2200 | 225 |
| 1056 | 3300047470 | Ga0495681_0022764 | Ga0495681_0022764_1435_2112 | 225 |
| 1057 | 3300048091 | Ga0495626_0019595 | Ga0495626_0019595_1118_1795 | 225 |
| 1058 | 3300048091 | Ga0495626_0035440 | Ga0495626_0035440_1571_2248 | 225 |
| 1059 | 3300048091 | Ga0495626_0038193 | Ga0495626_0038193_361_1038 | 225 |
| 1060 | 3300048909 | Ga0496106_0132833 | Ga0496106_0132833_1230_1907 | 225 |
| 1061 | 3300048919 | Ga0496116_0037567 | Ga0496116_0037567_1111_1788 | 225 |
| 1062 | 3300048924 | Ga0496121_0079897 | Ga0496121_0079897_1280_1957 | 225 |
| 1063 | 3300048925 | Ga0496122_0093236 | Ga0496122_0093236_36_713 | 225 |
| 1064 | 3300048929 | Ga0496126_0277065 | Ga0496126_0277065_679_1356 | 225 |
| 1065 | 3300049459 | Ga0495678_029232 | Ga0495678_029232_134_811 | 225 |
| 1066 | 3300049459 | Ga0495678_086008 | Ga0495678_086008_132_809 | 225 |
| 1067 | 3300049460 | Ga0495682_0028092 | Ga0495682_0028092_435_1112 | 225 |
| 1068 | 3300049460 | Ga0495682_0111657 | Ga0495682_0111657_232_909 | 225 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1pkv-assembly1.cif.gz_B | the n-terminal domain of riboflavin synthase in complex with riboflavin | 0.9698 | 1 | 87 |
| 4g6i-assembly1.cif.gz_B | crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with roseoflavin | 0.9663 | 1 | 195 |
| 4fxu-assembly1.cif.gz_A | crystallographic structure of trimeric riboflavin synthase from brucella abortus | 0.9649 | 1 | 195 |
| 1pkv-assembly1.cif.gz_B | the n-terminal domain of riboflavin synthase in complex with riboflavin | 0.959 | 1 | 87 |
| 4fxu-assembly1.cif.gz_A | crystallographic structure of trimeric riboflavin synthase from brucella abortus | 0.9553 | 1 | 195 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4fxuC02 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.9651 | 102 | 192 | 2.40.30.20 |
| af_Q2FXG0_1_88_2.40.30.20 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.9613 | 1 | 89 | 2.40.30.20 |
| af_P0AFU8_1_89_2.40.30.20 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.9593 | 1 | 89 | 2.40.30.20 |
| 4fxuA01 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.959 | 1 | 89 | 2.40.30.20 |
| af_A0A1D8PP67_110_218_2.40.30.20 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.9558 | 102 | 194 | 2.40.30.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A066RW78-F1-model_v4 | Riboflavin synthase (EC 2.5.1.9) | 0.9886 | 1 | 189 |
GO:0004746
GO:0009231 |
| AF-A0A0Q0CFZ6-F1-model_v4 | Riboflavin synthase (EC 2.5.1.9) | 0.9865 | 2 | 202 |
GO:0004746
GO:0009231 |
| AF-A0A844M1F6-F1-model_v4 | Riboflavin synthase (EC 2.5.1.9) | 0.9839 | 1 | 194 |
GO:0004746
GO:0009231 |
| AF-A0A066RW78-F1-model_v4 | Riboflavin synthase (EC 2.5.1.9) | 0.9834 | 1 | 189 |
GO:0004746
GO:0009231 |
| AF-A0A1S9CYA2-F1-model_v4 | Riboflavin synthase (EC 2.5.1.9) | 0.9833 | 1 | 194 |
GO:0004746
GO:0009231 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar