F489333

General Info

Members Datasets Scaffolds Average Seq Length
1063 834 471 304

Family's Representative Sequence

Representative Sequence 3300048922|Ga0496119_0015192|Ga0496119_0015192_2901_3857
Length 309
Sequence MMNDTASIKAPVRNNVPKQDRRSFLQRLAHASEPYLYSAPALILIGAVMLVPLILGVSYAFRDIQLLNPFSGGYVGLDHFRELATDQAFYRSLKNTLWWTGCSVLLQFVFGLILALLLDKPFAGRGLAQALIFLPWAVPTFLTGLNFAWLFNPVIGPLPHWLHAIGILSAPDNILSDPNLAMWGIITAGVWWGIPFFAITMLAALQAIPRDLYEAAAIDGAGPFQRFLSITLPYLAPTMAITILLRTVWIANSADLIVVMTGGGPADRTQIVASYIFTQAFKRLDFGYASAIAMVLLIVLLRQTLLNKD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501050 Microvirga lupini Lut6 Isolate Nodule
3 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276019 Ensifer aridi TW10 Isolate Nodule
6 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
7 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
8 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
9 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
10 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
11 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
12 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
13 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
14 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
15 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
16 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
17 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
18 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
19 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
20 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
21 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
22 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
23 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
24 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
25 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
26 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
27 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
28 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
29 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
30 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
31 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
32 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
33 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
34 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
35 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
36 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
37 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
38 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
39 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
40 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
41 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
42 2516143018 Ensifer sp. BR816 Isolate Nodule
43 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
44 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
45 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
46 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
47 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
48 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
49 2519899620 Rhizobium sp. Pop5 Isolate Nodule
50 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
51 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
52 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
53 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
54 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
55 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
56 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
57 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
58 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
59 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
60 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
61 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
62 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
63 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
64 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
65 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
66 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
67 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
68 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
69 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
70 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
71 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
72 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
73 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
74 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
75 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
76 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
77 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
78 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
79 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
80 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
81 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
82 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
83 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
84 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
85 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
86 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
87 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
88 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
89 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
90 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
91 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
92 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
93 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
94 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
95 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
96 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
97 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
98 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
99 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
100 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
101 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
102 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
103 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
104 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
105 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
106 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
107 2643221557 Ensifer sp. Root558 Isolate Unclassified
108 2643221568 Rhizobium sp. Root564 Isolate Unclassified
109 2643221582 Rhizobium sp. Root651 Isolate Unclassified
110 2643221599 Rhizobium sp. Root708 Isolate Unclassified
111 2643221607 Rhizobium sp. Root73 Isolate Unclassified
112 2643221610 Ensifer sp. Root74 Isolate Unclassified
113 2643221618 Ensifer sp. Root231 Isolate Unclassified
114 2643221626 Ensifer sp. Root31 Isolate Unclassified
115 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
116 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
117 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
118 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
119 2643221655 Ensifer sp. Root1252 Isolate Unclassified
120 2643221659 Ensifer sp. Root127 Isolate Unclassified
121 2643221668 Ensifer sp. Root423 Isolate Unclassified
122 2643221675 Ensifer sp. Root1298 Isolate Unclassified
123 2643221680 Ensifer sp. Root1312 Isolate Unclassified
124 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
125 2643221688 Rhizobium sp. Root482 Isolate Unclassified
126 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
127 2643221693 Rhizobium sp. Root491 Isolate Unclassified
128 2643221698 Ensifer sp. Root142 Isolate Unclassified
129 2643221712 Ensifer sp. Root258 Isolate Unclassified
130 2643221718 Rhizobium sp. Root268 Isolate Unclassified
131 2643221723 Ensifer sp. Root278 Isolate Unclassified
132 2643221726 Ensifer sp. Root954 Isolate Unclassified
133 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
134 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
135 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
136 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
137 2718217882 Rhizobium sp. N741 Isolate Nodule
138 2718217927 Rhizobium sp. N324 Isolate Nodule
139 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
140 2718218009 Rhizobium sp. N561 Isolate Nodule
141 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
142 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
143 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
144 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
145 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
146 2718218363 Rhizobium sp. N113 Isolate Nodule
147 2718218365 Rhizobium sp. N731 Isolate Nodule
148 2718218366 Rhizobium sp. N621 Isolate Nodule
149 2718218423 Rhizobium sp. N941 Isolate Nodule
150 2721755514 Rhizobium sp. N6212 Isolate Nodule
151 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
152 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
153 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
154 2721755809 Rhizobium sp. N541 Isolate Nodule
155 2721755810 Rhizobium sp. N871 Isolate Nodule
156 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
157 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
158 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
159 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
160 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
161 2728369365 Rhizobium sp. N1341 Isolate Nodule
162 2728369397 Rhizobium sp. N1314 Isolate Nodule
163 2738541293 Rhizobium sp. GV031 Isolate Unclassified
164 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
165 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
166 2751185800 Brucella pituitosa AA2 Isolate Unclassified
167 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
168 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
169 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
170 2773857925 Microvirga vignae BR3299 Isolate Unclassified
171 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
172 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
173 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
174 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
175 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
176 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
177 2791355256 Rhizobium sp. M10 Isolate Nodule
178 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
179 2791355260 Rhizobium sp. L9 Isolate Nodule
180 2791355261 Rhizobium sp. J15 Isolate Nodule
181 2791355262 Rhizobium sp. M1 Isolate Nodule
182 2791355263 Rhizobium chutanense C5 Isolate Nodule
183 2791355264 Rhizobium sp. S9 Isolate Nodule
184 2791355265 Rhizobium sp. H4 Isolate Nodule
185 2791355266 Rhizobium sp. L43 Isolate Nodule
186 2791355267 Rhizobium sp. L18 Isolate Nodule
187 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
188 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
189 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
190 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
191 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
192 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
193 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
194 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
195 2802429633 Rhizobium anhuiense J3 Isolate Nodule
196 2802429634 Rhizobium anhuiense S10 Isolate Nodule
197 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
198 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
199 2802429637 Rhizobium anhuiense C15 Isolate Nodule
200 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
201 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
202 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
203 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
204 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
205 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
206 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
207 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
208 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
209 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
210 2838048938 Rhizobium pisi 27/80 Isolate Nodule
211 2838061910 Rhizobium phaseoli L15 Isolate Nodule
212 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
213 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
214 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
215 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
216 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
217 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
218 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
219 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
220 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
221 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
222 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
223 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
224 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
225 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
226 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
227 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
228 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
229 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
230 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
231 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
232 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
233 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
234 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
235 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
236 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
237 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
238 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
239 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
240 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
241 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
242 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
243 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
244 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
245 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
246 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
247 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
248 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
249 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
250 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
251 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
252 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
253 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
254 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
255 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
256 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
257 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
258 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
259 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
260 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
261 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
262 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
263 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
264 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
265 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
266 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
267 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
268 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
269 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
270 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
271 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
272 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
273 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
274 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
275 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
276 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
277 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
278 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
279 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
280 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
281 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
282 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
283 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
284 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
285 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
286 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
287 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
288 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
289 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
290 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
291 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
292 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
293 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
294 2844163670 Ensifer sp. 1H6 Isolate Unclassified
295 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
296 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
297 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
298 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
299 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
300 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
301 2854911287 Brucella lupini LUP21 Isolate Unclassified
302 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
303 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
304 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
305 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
306 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
307 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
308 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
309 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
310 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
311 2876601092 Pantoea endophytica 596 Isolate Unclassified
312 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
313 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
314 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
315 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
316 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
317 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
318 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
319 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
320 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
321 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
322 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
323 2909042592 Labrys sp. LIt4 Isolate Nodule
324 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
325 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
326 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
327 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
328 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
329 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
330 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
331 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
332 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
333 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
334 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
335 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
336 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
337 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
338 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
339 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
340 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
341 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
342 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
343 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
344 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
345 2919150387 Rahnella aceris 1817 Isolate Unclassified
346 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
347 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
348 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
349 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
350 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
351 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
352 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
353 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
354 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
355 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
356 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
357 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
358 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
359 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
360 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
361 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
362 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
363 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
364 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
365 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
366 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
367 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
368 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
369 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
370 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
371 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
372 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
373 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
374 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
375 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
376 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
377 2927143783 Rahnella sp. 2050 Isolate Unclassified
378 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
379 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
380 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
381 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
382 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
383 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
384 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
385 2933599457 Rhizobium phaseoli M3 Isolate Nodule
386 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
387 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
388 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
389 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
390 2936381700 Rhizobium chutanense C16 Isolate Unclassified
391 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
392 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
393 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
394 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
395 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
396 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
397 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
398 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
399 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
400 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
401 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
402 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
403 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
404 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
405 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
406 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
407 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
408 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
409 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
410 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
411 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
412 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
413 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
414 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
415 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
416 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
417 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
418 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
419 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
420 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
421 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
422 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
423 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
424 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
425 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
426 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
427 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
428 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
429 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
430 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
431 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
432 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
433 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
434 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
435 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
436 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
437 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
438 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
439 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
440 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
441 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
442 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
443 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
444 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
445 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
446 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
447 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
448 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
449 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
450 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
451 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
452 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
453 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
454 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
455 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
456 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
457 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
458 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
459 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
460 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
461 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
462 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
463 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
464 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
465 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
466 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
467 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
468 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
469 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
470 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
471 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
472 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
473 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
474 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
475 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
476 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
477 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
478 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
479 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
480 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
481 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
482 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
483 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
484 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
485 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
486 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
487 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
488 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
489 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
490 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
491 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
492 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
493 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
494 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
495 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
496 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
497 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
498 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
499 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
500 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
501 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
502 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
503 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
504 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
505 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
506 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
507 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
508 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
509 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
510 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
511 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
512 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
513 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
514 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
515 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
516 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
517 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
518 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
519 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
520 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
521 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
522 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
523 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
524 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
525 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
526 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
527 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
528 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
529 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
530 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
531 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
532 2996887358 Rhizobium sp. R711 Isolate Nodule
533 2996893221 Rhizobium sp. R635 Isolate Nodule
534 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
535 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
536 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
537 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
538 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
539 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
540 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
541 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
542 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
543 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
544 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
545 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
546 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
547 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
548 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
549 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
550 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
551 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
552 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
553 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
554 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
555 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
556 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
557 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
558 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
559 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
560 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
561 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
562 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
563 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
564 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
565 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
566 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
567 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
568 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
569 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
570 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
571 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
572 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
573 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
574 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
575 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
576 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
577 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
578 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
579 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
580 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
581 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
582 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
583 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
584 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
585 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
586 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
587 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
588 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
589 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
590 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
591 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
592 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
593 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
594 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
595 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
596 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
597 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
598 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
599 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
600 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
601 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
602 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
603 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
604 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
605 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
606 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
607 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
608 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
609 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
610 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
611 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
612 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
613 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
614 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
615 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
616 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
617 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
618 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
619 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
620 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
621 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
622 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
623 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
624 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
625 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
626 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
627 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
628 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
629 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
630 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
631 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
632 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
633 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
634 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
635 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
636 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
637 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
638 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
639 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
640 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
641 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
642 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
643 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
644 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
645 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
646 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
647 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
648 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
649 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
650 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
651 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
652 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
653 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
654 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
655 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
656 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
657 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
658 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
659 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
660 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
661 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
662 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
663 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
664 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
665 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
666 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
667 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
668 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
669 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
670 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
671 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
672 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
673 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
674 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
675 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
676 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
677 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
678 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
679 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
680 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
681 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
682 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
683 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
684 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
685 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
686 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
687 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
688 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
689 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
690 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
691 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
692 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
693 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
694 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
695 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
696 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
697 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
698 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
699 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
700 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
701 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
702 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
703 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
704 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
705 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
706 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
707 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
708 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
709 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
710 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
711 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
712 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
713 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
714 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
715 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
716 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
717 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
718 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
719 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
720 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
721 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
722 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
723 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
724 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
725 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
726 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
727 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
728 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
729 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
730 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
731 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
732 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
733 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
734 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
735 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
736 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
737 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
738 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
739 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
740 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
741 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
742 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
743 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
744 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
745 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
746 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
747 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
748 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
749 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
750 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
751 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
752 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
753 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
754 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
755 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
756 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
757 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
758 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
759 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
760 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
761 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
762 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
763 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
764 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
765 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
766 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
767 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
768 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
769 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
770 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
771 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
772 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
773 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
774 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
775 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
776 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
777 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
778 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
779 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
780 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
781 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
782 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
783 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
784 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
785 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
786 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
787 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
788 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
789 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
790 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
791 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
792 8005258706 Rhizobium sp. R693 Isolate Nodule
793 8005275841 Rhizobium sp. N4311 Isolate Nodule
794 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
795 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
796 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
797 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
798 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
799 8005321885 Rhizobium sp. R72 Isolate Nodule
800 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
801 8005382845 Rhizobium sp. R634 Isolate Nodule
802 8005395548 Rhizobium sp. R339 Isolate Nodule
803 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
804 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
805 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
806 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
807 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
808 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
809 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
810 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
811 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
812 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
813 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
814 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
815 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
816 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
817 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
818 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
819 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
820 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
821 8018176218 Rhizobium sp. N122 Isolate Nodule
822 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
823 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
824 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
825 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
826 8024501048 Rhizobium sp. H4 Isolate Nodule
827 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
828 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
829 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
830 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
831 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
832 8056382006 Rhizobium croatiense 13T Isolate Nodule
833 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
834 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 44.31
Metatranscriptomes 0.09
Isolates 55.6

Biome Distribution

Category Percentage (%)
Aerial Root 0.09
Bulb 0
Endosphere 17.5
Nodule 42.24
Rhizoplane 1.03
Rhizosphere 21.35
Stem 0
Stem Tuber 0
Unclassified 17.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_999527 2162886007 Bacteria 5204
2 JGI25155J39150_1000015 3300002704 Bacteria 178839
3 JGI25156J39149_1000007 3300002705 Bacteria 252108
4 JGI25162J39368_1000009 3300002737 Bacteria 389795
5 JGI25162J39368_1000119 3300002737 Bacteria 87157
6 JGI25162J39368_1000489 3300002737 Bacteria 30241
7 JGI25154J39366_1000145 3300002738 Bacteria 55861
8 JGI25158J39367_1000094 3300002739 Bacteria 20606
9 JGI25158J39367_1007632 3300002739 Bacteria 1520
10 JGI25157J39369_1000012 3300002741 Bacteria 205167
11 JGI25163J39215_1000765 3300002771 Bacteria 7902
12 JGI25164J39214_1000002 3300002772 Bacteria 406570
13 JGI25152J39213_1001079 3300002773 Bacteria 12856
14 JGI25152J39213_1002953 3300002773 Bacteria 6053
15 JGI25152J39213_1007983 3300002773 Bacteria 2676
16 JGI25150J39212_1000103 3300002774 Bacteria 49029
17 JGI25150J39212_1006873 3300002774 Bacteria 2318
18 JGI25159J45721_1000008 3300002987 Bacteria 172667
19 JGI25159J45721_1000089 3300002987 Bacteria 43695
20 JGI25159J45721_1001078 3300002987 Bacteria 11655
21 JGI25151J46595_10000085 3300003187 Bacteria 127212
22 JGI25151J46595_10000450 3300003187 Bacteria 39793
23 JGI25151J46595_10023743 3300003187 Bacteria 2520
24 JGI25151J46595_10042716 3300003187 Bacteria 1630
25 JGI25165J46597_1000211 3300003214 Bacteria 82463
26 JGI25165J46597_1001070 3300003214 Bacteria 17582
27 JGI25153J46596_10000103 3300003215 Bacteria 96279
28 JGI25153J46596_10001488 3300003215 Bacteria 13974
29 JGI25153J46596_10005550 3300003215 Bacteria 6594
30 JGI25153J46596_10009848 3300003215 Bacteria 4386
31 rootH1_10002325 3300003323 Bacteria 1954
32 rootH1_10114926 3300003323 Bacteria 2568
33 JGI25160J50197_1000023 3300003354 Bacteria 200692
34 JGI25160J50197_1000033 3300003354 Bacteria 172667
35 JGI25160J50197_1001657 3300003354 Bacteria 10887
36 JGI25160J50197_1005696 3300003354 Bacteria 5147
37 JGI25161J50226_1000012 3300003374 Bacteria 200668
38 JGI25161J50226_1000508 3300003374 Bacteria 17047
39 JGI25161J50226_1001989 3300003374 Bacteria 5608
40 Ga0006562J51391_1050521 3300003578 Bacteria 2458
41 Ga0055538_1000015 3300003751 Bacteria 311166
42 Ga0055539_1000009 3300003752 Bacteria 406566
43 Ga0055533_1000012 3300003756 Bacteria 406566
44 Ga0055525_1000014 3300003759 Bacteria 406566
45 Ga0055526_1007886 3300003771 Bacteria 5425
46 Ga0055526_1008170 3300003771 Bacteria 5268
47 Ga0055526_1012891 3300003771 Bacteria 3593
48 Ga0055526_1016912 3300003771 Bacteria 2820
49 Ga0055524_1002358 3300003775 Bacteria 9823
50 Ga0055524_1003993 3300003775 Bacteria 6961
51 Ga0055524_1004703 3300003775 Bacteria 6253
52 Ga0055524_1014578 3300003775 Bacteria 2906
53 Ga0055528_1000519 3300003790 Bacteria 30154
54 Ga0055528_1004148 3300003790 Bacteria 7059
55 Ga0055528_1014232 3300003790 Bacteria 2957
56 Ga0055540_1000050 3300003792 Bacteria 145565
57 Ga0055540_1005332 3300003792 Bacteria 5457
58 Ga0055540_1022935 3300003792 Bacteria 1584
59 Ga0055531_10016516 3300003794 Bacteria 3179
60 Ga0055531_10017593 3300003794 Bacteria 3006
61 Ga0055541_1000006 3300003841 Bacteria 406566
62 Ga0058692_1003232 3300003856 Bacteria 5114
63 Ga0058692_1008266 3300003856 Bacteria 2693
64 Ga0055543_1000009 3300004625 Bacteria 200706
65 Ga0055543_1000021 3300004625 Bacteria 150116
66 Ga0055543_1000315 3300004625 Bacteria 33655
67 Ga0055543_1003043 3300004625 Bacteria 5170
68 Ga0065165_1000064 3300005262 Bacteria 175153
69 Ga0065165_1000513 3300005262 Bacteria 59506
70 Ga0065165_1006135 3300005262 Bacteria 6429
71 Ga0065165_1008941 3300005262 Bacteria 4588
72 Ga0065704_10000959 3300005289 Bacteria 34794
73 Ga0070670_100000287 3300005331 Bacteria 44454
74 Ga0070666_10038630 3300005335 Bacteria 3177
75 Ga0070689_100327329 3300005340 Bacteria 1281
76 Ga0070674_100001722 3300005356 Bacteria 11851
77 Ga0070667_100530015 3300005367 Bacteria 1081
78 Ga0070665_100177473 3300005548 Bacteria 2131
79 Ga0068854_100067701 3300005578 Bacteria 2602
80 Ga0068861_100033057 3300005719 Bacteria 3813
81 Ga0068862_100090252 3300005844 Bacteria 2667
82 Ga0081455_10107643 3300005937 Bacteria 2222
83 Ga0081538_10002181 3300005981 Bacteria 19427
84 Ga0075365_10010840 3300006038 Bacteria 5331
85 Ga0075365_10041025 3300006038 Bacteria 3021
86 Ga0075365_10102459 3300006038 Bacteria 1961
87 Ga0075363_100105762 3300006048 Bacteria 1561
88 Ga0075364_10013563 3300006051 Bacteria 5014
89 Ga0075367_10021014 3300006178 Bacteria 3643
90 Ga0075367_10209952 3300006178 Bacteria 1217
91 Ga0075369_10007134 3300006186 Bacteria 4247
92 Ga0075369_10035944 3300006186 Bacteria 2106
93 Ga0075369_10060762 3300006186 Bacteria 1649
94 Ga0075366_10003448 3300006195 Bacteria 8344
95 Ga0075366_10066583 3300006195 Bacteria 2143
96 Ga0075370_10003108 3300006353 Bacteria 7837
97 Ga0075431_100414289 3300006847 Bacteria 1347
98 Ga0099826_10000181 3300006948 Bacteria 26466
99 Ga0105244_10001340 3300009036 Bacteria 20097
100 Ga0105244_10001791 3300009036 Bacteria 16834
101 Ga0105244_10014154 3300009036 Bacteria 4625
102 Ga0105244_10113787 3300009036 Bacteria 1314
103 Ga0105250_10004385 3300009092 Bacteria 6501
104 Ga0105250_10016611 3300009092 Bacteria 2997
105 Ga0105240_10000217 3300009093 Bacteria 115649
106 Ga0105240_10326015 3300009093 Bacteria 1749
107 Ga0111539_10000123 3300009094 Bacteria 87000
108 Ga0114129_10338648 3300009147 Bacteria 1996
109 Ga0105243_10032808 3300009148 Bacteria 4014
110 Ga0105248_10046083 3300009177 Bacteria 4887
111 Ga0105237_10001458 3300009545 Bacteria 31192
112 Ga0105238_10586861 3300009551 Bacteria 1121
113 Ga0105249_10239161 3300009553 Bacteria 1794
114 Ga0123341_1000109 3300009765 Bacteria 36496
115 Ga0123342_1011498 3300009766 Bacteria 9644
116 Ga0123342_1014735 3300009766 Bacteria 7361
117 Ga0105239_10001164 3300010375 Bacteria 36154
118 Ga0105239_10331429 3300010375 Bacteria 1717
119 Ga0105246_10133406 3300011119 Bacteria 1858
120 Ga0157373_10004331 3300013100 Bacteria 10686
121 Ga0157373_10030840 3300013100 Bacteria 3858
122 Ga0157371_10000002 3300013102 Bacteria 665040
123 Ga0157371_10001454 3300013102 Bacteria 24558
124 Ga0157371_10010601 3300013102 Bacteria 7161
125 Ga0157370_10001923 3300013104 Bacteria 25548
126 Ga0171463_1007 3300013249 Bacteria 301198
127 Ga0163162_10064478 3300013306 Bacteria 3708
128 Ga0182008_10038396 3300014497 Bacteria 2394
129 Ga0182007_10000324 3300015262 Bacteria 30329
130 Ga0182005_1001504 3300015265 Bacteria 9294
131 Ga0182005_1001516 3300015265 Bacteria 9254
132 Ga0183363_1153 3300015690 Bacteria 17205
133 Ga0214544_1000010 3300021320 Bacteria 270164
134 Ga0214542_1000023 3300021321 Bacteria 191557
135 Ga0214543_1000019 3300021327 Bacteria 267908
136 Ga0214543_1001578 3300021327 Bacteria 44277
137 Ga0228711_1000017 3300022739 Bacteria 121084
138 Ga0228710_1000005 3300022740 Bacteria 233531
139 Ga0209435_100006 3300025206 Bacteria 542459
140 Ga0209760_100051 3300025207 Bacteria 105257
141 Ga0209784_100001 3300025224 Bacteria 3600592
142 Ga0209566_100001 3300025225 Bacteria 3600765
143 Ga0209674_100002 3300025226 Bacteria 3600592
144 Ga0209563_100002 3300025230 Bacteria 2045675
145 Ga0207427_100020 3300025231 Bacteria 507515
146 Ga0209437_100001 3300025233 Bacteria 2045675
147 Ga0209437_100042 3300025233 Bacteria 444095
148 Ga0209437_100062 3300025233 Bacteria 336900
149 Ga0207425_1000065 3300025245 Bacteria 127264
150 Ga0207425_1002970 3300025245 Bacteria 5671
151 Ga0207425_1008240 3300025245 Bacteria 2684
152 Ga0207425_1008594 3300025245 Bacteria 2599
153 Ga0207425_1009532 3300025245 Bacteria 2408
154 Ga0209646_1000015 3300025246 Bacteria 542459
155 Ga0209646_1003792 3300025246 Bacteria 2894
156 Ga0209026_1000046 3300025250 Bacteria 262031
157 Ga0209677_100002 3300025253 Bacteria 2045675
158 Ga0209677_100429 3300025253 Bacteria 24814
159 Ga0209759_1000005 3300025256 Bacteria 542459
160 Ga0209129_1000019 3300025258 Bacteria 460802
161 Ga0209129_1000132 3300025258 Bacteria 127262
162 Ga0209129_1001521 3300025258 Bacteria 12809
163 Ga0209129_1002872 3300025258 Bacteria 7945
164 Ga0209129_1004004 3300025258 Bacteria 6048
165 Ga0209129_1006071 3300025258 Bacteria 4038
166 Ga0209129_1008177 3300025258 Bacteria 2959
167 Ga0209233_1000082 3300025261 Bacteria 336320
168 Ga0209233_1000103 3300025261 Bacteria 284123
169 Ga0209233_1000288 3300025261 Bacteria 66882
170 Ga0209565_1009149 3300025263 Bacteria 2542
171 Ga0209673_1000023 3300025273 Bacteria 411385
172 Ga0209673_1000132 3300025273 Bacteria 162349
173 Ga0209673_1001968 3300025273 Bacteria 16055
174 Ga0209673_1002729 3300025273 Bacteria 11649
175 Ga0209673_1002876 3300025273 Bacteria 10948
176 Ga0209673_1013630 3300025273 Bacteria 3196
177 Ga0209130_1000001 3300025284 Bacteria 831557
178 Ga0209130_1000017 3300025284 Bacteria 388431
179 Ga0209130_1000048 3300025284 Bacteria 233357
180 Ga0209130_1010463 3300025284 Bacteria 2552
181 Ga0209676_1016266 3300025292 Bacteria 2695
182 Ga0209676_1019746 3300025292 Bacteria 2309
183 Ga0209676_1051628 3300025292 Bacteria 1077
184 Ga0209025_1000072 3300025294 Bacteria 283452
185 Ga0209025_1000153 3300025294 Bacteria 170548
186 Ga0209025_1000247 3300025294 Bacteria 127264
187 Ga0209025_1000666 3300025294 Bacteria 59408
188 Ga0209025_1002519 3300025294 Bacteria 19180
189 Ga0209025_1005892 3300025294 Bacteria 9796
190 Ga0209025_1019188 3300025294 Bacteria 3817
191 Ga0209025_1041861 3300025294 Bacteria 1955
192 Ga0209564_1000100 3300025295 Bacteria 224016
193 Ga0209564_1000372 3300025295 Bacteria 83053
194 Ga0209564_1001437 3300025295 Bacteria 24420
195 Ga0209564_1002441 3300025295 Bacteria 14707
196 Ga0209564_1011402 3300025295 Bacteria 3987
197 Ga0209758_1000053 3300025297 Bacteria 337751
198 Ga0209758_1000212 3300025297 Bacteria 127597
199 Ga0209758_1000239 3300025297 Bacteria 114761
200 Ga0209758_1000712 3300025297 Bacteria 49095
201 Ga0209758_1002735 3300025297 Bacteria 17345
202 Ga0209758_1004308 3300025297 Bacteria 11994
203 Ga0209758_1014984 3300025297 Bacteria 4056
204 Ga0209758_1030212 3300025297 Bacteria 2249
205 Ga0209050_1003849 3300025298 Bacteria 10688
206 Ga0209050_1009761 3300025298 Bacteria 4848
207 Ga0209256_1000401 3300025299 Bacteria 68618
208 Ga0209256_1000458 3300025299 Bacteria 61611
209 Ga0209256_1000735 3300025299 Bacteria 43205
210 Ga0209256_1002923 3300025299 Bacteria 12843
211 Ga0209256_1003989 3300025299 Bacteria 9683
212 Ga0209256_1034706 3300025299 Bacteria 1339
213 Ga0207426_1000005 3300025302 Bacteria 1037188
214 Ga0207426_1000006 3300025302 Bacteria 1025969
215 Ga0207426_1000035 3300025302 Bacteria 448327
216 Ga0207426_1000136 3300025302 Bacteria 201401
217 Ga0207426_1008593 3300025302 Bacteria 4103
218 Ga0209051_1000062 3300025303 Bacteria 251081
219 Ga0209051_1003152 3300025303 Bacteria 11077
220 Ga0209051_1005006 3300025303 Bacteria 7897
221 Ga0209051_1049963 3300025303 Bacteria 1404
222 Ga0209257_1001119 3300025304 Bacteria 34613
223 Ga0209257_1003325 3300025304 Bacteria 13918
224 Ga0209257_1010746 3300025304 Bacteria 4556
225 Ga0209257_1019784 3300025304 Bacteria 2519
226 Ga0207696_1000076 3300025711 Bacteria 210418
227 Ga0207696_1000396 3300025711 Bacteria 40779
228 Ga0207655_1000413 3300025728 Bacteria 58877
229 Ga0207643_10216081 3300025908 Bacteria 1172
230 Ga0207695_10000613 3300025913 Bacteria 71568
231 Ga0207671_10001160 3300025914 Bacteria 31428
232 Ga0207681_10180050 3300025923 Bacteria 1609
233 Ga0207650_10001289 3300025925 Bacteria 18184
234 Ga0207644_10129395 3300025931 Bacteria 1931
235 Ga0207709_10036345 3300025935 Bacteria 2919
236 Ga0207669_10006701 3300025937 Bacteria 5282
237 Ga0207640_10041416 3300025981 Bacteria 2929
238 Ga0207678_10193672 3300026067 Bacteria 1738
239 Ga0207678_10419430 3300026067 Bacteria 1160
240 Ga0207708_10168432 3300026075 Bacteria 1733
241 Ga0207702_10014348 3300026078 Bacteria 6578
242 Ga0207675_100011538 3300026118 Bacteria 8263
243 Ga0207698_10019310 3300026142 Bacteria 4664
244 Ga0209281_1000082 3300027111 Bacteria 257684
245 Ga0209281_1001229 3300027111 Bacteria 17082
246 Ga0209371_1004328 3300027312 Bacteria 6261
247 Ga0209371_1004561 3300027312 Bacteria 5941
248 Ga0209371_1004841 3300027312 Bacteria 5645
249 Ga0209371_1012154 3300027312 Bacteria 2511
250 Ga0209282_1000006 3300027666 Bacteria 276998
251 Ga0209282_1000176 3300027666 Bacteria 35300
252 Ga0209813_10003863 3300027866 Bacteria 3545
253 Ga0207428_10000133 3300027907 Bacteria 100902
254 Ga0268266_10005342 3300028379 Bacteria 12018
255 Ga0268266_10173894 3300028379 Bacteria 1956
256 Ga0268266_10210065 3300028379 Bacteria 1785
257 Ga0268266_10385997 3300028379 Bacteria 1322
258 Ga0307515_10002150 3300028794 Bacteria 43260
259 Ga0307515_10003918 3300028794 Bacteria 31060
260 Ga0307515_10033865 3300028794 Bacteria 8393
261 Ga0307515_10174626 3300028794 Bacteria 2125
262 Ga0307515_10178036 3300028794 Bacteria 2089
263 Ga0268256_1003641 3300030500 Bacteria 6841
264 Ga0268256_1003966 3300030500 Bacteria 6378
265 Ga0268256_1004619 3300030500 Bacteria 5645
266 Ga0268256_1015885 3300030500 Bacteria 2178
267 Ga0307513_10000463 3300031456 Bacteria 58389
268 Ga0307513_10028096 3300031456 Bacteria 6441
269 Ga0307513_10260744 3300031456 Bacteria 1523
270 Ga0307408_100123412 3300031548 Bacteria 2010
271 Ga0307408_100505965 3300031548 Bacteria 1058
272 Ga0307508_10081823 3300031616 Bacteria 2810
273 Ga0265314_10018857 3300031711 Bacteria 5359
274 Ga0307516_10312986 3300031730 Bacteria 1243
275 Ga0307405_10042032 3300031731 Bacteria 2780
276 Ga0307406_10009475 3300031901 Bacteria 5462
277 Ga0307406_10173760 3300031901 Bacteria 1562
278 Ga0315914_1000003 3300031967 Bacteria 314370
279 Ga0307409_100033770 3300031995 Bacteria 3727
280 Ga0307414_10231532 3300032004 Bacteria 1524
281 Ga0315913_1000001 3300033430 Bacteria 284459
282 Ga0315915_1000008 3300033464 Bacteria 258517
283 Ga0373946_0073534 3300035171 Bacteria 1482
284 Ga0373927_0000266 3300035695 Bacteria 41356
285 Ga0373925_0001672 3300037068 Bacteria 18664
286 Ga0395900_0195811 3300037418 Bacteria 2048
287 Ga0395905_0002837 3300037471 Bacteria 18981
288 Ga0395905_0003927 3300037471 Bacteria 15643
289 Ga0395905_0048313 3300037471 Bacteria 3988
290 Ga0439436_0000195 3300041404 Bacteria 14462
291 Ga0439438_033911 3300041405 Bacteria 1347
292 Ga0439465_0011745 3300041413 Bacteria 2745
293 Ga0439465_0018667 3300041413 Bacteria 2167
294 Ga0451841_0975768 3300041498 Bacteria 1921
295 Ga0451845_0189427 3300041501 Bacteria 2701
296 Ga0451855_0850854 3300041511 Bacteria 2133
297 Ga0439449_0017545 3300042007 Bacteria 2688
298 Ga0450918_013129 3300042531 Bacteria 1441
299 Ga0450893_0010090 3300042532 Bacteria 1548
300 Ga0495591_000803 3300046458 Bacteria 22249
301 Ga0495629_0040880 3300046459 Bacteria 3262
302 Ga0495638_0003868 3300046460 Bacteria 11612
303 Ga0495650_0000043 3300046471 Bacteria 357197
304 Ga0495650_0000113 3300046471 Bacteria 196536
305 Ga0495605_0062038 3300046474 Bacteria 1787
306 Ga0495584_0002744 3300046491 Bacteria 9858
307 Ga0495607_0020421 3300046501 Bacteria 4188
308 Ga0495607_0135549 3300046501 Bacteria 1276
309 Ga0495583_0027699 3300046506 Bacteria 2794
310 Ga0495606_0000374 3300046507 Bacteria 76132
311 Ga0495606_0001618 3300046507 Bacteria 29389
312 Ga0495610_0003039 3300046512 Bacteria 13434
313 Ga0495631_0036456 3300046518 Bacteria 2196
314 Ga0495632_0000181 3300046519 Bacteria 64344
315 Ga0495632_0069804 3300046519 Bacteria 1691
316 Ga0495643_0074995 3300046522 Bacteria 1770
317 Ga0495643_0149540 3300046522 Bacteria 1157
318 Ga0495644_0001112 3300046523 Bacteria 11067
319 Ga0495648_0018790 3300046524 Bacteria 4878
320 Ga0495654_0000124 3300046530 Bacteria 86154
321 Ga0495609_0095443 3300046538 Bacteria 1291
322 Ga0495597_0130276 3300046542 Bacteria 1044
323 Ga0495622_0023211 3300046557 Bacteria 2892
324 Ga0495633_0005760 3300046558 Bacteria 7486
325 Ga0495668_0084825 3300046616 Bacteria 1737
326 Ga0495634_0083991 3300046642 Bacteria 2077
327 Ga0495611_0050843 3300046648 Bacteria 1867
328 Ga0495625_0045083 3300046660 Bacteria 3190
329 Ga0495625_0082577 3300046660 Bacteria 2234
330 Ga0495670_0114601 3300046691 Bacteria 1397
331 Ga0495649_0014383 3300046694 Bacteria 4538
332 Ga0495660_0000012 3300046810 Bacteria 350701
333 Ga0495660_0000034 3300046810 Bacteria 201261
334 Ga0495660_0051547 3300046810 Bacteria 2239
335 Ga0495604_0021553 3300047317 Bacteria 5143
336 Ga0495672_0000029 3300047320 Bacteria 305231
337 Ga0495673_0000092 3300047469 Bacteria 187963
338 Ga0495681_0002695 3300047470 Bacteria 12583
339 Ga0495686_0000795 3300047472 Bacteria 41055
340 Ga0495686_0082322 3300047472 Bacteria 1964
341 Ga0495686_0098028 3300047472 Bacteria 1772
342 Ga0495602_0233377 3300048088 Bacteria 1381
343 Ga0496101_0000023 3300048904 Bacteria 209923
344 Ga0496102_0141483 3300048905 Bacteria 2256
345 Ga0496104_0002678 3300048907 Bacteria 15329
346 Ga0496116_0000042 3300048919 Bacteria 330516
347 Ga0496116_0000066 3300048919 Bacteria 264035
348 Ga0496116_0005820 3300048919 Bacteria 11323
349 Ga0496116_0007217 3300048919 Bacteria 9916
350 Ga0496116_0009455 3300048919 Bacteria 8303
351 Ga0496116_0019687 3300048919 Bacteria 5159
352 Ga0496116_0061839 3300048919 Bacteria 2421
353 Ga0496116_0104620 3300048919 Bacteria 1681
354 Ga0496117_0000036 3300048920 Bacteria 325635
355 Ga0496117_0013982 3300048920 Bacteria 6954
356 Ga0496117_0019866 3300048920 Bacteria 5499
357 Ga0496117_0032851 3300048920 Bacteria 3934
358 Ga0496117_0129192 3300048920 Bacteria 1535
359 Ga0496118_0008573 3300048921 Bacteria 10526
360 Ga0496118_0015347 3300048921 Bacteria 7096
361 Ga0496118_0022829 3300048921 Bacteria 5454
362 Ga0496118_0086250 3300048921 Bacteria 2182
363 Ga0496118_0169496 3300048921 Bacteria 1336
364 Ga0496119_0004655 3300048922 Bacteria 13530
365 Ga0496119_0010451 3300048922 Bacteria 7812
366 Ga0496119_0015192 3300048922 Bacteria 5957
367 Ga0496119_0016484 3300048922 Bacteria 5621
368 Ga0496119_0056647 3300048922 Bacteria 2374
369 Ga0496119_0095065 3300048922 Bacteria 1684
370 Ga0496120_0000032 3300048923 Bacteria 220255
371 Ga0496120_0000777 3300048923 Bacteria 46134
372 Ga0496120_0001086 3300048923 Bacteria 35695
373 Ga0496120_0001949 3300048923 Bacteria 22617
374 Ga0496120_0008032 3300048923 Bacteria 7762
375 Ga0496120_0008096 3300048923 Bacteria 7725
376 Ga0496121_0000001 3300048924 Bacteria 1830318
377 Ga0496121_0000239 3300048924 Bacteria 118051
378 Ga0496121_0002342 3300048924 Bacteria 29248
379 Ga0496121_0018876 3300048924 Bacteria 6922
380 Ga0496121_0089900 3300048924 Bacteria 2402
381 Ga0496121_0114540 3300048924 Bacteria 2049
382 Ga0496121_0149639 3300048924 Bacteria 1720
383 Ga0496122_0000002 3300048925 Bacteria 905834
384 Ga0496122_0000072 3300048925 Bacteria 222436
385 Ga0496122_0000110 3300048925 Bacteria 190142
386 Ga0496122_0006562 3300048925 Bacteria 13298
387 Ga0496122_0024700 3300048925 Bacteria 5250
388 Ga0496122_0038214 3300048925 Bacteria 3850
389 Ga0496122_0048082 3300048925 Bacteria 3285
390 Ga0496122_0055595 3300048925 Bacteria 2959
391 Ga0496122_0089123 3300048925 Bacteria 2111
392 Ga0496122_0102534 3300048925 Bacteria 1907
393 Ga0496122_0171152 3300048925 Bacteria 1309
394 Ga0496123_0000002 3300048926 Bacteria 1811682
395 Ga0496123_0000035 3300048926 Bacteria 267288
396 Ga0496123_0000081 3300048926 Bacteria 190142
397 Ga0496123_0019603 3300048926 Bacteria 5327
398 Ga0496123_0022001 3300048926 Bacteria 4931
399 Ga0496123_0088410 3300048926 Bacteria 1850
400 Ga0496123_0125553 3300048926 Bacteria 1433
401 Ga0496124_0000530 3300048927 Bacteria 65033
402 Ga0496124_0003541 3300048927 Bacteria 18992
403 Ga0496124_0010305 3300048927 Bacteria 9485
404 Ga0496124_0015678 3300048927 Bacteria 7249
405 Ga0496124_0018541 3300048927 Bacteria 6514
406 Ga0496124_0166198 3300048927 Bacteria 1714
407 Ga0496124_0183488 3300048927 Bacteria 1608
408 Ga0496125_0000001 3300048928 Bacteria 1766138
409 Ga0496125_0000033 3300048928 Bacteria 351850
410 Ga0496125_0329482 3300048928 Bacteria 921
411 Ga0496126_0000053 3300048929 Bacteria 311989
412 Ga0496126_0001066 3300048929 Bacteria 46225
413 Ga0496126_0061199 3300048929 Bacteria 3382
414 Ga0496126_0066054 3300048929 Bacteria 3235
415 Ga0496126_0068946 3300048929 Bacteria 3156
416 Ga0496126_0082583 3300048929 Bacteria 2838
417 Ga0495678_001299 3300049459 Bacteria 20174
418 Ga0495682_0000003 3300049460 Bacteria 515787
419 Ga0501032_0189669 3300049569 Bacteria 1344
420 Ga0501033_0175589 3300049570 Bacteria 1537
421 Ga0501034_0001016 3300049571 Bacteria 40222
422 Ga0501034_0127468 3300049571 Bacteria 2530
423 Ga0501034_0156497 3300049571 Bacteria 2252
424 Ga0501034_0170942 3300049571 Bacteria 2140
425 Ga0501037_0050168 3300049573 Bacteria 3055
426 Ga0501067_0060623 3300049583 Bacteria 2094
427 Ga0501067_0081931 3300049583 Bacteria 1789
428 Ga0501070_0240193 3300049586 Bacteria 1483
429 Ga0501073_0001099 3300049589 Bacteria 19587
430 Ga0501073_0129401 3300049589 Bacteria 1750
431 Ga0501073_0254413 3300049589 Bacteria 1212
432 Ga0501238_003722 3300049671 Bacteria 1884
433 Ga0501080_0401518 3300049742 Bacteria 1233
434 Ga0501280_004682 3300049776 Bacteria 1993
435 Ga0501035_0112926 3300049822 Bacteria 2380
436 Ga0501044_0007436 3300049823 Bacteria 12046
437 Ga0501044_0017995 3300049823 Bacteria 7577
438 Ga0501044_0019019 3300049823 Bacteria 7355
439 Ga0501044_0434355 3300049823 Bacteria 1222
440 nmdc:mga03n38_21958_c1 3300050490 Bacteria 2576
441 nmdc:mga00v17_18899_c1 3300050491 Bacteria 3923
442 nmdc:mga00v17_230_c1 3300050491 Bacteria 33351
443 nmdc:mga00v17_24964_c1 3300050491 Bacteria 3469
444 nmdc:mga0yw44_53094_c1 3300050492 Bacteria 2460
445 nmdc:mga0yw44_64092_c1 3300050492 Bacteria 2261
446 nmdc:mga0k408_76185_c1 3300050493 Bacteria 1960
447 nmdc:mga06r32_399024_c1 3300050510 Bacteria 1357
448 nmdc:mga08y16_44_c1 3300050511 Bacteria 121496
449 nmdc:mga0sz30_27459_c1 3300050516 Bacteria 2338
450 Ga0500646_0002763 3300053090 Bacteria 4529
451 Ga0500560_000282 3300053107 Bacteria 6409
452 Ga0500595_006666 3300053119 Bacteria 4871
453 Ga0500618_009881 3300053125 Bacteria 2586
454 Ga0500621_000006 3300053126 Bacteria 245480
455 Ga0500642_0002981 3300053130 Bacteria 5046
456 Ga0500658_0001819 3300053134 Bacteria 8407
457 Ga0500559_0058507 3300053136 Bacteria 1714
458 Ga0500561_0000110 3300053137 Bacteria 15825
459 Ga0500590_000792 3300053148 Bacteria 11720
460 Ga0500616_0001121 3300053153 Bacteria 27611
461 Ga0500616_0002733 3300053153 Bacteria 14294
462 Ga0500622_0002690 3300053156 Bacteria 12594
463 Ga0500624_000296 3300053157 Bacteria 17030
464 Ga0500624_003077 3300053157 Bacteria 2200
465 Ga0500627_0145969 3300053158 Bacteria 1069
466 Ga0500634_0000796 3300053161 Bacteria 11018
467 Ga0500634_0010247 3300053161 Bacteria 4780
468 Ga0500636_0000026 3300053177 Bacteria 84046
469 Ga0500636_0000083 3300053177 Bacteria 47142
470 Ga0500609_000048 3300053731 Bacteria 15782
471 Ga0501084_0206468 3300054114 Bacteria 1658

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003771 Ga0055526_1008170 Ga0055526_10081701 263
2 3300028379 Ga0268266_10210065 Ga0268266_102100651 267
3 3300002739 JGI25158J39367_1007632 JGI25158J39367_10076322 268
4 3300046519 Ga0495632_0069804 Ga0495632_0069804_41_853 268
5 3300009553 Ga0105249_10239161 Ga0105249_102391612 271
6 3300011119 Ga0105246_10133406 Ga0105246_101334062 271
7 3300049823 Ga0501044_0019019 Ga0501044_0019019_6429_7316 272
8 3300053153 Ga0500616_0001121 Ga0500616_0001121_25601_26488 272
9 3300003215 JGI25153J46596_10000103 JGI25153J46596_1000010344 273
10 3300003794 Ga0055531_10016516 Ga0055531_100165163 273
11 3300025297 Ga0209758_1000239 Ga0209758_100023966 273
12 3300025298 Ga0209050_1009761 Ga0209050_10097613 273
13 3300025304 Ga0209257_1001119 Ga0209257_10011195 273
14 3300049589 Ga0501073_0129401 Ga0501073_0129401_457_1344 273
15 3300049823 Ga0501044_0434355 Ga0501044_0434355_183_1070 273
16 3300049583 Ga0501067_0081931 Ga0501067_0081931_36_923 275
17 3300053119 Ga0500595_006666 Ga0500595_006666_1712_2599 277
18 3300046530 Ga0495654_0000124 Ga0495654_0000124_2925_3764 279
19 3300048928 Ga0496125_0329482 Ga0496125_0329482_23_907 281
20 3300014497 Ga0182008_10038396 Ga0182008_100383962 282
21 3300015265 Ga0182005_1001516 Ga0182005_10015164 282
22 3300005844 Ga0068862_100090252 Ga0068862_1000902522 283
23 3300009093 Ga0105240_10326015 Ga0105240_103260152 283
24 3300025304 Ga0209257_1019784 Ga0209257_10197841 283
25 3300049569 Ga0501032_0189669 Ga0501032_0189669_389_1318 283
26 3300049573 Ga0501037_0050168 Ga0501037_0050168_374_1303 283
27 3300049583 Ga0501067_0060623 Ga0501067_0060623_540_1469 283
28 3300049586 Ga0501070_0240193 Ga0501070_0240193_211_1140 283
29 3300049589 Ga0501073_0001099 Ga0501073_0001099_12372_13301 283
30 3300049742 Ga0501080_0401518 Ga0501080_0401518_153_1133 283
31 3300049823 Ga0501044_0017995 Ga0501044_0017995_66_995 283
32 3300053090 Ga0500646_0002763 Ga0500646_0002763_204_1133 283
33 3300053130 Ga0500642_0002981 Ga0500642_0002981_875_1804 283
34 3300053731 Ga0500609_000048 Ga0500609_000048_12291_13220 283
35 3300031456 Ga0307513_10028096 Ga0307513_100280964 284
36 3300053177 Ga0500636_0000083 Ga0500636_0000083_13956_14987 284
37 3300049589 Ga0501073_0254413 Ga0501073_0254413_93_1022 285
38 3300054114 Ga0501084_0206468 Ga0501084_0206468_114_1043 285
39 3300005340 Ga0070689_100327329 Ga0070689_1003273292 286
40 3300053177 Ga0500636_0000026 Ga0500636_0000026_7837_8769 286
41 3300005356 Ga0070674_100001722 Ga0070674_1000017223 287
42 3300005719 Ga0068861_100033057 Ga0068861_1000330571 287
43 3300025937 Ga0207669_10006701 Ga0207669_100067013 287
44 3300026067 Ga0207678_10419430 Ga0207678_104194302 287
45 3300026075 Ga0207708_10168432 Ga0207708_101684322 287
46 3300026118 Ga0207675_100011538 Ga0207675_1000115382 287
47 3300037471 Ga0395905_0048313 Ga0395905_0048313_1302_2234 287
48 3300005937 Ga0081455_10107643 Ga0081455_101076433 288
49 3300005981 Ga0081538_10002181 Ga0081538_1000218119 288
50 3300006048 Ga0075363_100105762 Ga0075363_1001057622 288
51 3300009147 Ga0114129_10338648 Ga0114129_103386482 288
52 3300010375 Ga0105239_10331429 Ga0105239_103314292 288
53 3300028794 Ga0307515_10174626 Ga0307515_101746262 288
54 3300031548 Ga0307408_100505965 Ga0307408_1005059651 288
55 3300031901 Ga0307406_10173760 Ga0307406_101737601 288
56 3300031995 Ga0307409_100033770 Ga0307409_1000337703 288
57 3300037471 Ga0395905_0002837 Ga0395905_0002837_5853_6788 288
58 3300046507 Ga0495606_0001618 Ga0495606_0001618_613_1548 288
59 3300047472 Ga0495686_0082322 Ga0495686_0082322_627_1559 288
60 3300047472 Ga0495686_0098028 Ga0495686_0098028_484_1419 288
61 3300048924 Ga0496121_0114540 Ga0496121_0114540_617_1552 288
62 iso_pu_bacteria 2838675328 2838679984 288
63 iso_pu_bacteria 2838719591 2838721993 288
64 iso_pu_bacteria 2838724970 2838728147 288
65 iso_pu_bacteria 2842130223 2842134887 288
66 iso_pu_bacteria 2842152218 2842156902 288
67 iso_pu_bacteria 2842170452 2842173082 288
68 iso_pu_bacteria 2842175837 2842180520 288
69 iso_pu_bacteria 2842187318 2842190504 288
70 iso_pu_bacteria 2842211629 2842214818 288
71 iso_pu_bacteria 2842224351 2842227539 288
72 3300002737 JGI25162J39368_1000119 JGI25162J39368_100011948 289
73 3300002774 JGI25150J39212_1006873 JGI25150J39212_10068733 289
74 3300003187 JGI25151J46595_10042716 JGI25151J46595_100427162 289
75 3300003214 JGI25165J46597_1000211 JGI25165J46597_100021148 289
76 3300013102 Ga0157371_10010601 Ga0157371_100106012 289
77 3300025233 Ga0209437_100062 Ga0209437_100062280 289
78 3300025245 Ga0207425_1002970 Ga0207425_10029705 289
79 3300025245 Ga0207425_1008594 Ga0207425_10085943 289
80 3300025258 Ga0209129_1001521 Ga0209129_100152113 289
81 3300025258 Ga0209129_1004004 Ga0209129_10040045 289
82 3300025261 Ga0209233_1000082 Ga0209233_1000082280 289
83 3300025294 Ga0209025_1002519 Ga0209025_10025193 289
84 3300025297 Ga0209758_1000712 Ga0209758_100071212 289
85 3300025297 Ga0209758_1002735 Ga0209758_100273516 289
86 3300025908 Ga0207643_10216081 Ga0207643_102160812 289
87 3300026078 Ga0207702_10014348 Ga0207702_100143487 289
88 3300028379 Ga0268266_10385997 Ga0268266_103859972 289
89 3300028794 Ga0307515_10002150 Ga0307515_1000215039 289
90 3300031730 Ga0307516_10312986 Ga0307516_103129862 289
91 3300046460 Ga0495638_0003868 Ga0495638_0003868_7396_8331 289
92 3300046519 Ga0495632_0000181 Ga0495632_0000181_63149_64099 289
93 3300048919 Ga0496116_0000042 Ga0496116_0000042_123427_124359 289
94 3300048920 Ga0496117_0129192 Ga0496117_0129192_37_972 289
95 3300048922 Ga0496119_0095065 Ga0496119_0095065_128_1108 289
96 3300048924 Ga0496121_0018876 Ga0496121_0018876_123_1058 289
97 3300048925 Ga0496122_0024700 Ga0496122_0024700_614_1594 289
98 3300048925 Ga0496122_0089123 Ga0496122_0089123_796_1731 289
99 3300048925 Ga0496122_0171152 Ga0496122_0171152_316_1248 289
100 3300048929 Ga0496126_0000053 Ga0496126_0000053_166291_167223 289
101 3300049570 Ga0501033_0175589 Ga0501033_0175589_326_1249 289
102 3300049571 Ga0501034_0156497 Ga0501034_0156497_395_1318 289
103 3300049571 Ga0501034_0170942 Ga0501034_0170942_621_1556 289
104 3300049822 Ga0501035_0112926 Ga0501035_0112926_485_1408 289
105 3300049823 Ga0501044_0007436 Ga0501044_0007436_5751_6674 289
106 3300053153 Ga0500616_0002733 Ga0500616_0002733_10191_11126 289
107 3300053156 Ga0500622_0002690 Ga0500622_0002690_671_1606 289
108 3300005331 Ga0070670_100000287 Ga0070670_10000028723 290
109 3300006051 Ga0075364_10013563 Ga0075364_100135634 290
110 3300006178 Ga0075367_10021014 Ga0075367_100210142 290
111 3300025246 Ga0209646_1003792 Ga0209646_10037923 290
112 3300025925 Ga0207650_10001289 Ga0207650_100012899 290
113 3300028794 Ga0307515_10033865 Ga0307515_100338653 290
114 3300031456 Ga0307513_10000463 Ga0307513_1000046354 290
115 3300037471 Ga0395905_0003927 Ga0395905_0003927_7037_7972 290
116 3300046474 Ga0495605_0062038 Ga0495605_0062038_221_1186 290
117 3300046501 Ga0495607_0135549 Ga0495607_0135549_75_1010 290
118 3300046538 Ga0495609_0095443 Ga0495609_0095443_239_1174 290
119 3300046691 Ga0495670_0114601 Ga0495670_0114601_224_1159 290
120 3300048919 Ga0496116_0061839 Ga0496116_0061839_691_1626 290
121 3300048920 Ga0496117_0032851 Ga0496117_0032851_504_1439 290
122 3300048921 Ga0496118_0086250 Ga0496118_0086250_869_1804 290
123 3300048922 Ga0496119_0016484 Ga0496119_0016484_4578_5570 290
124 3300048923 Ga0496120_0008096 Ga0496120_0008096_4853_5788 290
125 3300048924 Ga0496121_0000001 Ga0496121_0000001_102663_103598 290
126 3300048925 Ga0496122_0000072 Ga0496122_0000072_20390_21322 290
127 3300048926 Ga0496123_0000035 Ga0496123_0000035_65242_66174 290
128 3300048927 Ga0496124_0010305 Ga0496124_0010305_8163_9095 290
129 3300048928 Ga0496125_0000001 Ga0496125_0000001_216016_217053 290
130 3300048929 Ga0496126_0082583 Ga0496126_0082583_462_1397 290
131 3300050491 nmdc:mga00v17_18899_c1 nmdc:mga00v17_18899_c1_1124_2059 290
132 3300002704 JGI25155J39150_1000015 JGI25155J39150_100001544 291
133 3300002705 JGI25156J39149_1000007 JGI25156J39149_100000744 291
134 3300002737 JGI25162J39368_1000489 JGI25162J39368_100048927 291
135 3300002738 JGI25154J39366_1000145 JGI25154J39366_100014544 291
136 3300002739 JGI25158J39367_1000094 JGI25158J39367_10000945 291
137 3300002741 JGI25157J39369_1000012 JGI25157J39369_1000012157 291
138 3300002773 JGI25152J39213_1001079 JGI25152J39213_10010798 291
139 3300002773 JGI25152J39213_1002953 JGI25152J39213_10029534 291
140 3300002773 JGI25152J39213_1007983 JGI25152J39213_10079832 291
141 3300002774 JGI25150J39212_1000103 JGI25150J39212_100010337 291
142 3300002987 JGI25159J45721_1000089 JGI25159J45721_100008917 291
143 3300002987 JGI25159J45721_1001078 JGI25159J45721_10010789 291
144 3300003187 JGI25151J46595_10000085 JGI25151J46595_10000085112 291
145 3300003187 JGI25151J46595_10000450 JGI25151J46595_100004502 291
146 3300003214 JGI25165J46597_1001070 JGI25165J46597_100107011 291
147 3300003215 JGI25153J46596_10001488 JGI25153J46596_100014886 291
148 3300003215 JGI25153J46596_10005550 JGI25153J46596_100055506 291
149 3300003215 JGI25153J46596_10009848 JGI25153J46596_100098485 291
150 3300003323 rootH1_10114926 rootH1_101149262 291
151 3300003354 JGI25160J50197_1000023 JGI25160J50197_1000023169 291
152 3300003354 JGI25160J50197_1001657 JGI25160J50197_10016577 291
153 3300003354 JGI25160J50197_1005696 JGI25160J50197_10056962 291
154 3300003374 JGI25161J50226_1000012 JGI25161J50226_1000012169 291
155 3300003374 JGI25161J50226_1001989 JGI25161J50226_10019896 291
156 3300003578 Ga0006562J51391_1050521 Ga0006562J51391_10505211 291
157 3300003771 Ga0055526_1007886 Ga0055526_10078862 291
158 3300003775 Ga0055524_1003993 Ga0055524_10039935 291
159 3300003775 Ga0055524_1004703 Ga0055524_10047034 291
160 3300003775 Ga0055524_1014578 Ga0055524_10145782 291
161 3300003790 Ga0055528_1004148 Ga0055528_10041486 291
162 3300003792 Ga0055540_1000050 Ga0055540_1000050125 291
163 3300003792 Ga0055540_1005332 Ga0055540_10053324 291
164 3300003792 Ga0055540_1022935 Ga0055540_10229351 291
165 3300004625 Ga0055543_1000009 Ga0055543_1000009169 291
166 3300004625 Ga0055543_1000021 Ga0055543_100002158 291
167 3300004625 Ga0055543_1003043 Ga0055543_10030432 291
168 3300005262 Ga0065165_1000064 Ga0065165_100006428 291
169 3300005262 Ga0065165_1008941 Ga0065165_10089413 291
170 3300005335 Ga0070666_10038630 Ga0070666_100386303 291
171 3300005367 Ga0070667_100530015 Ga0070667_1005300151 291
172 3300005548 Ga0070665_100177473 Ga0070665_1001774732 291
173 3300005578 Ga0068854_100067701 Ga0068854_1000677012 291
174 3300006038 Ga0075365_10010840 Ga0075365_100108403 291
175 3300006038 Ga0075365_10041025 Ga0075365_100410252 291
176 3300006186 Ga0075369_10007134 Ga0075369_100071345 291
177 3300006195 Ga0075366_10066583 Ga0075366_100665832 291
178 3300006353 Ga0075370_10003108 Ga0075370_100031089 291
179 3300009036 Ga0105244_10113787 Ga0105244_101137872 291
180 3300009092 Ga0105250_10016611 Ga0105250_100166112 291
181 3300009093 Ga0105240_10000217 Ga0105240_1000021765 291
182 3300009177 Ga0105248_10046083 Ga0105248_100460833 291
183 3300009545 Ga0105237_10001458 Ga0105237_1000145827 291
184 3300009765 Ga0123341_1000109 Ga0123341_100010914 291
185 3300009766 Ga0123342_1011498 Ga0123342_101149812 291
186 3300009766 Ga0123342_1014735 Ga0123342_10147354 291
187 3300010375 Ga0105239_10001164 Ga0105239_100011643 291
188 3300015262 Ga0182007_10000324 Ga0182007_100003248 291
189 3300015265 Ga0182005_1001504 Ga0182005_10015045 291
190 3300025206 Ga0209435_100006 Ga0209435_100006482 291
191 3300025233 Ga0209437_100042 Ga0209437_100042131 291
192 3300025245 Ga0207425_1000065 Ga0207425_1000065109 291
193 3300025245 Ga0207425_1008240 Ga0207425_10082401 291
194 3300025245 Ga0207425_1009532 Ga0207425_10095323 291
195 3300025246 Ga0209646_1000015 Ga0209646_100001552 291
196 3300025250 Ga0209026_1000046 Ga0209026_100004652 291
197 3300025253 Ga0209677_100429 Ga0209677_1004295 291
198 3300025256 Ga0209759_1000005 Ga0209759_1000005482 291
199 3300025258 Ga0209129_1000132 Ga0209129_1000132109 291
200 3300025258 Ga0209129_1002872 Ga0209129_10028722 291
201 3300025258 Ga0209129_1006071 Ga0209129_10060712 291
202 3300025258 Ga0209129_1008177 Ga0209129_10081773 291
203 3300025261 Ga0209233_1000103 Ga0209233_1000103131 291
204 3300025261 Ga0209233_1000288 Ga0209233_100028816 291
205 3300025273 Ga0209673_1001968 Ga0209673_10019688 291
206 3300025273 Ga0209673_1002729 Ga0209673_100272910 291
207 3300025273 Ga0209673_1002876 Ga0209673_10028762 291
208 3300025273 Ga0209673_1013630 Ga0209673_10136303 291
209 3300025284 Ga0209130_1000001 Ga0209130_1000001212 291
210 3300025284 Ga0209130_1000048 Ga0209130_100004828 291
211 3300025292 Ga0209676_1019746 Ga0209676_10197462 291
212 3300025292 Ga0209676_1051628 Ga0209676_10516282 291
213 3300025294 Ga0209025_1000072 Ga0209025_100007281 291
214 3300025294 Ga0209025_1000247 Ga0209025_1000247109 291
215 3300025294 Ga0209025_1019188 Ga0209025_10191883 291
216 3300025295 Ga0209564_1001437 Ga0209564_100143710 291
217 3300025295 Ga0209564_1002441 Ga0209564_100244110 291
218 3300025297 Ga0209758_1000053 Ga0209758_1000053151 291
219 3300025297 Ga0209758_1000212 Ga0209758_1000212110 291
220 3300025297 Ga0209758_1004308 Ga0209758_100430810 291
221 3300025297 Ga0209758_1014984 Ga0209758_10149844 291
222 3300025298 Ga0209050_1003849 Ga0209050_100384912 291
223 3300025299 Ga0209256_1002923 Ga0209256_10029234 291
224 3300025299 Ga0209256_1003989 Ga0209256_100398910 291
225 3300025299 Ga0209256_1034706 Ga0209256_10347062 291
226 3300025302 Ga0207426_1000005 Ga0207426_1000005817 291
227 3300025302 Ga0207426_1000035 Ga0207426_1000035226 291
228 3300025302 Ga0207426_1000136 Ga0207426_100013628 291
229 3300025302 Ga0207426_1008593 Ga0207426_10085934 291
230 3300025303 Ga0209051_1000062 Ga0209051_1000062202 291
231 3300025303 Ga0209051_1003152 Ga0209051_10031527 291
232 3300025303 Ga0209051_1005006 Ga0209051_10050062 291
233 3300025304 Ga0209257_1003325 Ga0209257_100332517 291
234 3300025913 Ga0207695_10000613 Ga0207695_1000061348 291
235 3300025914 Ga0207671_10001160 Ga0207671_100011603 291
236 3300025931 Ga0207644_10129395 Ga0207644_101293952 291
237 3300025981 Ga0207640_10041416 Ga0207640_100414162 291
238 3300026067 Ga0207678_10193672 Ga0207678_101936722 291
239 3300026142 Ga0207698_10019310 Ga0207698_100193102 291
240 3300027312 Ga0209371_1004328 Ga0209371_10043283 291
241 3300028379 Ga0268266_10173894 Ga0268266_101738942 291
242 3300030500 Ga0268256_1003966 Ga0268256_10039664 291
243 3300031901 Ga0307406_10009475 Ga0307406_100094754 291
244 3300032004 Ga0307414_10231532 Ga0307414_102315321 291
245 3300041498 Ga0451841_0975768 Ga0451841_0975768_418_1383 291
246 3300041501 Ga0451845_0189427 Ga0451845_0189427_1265_2230 291
247 3300041511 Ga0451855_0850854 Ga0451855_0850854_61_1026 291
248 3300046522 Ga0495643_0149540 Ga0495643_0149540_69_1034 291
249 3300046542 Ga0495597_0130276 Ga0495597_0130276_25_990 291
250 3300046558 Ga0495633_0005760 Ga0495633_0005760_5854_6819 291
251 3300046660 Ga0495625_0082577 Ga0495625_0082577_947_1912 291
252 3300046810 Ga0495660_0051547 Ga0495660_0051547_260_1195 291
253 3300048905 Ga0496102_0141483 Ga0496102_0141483_900_1835 291
254 3300048919 Ga0496116_0007217 Ga0496116_0007217_8012_8947 291
255 3300048919 Ga0496116_0104620 Ga0496116_0104620_548_1483 291
256 3300048921 Ga0496118_0008573 Ga0496118_0008573_9457_10392 291
257 3300048921 Ga0496118_0169496 Ga0496118_0169496_131_1066 291
258 3300048922 Ga0496119_0004655 Ga0496119_0004655_1924_2859 291
259 3300048923 Ga0496120_0001949 Ga0496120_0001949_9343_10278 291
260 3300048924 Ga0496121_0000239 Ga0496121_0000239_116584_117513 291
261 3300048924 Ga0496121_0002342 Ga0496121_0002342_9442_10377 291
262 3300048925 Ga0496122_0038214 Ga0496122_0038214_1822_2757 291
263 3300048925 Ga0496122_0048082 Ga0496122_0048082_828_1763 291
264 3300048925 Ga0496122_0102534 Ga0496122_0102534_80_1015 291
265 3300048926 Ga0496123_0088410 Ga0496123_0088410_863_1798 291
266 3300048926 Ga0496123_0125553 Ga0496123_0125553_357_1292 291
267 3300048927 Ga0496124_0003541 Ga0496124_0003541_16838_17773 291
268 3300048927 Ga0496124_0018541 Ga0496124_0018541_896_1831 291
269 3300048927 Ga0496124_0166198 Ga0496124_0166198_154_1089 291
270 3300048929 Ga0496126_0061199 Ga0496126_0061199_2231_3166 291
271 3300048929 Ga0496126_0068946 Ga0496126_0068946_1558_2493 291
272 3300049671 Ga0501238_003722 Ga0501238_003722_558_1511 291
273 3300050492 nmdc:mga0yw44_64092_c1 nmdc:mga0yw44_64092_c1_1063_1998 291
274 3300050493 nmdc:mga0k408_76185_c1 nmdc:mga0k408_76185_c1_569_1504 291
275 3300050516 nmdc:mga0sz30_27459_c1 nmdc:mga0sz30_27459_c1_241_1176 291
276 3300053134 Ga0500658_0001819 Ga0500658_0001819_781_1746 291
277 3300053158 Ga0500627_0145969 Ga0500627_0145969_14_979 291
278 3300015690 Ga0183363_1153 Ga0183363_11534 292
279 3300048922 Ga0496119_0056647 Ga0496119_0056647_362_1351 292
280 3300053157 Ga0500624_003077 Ga0500624_003077_750_1685 292
281 3300053161 Ga0500634_0010247 Ga0500634_0010247_1651_2586 292
282 3300047472 Ga0495686_0000795 Ga0495686_0000795_1867_2802 293
283 iso_pu_bacteria 2936367885 2936370189 294
284 3300049571 Ga0501034_0127468 Ga0501034_0127468_719_1642 295
285 3300003856 Ga0058692_1003232 Ga0058692_10032324 296
286 3300006178 Ga0075367_10209952 Ga0075367_102099522 296
287 3300006186 Ga0075369_10060762 Ga0075369_100607622 296
288 3300006195 Ga0075366_10003448 Ga0075366_100034484 296
289 3300006948 Ga0099826_10000181 Ga0099826_100001815 296
290 3300009148 Ga0105243_10032808 Ga0105243_100328082 296
291 3300013100 Ga0157373_10030840 Ga0157373_100308404 296
292 3300013102 Ga0157371_10000002 Ga0157371_10000002605 296
293 3300013104 Ga0157370_10001923 Ga0157370_100019234 296
294 3300025923 Ga0207681_10180050 Ga0207681_101800501 296
295 3300025935 Ga0207709_10036345 Ga0207709_100363453 296
296 3300027312 Ga0209371_1004841 Ga0209371_10048414 296
297 3300027312 Ga0209371_1012154 Ga0209371_10121542 296
298 3300027666 Ga0209282_1000176 Ga0209282_100017630 296
299 3300027866 Ga0209813_10003863 Ga0209813_100038633 296
300 3300028379 Ga0268266_10005342 Ga0268266_100053424 296
301 3300030500 Ga0268256_1003641 Ga0268256_10036413 296
302 3300030500 Ga0268256_1004619 Ga0268256_10046194 296
303 3300046616 Ga0495668_0084825 Ga0495668_0084825_34_963 296
304 3300047470 Ga0495681_0002695 Ga0495681_0002695_9786_10730 296
305 3300048919 Ga0496116_0019687 Ga0496116_0019687_1844_2788 296
306 3300048920 Ga0496117_0000036 Ga0496117_0000036_305112_306056 296
307 3300048921 Ga0496118_0015347 Ga0496118_0015347_4649_5593 296
308 3300048923 Ga0496120_0000777 Ga0496120_0000777_42975_43919 296
309 3300048925 Ga0496122_0000002 Ga0496122_0000002_575308_576252 296
310 3300048926 Ga0496123_0000002 Ga0496123_0000002_1235431_1236375 296
311 3300048926 Ga0496123_0000002 Ga0496123_0000002_575308_576252 296
312 3300048927 Ga0496124_0015678 Ga0496124_0015678_4634_5578 296
313 3300049776 Ga0501280_004682 Ga0501280_004682_369_1292 296
314 3300050490 nmdc:mga03n38_21958_c1 nmdc:mga03n38_21958_c1_612_1556 296
315 3300050491 nmdc:mga00v17_230_c1 nmdc:mga00v17_230_c1_2084_3028 296
316 3300050492 nmdc:mga0yw44_53094_c1 nmdc:mga0yw44_53094_c1_1423_2367 296
317 3300053107 Ga0500560_000282 Ga0500560_000282_4668_5612 296
318 3300053137 Ga0500561_0000110 Ga0500561_0000110_3941_4885 296
319 3300053157 Ga0500624_000296 Ga0500624_000296_10217_11161 296
320 3300053161 Ga0500634_0000796 Ga0500634_0000796_5607_6551 296
321 3300006038 Ga0075365_10102459 Ga0075365_101024592 297
322 3300048922 Ga0496119_0015192 Ga0496119_0015192_2901_3857 298
323 3300048924 Ga0496121_0149639 Ga0496121_0149639_136_1092 298
324 3300048925 Ga0496122_0055595 Ga0496122_0055595_874_1830 298
325 3300048926 Ga0496123_0022001 Ga0496123_0022001_163_1119 298
326 3300046459 Ga0495629_0040880 Ga0495629_0040880_2061_3023 299
327 3300046557 Ga0495622_0023211 Ga0495622_0023211_1752_2714 299
328 3300046642 Ga0495634_0083991 Ga0495634_0083991_794_1756 299
329 3300047317 Ga0495604_0021553 Ga0495604_0021553_871_1833 299
330 3300048088 Ga0495602_0233377 Ga0495602_0233377_237_1199 299
331 3300053148 Ga0500590_000792 Ga0500590_000792_10020_10982 299
332 iso_pu_bacteria 2917554339 2917556393 299
333 3300031616 Ga0307508_10081823 Ga0307508_100818233 300
334 3300046660 Ga0495625_0045083 Ga0495625_0045083_1862_2797 300
335 iso_pu_bacteria 2599185156 2599334021 300
336 iso_pu_bacteria 2791355253 2793281229 300
337 iso_pu_bacteria 2842922631 2842925699 300
338 iso_pu_bacteria 2909042592 2909043880 300
339 iso_pu_bacteria 2671180139 2671693576 301
340 iso_pu_bacteria 2738541317 2738944976 301
341 iso_pu_bacteria 2818991272 2819244925 301
342 iso_pu_bacteria 2913308742 2913309601 301
343 iso_pu_bacteria 2915650412 2915651049 301
344 iso_pu_bacteria 2989349275 2989352530 301
345 iso_pu_bacteria 2989771324 2989773982 301
346 iso_pu_bacteria 2989776772 2989780770 301
347 iso_pu_bacteria 3003930520 3003935538 301
348 iso_pu_bacteria 8005246636 8005250598 301
349 iso_pu_bacteria 8054558443 8054560446 301
350 3300009551 Ga0105238_10586861 Ga0105238_105868611 302
351 3300025297 Ga0209758_1030212 Ga0209758_10302121 302
352 3300028794 Ga0307515_10003918 Ga0307515_1000391819 302
353 3300041413 Ga0439465_0011745 Ga0439465_0011745_467_1405 302
354 3300042531 Ga0450918_013129 Ga0450918_013129_134_1072 302
355 iso_pu_bacteria 2508501050 2508733345 302
356 iso_pu_bacteria 2510917022 2511135647 302
357 iso_pu_bacteria 2582581307 2585272722 302
358 iso_pu_bacteria 2585427531 2585562390 302
359 iso_pu_bacteria 2585427608 2585896830 302
360 iso_pu_bacteria 2585427609 2585906443 302
361 iso_pu_bacteria 2585428125 2587981865 302
362 iso_pu_bacteria 2773857925 2774872486 302
363 iso_pu_bacteria 2854896431 2854899984 302
364 iso_pu_bacteria 2876601092 2876604990 302
365 iso_pu_bacteria 2882456835 2882460009 302
366 iso_pu_bacteria 2894232714 2894236835 302
367 iso_pu_bacteria 2939602548 2939605382 302
368 iso_pu_bacteria 8016733728 8016738590 302
369 iso_pu_bacteria 8019499862 8019500237 302
370 iso_pu_bacteria 2511231035 2511435637 303
371 iso_pu_bacteria 2585427591 2585829463 303
372 iso_pu_bacteria 2585427592 2585834828 303
373 iso_pu_bacteria 2667528173 2671109942 303
374 iso_pu_bacteria 2904474040 2904477226 303
375 iso_pu_bacteria 2919150387 2919153393 303
376 iso_pu_bacteria 2927143783 2927144019 303
377 3300006186 Ga0075369_10035944 Ga0075369_100359443 304
378 3300049571 Ga0501034_0001016 Ga0501034_0001016_9982_10914 304
379 iso_pu_bacteria 2508501122 2509107965 304
380 iso_pu_bacteria 2509276019 2509376859 304
381 iso_pu_bacteria 2513237146 2513929074 304
382 iso_pu_bacteria 2523231067 2523468243 304
383 iso_pu_bacteria 2537561587 2537877751 304
384 iso_pu_bacteria 2554235003 2554245786 304
385 iso_pu_bacteria 2558860100 2558865783 304
386 iso_pu_bacteria 2558860242 2559296447 304
387 iso_pu_bacteria 2599185170 2599414713 304
388 iso_pu_bacteria 2599185210 2599603065 304
389 iso_pu_bacteria 2600255279 2601610682 304
390 iso_pu_bacteria 2600255308 2601746988 304
391 iso_pu_bacteria 2617270742 2617382882 304
392 iso_pu_bacteria 2643221568 2643857038 304
393 iso_pu_bacteria 2643221582 2643922191 304
394 iso_pu_bacteria 2643221618 2644105547 304
395 iso_pu_bacteria 2643221626 2644146550 304
396 iso_pu_bacteria 2643221637 2644210825 304
397 iso_pu_bacteria 2643221655 2644308298 304
398 iso_pu_bacteria 2643221659 2644334125 304
399 iso_pu_bacteria 2643221693 2644520573 304
400 iso_pu_bacteria 2643221698 2644541719 304
401 iso_pu_bacteria 2643221712 2644615580 304
402 iso_pu_bacteria 2643221718 2644654359 304
403 iso_pu_bacteria 2775507266 2778175157 304
404 iso_pu_bacteria 2808606387 2808990161 304
405 iso_pu_bacteria 2838035591 2838039568 304
406 iso_pu_bacteria 2838661181 2838667955 304
407 iso_pu_bacteria 2838714209 2838717397 304
408 iso_pu_bacteria 2841846520 2841850708 304
409 iso_pu_bacteria 2841859092 2841864184 304
410 iso_pu_bacteria 2842124991 2842129513 304
411 iso_pu_bacteria 2842482326 2842487523 304
412 iso_pu_bacteria 2842515876 2842521069 304
413 iso_pu_bacteria 2844163670 2844166463 304
414 iso_pu_bacteria 2850079185 2850081863 304
415 iso_pu_bacteria 2889790730 2889790743 304
416 iso_pu_bacteria 2889914905 2889915127 304
417 iso_pu_bacteria 2894817345 2894821316 304
418 iso_pu_bacteria 2899792073 2899793444 304
419 iso_pu_bacteria 2899845264 2899847645 304
420 iso_pu_bacteria 2919114240 2919119150 304
421 iso_pu_bacteria 2919166419 2919170184 304
422 iso_pu_bacteria 2926754445 2926759179 304
423 iso_pu_bacteria 2926760298 2926763395 304
424 iso_pu_bacteria 2933006813 2933010032 304
425 iso_pu_bacteria 2933011516 2933011519 304
426 iso_pu_bacteria 2933016740 2933017613 304
427 iso_pu_bacteria 2933594066 2933595993 304
428 iso_pu_bacteria 2939669807 2939673711 304
429 iso_pu_bacteria 2941499720 2941504508 304
430 iso_pu_bacteria 2978969890 2978970188 304
431 iso_pu_bacteria 2979089926 2979091572 304
432 iso_pu_bacteria 2979095461 2979097093 304
433 iso_pu_bacteria 2984587000 2984587215 304
434 iso_pu_bacteria 3005409236 3005416288 304
435 iso_pu_bacteria 650716007 650842844 304
436 iso_pu_bacteria 8003570095 8003574442 304
437 3300006847 Ga0075431_100414289 Ga0075431_1004142892 305
438 3300031711 Ga0265314_10018857 Ga0265314_100188574 305
439 3300035171 Ga0373946_0073534 Ga0373946_0073534_333_1256 305
440 3300035695 Ga0373927_0000266 Ga0373927_0000266_1833_2756 305
441 3300037068 Ga0373925_0001672 Ga0373925_0001672_13287_14210 305
442 3300050510 nmdc:mga06r32_399024_c1 nmdc:mga06r32_399024_c1_317_1240 305
443 iso_pu_bacteria 2508501127 2509141455 305
444 iso_pu_bacteria 2509276021 2509385492 305
445 iso_pu_bacteria 2509276033 2509448467 305
446 iso_pu_bacteria 2510065019 2510136502 305
447 iso_pu_bacteria 2510065057 2510304150 305
448 iso_pu_bacteria 2510917028 2511184342 305
449 iso_pu_bacteria 2510917030 2511197551 305
450 iso_pu_bacteria 2511231052 2511502587 305
451 iso_pu_bacteria 2512047086 2512533956 305
452 iso_pu_bacteria 2512875026 2512970285 305
453 iso_pu_bacteria 2513237084 2513569647 305
454 iso_pu_bacteria 2513237086 2513583218 305
455 iso_pu_bacteria 2513237088 2513595061 305
456 iso_pu_bacteria 2513237089 2513601349 305
457 iso_pu_bacteria 2513237091 2513620916 305
458 iso_pu_bacteria 2513237103 2513709793 305
459 iso_pu_bacteria 2513237138 2513871327 305
460 iso_pu_bacteria 2513237140 2513881730 305
461 iso_pu_bacteria 2513237143 2513904874 305
462 iso_pu_bacteria 2513237144 2513911557 305
463 iso_pu_bacteria 2513237156 2513986638 305
464 iso_pu_bacteria 2513237160 2514003204 305
465 iso_pu_bacteria 2515154107 2515609370 305
466 iso_pu_bacteria 2515154116 2515658451 305
467 iso_pu_bacteria 2516143018 2516205992 305
468 iso_pu_bacteria 2516653046 2516893963 305
469 iso_pu_bacteria 2516653077 2517041926 305
470 iso_pu_bacteria 2516653085 2517081043 305
471 iso_pu_bacteria 2517287029 2517410835 305
472 iso_pu_bacteria 2517487022 2517570677 305
473 iso_pu_bacteria 2519899620 2520380738 305
474 iso_pu_bacteria 2524023207 2524448217 305
475 iso_pu_bacteria 2524023209 2524457343 305
476 iso_pu_bacteria 2529292951 2530644494 305
477 iso_pu_bacteria 2534681796 2535520001 305
478 iso_pu_bacteria 2551306084 2551675352 305
479 iso_pu_bacteria 2551306084 2551676762 305
480 iso_pu_bacteria 2551306085 2551689364 305
481 iso_pu_bacteria 2551306086 2551695506 305
482 iso_pu_bacteria 2551306087 2551700997 305
483 iso_pu_bacteria 2551306089 2551711111 305
484 iso_pu_bacteria 2551306090 2551722008 305
485 iso_pu_bacteria 2551306091 2551724379 305
486 iso_pu_bacteria 2551306092 2551736475 305
487 iso_pu_bacteria 2551306093 2551739981 305
488 iso_pu_bacteria 2582581294 2585202768 305
489 iso_pu_bacteria 2582581298 2585221617 305
490 iso_pu_bacteria 2582581299 2585233304 305
491 iso_pu_bacteria 2582581304 2585255304 305
492 iso_pu_bacteria 2582581306 2585270228 305
493 iso_pu_bacteria 2582581308 2585281238 305
494 iso_pu_bacteria 2582581315 2585327346 305
495 iso_pu_bacteria 2582581316 2585335302 305
496 iso_pu_bacteria 2582581865 2585390450 305
497 iso_pu_bacteria 2582581867 2585401687 305
498 iso_pu_bacteria 2585427527 2585536101 305
499 iso_pu_bacteria 2585427528 2585539211 305
500 iso_pu_bacteria 2585427529 2585544213 305
501 iso_pu_bacteria 2585427530 2585557412 305
502 iso_pu_bacteria 2585427590 2585821382 305
503 iso_pu_bacteria 2585427593 2585837164 305
504 iso_pu_bacteria 2585427594 2585842472 305
505 iso_pu_bacteria 2597489875 2597815000 305
506 iso_pu_bacteria 2599185236 2599717817 305
507 iso_pu_bacteria 2599185352 2600196890 305
508 iso_pu_bacteria 2615840624 2616295199 305
509 iso_pu_bacteria 2615840626 2616310960 305
510 iso_pu_bacteria 2615840698 2616551886 305
511 iso_pu_bacteria 2643221557 2643804483 305
512 iso_pu_bacteria 2643221599 2644003365 305
513 iso_pu_bacteria 2643221610 2644065254 305
514 iso_pu_bacteria 2643221634 2644194444 305
515 iso_pu_bacteria 2643221643 2644240820 305
516 iso_pu_bacteria 2643221668 2644377663 305
517 iso_pu_bacteria 2643221675 2644418140 305
518 iso_pu_bacteria 2643221680 2644451396 305
519 iso_pu_bacteria 2643221723 2644672680 305
520 iso_pu_bacteria 2643221726 2644691624 305
521 iso_pu_bacteria 2667528174 2671116757 305
522 iso_pu_bacteria 2690316117 2692315092 305
523 iso_pu_bacteria 2718217882 2719183760 305
524 iso_pu_bacteria 2718217997 2719668059 305
525 iso_pu_bacteria 2718218009 2719728201 305
526 iso_pu_bacteria 2718218199 2720494822 305
527 iso_pu_bacteria 2718218232 2720611144 305
528 iso_pu_bacteria 2718218233 2720616316 305
529 iso_pu_bacteria 2718218235 2720629391 305
530 iso_pu_bacteria 2718218269 2720771962 305
531 iso_pu_bacteria 2718218363 2721145062 305
532 iso_pu_bacteria 2718218365 2721155799 305
533 iso_pu_bacteria 2718218366 2721167149 305
534 iso_pu_bacteria 2721755514 2722838127 305
535 iso_pu_bacteria 2721755556 2723029392 305
536 iso_pu_bacteria 2721755684 2723563008 305
537 iso_pu_bacteria 2721755685 2723570989 305
538 iso_pu_bacteria 2721755810 2724042395 305
539 iso_pu_bacteria 2721755819 2724086782 305
540 iso_pu_bacteria 2721755822 2724106940 305
541 iso_pu_bacteria 2721755823 2724107749 305
542 iso_pu_bacteria 2728369352 2730105706 305
543 iso_pu_bacteria 2728369365 2730161900 305
544 iso_pu_bacteria 2728369397 2730300906 305
545 iso_pu_bacteria 2738541293 2738802542 305
546 iso_pu_bacteria 2738541333 2739033658 305
547 iso_pu_bacteria 2751185821 2753463268 305
548 iso_pu_bacteria 2765235942 2766068381 305
549 iso_pu_bacteria 2791355082 2792581603 305
550 iso_pu_bacteria 2791355091 2792620399 305
551 iso_pu_bacteria 2791355092 2792625757 305
552 iso_pu_bacteria 2791355094 2792641828 305
553 iso_pu_bacteria 2791355256 2793296423 305
554 iso_pu_bacteria 2791355259 2793317211 305
555 iso_pu_bacteria 2791355260 2793324055 305
556 iso_pu_bacteria 2791355261 2793325641 305
557 iso_pu_bacteria 2791355262 2793333064 305
558 iso_pu_bacteria 2791355263 2793340131 305
559 iso_pu_bacteria 2791355264 2793346236 305
560 iso_pu_bacteria 2791355265 2793355456 305
561 iso_pu_bacteria 2791355266 2793357803 305
562 iso_pu_bacteria 2791355267 2793366541 305
563 iso_pu_bacteria 2802428858 2802716642 305
564 iso_pu_bacteria 2802428859 2802725453 305
565 iso_pu_bacteria 2802428860 2802730455 305
566 iso_pu_bacteria 2802428861 2802737573 305
567 iso_pu_bacteria 2802428862 2802743037 305
568 iso_pu_bacteria 2802428863 2802750461 305
569 iso_pu_bacteria 2802429605 2805929050 305
570 iso_pu_bacteria 2802429606 2805937248 305
571 iso_pu_bacteria 2802429633 2806044843 305
572 iso_pu_bacteria 2802429634 2806053997 305
573 iso_pu_bacteria 2802429635 2806059911 305
574 iso_pu_bacteria 2802429636 2806066036 305
575 iso_pu_bacteria 2802429637 2806073382 305
576 iso_pu_bacteria 2818991448 2819607524 305
577 iso_pu_bacteria 2818991453 2819643923 305
578 iso_pu_bacteria 2821123053 2821126608 305
579 iso_pu_bacteria 2838016132 2838019454 305
580 iso_pu_bacteria 2838022645 2838025080 305
581 iso_pu_bacteria 2838029111 2838032023 305
582 iso_pu_bacteria 2838042994 2838045956 305
583 iso_pu_bacteria 2838048938 2838050560 305
584 iso_pu_bacteria 2838061910 2838062854 305
585 iso_pu_bacteria 2838068647 2838071802 305
586 iso_pu_bacteria 2838074704 2838080551 305
587 iso_pu_bacteria 2838668709 2838671488 305
588 iso_pu_bacteria 2838680041 2838684409 305
589 iso_pu_bacteria 2838686498 2838693561 305
590 iso_pu_bacteria 2838694306 2838699900 305
591 iso_pu_bacteria 2838701080 2838704245 305
592 iso_pu_bacteria 2838707686 2838711815 305
593 iso_pu_bacteria 2838729681 2838735454 305
594 iso_pu_bacteria 2838736955 2838739990 305
595 iso_pu_bacteria 2838742623 2838748356 305
596 iso_pu_bacteria 2841734538 2841741109 305
597 iso_pu_bacteria 2841840854 2841843886 305
598 iso_pu_bacteria 2841851746 2841858420 305
599 iso_pu_bacteria 2841864319 2841869755 305
600 iso_pu_bacteria 2842077413 2842081876 305
601 iso_pu_bacteria 2842110456 2842117608 305
602 iso_pu_bacteria 2842118031 2842122452 305
603 iso_pu_bacteria 2842140634 2842143607 305
604 iso_pu_bacteria 2842146304 2842149137 305
605 iso_pu_bacteria 2842156927 2842162668 305
606 iso_pu_bacteria 2842163707 2842167039 305
607 iso_pu_bacteria 2842180545 2842186172 305
608 iso_pu_bacteria 2842192696 2842195255 305
609 iso_pu_bacteria 2842198810 2842203280 305
610 iso_pu_bacteria 2842205361 2842210271 305
611 iso_pu_bacteria 2842217011 2842222261 305
612 iso_pu_bacteria 2842229732 2842236047 305
613 iso_pu_bacteria 2842237096 2842241227 305
614 iso_pu_bacteria 2842243621 2842249978 305
615 iso_pu_bacteria 2842250916 2842253696 305
616 iso_pu_bacteria 2842257432 2842263274 305
617 iso_pu_bacteria 2842264693 2842268005 305
618 iso_pu_bacteria 2842271015 2842278030 305
619 iso_pu_bacteria 2842278818 2842283725 305
620 iso_pu_bacteria 2842285085 2842289698 305
621 iso_pu_bacteria 2842291075 2842295531 305
622 iso_pu_bacteria 2842298080 2842299101 305
623 iso_pu_bacteria 2842304105 2842310048 305
624 iso_pu_bacteria 2842311132 2842311774 305
625 iso_pu_bacteria 2842317721 2842318997 305
626 iso_pu_bacteria 2842341865 2842343993 305
627 iso_pu_bacteria 2842357229 2842358567 305
628 iso_pu_bacteria 2842363717 2842369695 305
629 iso_pu_bacteria 2842370503 2842376677 305
630 iso_pu_bacteria 2842377471 2842381693 305
631 iso_pu_bacteria 2842384541 2842389000 305
632 iso_pu_bacteria 2842395702 2842396354 305
633 iso_pu_bacteria 2842402390 2842407161 305
634 iso_pu_bacteria 2842409023 2842414053 305
635 iso_pu_bacteria 2842415677 2842420694 305
636 iso_pu_bacteria 2842422224 2842425435 305
637 iso_pu_bacteria 2842428310 2842432168 305
638 iso_pu_bacteria 2842434925 2842438280 305
639 iso_pu_bacteria 2842441272 2842443976 305
640 iso_pu_bacteria 2842447887 2842450152 305
641 iso_pu_bacteria 2842462802 2842466266 305
642 iso_pu_bacteria 2842469257 2842472750 305
643 iso_pu_bacteria 2842475841 2842478755 305
644 iso_pu_bacteria 2842489311 2842491447 305
645 iso_pu_bacteria 2842495871 2842499515 305
646 iso_pu_bacteria 2842502639 2842505926 305
647 iso_pu_bacteria 2842509118 2842511960 305
648 iso_pu_bacteria 2844454524 2844461107 305
649 iso_pu_bacteria 2847417321 2847419847 305
650 iso_pu_bacteria 2848992105 2848994864 305
651 iso_pu_bacteria 2852387548 2852394990 305
652 iso_pu_bacteria 2854916844 2854921103 305
653 iso_pu_bacteria 2855825444 2855826684 305
654 iso_pu_bacteria 2855839649 2855842077 305
655 iso_pu_bacteria 2855872281 2855877363 305
656 iso_pu_bacteria 2856342000 2856346835 305
657 iso_pu_bacteria 2857516855 2857519182 305
658 iso_pu_bacteria 2857531043 2857536700 305
659 iso_pu_bacteria 2858800743 2858802752 305
660 iso_pu_bacteria 2871474448 2871478496 305
661 iso_pu_bacteria 2885312484 2885316412 305
662 iso_pu_bacteria 2888343758 2888348475 305
663 iso_pu_bacteria 2896384573 2896391297 305
664 iso_pu_bacteria 2913295892 2913301711 305
665 iso_pu_bacteria 2915980308 2915981221 305
666 iso_pu_bacteria 2915986958 2915992232 305
667 iso_pu_bacteria 2915993759 2915998592 305
668 iso_pu_bacteria 2916000859 2916005668 305
669 iso_pu_bacteria 2916007675 2916013522 305
670 iso_pu_bacteria 2916014648 2916021439 305
671 iso_pu_bacteria 2916021584 2916026841 305
672 iso_pu_bacteria 2916028427 2916033035 305
673 iso_pu_bacteria 2916035215 2916039280 305
674 iso_pu_bacteria 2916041962 2916046501 305
675 iso_pu_bacteria 2916048683 2916050503 305
676 iso_pu_bacteria 2916055098 2916055952 305
677 iso_pu_bacteria 2916061851 2916062082 305
678 iso_pu_bacteria 2916068649 2916070756 305
679 iso_pu_bacteria 2916076590 2916082654 305
680 iso_pu_bacteria 2919100787 2919103462 305
681 iso_pu_bacteria 2919408235 2919413119 305
682 iso_pu_bacteria 2920760137 2920761100 305
683 iso_pu_bacteria 2920822456 2920825721 305
684 iso_pu_bacteria 2921201388 2921204233 305
685 iso_pu_bacteria 2921208531 2921210304 305
686 iso_pu_bacteria 2921237296 2921239340 305
687 iso_pu_bacteria 2921244191 2921249950 305
688 iso_pu_bacteria 2921250672 2921251727 305
689 iso_pu_bacteria 2921257292 2921258883 305
690 iso_pu_bacteria 2921263974 2921270255 305
691 iso_pu_bacteria 2921282425 2921287216 305
692 iso_pu_bacteria 2921289301 2921292026 305
693 iso_pu_bacteria 2921296804 2921302384 305
694 iso_pu_bacteria 2923556063 2923556727 305
695 iso_pu_bacteria 2924144063 2924144923 305
696 iso_pu_bacteria 2924150972 2924156116 305
697 iso_pu_bacteria 2924158325 2924159967 305
698 iso_pu_bacteria 2924165586 2924169481 305
699 iso_pu_bacteria 2924172951 2924173546 305
700 iso_pu_bacteria 2924179722 2924183368 305
701 iso_pu_bacteria 2924186466 2924193171 305
702 iso_pu_bacteria 2924193448 2924195094 305
703 iso_pu_bacteria 2924200457 2924201594 305
704 iso_pu_bacteria 2924207177 2924208207 305
705 iso_pu_bacteria 2924214083 2924216931 305
706 iso_pu_bacteria 2924221636 2924227451 305
707 iso_pu_bacteria 2924228884 2924235220 305
708 iso_pu_bacteria 2924754689 2924756722 305
709 iso_pu_bacteria 2929138655 2929138669 305
710 iso_pu_bacteria 2933570622 2933576489 305
711 iso_pu_bacteria 2933586486 2933591784 305
712 iso_pu_bacteria 2933599457 2933602597 305
713 iso_pu_bacteria 2935894831 2935898251 305
714 iso_pu_bacteria 2936375103 2936377861 305
715 iso_pu_bacteria 2936381700 2936384151 305
716 iso_pu_bacteria 2936996657 2937001223 305
717 iso_pu_bacteria 2937002841 2937003933 305
718 iso_pu_bacteria 2937009748 2937010757 305
719 iso_pu_bacteria 2937016420 2937021796 305
720 iso_pu_bacteria 2937023124 2937027410 305
721 iso_pu_bacteria 2937029754 2937035709 305
722 iso_pu_bacteria 2937036028 2937039372 305
723 iso_pu_bacteria 2937042894 2937042929 305
724 iso_pu_bacteria 2937049772 2937050360 305
725 iso_pu_bacteria 2937056579 2937062851 305
726 iso_pu_bacteria 2937063883 2937064568 305
727 iso_pu_bacteria 2937071275 2937073261 305
728 iso_pu_bacteria 2937078374 2937080771 305
729 iso_pu_bacteria 2937084907 2937085375 305
730 iso_pu_bacteria 2937091812 2937098125 305
731 iso_pu_bacteria 2937098957 2937105569 305
732 iso_pu_bacteria 2937106411 2937110905 305
733 iso_pu_bacteria 2937113482 2937117605 305
734 iso_pu_bacteria 2937119839 2937124436 305
735 iso_pu_bacteria 2937126314 2937131494 305
736 iso_pu_bacteria 2937836603 2937840484 305
737 iso_pu_bacteria 2957375807 2957380616 305
738 iso_pu_bacteria 2957382221 2957382592 305
739 iso_pu_bacteria 2957388812 2957389430 305
740 iso_pu_bacteria 2957395598 2957401972 305
741 iso_pu_bacteria 2957402308 2957408394 305
742 iso_pu_bacteria 2957408893 2957410151 305
743 iso_pu_bacteria 2957415311 2957420040 305
744 iso_pu_bacteria 2957422303 2957424792 305
745 iso_pu_bacteria 2957430029 2957433655 305
746 iso_pu_bacteria 2957437181 2957437526 305
747 iso_pu_bacteria 2957443900 2957450646 305
748 iso_pu_bacteria 2957450854 2957452241 305
749 iso_pu_bacteria 2957457609 2957462657 305
750 iso_pu_bacteria 2957464669 2957465612 305
751 iso_pu_bacteria 2957471148 2957475714 305
752 iso_pu_bacteria 2957478035 2957478982 305
753 iso_pu_bacteria 2957484790 2957488883 305
754 iso_pu_bacteria 2957491536 2957497916 305
755 iso_pu_bacteria 2957498199 2957501766 305
756 iso_pu_bacteria 2957505466 2957509919 305
757 iso_pu_bacteria 2958071322 2958071391 305
758 iso_pu_bacteria 2960584000 2960590584 305
759 iso_pu_bacteria 2960591022 2960591884 305
760 iso_pu_bacteria 2960597568 2960602032 305
761 iso_pu_bacteria 2960603979 2960607909 305
762 iso_pu_bacteria 2960610863 2960614791 305
763 iso_pu_bacteria 2960617483 2960618072 305
764 iso_pu_bacteria 2960624210 2960630025 305
765 iso_pu_bacteria 2960631154 2960633905 305
766 iso_pu_bacteria 2960637947 2960642602 305
767 iso_pu_bacteria 2960645483 2960651187 305
768 iso_pu_bacteria 2960652885 2960659470 305
769 iso_pu_bacteria 2960660292 2960667201 305
770 iso_pu_bacteria 2960667422 2960669931 305
771 iso_pu_bacteria 2960674078 2960675288 305
772 iso_pu_bacteria 2960680706 2960680730 305
773 iso_pu_bacteria 2960687367 2960688670 305
774 iso_pu_bacteria 2960693952 2960696513 305
775 iso_pu_bacteria 2964607997 2964614880 305
776 iso_pu_bacteria 2964615318 2964617100 305
777 iso_pu_bacteria 2964621998 2964627195 305
778 iso_pu_bacteria 2964628898 2964630390 305
779 iso_pu_bacteria 2964636051 2964637709 305
780 iso_pu_bacteria 2964643177 2964646324 305
781 iso_pu_bacteria 2964649959 2964651174 305
782 iso_pu_bacteria 2964656573 2964663288 305
783 iso_pu_bacteria 2964663802 2964666284 305
784 iso_pu_bacteria 2964670856 2964672665 305
785 iso_pu_bacteria 2964678106 2964682452 305
786 iso_pu_bacteria 2964685014 2964689376 305
787 iso_pu_bacteria 2964691889 2964693916 305
788 iso_pu_bacteria 2964698721 2964704778 305
789 iso_pu_bacteria 2964705432 2964706425 305
790 iso_pu_bacteria 2964712639 2964716460 305
791 iso_pu_bacteria 2964719344 2964725739 305
792 iso_pu_bacteria 2967664464 2967668424 305
793 iso_pu_bacteria 2967671571 2967676208 305
794 iso_pu_bacteria 2967678726 2967685897 305
795 iso_pu_bacteria 2967686174 2967691002 305
796 iso_pu_bacteria 2967693043 2967698985 305
797 iso_pu_bacteria 2967699805 2967704341 305
798 iso_pu_bacteria 2967706974 2967711602 305
799 iso_pu_bacteria 2967714385 2967720460 305
800 iso_pu_bacteria 2967721400 2967724395 305
801 iso_pu_bacteria 2967728569 2967730998 305
802 iso_pu_bacteria 2967735183 2967739937 305
803 iso_pu_bacteria 2967742019 2967744522 305
804 iso_pu_bacteria 2967748971 2967749381 305
805 iso_pu_bacteria 2967755722 2967759581 305
806 iso_pu_bacteria 2967762386 2967767207 305
807 iso_pu_bacteria 2967769361 2967770501 305
808 iso_pu_bacteria 2967775926 2967782432 305
809 iso_pu_bacteria 2970019648 2970025758 305
810 iso_pu_bacteria 2970026789 2970027510 305
811 iso_pu_bacteria 2970033650 2970036057 305
812 iso_pu_bacteria 2970040964 2970046116 305
813 iso_pu_bacteria 2970047711 2970048397 305
814 iso_pu_bacteria 2970054988 2970057259 305
815 iso_pu_bacteria 2970061556 2970064735 305
816 iso_pu_bacteria 2970068827 2970071066 305
817 iso_pu_bacteria 2970076120 2970082492 305
818 iso_pu_bacteria 2970082768 2970083633 305
819 iso_pu_bacteria 2970088815 2970094198 305
820 iso_pu_bacteria 2970095765 2970102145 305
821 iso_pu_bacteria 2970102677 2970104444 305
822 iso_pu_bacteria 2970109326 2970115034 305
823 iso_pu_bacteria 2970116247 2970120632 305
824 iso_pu_bacteria 2970122695 2970123418 305
825 iso_pu_bacteria 2970129317 2970135924 305
826 iso_pu_bacteria 2970136068 2970140851 305
827 iso_pu_bacteria 2970143518 2970144805 305
828 iso_pu_bacteria 2970149975 2970154925 305
829 iso_pu_bacteria 2970156795 2970161341 305
830 iso_pu_bacteria 2970164137 2970168348 305
831 iso_pu_bacteria 2970170962 2970173879 305
832 iso_pu_bacteria 2970177841 2970181034 305
833 iso_pu_bacteria 2970184632 2970184971 305
834 iso_pu_bacteria 2970191845 2970196076 305
835 iso_pu_bacteria 2970524798 2970529722 305
836 iso_pu_bacteria 2970540015 2970545326 305
837 iso_pu_bacteria 2977516862 2977519384 305
838 iso_pu_bacteria 2977523885 2977530475 305
839 iso_pu_bacteria 2977530762 2977536320 305
840 iso_pu_bacteria 2977537788 2977543264 305
841 iso_pu_bacteria 2977544691 2977546457 305
842 iso_pu_bacteria 2977551784 2977553098 305
843 iso_pu_bacteria 2977558990 2977565218 305
844 iso_pu_bacteria 2977565890 2977567021 305
845 iso_pu_bacteria 2977572785 2977574371 305
846 iso_pu_bacteria 2977579622 2977585873 305
847 iso_pu_bacteria 2996887358 2996888651 305
848 iso_pu_bacteria 2996893221 2996896962 305
849 iso_pu_bacteria 3005416602 3005421942 305
850 iso_pu_bacteria 3005445848 3005451459 305
851 iso_pu_bacteria 3005452660 3005456760 305
852 iso_pu_bacteria 639633055 639651714 305
853 iso_pu_bacteria 643692032 643826743 305
854 iso_pu_bacteria 648276728 648738781 305
855 iso_pu_bacteria 8003992118 8003994520 305
856 iso_pu_bacteria 8003999396 8004002215 305
857 iso_pu_bacteria 8004395343 8004395864 305
858 iso_pu_bacteria 8004633249 8004633319 305
859 iso_pu_bacteria 8005258706 8005264417 305
860 iso_pu_bacteria 8005282627 8005287842 305
861 iso_pu_bacteria 8005301065 8005305026 305
862 iso_pu_bacteria 8005314921 8005321224 305
863 iso_pu_bacteria 8005321885 8005323178 305
864 iso_pu_bacteria 8005382845 8005388480 305
865 iso_pu_bacteria 8005395548 8005397646 305
866 iso_pu_bacteria 8005430974 8005436997 305
867 iso_pu_bacteria 8005484373 8005490035 305
868 iso_pu_bacteria 8005497431 8005503071 305
869 iso_pu_bacteria 8005542996 8005547731 305
870 iso_pu_bacteria 8005556819 8005562112 305
871 iso_pu_bacteria 8005563573 8005567132 305
872 iso_pu_bacteria 8005570704 8005576297 305
873 iso_pu_bacteria 8005619151 8005625590 305
874 iso_pu_bacteria 8005626139 8005630613 305
875 iso_pu_bacteria 8005645114 8005650911 305
876 iso_pu_bacteria 8005668836 8005674989 305
877 iso_pu_bacteria 8005682033 8005688171 305
878 iso_pu_bacteria 8005688590 8005689430 305
879 iso_pu_bacteria 8018127388 8018130456 305
880 iso_pu_bacteria 8018176218 8018182229 305
881 iso_pu_bacteria 8023680758 8023682366 305
882 iso_pu_bacteria 8024479707 8024484154 305
883 iso_pu_bacteria 8024486573 8024492854 305
884 iso_pu_bacteria 8024501048 8024505580 305
885 iso_pu_bacteria 8046767195 8046773916 305
886 iso_pu_bacteria 8049293176 8049295687 305
887 iso_pu_bacteria 8055617313 8055622684 305
888 iso_pu_bacteria 8056375014 8056375188 305
889 iso_pu_bacteria 8056382006 8056383515 305
890 iso_pu_bacteria 8057575449 8057576257 305
891 iso_pu_bacteria 8057874678 8057878336 305
892 3300003856 Ga0058692_1008266 Ga0058692_10082662 306
893 3300005262 Ga0065165_1006135 Ga0065165_10061351 306
894 3300009036 Ga0105244_10014154 Ga0105244_100141542 306
895 3300013100 Ga0157373_10004331 Ga0157373_1000433111 306
896 3300013102 Ga0157371_10001454 Ga0157371_1000145429 306
897 3300021327 Ga0214543_1001578 Ga0214543_100157838 306
898 3300025711 Ga0207696_1000076 Ga0207696_100007699 306
899 3300027312 Ga0209371_1004561 Ga0209371_10045612 306
900 3300030500 Ga0268256_1015885 Ga0268256_10158852 306
901 3300041413 Ga0439465_0018667 Ga0439465_0018667_1175_2101 306
902 3300048919 Ga0496116_0009455 Ga0496116_0009455_3874_4794 306
903 3300048920 Ga0496117_0019866 Ga0496117_0019866_3613_4533 306
904 3300048923 Ga0496120_0001086 Ga0496120_0001086_6996_7916 306
905 3300048924 Ga0496121_0089900 Ga0496121_0089900_805_1737 306
906 3300048925 Ga0496122_0006562 Ga0496122_0006562_2839_3759 306
907 3300048926 Ga0496123_0019603 Ga0496123_0019603_1952_2872 306
908 3300048927 Ga0496124_0183488 Ga0496124_0183488_147_1079 306
909 3300048929 Ga0496126_0066054 Ga0496126_0066054_1756_2688 306
910 3300050491 nmdc:mga00v17_24964_c1 nmdc:mga00v17_24964_c1_607_1527 306
911 3300053136 Ga0500559_0058507 Ga0500559_0058507_112_1044 306
912 iso_pu_bacteria 2510461069 2510839080 306
913 iso_pu_bacteria 2513237159 2513999226 306
914 iso_pu_bacteria 2582581866 2585395811 306
915 iso_pu_bacteria 2643221688 2644494937 306
916 iso_pu_bacteria 2842521101 2842524973 306
917 iso_pu_bacteria 8018163183 8018165903 306
918 2162886007 SwRhRL2b_contig_999527 SwRhRL2b_0261.00003910 307
919 3300002737 JGI25162J39368_1000009 JGI25162J39368_1000009211 307
920 3300002771 JGI25163J39215_1000765 JGI25163J39215_10007655 307
921 3300002772 JGI25164J39214_1000002 JGI25164J39214_1000002136 307
922 3300002987 JGI25159J45721_1000008 JGI25159J45721_100000814 307
923 3300003187 JGI25151J46595_10023743 JGI25151J46595_100237432 307
924 3300003323 rootH1_10002325 rootH1_100023252 307
925 3300003354 JGI25160J50197_1000033 JGI25160J50197_1000033162 307
926 3300003374 JGI25161J50226_1000508 JGI25161J50226_10005084 307
927 3300003751 Ga0055538_1000015 Ga0055538_1000015135 307
928 3300003752 Ga0055539_1000009 Ga0055539_1000009226 307
929 3300003756 Ga0055533_1000012 Ga0055533_1000012135 307
930 3300003759 Ga0055525_1000014 Ga0055525_1000014226 307
931 3300003771 Ga0055526_1012891 Ga0055526_10128913 307
932 3300003771 Ga0055526_1016912 Ga0055526_10169123 307
933 3300003775 Ga0055524_1002358 Ga0055524_100235810 307
934 3300003790 Ga0055528_1000519 Ga0055528_100051920 307
935 3300003790 Ga0055528_1014232 Ga0055528_10142323 307
936 3300003794 Ga0055531_10017593 Ga0055531_100175932 307
937 3300003841 Ga0055541_1000006 Ga0055541_1000006135 307
938 3300004625 Ga0055543_1000315 Ga0055543_100031521 307
939 3300005262 Ga0065165_1000513 Ga0065165_100051315 307
940 3300005289 Ga0065704_10000959 Ga0065704_100009596 307
941 3300009036 Ga0105244_10001340 Ga0105244_100013406 307
942 3300009036 Ga0105244_10001791 Ga0105244_1000179113 307
943 3300009092 Ga0105250_10004385 Ga0105250_100043855 307
944 3300009094 Ga0111539_10000123 Ga0111539_1000012351 307
945 3300013249 Ga0171463_1007 Ga0171463_1007284 307
946 3300013306 Ga0163162_10064478 Ga0163162_100644782 307
947 3300021320 Ga0214544_1000010 Ga0214544_1000010195 307
948 3300021321 Ga0214542_1000023 Ga0214542_100002356 307
949 3300021327 Ga0214543_1000019 Ga0214543_1000019131 307
950 3300022739 Ga0228711_1000017 Ga0228711_100001720 307
951 3300022740 Ga0228710_1000005 Ga0228710_1000005233 307
952 3300025207 Ga0209760_100051 Ga0209760_10005140 307
953 3300025224 Ga0209784_100001 Ga0209784_1000012020 307
954 3300025225 Ga0209566_100001 Ga0209566_1000012020 307
955 3300025226 Ga0209674_100002 Ga0209674_1000022020 307
956 3300025230 Ga0209563_100002 Ga0209563_100002555 307
957 3300025231 Ga0207427_100020 Ga0207427_100020221 307
958 3300025233 Ga0209437_100001 Ga0209437_100001555 307
959 3300025253 Ga0209677_100002 Ga0209677_100002555 307
960 3300025258 Ga0209129_1000019 Ga0209129_1000019108 307
961 3300025263 Ga0209565_1009149 Ga0209565_10091492 307
962 3300025273 Ga0209673_1000023 Ga0209673_1000023227 307
963 3300025273 Ga0209673_1000132 Ga0209673_1000132107 307
964 3300025284 Ga0209130_1000017 Ga0209130_100001715 307
965 3300025284 Ga0209130_1010463 Ga0209130_10104632 307
966 3300025292 Ga0209676_1016266 Ga0209676_10162662 307
967 3300025294 Ga0209025_1000153 Ga0209025_1000153161 307
968 3300025294 Ga0209025_1000666 Ga0209025_100066650 307
969 3300025294 Ga0209025_1005892 Ga0209025_10058927 307
970 3300025294 Ga0209025_1041861 Ga0209025_10418612 307
971 3300025295 Ga0209564_1000100 Ga0209564_1000100155 307
972 3300025295 Ga0209564_1000372 Ga0209564_100037251 307
973 3300025295 Ga0209564_1011402 Ga0209564_10114023 307
974 3300025299 Ga0209256_1000401 Ga0209256_100040123 307
975 3300025299 Ga0209256_1000458 Ga0209256_100045823 307
976 3300025299 Ga0209256_1000735 Ga0209256_100073539 307
977 3300025302 Ga0207426_1000006 Ga0207426_100000615 307
978 3300025303 Ga0209051_1049963 Ga0209051_10499632 307
979 3300025304 Ga0209257_1010746 Ga0209257_10107463 307
980 3300025711 Ga0207696_1000396 Ga0207696_100039629 307
981 3300025728 Ga0207655_1000413 Ga0207655_100041313 307
982 3300027111 Ga0209281_1000082 Ga0209281_1000082181 307
983 3300027111 Ga0209281_1001229 Ga0209281_10012295 307
984 3300027666 Ga0209282_1000006 Ga0209282_1000006203 307
985 3300027907 Ga0207428_10000133 Ga0207428_1000013329 307
986 3300028794 Ga0307515_10178036 Ga0307515_101780362 307
987 3300031456 Ga0307513_10260744 Ga0307513_102607441 307
988 3300031548 Ga0307408_100123412 Ga0307408_1001234122 307
989 3300031731 Ga0307405_10042032 Ga0307405_100420322 307
990 3300031967 Ga0315914_1000003 Ga0315914_1000003258 307
991 3300033430 Ga0315913_1000001 Ga0315913_1000001209 307
992 3300033464 Ga0315915_1000008 Ga0315915_100000878 307
993 3300037418 Ga0395900_0195811 Ga0395900_0195811_557_1492 307
994 3300041404 Ga0439436_0000195 Ga0439436_0000195_9502_10440 307
995 3300041405 Ga0439438_033911 Ga0439438_033911_317_1252 307
996 3300042007 Ga0439449_0017545 Ga0439449_0017545_855_1790 307
997 3300042532 Ga0450893_0010090 Ga0450893_0010090_406_1329 307
998 3300046458 Ga0495591_000803 Ga0495591_000803_18302_19225 307
999 3300046471 Ga0495650_0000043 Ga0495650_0000043_246650_247573 307
1000 3300046471 Ga0495650_0000113 Ga0495650_0000113_112393_113316 307
1001 3300046491 Ga0495584_0002744 Ga0495584_0002744_6908_7831 307
1002 3300046501 Ga0495607_0020421 Ga0495607_0020421_2740_3663 307
1003 3300046506 Ga0495583_0027699 Ga0495583_0027699_11_991 307
1004 3300046507 Ga0495606_0000374 Ga0495606_0000374_50390_51313 307
1005 3300046512 Ga0495610_0003039 Ga0495610_0003039_12223_13158 307
1006 3300046518 Ga0495631_0036456 Ga0495631_0036456_280_1203 307
1007 3300046522 Ga0495643_0074995 Ga0495643_0074995_301_1224 307
1008 3300046523 Ga0495644_0001112 Ga0495644_0001112_7009_7932 307
1009 3300046524 Ga0495648_0018790 Ga0495648_0018790_3429_4352 307
1010 3300046648 Ga0495611_0050843 Ga0495611_0050843_269_1192 307
1011 3300046694 Ga0495649_0014383 Ga0495649_0014383_2984_3907 307
1012 3300046810 Ga0495660_0000012 Ga0495660_0000012_172281_173204 307
1013 3300046810 Ga0495660_0000034 Ga0495660_0000034_55119_56042 307
1014 3300047320 Ga0495672_0000029 Ga0495672_0000029_122775_123698 307
1015 3300047469 Ga0495673_0000092 Ga0495673_0000092_172390_173313 307
1016 3300048904 Ga0496101_0000023 Ga0496101_0000023_86377_87300 307
1017 3300048907 Ga0496104_0002678 Ga0496104_0002678_3604_4527 307
1018 3300048919 Ga0496116_0000066 Ga0496116_0000066_173266_174189 307
1019 3300048919 Ga0496116_0005820 Ga0496116_0005820_4989_5912 307
1020 3300048920 Ga0496117_0013982 Ga0496117_0013982_3544_4467 307
1021 3300048921 Ga0496118_0022829 Ga0496118_0022829_2616_3539 307
1022 3300048922 Ga0496119_0010451 Ga0496119_0010451_2667_3590 307
1023 3300048923 Ga0496120_0000032 Ga0496120_0000032_22440_23363 307
1024 3300048923 Ga0496120_0008032 Ga0496120_0008032_3679_4602 307
1025 3300048925 Ga0496122_0000110 Ga0496122_0000110_170676_171599 307
1026 3300048926 Ga0496123_0000081 Ga0496123_0000081_18544_19467 307
1027 3300048927 Ga0496124_0000530 Ga0496124_0000530_12484_13407 307
1028 3300048928 Ga0496125_0000033 Ga0496125_0000033_96225_97148 307
1029 3300048929 Ga0496126_0001066 Ga0496126_0001066_32928_33851 307
1030 3300049459 Ga0495678_001299 Ga0495678_001299_4693_5616 307
1031 3300049460 Ga0495682_0000003 Ga0495682_0000003_172273_173196 307
1032 3300050511 nmdc:mga08y16_44_c1 nmdc:mga08y16_44_c1_19420_20355 307
1033 3300053125 Ga0500618_009881 Ga0500618_009881_1473_2408 307
1034 3300053126 Ga0500621_000006 Ga0500621_000006_160617_161540 307
1035 iso_pu_bacteria 2510461076 2510900236 307
1036 iso_pu_bacteria 2513237085 2513576472 307
1037 iso_pu_bacteria 2513237093 2513635125 307
1038 iso_pu_bacteria 2513237162 2514018771 307
1039 iso_pu_bacteria 2515075009 2515115073 307
1040 iso_pu_bacteria 2515154113 2515633249 307
1041 iso_pu_bacteria 2515154114 2515642475 307
1042 iso_pu_bacteria 2515154134 2515741925 307
1043 iso_pu_bacteria 2517093000 2517098617 307
1044 iso_pu_bacteria 2582581283 2585169050 307
1045 iso_pu_bacteria 2585427526 2585524175 307
1046 iso_pu_bacteria 2643221607 2644051209 307
1047 iso_pu_bacteria 2643221636 2644200880 307
1048 iso_pu_bacteria 2643221686 2644484113 307
1049 iso_pu_bacteria 2643221689 2644497934 307
1050 iso_pu_bacteria 2718217927 2719388439 307
1051 iso_pu_bacteria 2718218423 2721403062 307
1052 iso_pu_bacteria 2721755809 2724035419 307
1053 iso_pu_bacteria 2724679232 2725952225 307
1054 iso_pu_bacteria 2751185800 2753358608 307
1055 iso_pu_bacteria 2758568016 2758640844 307
1056 iso_pu_bacteria 2854911287 2854914165 307
1057 iso_pu_bacteria 2935901341 2935905751 307
1058 iso_pu_bacteria 8005275841 8005277154 307
1059 iso_pu_bacteria 8005289223 8005290652 307
1060 iso_pu_bacteria 8005307578 8005313121 307
1061 iso_pu_bacteria 8005376324 8005381870 307
1062 iso_pu_bacteria 8005460587 8005466800 307
1063 iso_pu_bacteria 8005695170 8005701934 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

107

307

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.8117 15 301
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.809 15 301
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.8088 16 301
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8037 15 301
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.7977 15 300
ID Description Score Start End Superfamily
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8163 64 303 1.10.3720.10
af_P10905_52_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8132 64 304 1.10.3720.10
af_P10905_52_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8044 64 304 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8041 64 303 1.10.3720.10
af_P71745_27_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8035 32 307 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7V3X9Z6-F1-model_v4 Sugar ABC transporter permease 0.8618 41 304 GO:0005886
GO:0055085
AF-A0A6P1F6V1-F1-model_v4 ABC transporter permease subunit 0.859 51 307 GO:0005886
GO:0055085
AF-A0A0C2V792-F1-model_v4 deleted 0.8564 26 300
AF-A0A6P1F6V1-F1-model_v4 ABC transporter permease subunit 0.8528 51 307 GO:0005886
GO:0055085
AF-A0A6M5IXV0-F1-model_v4 Sugar ABC transporter permease 0.8524 20 304 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
72.7 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map