F489304

General Info

Members Datasets Scaffolds Average Seq Length
1062 759 590 145

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10432640|Ga0157374_104326402
Length 171
Sequence VKALSQAVSTPRKTSGRPTARSKKEQEMLKGIPAIIGPDLLYVLQAMGHGDQITIVDGNYPGESAGPELVRMDGHSATEVLEAILTLMPLDDFVDDPAICMQVVGNAGKHEPIMDEFEAIIKKFEPKMGLTSMERFAFYERANSGYAIVQTGEPRLYGNLILKKGVIRPGD

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
3 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
4 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
5 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
6 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
7 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
8 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
9 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
10 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
11 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
12 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
13 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
14 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
15 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
16 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
17 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
18 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
19 2516143018 Ensifer sp. BR816 Isolate Nodule
20 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
21 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
22 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
23 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
24 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
25 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
26 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
27 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
28 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
29 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
30 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
31 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
32 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
33 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
34 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
35 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
36 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
37 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
38 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
39 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
40 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
41 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
42 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
43 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
44 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
45 2643221557 Ensifer sp. Root558 Isolate Unclassified
46 2643221558 Rhizobium sp. Root149 Isolate Unclassified
47 2643221599 Rhizobium sp. Root708 Isolate Unclassified
48 2643221610 Ensifer sp. Root74 Isolate Unclassified
49 2643221618 Ensifer sp. Root231 Isolate Unclassified
50 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
51 2643221626 Ensifer sp. Root31 Isolate Unclassified
52 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
53 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
54 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
55 2643221655 Ensifer sp. Root1252 Isolate Unclassified
56 2643221659 Ensifer sp. Root127 Isolate Unclassified
57 2643221668 Ensifer sp. Root423 Isolate Unclassified
58 2643221675 Ensifer sp. Root1298 Isolate Unclassified
59 2643221680 Ensifer sp. Root1312 Isolate Unclassified
60 2643221698 Ensifer sp. Root142 Isolate Unclassified
61 2643221712 Ensifer sp. Root258 Isolate Unclassified
62 2643221719 Rhizobium sp. Root274 Isolate Unclassified
63 2643221723 Ensifer sp. Root278 Isolate Unclassified
64 2643221726 Ensifer sp. Root954 Isolate Unclassified
65 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
66 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
67 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
68 2718217882 Rhizobium sp. N741 Isolate Nodule
69 2718217927 Rhizobium sp. N324 Isolate Nodule
70 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
71 2718218009 Rhizobium sp. N561 Isolate Nodule
72 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
73 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
74 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
75 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
76 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
77 2718218363 Rhizobium sp. N113 Isolate Nodule
78 2718218365 Rhizobium sp. N731 Isolate Nodule
79 2718218366 Rhizobium sp. N621 Isolate Nodule
80 2718218423 Rhizobium sp. N941 Isolate Nodule
81 2721755514 Rhizobium sp. N6212 Isolate Nodule
82 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
83 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
84 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
85 2721755809 Rhizobium sp. N541 Isolate Nodule
86 2721755810 Rhizobium sp. N871 Isolate Nodule
87 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
88 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
89 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
90 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
91 2728369365 Rhizobium sp. N1341 Isolate Nodule
92 2728369397 Rhizobium sp. N1314 Isolate Nodule
93 2738541293 Rhizobium sp. GV031 Isolate Unclassified
94 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
95 2738543024 Aminobacter sp. AP02 Isolate Unclassified
96 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
97 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
98 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
99 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
100 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
101 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
102 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
103 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
104 2791355260 Rhizobium sp. L9 Isolate Nodule
105 2791355261 Rhizobium sp. J15 Isolate Nodule
106 2791355263 Rhizobium chutanense C5 Isolate Nodule
107 2791355264 Rhizobium sp. S9 Isolate Nodule
108 2791355267 Rhizobium sp. L18 Isolate Nodule
109 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
110 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
111 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
112 2802429633 Rhizobium anhuiense J3 Isolate Nodule
113 2802429634 Rhizobium anhuiense S10 Isolate Nodule
114 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
115 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
116 2802429637 Rhizobium anhuiense C15 Isolate Nodule
117 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
118 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
119 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
120 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
121 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
122 2838048938 Rhizobium pisi 27/80 Isolate Nodule
123 2838061910 Rhizobium phaseoli L15 Isolate Nodule
124 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
125 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
126 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
127 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
128 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
129 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
130 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
131 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
132 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
133 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
134 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
135 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
136 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
137 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
138 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
139 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
140 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
141 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
142 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
143 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
144 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
145 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
146 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
147 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
148 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
149 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
150 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
151 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
152 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
153 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
154 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
155 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
156 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
157 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
158 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
159 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
160 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
161 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
162 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
163 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
164 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
165 2844163670 Ensifer sp. 1H6 Isolate Unclassified
166 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
167 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
168 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
169 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
170 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
171 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
172 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
173 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
174 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
175 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
176 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
177 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
178 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
179 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
180 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
181 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
182 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
183 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
184 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
185 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
186 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
187 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
188 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
189 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
190 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
191 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
192 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
193 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
194 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
195 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
196 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
197 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
198 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
199 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
200 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
201 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
202 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
203 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
204 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
205 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
206 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
207 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
208 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
209 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
210 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
211 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
212 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
213 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
214 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
215 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
216 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
217 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
218 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
219 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
220 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
221 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
222 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
223 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
224 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
225 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
226 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
227 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
228 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
229 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
230 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
231 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
232 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
233 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
234 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
235 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
236 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
237 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
238 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
239 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
240 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
241 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
242 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
243 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
244 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
245 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
246 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
247 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
248 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
249 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
250 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
251 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
252 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
253 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
254 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
255 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
256 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
257 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
258 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
259 2933599457 Rhizobium phaseoli M3 Isolate Nodule
260 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
261 2936381700 Rhizobium chutanense C16 Isolate Unclassified
262 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
263 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
264 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
265 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
266 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
267 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
268 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
269 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
270 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
271 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
272 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
273 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
274 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
275 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
276 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
277 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
278 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
279 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
280 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
281 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
282 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
283 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
284 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
285 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
286 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
287 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
288 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
289 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
290 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
291 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
292 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
293 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
294 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
295 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
296 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
297 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
298 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
299 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
300 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
301 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
302 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
303 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
304 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
305 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
306 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
307 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
308 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
309 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
310 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
311 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
312 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
313 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
314 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
315 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
316 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
317 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
318 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
319 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
320 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
321 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
322 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
323 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
324 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
325 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
326 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
327 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
328 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
329 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
330 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
331 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
332 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
333 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
334 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
335 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
336 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
337 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
338 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
339 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
340 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
341 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
342 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
343 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
344 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
345 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
346 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
347 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
348 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
349 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
350 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
351 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
352 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
353 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
354 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
355 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
356 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
357 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
358 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
359 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
360 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
361 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
362 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
363 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
364 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
365 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
366 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
367 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
368 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
369 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
370 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
371 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
372 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
373 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
374 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
375 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
376 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
377 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
378 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
379 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
380 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
381 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
382 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
383 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
384 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
385 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
386 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
387 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
388 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
389 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
390 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
391 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
392 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
393 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
394 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
395 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
396 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
397 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
398 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
399 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
400 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
401 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
402 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
403 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
404 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
405 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
406 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
407 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
408 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
409 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
410 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
411 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
412 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
413 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
414 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
415 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
416 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
417 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
418 2996887358 Rhizobium sp. R711 Isolate Nodule
419 2996893221 Rhizobium sp. R635 Isolate Nodule
420 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
421 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
422 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
423 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
424 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
425 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
426 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
427 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
428 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
429 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
430 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
431 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
432 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
433 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
434 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
435 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
436 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
437 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
438 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
439 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
440 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
441 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
442 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
443 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
444 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
445 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
446 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
447 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
448 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
449 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
450 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
451 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
452 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
453 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
454 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
455 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
456 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
457 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
458 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
459 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
460 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
461 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
462 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
463 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
464 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
465 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
466 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
467 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
468 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
469 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
470 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
471 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
472 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
473 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
474 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
475 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
476 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
477 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
478 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
479 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
480 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
481 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
482 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
483 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
484 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
485 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
486 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
487 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
488 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
489 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
490 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
491 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
492 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
493 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
494 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
495 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
496 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
497 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
498 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
499 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
500 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
501 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
502 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
503 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
504 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
505 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
506 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
507 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
508 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
509 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
510 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
511 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
512 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
513 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
514 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
515 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
516 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
517 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
518 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
519 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
520 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
521 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
522 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
523 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
524 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
525 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
526 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
527 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
528 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
529 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
530 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
531 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
532 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
533 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
534 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
535 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
536 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
537 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
538 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
539 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
540 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
541 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
542 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
543 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
544 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
545 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
546 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
547 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
548 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
549 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
550 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
551 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
552 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
553 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
554 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
555 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
556 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
557 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
558 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
559 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
560 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
561 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
562 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
563 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
564 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
565 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
566 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
567 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
568 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
569 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
570 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
571 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
572 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
573 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
574 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
575 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
576 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
577 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
578 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
579 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
580 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
581 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
582 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
583 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
584 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
585 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
586 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
587 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
588 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
589 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
590 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
591 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
592 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
593 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
594 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
595 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
596 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
597 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
598 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
599 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
600 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
601 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
602 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
603 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
604 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
605 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
606 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
607 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
608 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
609 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
610 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
611 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
612 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
613 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
614 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
615 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
616 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
617 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
618 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
619 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
620 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
621 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
622 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
623 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
624 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
625 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
626 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
627 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
628 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
629 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
630 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
631 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
632 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
633 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
634 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
635 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
636 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
637 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
638 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
639 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
640 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
641 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
642 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
643 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
644 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
645 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
646 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
647 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
648 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
649 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
650 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
651 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
652 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
653 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
654 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
655 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
656 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
657 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
658 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
659 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
660 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
661 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
662 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
663 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
664 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
665 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
666 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
667 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
668 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
669 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
670 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
671 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
672 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
673 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
674 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
675 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
676 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
677 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
678 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
679 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
680 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
681 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
682 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
683 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
684 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
685 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
686 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
687 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
688 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
689 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
690 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
691 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
692 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
693 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
694 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
695 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
696 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
697 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
698 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
699 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
700 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
701 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
702 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
703 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
704 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
705 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
706 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
707 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
708 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
709 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
710 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
711 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
712 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
713 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
714 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
715 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
716 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
717 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
718 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
719 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
720 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
721 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
722 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
723 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
724 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
725 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
726 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
727 8005258706 Rhizobium sp. R693 Isolate Nodule
728 8005275841 Rhizobium sp. N4311 Isolate Nodule
729 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
730 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
731 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
732 8005321885 Rhizobium sp. R72 Isolate Nodule
733 8005382845 Rhizobium sp. R634 Isolate Nodule
734 8005395548 Rhizobium sp. R339 Isolate Nodule
735 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
736 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
737 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
738 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
739 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
740 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
741 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
742 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
743 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
744 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
745 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
746 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
747 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
748 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
749 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
750 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
751 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
752 8018176218 Rhizobium sp. N122 Isolate Nodule
753 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
754 8024501048 Rhizobium sp. H4 Isolate Nodule
755 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
756 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
757 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
758 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
759 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.8
Metatranscriptomes 0.75
Isolates 44.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.15
Nodule 37.85
Rhizoplane 1.79
Rhizosphere 36.25
Stem 0
Stem Tuber 0
Unclassified 11.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10086643 3300002067 Bacteria 897
2 JGI25158J39367_1032113 3300002739 Bacteria 588
3 JGI25157J39369_1001027 3300002741 Bacteria 12885
4 JGI25152J39213_1001483 3300002773 Bacteria 10028
5 JGI25152J39213_1003180 3300002773 Bacteria 5716
6 JGI25150J39212_1000199 3300002774 Bacteria 32990
7 JGI25159J45721_1000003 3300002987 Bacteria 274069
8 JGI25159J45721_1002037 3300002987 Bacteria 7997
9 JGI25151J46595_10001303 3300003187 Bacteria 17484
10 JGI25151J46595_10004870 3300003187 Bacteria 7012
11 JGI25151J46595_10006323 3300003187 Bacteria 5970
12 JGI25406J46586_10008349 3300003203 Bacteria 4695
13 JGI25165J46597_1000016 3300003214 Bacteria 377866
14 JGI25153J46596_10000978 3300003215 Bacteria 17322
15 rootH1_10116783 3300003316 Bacteria 1732
16 rootH2_10011781 3300003320 Bacteria 7762
17 rootH2_10049858 3300003320 Bacteria 2146
18 rootH1_10019781 3300003323 Bacteria 1356
19 rootH1_10019782 3300003323 Bacteria 2571
20 rootH1_10021120 3300003323 Bacteria 10778
21 rootH1_10107305 3300003323 Plasmid 3148
22 JGI25160J50197_1000003 3300003354 Bacteria 482719
23 JGI25160J50197_1000012 3300003354 Bacteria 267582
24 JGI25160J50197_1003267 3300003354 Bacteria 7299
25 JGI25160J50197_1027133 3300003354 Bacteria 1565
26 JGI25161J50226_1000002 3300003374 Bacteria 420324
27 JGI25161J50226_1000239 3300003374 Bacteria 32969
28 JGI25161J50226_1003433 3300003374 Bacteria 3622
29 Ga0006562J51391_1034067 3300003578 Bacteria 2200
30 Ga0055526_1003533 3300003771 Bacteria 9871
31 Ga0055526_1004786 3300003771 Bacteria 8014
32 Ga0055524_1000434 3300003775 Bacteria 34967
33 Ga0055524_1001875 3300003775 Bacteria 11451
34 Ga0055524_1002834 3300003775 Bacteria 8692
35 Ga0055524_1004206 3300003775 Bacteria 6704
36 Ga0055536_1009396 3300003781 Bacteria 4044
37 Ga0055528_1000594 3300003790 Bacteria 27215
38 Ga0055528_1006905 3300003790 Bacteria 5088
39 Ga0055528_1021981 3300003790 Bacteria 2001
40 Ga0055530_10025614 3300003791 Bacteria 1644
41 Ga0055540_1000272 3300003792 Bacteria 46628
42 Ga0055540_1026319 3300003792 Bacteria 1409
43 Ga0055540_1049979 3300003792 Bacteria 866
44 Ga0055531_10017334 3300003794 Bacteria 3047
45 Ga0055543_1000043 3300004625 Bacteria 116599
46 Ga0055543_1000050 3300004625 Bacteria 107366
47 Ga0055543_1000774 3300004625 Bacteria 15885
48 Ga0065165_1000025 3300005262 Bacteria 246909
49 Ga0065165_1000031 3300005262 Bacteria 216330
50 Ga0065165_1004348 3300005262 Bacteria 8885
51 Ga0065165_1027649 3300005262 Bacteria 1844
52 Ga0070676_10212871 3300005328 Bacteria 1273
53 Ga0070683_100057160 3300005329 Bacteria 3624
54 Ga0070670_100322704 3300005331 Bacteria 1353
55 Ga0068869_100348922 3300005334 Bacteria 1206
56 Ga0070666_10201911 3300005335 Bacteria 1399
57 Ga0070660_100027460 3300005339 Bacteria 4248
58 Ga0070660_100285741 3300005339 Bacteria 1350
59 Ga0070661_100008136 3300005344 Bacteria 7235
60 Ga0070661_100013469 3300005344 Bacteria 5741
61 Ga0070661_100205093 3300005344 Bacteria 1508
62 Ga0070661_100613857 3300005344 Bacteria 880
63 Ga0070668_100105865 3300005347 Bacteria 2234
64 Ga0070668_100178826 3300005347 Bacteria 1732
65 Ga0070675_100192304 3300005354 Bacteria 1768
66 Ga0070671_100013114 3300005355 Bacteria 6677
67 Ga0070671_100225258 3300005355 Bacteria 1591
68 Ga0070673_100018723 3300005364 Bacteria 4956
69 Ga0070659_100012347 3300005366 Bacteria 6330
70 Ga0070659_100060715 3300005366 Bacteria 2986
71 Ga0070659_100101025 3300005366 Bacteria 2321
72 Ga0070659_100555824 3300005366 Bacteria 983
73 Ga0070659_100975335 3300005366 Bacteria 743
74 Ga0070667_100270274 3300005367 Bacteria 1524
75 Ga0070700_100414507 3300005441 Bacteria 1016
76 Ga0070663_100074188 3300005455 Bacteria 2483
77 Ga0070663_100273824 3300005455 Bacteria 1343
78 Ga0070663_101093231 3300005455 Bacteria 697
79 Ga0070678_100138538 3300005456 Bacteria 1944
80 Ga0070662_100480687 3300005457 Bacteria 1034
81 Ga0068867_100392100 3300005459 Bacteria 1169
82 Ga0070679_100837402 3300005530 Bacteria 863
83 Ga0070684_100381065 3300005535 Bacteria 1299
84 Ga0068853_100039407 3300005539 Bacteria 4029
85 Ga0068853_100077154 3300005539 Bacteria 2910
86 Ga0068853_100221433 3300005539 Bacteria 1728
87 Ga0068853_101591402 3300005539 Unclassified 633
88 Ga0070672_100786425 3300005543 Unclassified 837
89 Ga0070686_100090655 3300005544 Bacteria 2044
90 Ga0070693_100718899 3300005547 Bacteria 733
91 Ga0070665_100096659 3300005548 Bacteria 2959
92 Ga0070665_100102847 3300005548 Bacteria 2860
93 Ga0068855_100025742 3300005563 Bacteria 7035
94 Ga0068855_100080077 3300005563 Bacteria 3788
95 Ga0068855_100235898 3300005563 Bacteria 2046
96 Ga0068855_101384584 3300005563 Bacteria 725
97 Ga0068855_102094299 3300005563 Bacteria 570
98 Ga0068857_100007527 3300005577 Bacteria 9369
99 Ga0068854_100066665 3300005578 Bacteria 2620
100 Ga0068854_100080736 3300005578 Bacteria 2400
101 Ga0068854_100089422 3300005578 Bacteria 2288
102 Ga0068856_100058011 3300005614 Bacteria 3823
103 Ga0068856_100112834 3300005614 Bacteria 2716
104 Ga0068856_100115814 3300005614 Bacteria 2680
105 Ga0068856_100223318 3300005614 Bacteria 1899
106 Ga0068856_100249888 3300005614 Bacteria 1788
107 Ga0068856_100498433 3300005614 Bacteria 1239
108 Ga0068856_101609399 3300005614 Bacteria 663
109 Ga0068852_100007964 3300005616 Bacteria 7769
110 Ga0068852_100045127 3300005616 Bacteria 3747
111 Ga0068852_100050929 3300005616 Bacteria 3551
112 Ga0068852_100113029 3300005616 Bacteria 2472
113 Ga0068852_100287989 3300005616 Bacteria 1586
114 Ga0068852_100591142 3300005616 Bacteria 1114
115 Ga0068866_10600330 3300005718 Bacteria 743
116 Ga0068851_10016419 3300005834 Bacteria 3542
117 Ga0068851_10058947 3300005834 Bacteria 1963
118 Ga0068858_100211506 3300005842 Bacteria 1835
119 Ga0081539_10003049 3300005985 Bacteria 21640
120 Ga0075365_10006944 3300006038 Bacteria 6289
121 Ga0075365_10008779 3300006038 Bacteria 5765
122 Ga0075365_10011572 3300006038 Bacteria 5194
123 Ga0075365_10137064 3300006038 Bacteria 1697
124 Ga0075365_10161513 3300006038 Bacteria 1561
125 Ga0075368_10020065 3300006042 Bacteria 2528
126 Ga0075363_100132438 3300006048 Bacteria 1399
127 Ga0075363_100167894 3300006048 Bacteria 1245
128 Ga0075363_100492393 3300006048 Bacteria 727
129 Ga0075362_10000690 3300006177 Bacteria 9988
130 Ga0075362_10259328 3300006177 Bacteria 856
131 Ga0075362_10267217 3300006177 Bacteria 844
132 Ga0075367_10007331 3300006178 Bacteria 5640
133 Ga0075367_10075532 3300006178 Bacteria 2033
134 Ga0075367_10500528 3300006178 Bacteria 771
135 Ga0075367_10509172 3300006178 Bacteria 764
136 Ga0075369_10014458 3300006186 Bacteria 3153
137 Ga0075369_10077459 3300006186 Bacteria 1471
138 Ga0075366_10042198 3300006195 Bacteria 2700
139 Ga0075366_10879488 3300006195 Bacteria 558
140 Ga0075370_10002201 3300006353 Bacteria 8953
141 Ga0075370_10188960 3300006353 Bacteria 1213
142 Ga0075370_10256387 3300006353 Bacteria 1037
143 Ga0068865_100392488 3300006881 Bacteria 1135
144 Ga0075435_100384299 3300007076 Bacteria 1206
145 Ga0105251_10014773 3300009011 Bacteria 4297
146 Ga0105244_10090700 3300009036 Bacteria 1503
147 Ga0105250_10027381 3300009092 Bacteria 2297
148 Ga0105240_10040307 3300009093 Bacteria 5974
149 Ga0105240_10189863 3300009093 Bacteria 2416
150 Ga0105240_10210247 3300009093 Bacteria 2274
151 Ga0105240_10410925 3300009093 Bacteria 1522
152 Ga0105240_10867834 3300009093 Bacteria 973
153 Ga0105240_12584651 3300009093 Bacteria 525
154 Ga0105245_10199319 3300009098 Bacteria 1922
155 Ga0114129_11356429 3300009147 Bacteria 879
156 Ga0105243_11233550 3300009148 Bacteria 762
157 Ga0105243_11318356 3300009148 Bacteria 740
158 Ga0105241_11294441 3300009174 Bacteria 694
159 Ga0105248_10766100 3300009177 Bacteria 1089
160 Ga0105237_10000071 3300009545 Bacteria 135695
161 Ga0105237_10026573 3300009545 Bacteria 5916
162 Ga0105237_10104123 3300009545 Bacteria 2829
163 Ga0105237_10387028 3300009545 Bacteria 1403
164 Ga0105237_10999241 3300009545 Bacteria 843
165 Ga0105238_10001439 3300009551 Bacteria 23916
166 Ga0105238_10015176 3300009551 Bacteria 7800
167 Ga0105238_10052632 3300009551 Bacteria 4093
168 Ga0105238_10211418 3300009551 Bacteria 1916
169 Ga0105249_10251127 3300009553 Bacteria 1754
170 Ga0105249_11187797 3300009553 Bacteria 834
171 Ga0123341_1000038 3300009765 Bacteria 60679
172 Ga0123341_1000054 3300009765 Bacteria 48678
173 Ga0123341_1036851 3300009765 Bacteria 3365
174 Ga0123342_1013519 3300009766 Bacteria 8150
175 Ga0123342_1018935 3300009766 Bacteria 5364
176 Ga0105239_10027474 3300010375 Bacteria 6264
177 Ga0105239_10182662 3300010375 Bacteria 2347
178 Ga0105239_10201351 3300010375 Bacteria 2231
179 Ga0105239_10201683 3300010375 Bacteria 2229
180 Ga0105239_10315656 3300010375 Bacteria 1762
181 Ga0105239_10328171 3300010375 Bacteria 1726
182 Ga0105239_10373235 3300010375 Bacteria 1612
183 Ga0157371_10043386 3300013102 Bacteria 3204
184 Ga0157371_10167960 3300013102 Bacteria 1567
185 Ga0157371_10765515 3300013102 Bacteria 726
186 Ga0157370_10148729 3300013104 Bacteria 2180
187 Ga0157370_10150919 3300013104 Bacteria 2162
188 Ga0157370_10709596 3300013104 Bacteria 918
189 Ga0157370_10729841 3300013104 Bacteria 903
190 Ga0157369_10105860 3300013105 Bacteria 2994
191 Ga0157369_10236617 3300013105 Bacteria 1908
192 Ga0157369_10568629 3300013105 Bacteria 1171
193 Ga0171463_1001 3300013249 Bacteria 1406070
194 Ga0157374_10432640 3300013296 Bacteria 1316
195 Ga0157378_10054679 3300013297 Bacteria 3554
196 Ga0157378_10266716 3300013297 Bacteria 1645
197 Ga0157378_11196274 3300013297 Bacteria 799
198 Ga0163162_11416224 3300013306 Bacteria 791
199 Ga0157372_10208590 3300013307 Bacteria 2264
200 Ga0157372_10468223 3300013307 Bacteria 1469
201 Ga0157372_11937034 3300013307 Bacteria 677
202 Ga0157372_11951626 3300013307 Bacteria 675
203 Ga0157372_12741704 3300013307 Bacteria 565
204 Ga0157375_11133313 3300013308 Bacteria 916
205 Ga0157375_11531052 3300013308 Bacteria 788
206 Ga0182008_10072474 3300014497 Bacteria 1695
207 Ga0182008_10495417 3300014497 Bacteria 671
208 Ga0157376_10483449 3300014969 Bacteria 1214
209 Ga0182005_1004662 3300015265 Bacteria 4382
210 Ga0183362_10531 3300015683 Bacteria 817
211 Ga0183363_1081 3300015690 Bacteria 29051
212 Ga0163161_10366513 3300017792 Bacteria 1149
213 Ga0214544_1000105 3300021320 Bacteria 114109
214 Ga0214542_1000029 3300021321 Bacteria 174097
215 Ga0214543_1000040 3300021327 Bacteria 174142
216 Ga0209436_101403 3300025208 Bacteria 8484
217 Ga0209436_111980 3300025208 Bacteria 1494
218 Ga0209563_105256 3300025230 Bacteria 2371
219 Ga0207425_1000012 3300025245 Bacteria 528324
220 Ga0209129_1000110 3300025258 Bacteria 150918
221 Ga0209129_1000192 3300025258 Bacteria 83041
222 Ga0209129_1002601 3300025258 Bacteria 8623
223 Ga0209233_1000068 3300025261 Bacteria 377969
224 Ga0209565_1056866 3300025263 Bacteria 687
225 Ga0209673_1000024 3300025273 Bacteria 409632
226 Ga0209673_1016778 3300025273 Bacteria 2724
227 Ga0209673_1024184 3300025273 Bacteria 2048
228 Ga0209130_1000005 3300025284 Bacteria 599620
229 Ga0209130_1000028 3300025284 Bacteria 325668
230 Ga0209676_1001325 3300025292 Bacteria 25063
231 Ga0209025_1000024 3300025294 Bacteria 528324
232 Ga0209025_1000377 3300025294 Bacteria 92728
233 Ga0209025_1001341 3300025294 Bacteria 33186
234 Ga0209025_1002318 3300025294 Bacteria 20601
235 Ga0209025_1012802 3300025294 Bacteria 5337
236 Ga0209025_1019667 3300025294 Bacteria 3741
237 Ga0209025_1039114 3300025294 Bacteria 2074
238 Ga0209564_1000093 3300025295 Bacteria 245793
239 Ga0209564_1001378 3300025295 Bacteria 25367
240 Ga0209564_1016216 3300025295 Bacteria 2980
241 Ga0209564_1064075 3300025295 Bacteria 803
242 Ga0209564_1064569 3300025295 Bacteria 797
243 Ga0209758_1000150 3300025297 Bacteria 163494
244 Ga0209758_1013507 3300025297 Bacteria 4444
245 Ga0209758_1014803 3300025297 Bacteria 4109
246 Ga0209758_1061825 3300025297 Bacteria 1230
247 Ga0209758_1107515 3300025297 Bacteria 779
248 Ga0209050_1009758 3300025298 Bacteria 4852
249 Ga0209256_1000027 3300025299 Bacteria 423283
250 Ga0209256_1001654 3300025299 Bacteria 21679
251 Ga0209256_1001872 3300025299 Bacteria 19427
252 Ga0207426_1000012 3300025302 Bacteria 730942
253 Ga0207426_1000015 3300025302 Bacteria 599316
254 Ga0207426_1006180 3300025302 Bacteria 5268
255 Ga0209051_1008107 3300025303 Bacteria 5616
256 Ga0209051_1009004 3300025303 Bacteria 5198
257 Ga0209051_1023500 3300025303 Bacteria 2559
258 Ga0209051_1048297 3300025303 Bacteria 1444
259 Ga0209257_1001105 3300025304 Bacteria 35073
260 Ga0207656_10093476 3300025321 Bacteria 1368
261 Ga0207642_10215804 3300025899 Bacteria 1069
262 Ga0207647_10031770 3300025904 Bacteria 3396
263 Ga0207647_10558768 3300025904 Bacteria 634
264 Ga0207705_10032925 3300025909 Bacteria 3704
265 Ga0207654_10022493 3300025911 Bacteria 3364
266 Ga0207654_11167695 3300025911 Bacteria 561
267 Ga0207695_10052067 3300025913 Bacteria 4292
268 Ga0207695_10209038 3300025913 Bacteria 1863
269 Ga0207695_10590437 3300025913 Bacteria 992
270 Ga0207695_10596455 3300025913 Bacteria 986
271 Ga0207671_10000099 3300025914 Bacteria 132378
272 Ga0207671_10039420 3300025914 Bacteria 3498
273 Ga0207671_10044229 3300025914 Bacteria 3293
274 Ga0207671_10131147 3300025914 Bacteria 1924
275 Ga0207671_10134873 3300025914 Bacteria 1897
276 Ga0207657_10003404 3300025919 Bacteria 16996
277 Ga0207657_10059244 3300025919 Bacteria 3292
278 Ga0207649_10025092 3300025920 Bacteria 3472
279 Ga0207649_10025957 3300025920 Bacteria 3422
280 Ga0207649_10111513 3300025920 Bacteria 1828
281 Ga0207649_10475181 3300025920 Bacteria 947
282 Ga0207694_10013184 3300025924 Bacteria 6223
283 Ga0207694_10048161 3300025924 Bacteria 3298
284 Ga0207694_10059881 3300025924 Bacteria 2962
285 Ga0207694_10999250 3300025924 Bacteria 708
286 Ga0207650_11068244 3300025925 Bacteria 687
287 Ga0207659_10126363 3300025926 Bacteria 1967
288 Ga0207644_10129897 3300025931 Bacteria 1927
289 Ga0207644_10309605 3300025931 Bacteria 1275
290 Ga0207690_10096223 3300025932 Bacteria 2105
291 Ga0207690_10199653 3300025932 Bacteria 1518
292 Ga0207690_10638530 3300025932 Bacteria 872
293 Ga0207706_10508283 3300025933 Bacteria 1040
294 Ga0207669_10029972 3300025937 Bacteria 3017
295 Ga0207704_11032274 3300025938 Bacteria 696
296 Ga0207691_10022269 3300025940 Bacteria 5978
297 Ga0207689_10289738 3300025942 Bacteria 1356
298 Ga0207661_10156209 3300025944 Bacteria 1976
299 Ga0207679_10196903 3300025945 Bacteria 1680
300 Ga0207667_10027567 3300025949 Bacteria 6180
301 Ga0207667_10217769 3300025949 Bacteria 1956
302 Ga0207667_10644288 3300025949 Bacteria 1066
303 Ga0207667_10716407 3300025949 Bacteria 1002
304 Ga0207667_11525029 3300025949 Bacteria 639
305 Ga0207668_10044029 3300025972 Bacteria 3034
306 Ga0207668_10524986 3300025972 Bacteria 1022
307 Ga0207640_10062710 3300025981 Bacteria 2467
308 Ga0207640_11539430 3300025981 Bacteria 598
309 Ga0207658_10739460 3300025986 Bacteria 890
310 Ga0207658_11409788 3300025986 Bacteria 637
311 Ga0207677_10060700 3300026023 Bacteria 2615
312 Ga0207703_10165180 3300026035 Bacteria 1942
313 Ga0207639_10016390 3300026041 Bacteria 5241
314 Ga0207639_10237092 3300026041 Bacteria 1584
315 Ga0207639_10501444 3300026041 Bacteria 1109
316 Ga0207639_10844269 3300026041 Bacteria 855
317 Ga0207639_12268190 3300026041 Bacteria 504
318 Ga0207678_10118412 3300026067 Bacteria 2260
319 Ga0207678_10177741 3300026067 Bacteria 1817
320 Ga0207678_10223486 3300026067 Bacteria 1612
321 Ga0207678_10845446 3300026067 Bacteria 809
322 Ga0207702_10026350 3300026078 Bacteria 4827
323 Ga0207702_10083818 3300026078 Bacteria 2774
324 Ga0207702_10114212 3300026078 Bacteria 2406
325 Ga0207702_10321314 3300026078 Bacteria 1474
326 Ga0207648_10221475 3300026089 Bacteria 1682
327 Ga0207648_10592794 3300026089 Bacteria 1021
328 Ga0207674_10004838 3300026116 Bacteria 16125
329 Ga0207674_10201622 3300026116 Bacteria 1939
330 Ga0207674_10231188 3300026116 Bacteria 1797
331 Ga0207674_10404515 3300026116 Bacteria 1319
332 Ga0207674_10698860 3300026116 Bacteria 979
333 Ga0207683_10088066 3300026121 Bacteria 2762
334 Ga0207683_10321178 3300026121 Bacteria 1418
335 Ga0207698_10015331 3300026142 Bacteria 5128
336 Ga0207698_10041703 3300026142 Bacteria 3423
337 Ga0207698_10072190 3300026142 Bacteria 2743
338 Ga0207698_10512156 3300026142 Bacteria 1169
339 Ga0209281_1000809 3300027111 Bacteria 28568
340 Ga0268266_10000391 3300028379 Bacteria 66400
341 Ga0268266_10742379 3300028379 Bacteria 947
342 Ga0265318_10031577 3300028577 Bacteria 2053
343 Ga0307515_10026670 3300028794 Bacteria 9929
344 Ga0307515_10422696 3300028794 Bacteria 953
345 Ga0265338_10008348 3300028800 Bacteria 12595
346 Ga0265330_10033192 3300031235 Bacteria 2310
347 Ga0265340_10218257 3300031247 Bacteria 855
348 Ga0265339_10051730 3300031249 Bacteria 2240
349 Ga0265331_10012154 3300031250 Bacteria 4677
350 Ga0265327_10032300 3300031251 Bacteria 2931
351 Ga0265316_10015330 3300031344 Bacteria 6705
352 Ga0307513_10006535 3300031456 Bacteria 15225
353 Ga0307513_10189961 3300031456 Bacteria 1907
354 Ga0307513_10497487 3300031456 Bacteria 937
355 Ga0265313_10000962 3300031595 Bacteria 28567
356 Ga0265314_10046761 3300031711 Bacteria 3051
357 Ga0265342_10026094 3300031712 Bacteria 3665
358 Ga0307516_10093184 3300031730 Bacteria 2838
359 Ga0307405_10001510 3300031731 Bacteria 9858
360 Ga0307405_11131470 3300031731 Unclassified 674
361 Ga0307410_10264206 3300031852 Bacteria 1343
362 Ga0307410_10401307 3300031852 Bacteria 1108
363 Ga0307410_12001072 3300031852 Bacteria 517
364 Ga0307406_10002121 3300031901 Bacteria 10797
365 Ga0307406_10907914 3300031901 Unclassified 750
366 Ga0307407_10209930 3300031903 Bacteria 1310
367 Ga0307412_10000777 3300031911 Bacteria 18415
368 Ga0307409_100700544 3300031995 Bacteria 1012
369 Ga0307409_100700652 3300031995 Bacteria 1012
370 Ga0307416_100281989 3300032002 Bacteria 1639
371 Ga0307416_100316647 3300032002 Unclassified 1560
372 Ga0373930_0022221 3300034816 Bacteria 1253
373 Ga0373949_0019242 3300035090 Bacteria 1554
374 Ga0373952_0042611 3300035092 Bacteria 1055
375 Ga0373932_0042040 3300035112 Bacteria 1324
376 Ga0373941_0165943 3300035115 Bacteria 820
377 Ga0373946_0160169 3300035171 Bacteria 1056
378 Ga0373931_0202569 3300035691 Bacteria 1186
379 Ga0373927_0612003 3300035695 Bacteria 720
380 Ga0373925_0147774 3300037068 Bacteria 1843
381 Ga0373925_0848465 3300037068 Bacteria 753
382 Ga0395899_0071063 3300037312 Bacteria 2547
383 Ga0395899_0555648 3300037312 Bacteria 737
384 Ga0395900_0042983 3300037418 Bacteria 4656
385 Ga0395900_0073589 3300037418 Bacteria 3513
386 Ga0395900_0086703 3300037418 Bacteria 3217
387 Ga0395900_0194679 3300037418 Bacteria 2054
388 Ga0395898_1162714 3300037466 Bacteria 703
389 Ga0395905_0157381 3300037471 Bacteria 2136
390 Ga0395905_0205572 3300037471 Bacteria 1845
391 Ga0395905_0817723 3300037471 Bacteria 835
392 Ga0395901_0036925 3300038443 Bacteria 5052
393 Ga0395901_0067508 3300038443 Bacteria 3724
394 Ga0395901_0443448 3300038443 Bacteria 1328
395 Ga0395901_0537010 3300038443 Bacteria 1186
396 Ga0395901_1619437 3300038443 Bacteria 600
397 Ga0439436_0007013 3300041404 Bacteria 3467
398 Ga0439439_0023748 3300041406 Bacteria 1537
399 Ga0439439_0171214 3300041406 Bacteria 622
400 Ga0439465_0004886 3300041413 Bacteria 4308
401 Ga0439465_0010793 3300041413 Bacteria 2865
402 Ga0451837_0747757 3300041494 Bacteria 1746
403 Ga0439432_020030 3300042006 Bacteria 2226
404 Ga0439432_057550 3300042006 Bacteria 1203
405 Ga0439449_0204367 3300042007 Bacteria 739
406 Ga0439455_0171371 3300042012 Bacteria 623
407 Ga0439434_0048484 3300042435 Bacteria 1314
408 Ga0466972_0051082 3300044658 Bacteria 1995
409 Ga0466972_0203778 3300044658 Bacteria 926
410 Ga0466965_0275141 3300044683 Bacteria 908
411 Ga0466957_0220052 3300044842 Bacteria 1253
412 Ga0466960_0622413 3300044901 Bacteria 642
413 Ga0466967_0672632 3300045976 Bacteria 1025
414 Ga0495638_0000418 3300046460 Bacteria 51339
415 Ga0495650_0028711 3300046471 Bacteria 2547
416 Ga0495583_0033574 3300046506 Bacteria 2467
417 Ga0495606_0068359 3300046507 Bacteria 2248
418 Ga0495606_0145157 3300046507 Bacteria 1398
419 Ga0495606_0354703 3300046507 Bacteria 777
420 Ga0495606_0426763 3300046507 Bacteria 684
421 Ga0495610_0026586 3300046512 Bacteria 3088
422 Ga0495618_0182095 3300046514 Bacteria 1335
423 Ga0495620_0048549 3300046515 Bacteria 1821
424 Ga0495620_0063464 3300046515 Bacteria 1531
425 Ga0495632_0015362 3300046519 Bacteria 4298
426 Ga0495632_0030319 3300046519 Bacteria 2808
427 Ga0495654_0369164 3300046530 Bacteria 574
428 Ga0495587_0336131 3300046536 Bacteria 843
429 Ga0495668_0039174 3300046616 Bacteria 2647
430 Ga0495625_0025590 3300046660 Bacteria 4474
431 Ga0495625_0148169 3300046660 Bacteria 1579
432 Ga0495661_0020237 3300046665 Bacteria 4349
433 Ga0495661_0259876 3300046665 Bacteria 883
434 Ga0495673_0061921 3300047469 Bacteria 1600
435 Ga0495686_0057666 3300047472 Bacteria 2423
436 Ga0495686_0099734 3300047472 Bacteria 1753
437 Ga0495686_0234225 3300047472 Bacteria 1038
438 Ga0496100_0577560 3300048903 Bacteria 871
439 Ga0496101_0422335 3300048904 Bacteria 1051
440 Ga0496101_0517342 3300048904 Bacteria 943
441 Ga0496102_0502503 3300048905 Bacteria 1135
442 Ga0496102_0542638 3300048905 Bacteria 1085
443 Ga0496102_0558831 3300048905 Bacteria 1067
444 Ga0496103_0901182 3300048906 Bacteria 554
445 Ga0496104_0323568 3300048907 Bacteria 1455
446 Ga0496105_0327317 3300048908 Bacteria 1227
447 Ga0496107_0087497 3300048910 Bacteria 2275
448 Ga0496110_0372368 3300048913 Bacteria 1301
449 Ga0496111_0835875 3300048914 Bacteria 665
450 Ga0496112_0295832 3300048915 Bacteria 1565
451 Ga0496113_1235776 3300048916 Bacteria 582
452 Ga0496114_0234461 3300048917 Bacteria 1613
453 Ga0496114_1404330 3300048917 Bacteria 585
454 Ga0496116_0006249 3300048919 Bacteria 10859
455 Ga0496116_0022947 3300048919 Bacteria 4658
456 Ga0496116_0045989 3300048919 Bacteria 2949
457 Ga0496116_0100424 3300048919 Bacteria 1730
458 Ga0496116_0181923 3300048919 Bacteria 1124
459 Ga0496117_0001790 3300048920 Bacteria 29267
460 Ga0496117_0004943 3300048920 Bacteria 14321
461 Ga0496117_0052807 3300048920 Bacteria 2860
462 Ga0496117_0491919 3300048920 Bacteria 597
463 Ga0496118_0128595 3300048921 Bacteria 1632
464 Ga0496118_0198479 3300048921 Bacteria 1191
465 Ga0496119_0134812 3300048922 Bacteria 1341
466 Ga0496119_0153309 3300048922 Bacteria 1232
467 Ga0496119_0194681 3300048922 Bacteria 1054
468 Ga0496119_0288868 3300048922 Bacteria 813
469 Ga0496119_0421791 3300048922 Bacteria 633
470 Ga0496120_0008764 3300048923 Bacteria 7273
471 Ga0496120_0250315 3300048923 Bacteria 832
472 Ga0496121_0063986 3300048924 Bacteria 3001
473 Ga0496121_0123153 3300048924 Bacteria 1954
474 Ga0496121_0146228 3300048924 Bacteria 1746
475 Ga0496121_0151447 3300048924 Bacteria 1706
476 Ga0496121_0174972 3300048924 Bacteria 1555
477 Ga0496121_0286228 3300048924 Bacteria 1125
478 Ga0496121_0398412 3300048924 Bacteria 902
479 Ga0496121_0466751 3300048924 Bacteria 809
480 Ga0496122_0000321 3300048925 Bacteria 105353
481 Ga0496122_0040256 3300048925 Bacteria 3717
482 Ga0496122_0084848 3300048925 Bacteria 2188
483 Ga0496122_0120196 3300048925 Bacteria 1696
484 Ga0496122_0150948 3300048925 Bacteria 1434
485 Ga0496122_0205082 3300048925 Bacteria 1148
486 Ga0496122_0497265 3300048925 Bacteria 593
487 Ga0496123_0002294 3300048926 Bacteria 24023
488 Ga0496123_0002453 3300048926 Bacteria 22987
489 Ga0496123_0054291 3300048926 Bacteria 2639
490 Ga0496123_0097863 3300048926 Bacteria 1717
491 Ga0496124_0000558 3300048927 Bacteria 63070
492 Ga0496124_0002598 3300048927 Bacteria 23360
493 Ga0496124_0004301 3300048927 Bacteria 16726
494 Ga0496124_0088748 3300048927 Bacteria 2526
495 Ga0496124_0490525 3300048927 Bacteria 827
496 Ga0496124_0563234 3300048927 Bacteria 749
497 Ga0496124_0789793 3300048927 Bacteria 589
498 Ga0496125_0000628 3300048928 Bacteria 59302
499 Ga0496125_0006143 3300048928 Bacteria 13095
500 Ga0496125_0090448 3300048928 Bacteria 2297
501 Ga0496125_0216091 3300048928 Bacteria 1240
502 Ga0496126_0000378 3300048929 Bacteria 92187
503 Ga0496126_0030068 3300048929 Bacteria 5153
504 Ga0496126_0086643 3300048929 Bacteria 2760
505 Ga0496126_0446599 3300048929 Bacteria 1041
506 Ga0496126_0625952 3300048929 Bacteria 845
507 Ga0496126_0636267 3300048929 Bacteria 836
508 Ga0501031_0075511 3300049568 Bacteria 2194
509 Ga0501031_0715757 3300049568 Bacteria 643
510 Ga0501032_0006049 3300049569 Bacteria 8924
511 Ga0501032_0044975 3300049569 Bacteria 2987
512 Ga0501032_0090992 3300049569 Bacteria 2025
513 Ga0501032_0940381 3300049569 Bacteria 544
514 Ga0501033_0001198 3300049570 Bacteria 23371
515 Ga0501033_0002685 3300049570 Bacteria 14934
516 Ga0501033_0146538 3300049570 Bacteria 1704
517 Ga0501033_1104080 3300049570 Bacteria 527
518 Ga0501034_0000611 3300049571 Bacteria 56186
519 Ga0501034_0080065 3300049571 Bacteria 3270
520 Ga0501034_1699161 3300049571 Bacteria 504
521 Ga0501037_0000077 3300049573 Bacteria 91081
522 Ga0501037_0068581 3300049573 Bacteria 2582
523 Ga0501038_0054421 3300049574 Bacteria 3442
524 Ga0501038_0146394 3300049574 Bacteria 1928
525 Ga0501039_0013172 3300049575 Bacteria 6320
526 Ga0501042_0540034 3300049578 Bacteria 847
527 Ga0501043_0000114 3300049579 Bacteria 75782
528 Ga0501043_0021577 3300049579 Bacteria 5050
529 Ga0501043_0301776 3300049579 Bacteria 1223
530 Ga0501043_0301906 3300049579 Bacteria 1223
531 Ga0501046_0443277 3300049580 Bacteria 934
532 Ga0501047_0137210 3300049581 Bacteria 2326
533 Ga0501048_0403341 3300049582 Bacteria 977
534 Ga0501068_0075333 3300049584 Bacteria 2064
535 Ga0501068_0089463 3300049584 Bacteria 1898
536 Ga0501068_0126439 3300049584 Bacteria 1597
537 Ga0501068_0594196 3300049584 Bacteria 721
538 Ga0501069_0000016 3300049585 Bacteria 142565
539 Ga0501070_0000450 3300049586 Bacteria 37447
540 Ga0501070_0153410 3300049586 Bacteria 1900
541 Ga0501070_1523495 3300049586 Bacteria 505
542 Ga0501071_0002157 3300049587 Bacteria 11818
543 Ga0501072_0597904 3300049588 Bacteria 870
544 Ga0501073_0015087 3300049589 Bacteria 5606
545 Ga0501074_0000067 3300049590 Bacteria 49686
546 Ga0501080_0002371 3300049742 Bacteria 16432
547 Ga0501080_0475688 3300049742 Bacteria 1118
548 Ga0501080_0680795 3300049742 Bacteria 908
549 Ga0501083_0000111 3300049744 Bacteria 55529
550 Ga0501280_015862 3300049776 Bacteria 1082
551 Ga0501035_0000048 3300049822 Bacteria 146466
552 Ga0501035_0001858 3300049822 Bacteria 21271
553 Ga0501035_0094160 3300049822 Bacteria 2634
554 Ga0501044_0000003 3300049823 Bacteria 345647
555 Ga0501044_0354038 3300049823 Bacteria 1387
556 Ga0501044_0610175 3300049823 Bacteria 983
557 nmdc:mga03683_168965_c1 3300050489 Bacteria 993
558 nmdc:mga03n38_173897_c1 3300050490 Bacteria 1099
559 nmdc:mga03n38_319631_c1 3300050490 Bacteria 838
560 nmdc:mga03n38_560094_c1 3300050490 Bacteria 647
561 nmdc:mga03n38_564302_c1 3300050490 Bacteria 645
562 nmdc:mga0yw44_13252_c1 3300050492 Bacteria 4334
563 nmdc:mga0yw44_492430_c1 3300050492 Bacteria 832
564 nmdc:mga06z11_208041_c1 3300050494 Bacteria 1139
565 nmdc:mga06z11_812958_c1 3300050494 Bacteria 569
566 nmdc:mga06z11_896727_c1 3300050494 Bacteria 540
567 nmdc:mga07m45_380889_c1 3300050496 Bacteria 819
568 nmdc:mga07m45_599695_c1 3300050496 Bacteria 636
569 nmdc:mga05p37_1161233_c1 3300050507 Bacteria 802
570 nmdc:mga0n895_1204254_c1 3300050512 Bacteria 731
571 Ga0500647_0403096 3300053091 Bacteria 554
572 Ga0500562_113988 3300053108 Bacteria 736
573 Ga0500592_024372 3300053116 Bacteria 976
574 Ga0500618_008381 3300053125 Bacteria 2888
575 Ga0500568_0077674 3300053139 Bacteria 1263
576 Ga0500573_0006984 3300053140 Bacteria 6132
577 Ga0500573_0298534 3300053140 Bacteria 806
578 Ga0500616_0061423 3300053153 Bacteria 1945
579 Ga0500627_0038334 3300053158 Bacteria 2048
580 Ga0501084_0392713 3300054114 Bacteria 1172
581 Ga0501084_0402871 3300054114 Bacteria 1156
582 Ga0500661_030783 3300055283 Bacteria 947
583 Ga0587086_114302 3300059507 Bacteria 510
584 Ga0587088_016135 3300059508 Bacteria 1186
585 Ga0587128_139212 3300059630 Bacteria 544
586 Ga0587068_106416 3300059641 Bacteria 594
587 Ga0587075_013271 3300059644 Bacteria 1131
588 Ga0587076_045237 3300059645 Bacteria 838
589 Ga0587071_029025 3300060344 Bacteria 1056
590 Ga0501082_0006930 3300060353 Bacteria 9794

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042006 Ga0439432_057550 Ga0439432_057550_10_495 106
2 3300009092 Ga0105250_10027381 Ga0105250_100273812 111
3 3300041494 Ga0451837_0747757 Ga0451837_0747757_20_433 111
4 3300046507 Ga0495606_0426763 Ga0495606_0426763_252_671 111
5 3300050490 nmdc:mga03n38_560094_c1 nmdc:mga03n38_560094_c1_174_593 111
6 3300053091 Ga0500647_0403096 Ga0500647_0403096_101_520 111
7 3300053108 Ga0500562_113988 Ga0500562_113988_39_464 111
8 iso_pu_bacteria 2885334103 2885342080 113
9 iso_pu_bacteria 2937813078 2937819584 113
10 iso_pu_bacteria 2979742915 2979744935 113
11 3300025273 Ga0209673_1024184 Ga0209673_10241842 116
12 3300059630 Ga0587128_139212 Ga0587128_139212_66_467 117
13 iso_pu_bacteria 2529292951 2530648079 118
14 3300026116 Ga0207674_10231188 Ga0207674_102311882 119
15 3300003214 JGI25165J46597_1000016 JGI25165J46597_1000016132 120
16 3300006038 Ga0075365_10137064 Ga0075365_101370642 120
17 3300006048 Ga0075363_100132438 Ga0075363_1001324382 120
18 3300006177 Ga0075362_10267217 Ga0075362_102672172 120
19 3300025261 Ga0209233_1000068 Ga0209233_1000068133 120
20 3300038443 Ga0395901_1619437 Ga0395901_1619437_19_465 120
21 3300050489 nmdc:mga03683_168965_c1 nmdc:mga03683_168965_c1_418_864 120
22 3300050490 nmdc:mga03n38_173897_c1 nmdc:mga03n38_173897_c1_54_500 120
23 3300050492 nmdc:mga0yw44_492430_c1 nmdc:mga0yw44_492430_c1_77_523 120
24 iso_pu_bacteria 2508501122 2509109045 120
25 iso_pu_bacteria 2510065057 2510303438 120
26 iso_pu_bacteria 2510461069 2510839443 120
27 iso_pu_bacteria 2513237086 2513582351 120
28 iso_pu_bacteria 2513237091 2513616054 120
29 iso_pu_bacteria 2513237140 2513884744 120
30 iso_pu_bacteria 2513237143 2513905139 120
31 iso_pu_bacteria 2515154107 2515607510 120
32 iso_pu_bacteria 2516143018 2516204544 120
33 iso_pu_bacteria 2516653046 2516891638 120
34 iso_pu_bacteria 2524023207 2524450756 120
35 iso_pu_bacteria 2551306084 2551680036 120
36 iso_pu_bacteria 2551306085 2551683609 120
37 iso_pu_bacteria 2551306086 2551690905 120
38 iso_pu_bacteria 2551306089 2551713684 120
39 iso_pu_bacteria 2551306091 2551727619 120
40 iso_pu_bacteria 2551306092 2551737134 120
41 iso_pu_bacteria 2551306093 2551742365 120
42 iso_pu_bacteria 2558860100 2558866323 120
43 iso_pu_bacteria 2599185352 2600191173 120
44 iso_pu_bacteria 2643221557 2643806059 120
45 iso_pu_bacteria 2643221558 2643813883 120
46 iso_pu_bacteria 2643221610 2644066236 120
47 iso_pu_bacteria 2643221618 2644103522 120
48 iso_pu_bacteria 2643221626 2644144401 120
49 iso_pu_bacteria 2643221653 2644297861 120
50 iso_pu_bacteria 2643221655 2644306452 120
51 iso_pu_bacteria 2643221659 2644330642 120
52 iso_pu_bacteria 2643221668 2644377320 120
53 iso_pu_bacteria 2643221675 2644417567 120
54 iso_pu_bacteria 2643221680 2644450963 120
55 iso_pu_bacteria 2643221698 2644542554 120
56 iso_pu_bacteria 2643221712 2644612063 120
57 iso_pu_bacteria 2643221719 2644656114 120
58 iso_pu_bacteria 2643221723 2644671743 120
59 iso_pu_bacteria 2643221726 2644692614 120
60 iso_pu_bacteria 2751185821 2753462663 120
61 iso_pu_bacteria 2775507049 2776911795 120
62 iso_pu_bacteria 2791355094 2792637850 120
63 iso_pu_bacteria 2791355253 2793283396 120
64 iso_pu_bacteria 2818991272 2819245105 120
65 iso_pu_bacteria 2838074704 2838075134 120
66 iso_pu_bacteria 2844163670 2844170208 120
67 iso_pu_bacteria 2850079185 2850079717 120
68 iso_pu_bacteria 2855825444 2855828005 120
69 iso_pu_bacteria 2855839649 2855839775 120
70 iso_pu_bacteria 2858800743 2858803650 120
71 iso_pu_bacteria 2891373044 2891374758 120
72 iso_pu_bacteria 2896384573 2896388543 120
73 iso_pu_bacteria 2899803654 2899808785 120
74 iso_pu_bacteria 2913295892 2913298194 120
75 iso_pu_bacteria 2915986958 2915987790 120
76 iso_pu_bacteria 2915993759 2915997218 120
77 iso_pu_bacteria 2916000859 2916000876 120
78 iso_pu_bacteria 2916007675 2916014112 120
79 iso_pu_bacteria 2916014648 2916021237 120
80 iso_pu_bacteria 2916021584 2916021932 120
81 iso_pu_bacteria 2916028427 2916034159 120
82 iso_pu_bacteria 2916035215 2916040798 120
83 iso_pu_bacteria 2916041962 2916042643 120
84 iso_pu_bacteria 2916048683 2916053606 120
85 iso_pu_bacteria 2916055098 2916057018 120
86 iso_pu_bacteria 2916068649 2916072744 120
87 iso_pu_bacteria 2916076590 2916078433 120
88 iso_pu_bacteria 2920760137 2920763614 120
89 iso_pu_bacteria 2920822456 2920823093 120
90 iso_pu_bacteria 2921201388 2921207090 120
91 iso_pu_bacteria 2921208531 2921213751 120
92 iso_pu_bacteria 2921237296 2921241468 120
93 iso_pu_bacteria 2921244191 2921247032 120
94 iso_pu_bacteria 2921257292 2921262781 120
95 iso_pu_bacteria 2921263974 2921268764 120
96 iso_pu_bacteria 2921282425 2921288161 120
97 iso_pu_bacteria 2921289301 2921293740 120
98 iso_pu_bacteria 2924144063 2924150712 120
99 iso_pu_bacteria 2924150972 2924154276 120
100 iso_pu_bacteria 2924158325 2924164695 120
101 iso_pu_bacteria 2924165586 2924166478 120
102 iso_pu_bacteria 2924172951 2924178899 120
103 iso_pu_bacteria 2924179722 2924184911 120
104 iso_pu_bacteria 2924186466 2924190386 120
105 iso_pu_bacteria 2924193448 2924198939 120
106 iso_pu_bacteria 2924200457 2924200807 120
107 iso_pu_bacteria 2924207177 2924209312 120
108 iso_pu_bacteria 2924214083 2924215019 120
109 iso_pu_bacteria 2924221636 2924228245 120
110 iso_pu_bacteria 2924228884 2924232699 120
111 iso_pu_bacteria 2936996657 2936998505 120
112 iso_pu_bacteria 2937002841 2937007755 120
113 iso_pu_bacteria 2937009748 2937015004 120
114 iso_pu_bacteria 2937016420 2937022252 120
115 iso_pu_bacteria 2937023124 2937023424 120
116 iso_pu_bacteria 2937042894 2937046267 120
117 iso_pu_bacteria 2937049772 2937053316 120
118 iso_pu_bacteria 2937056579 2937057587 120
119 iso_pu_bacteria 2937063883 2937065390 120
120 iso_pu_bacteria 2937071275 2937077168 120
121 iso_pu_bacteria 2937091812 2937098917 120
122 iso_pu_bacteria 2937098957 2937102750 120
123 iso_pu_bacteria 2937106411 2937106464 120
124 iso_pu_bacteria 2937113482 2937119423 120
125 iso_pu_bacteria 2937119839 2937126238 120
126 iso_pu_bacteria 2937126314 2937131661 120
127 iso_pu_bacteria 2941499720 2941500945 120
128 iso_pu_bacteria 2957382221 2957387102 120
129 iso_pu_bacteria 2957388812 2957393331 120
130 iso_pu_bacteria 2957395598 2957397777 120
131 iso_pu_bacteria 2957402308 2957407249 120
132 iso_pu_bacteria 2957408893 2957413370 120
133 iso_pu_bacteria 2957415311 2957417724 120
134 iso_pu_bacteria 2957422303 2957425290 120
135 iso_pu_bacteria 2957430029 2957436838 120
136 iso_pu_bacteria 2957443900 2957447346 120
137 iso_pu_bacteria 2957450854 2957456631 120
138 iso_pu_bacteria 2957457609 2957460649 120
139 iso_pu_bacteria 2957464669 2957469512 120
140 iso_pu_bacteria 2957471148 2957471711 120
141 iso_pu_bacteria 2957478035 2957481931 120
142 iso_pu_bacteria 2957484790 2957490955 120
143 iso_pu_bacteria 2957491536 2957495731 120
144 iso_pu_bacteria 2957498199 2957500717 120
145 iso_pu_bacteria 2957505466 2957508075 120
146 iso_pu_bacteria 2960584000 2960590279 120
147 iso_pu_bacteria 2960597568 2960603335 120
148 iso_pu_bacteria 2960603979 2960607858 120
149 iso_pu_bacteria 2960610863 2960611674 120
150 iso_pu_bacteria 2960617483 2960620075 120
151 iso_pu_bacteria 2960624210 2960626721 120
152 iso_pu_bacteria 2960637947 2960639144 120
153 iso_pu_bacteria 2960645483 2960648134 120
154 iso_pu_bacteria 2960652885 2960654427 120
155 iso_pu_bacteria 2960660292 2960660630 120
156 iso_pu_bacteria 2960667422 2960672135 120
157 iso_pu_bacteria 2960674078 2960678670 120
158 iso_pu_bacteria 2960687367 2960687453 120
159 iso_pu_bacteria 2964607997 2964613464 120
160 iso_pu_bacteria 2964615318 2964618377 120
161 iso_pu_bacteria 2964621998 2964625504 120
162 iso_pu_bacteria 2964628898 2964633736 120
163 iso_pu_bacteria 2964636051 2964643099 120
164 iso_pu_bacteria 2964643177 2964649560 120
165 iso_pu_bacteria 2964649959 2964650114 120
166 iso_pu_bacteria 2964656573 2964663130 120
167 iso_pu_bacteria 2964663802 2964668044 120
168 iso_pu_bacteria 2964670856 2964671341 120
169 iso_pu_bacteria 2964678106 2964682635 120
170 iso_pu_bacteria 2964685014 2964687637 120
171 iso_pu_bacteria 2964691889 2964696618 120
172 iso_pu_bacteria 2964698721 2964703997 120
173 iso_pu_bacteria 2964705432 2964710274 120
174 iso_pu_bacteria 2964712639 2964714318 120
175 iso_pu_bacteria 2964719344 2964721982 120
176 iso_pu_bacteria 2967664464 2967671425 120
177 iso_pu_bacteria 2967671571 2967678474 120
178 iso_pu_bacteria 2967678726 2967682542 120
179 iso_pu_bacteria 2967693043 2967694852 120
180 iso_pu_bacteria 2967699805 2967703586 120
181 iso_pu_bacteria 2967706974 2967712725 120
182 iso_pu_bacteria 2967714385 2967714446 120
183 iso_pu_bacteria 2967721400 2967723770 120
184 iso_pu_bacteria 2967735183 2967739196 120
185 iso_pu_bacteria 2967742019 2967746353 120
186 iso_pu_bacteria 2967748971 2967754717 120
187 iso_pu_bacteria 2967755722 2967758199 120
188 iso_pu_bacteria 2967762386 2967766607 120
189 iso_pu_bacteria 2967769361 2967769888 120
190 iso_pu_bacteria 2967775926 2967776460 120
191 iso_pu_bacteria 2970019648 2970021285 120
192 iso_pu_bacteria 2970033650 2970034751 120
193 iso_pu_bacteria 2970040964 2970041063 120
194 iso_pu_bacteria 2970047711 2970054035 120
195 iso_pu_bacteria 2970054988 2970056901 120
196 iso_pu_bacteria 2970061556 2970062215 120
197 iso_pu_bacteria 2970068827 2970069774 120
198 iso_pu_bacteria 2970076120 2970080804 120
199 iso_pu_bacteria 2970082768 2970088136 120
200 iso_pu_bacteria 2970088815 2970089449 120
201 iso_pu_bacteria 2970095765 2970098843 120
202 iso_pu_bacteria 2970102677 2970106036 120
203 iso_pu_bacteria 2970109326 2970110958 120
204 iso_pu_bacteria 2970116247 2970118211 120
205 iso_pu_bacteria 2970129317 2970131350 120
206 iso_pu_bacteria 2970136068 2970142087 120
207 iso_pu_bacteria 2970149975 2970154565 120
208 iso_pu_bacteria 2970156795 2970163740 120
209 iso_pu_bacteria 2970164137 2970170169 120
210 iso_pu_bacteria 2970170962 2970177667 120
211 iso_pu_bacteria 2970177841 2970183606 120
212 iso_pu_bacteria 2970184632 2970188745 120
213 iso_pu_bacteria 2970191845 2970197505 120
214 iso_pu_bacteria 2977516862 2977521062 120
215 iso_pu_bacteria 2977523885 2977528493 120
216 iso_pu_bacteria 2977537788 2977543738 120
217 iso_pu_bacteria 2977551784 2977554769 120
218 iso_pu_bacteria 2977558990 2977563778 120
219 iso_pu_bacteria 2977565890 2977571509 120
220 iso_pu_bacteria 2977572785 2977574735 120
221 iso_pu_bacteria 2977579622 2977584387 120
222 iso_pu_bacteria 2989349275 2989351922 120
223 iso_pu_bacteria 2989776772 2989777192 120
224 iso_pu_bacteria 648276728 648736824 120
225 iso_pu_bacteria 8003992118 8003992228 120
226 iso_pu_bacteria 8005246636 8005247660 120
227 iso_pu_bacteria 8018150411 8018153484 120
228 iso_pu_bacteria 8054558443 8054562432 120
229 iso_pu_bacteria 2524023209 2524458180 121
230 iso_pu_bacteria 2599185156 2599332805 121
231 iso_pu_bacteria 2791355091 2792621203 121
232 iso_pu_bacteria 2791355092 2792625418 121
233 iso_pu_bacteria 2842298080 2842299635 121
234 iso_pu_bacteria 2842357229 2842361064 121
235 iso_pu_bacteria 2939669807 2939674137 121
236 iso_pu_bacteria 3003930520 3003931474 121
237 iso_pu_bacteria 8005258706 8005263228 121
238 3300005616 Ga0068852_100287989 Ga0068852_1002879892 122
239 3300009093 Ga0105240_10410925 Ga0105240_104109252 122
240 3300009545 Ga0105237_10104123 Ga0105237_101041233 122
241 3300009765 Ga0123341_1036851 Ga0123341_10368512 122
242 3300013105 Ga0157369_10568629 Ga0157369_105686292 122
243 3300025904 Ga0207647_10558768 Ga0207647_105587682 122
244 3300025914 Ga0207671_10131147 Ga0207671_101311472 122
245 3300025924 Ga0207694_10013184 Ga0207694_100131844 122
246 3300026116 Ga0207674_10698860 Ga0207674_106988602 122
247 3300044658 Ga0466972_0051082 Ga0466972_0051082_1328_1774 122
248 3300048917 Ga0496114_1404330 Ga0496114_1404330_53_499 122
249 3300048920 Ga0496117_0491919 Ga0496117_0491919_79_525 122
250 3300048924 Ga0496121_0146228 Ga0496121_0146228_987_1433 122
251 3300048928 Ga0496125_0216091 Ga0496125_0216091_720_1166 122
252 3300048929 Ga0496126_0030068 Ga0496126_0030068_1983_2429 122
253 3300049584 Ga0501068_0126439 Ga0501068_0126439_385_831 122
254 iso_pu_bacteria 2657244999 2657683000 122
255 iso_pu_bacteria 2791355082 2792583124 122
256 iso_pu_bacteria 2802429268 2804750717 122
257 iso_pu_bacteria 2842482326 2842486180 122
258 iso_pu_bacteria 2842509118 2842512858 122
259 iso_pu_bacteria 2979710463 2979717344 122
260 iso_pu_bacteria 8005484373 8005484760 122
261 iso_pu_bacteria 8005682033 8005685304 122
262 iso_pu_bacteria 8046767195 8046770890 122
263 iso_pu_bacteria 8049293176 8049293269 122
264 iso_pu_bacteria 8057575449 8057580501 122
265 3300031731 Ga0307405_11131470 Ga0307405_111314701 123
266 3300031852 Ga0307410_10401307 Ga0307410_104013072 123
267 3300031901 Ga0307406_10907914 Ga0307406_109079141 123
268 3300031903 Ga0307407_10209930 Ga0307407_102099302 123
269 3300031995 Ga0307409_100700652 Ga0307409_1007006521 123
270 3300002987 JGI25159J45721_1000003 JGI25159J45721_1000003123 124
271 3300003187 JGI25151J46595_10006323 JGI25151J46595_100063234 124
272 3300003203 JGI25406J46586_10008349 JGI25406J46586_100083495 124
273 3300003320 rootH2_10011781 rootH2_100117812 124
274 3300003320 rootH2_10049858 rootH2_100498583 124
275 3300003323 rootH1_10021120 rootH1_100211206 124
276 3300003323 rootH1_10107305 rootH1_101073054 124
277 3300003354 JGI25160J50197_1000003 JGI25160J50197_1000003304 124
278 3300003374 JGI25161J50226_1000239 JGI25161J50226_100023925 124
279 3300003771 Ga0055526_1003533 Ga0055526_10035335 124
280 3300003775 Ga0055524_1000434 Ga0055524_100043419 124
281 3300003781 Ga0055536_1009396 Ga0055536_10093963 124
282 3300003791 Ga0055530_10025614 Ga0055530_100256141 124
283 3300003792 Ga0055540_1026319 Ga0055540_10263192 124
284 3300003794 Ga0055531_10017334 Ga0055531_100173342 124
285 3300004625 Ga0055543_1000043 Ga0055543_100004395 124
286 3300005262 Ga0065165_1000025 Ga0065165_100002523 124
287 3300005334 Ga0068869_100348922 Ga0068869_1003489222 124
288 3300005366 Ga0070659_100975335 Ga0070659_1009753351 124
289 3300005455 Ga0070663_100273824 Ga0070663_1002738242 124
290 3300005455 Ga0070663_101093231 Ga0070663_1010932311 124
291 3300005459 Ga0068867_100392100 Ga0068867_1003921001 124
292 3300005539 Ga0068853_101591402 Ga0068853_1015914021 124
293 3300005548 Ga0070665_100102847 Ga0070665_1001028474 124
294 3300005563 Ga0068855_100235898 Ga0068855_1002358984 124
295 3300005985 Ga0081539_10003049 Ga0081539_100030495 124
296 3300006353 Ga0075370_10188960 Ga0075370_101889602 124
297 3300009093 Ga0105240_10867834 Ga0105240_108678341 124
298 3300009093 Ga0105240_12584651 Ga0105240_125846511 124
299 3300009147 Ga0114129_11356429 Ga0114129_113564292 124
300 3300009148 Ga0105243_11318356 Ga0105243_113183562 124
301 3300009545 Ga0105237_10000071 Ga0105237_1000007196 124
302 3300009553 Ga0105249_10251127 Ga0105249_102511271 124
303 3300009553 Ga0105249_11187797 Ga0105249_111877972 124
304 3300010375 Ga0105239_10027474 Ga0105239_100274747 124
305 3300010375 Ga0105239_10182662 Ga0105239_101826621 124
306 3300013105 Ga0157369_10236617 Ga0157369_102366172 124
307 3300013249 Ga0171463_1001 Ga0171463_1001983 124
308 3300013307 Ga0157372_11951626 Ga0157372_119516261 124
309 3300015683 Ga0183362_10531 Ga0183362_105312 124
310 3300015690 Ga0183363_1081 Ga0183363_10819 124
311 3300021320 Ga0214544_1000105 Ga0214544_100010510 124
312 3300021321 Ga0214542_1000029 Ga0214542_1000029160 124
313 3300021327 Ga0214543_1000040 Ga0214543_1000040160 124
314 3300025208 Ga0209436_101403 Ga0209436_1014033 124
315 3300025230 Ga0209563_105256 Ga0209563_1052562 124
316 3300025263 Ga0209565_1056866 Ga0209565_10568662 124
317 3300025284 Ga0209130_1000005 Ga0209130_1000005177 124
318 3300025292 Ga0209676_1001325 Ga0209676_100132511 124
319 3300025294 Ga0209025_1000377 Ga0209025_10003774 124
320 3300025294 Ga0209025_1001341 Ga0209025_100134118 124
321 3300025295 Ga0209564_1000093 Ga0209564_1000093179 124
322 3300025295 Ga0209564_1064075 Ga0209564_10640752 124
323 3300025297 Ga0209758_1061825 Ga0209758_10618252 124
324 3300025298 Ga0209050_1009758 Ga0209050_10097584 124
325 3300025299 Ga0209256_1000027 Ga0209256_1000027236 124
326 3300025299 Ga0209256_1001872 Ga0209256_10018723 124
327 3300025302 Ga0207426_1000015 Ga0207426_1000015422 124
328 3300025303 Ga0209051_1008107 Ga0209051_10081073 124
329 3300025304 Ga0209257_1001105 Ga0209257_100110528 124
330 3300025913 Ga0207695_10596455 Ga0207695_105964551 124
331 3300025914 Ga0207671_10000099 Ga0207671_1000009984 124
332 3300025914 Ga0207671_10039420 Ga0207671_100394204 124
333 3300025942 Ga0207689_10289738 Ga0207689_102897382 124
334 3300025949 Ga0207667_10644288 Ga0207667_106442881 124
335 3300026067 Ga0207678_10223486 Ga0207678_102234862 124
336 3300026067 Ga0207678_10845446 Ga0207678_108454461 124
337 3300026089 Ga0207648_10592794 Ga0207648_105927942 124
338 3300026116 Ga0207674_10404515 Ga0207674_104045152 124
339 3300027111 Ga0209281_1000809 Ga0209281_100080911 124
340 3300028379 Ga0268266_10000391 Ga0268266_1000039117 124
341 3300028800 Ga0265338_10008348 Ga0265338_1000834813 124
342 3300031235 Ga0265330_10033192 Ga0265330_100331923 124
343 3300031249 Ga0265339_10051730 Ga0265339_100517303 124
344 3300031250 Ga0265331_10012154 Ga0265331_100121543 124
345 3300031251 Ga0265327_10032300 Ga0265327_100323002 124
346 3300031344 Ga0265316_10015330 Ga0265316_100153304 124
347 3300031595 Ga0265313_10000962 Ga0265313_100009628 124
348 3300031712 Ga0265342_10026094 Ga0265342_100260944 124
349 3300032002 Ga0307416_100281989 Ga0307416_1002819891 124
350 3300032002 Ga0307416_100316647 Ga0307416_1003166471 124
351 3300035171 Ga0373946_0160169 Ga0373946_0160169_326_754 124
352 3300035695 Ga0373927_0612003 Ga0373927_0612003_277_705 124
353 3300037068 Ga0373925_0147774 Ga0373925_0147774_26_454 124
354 3300037312 Ga0395899_0071063 Ga0395899_0071063_485_913 124
355 3300037418 Ga0395900_0086703 Ga0395900_0086703_617_1045 124
356 3300037466 Ga0395898_1162714 Ga0395898_1162714_203_631 124
357 3300038443 Ga0395901_0443448 Ga0395901_0443448_682_1110 124
358 3300041404 Ga0439436_0007013 Ga0439436_0007013_2861_3289 124
359 3300041406 Ga0439439_0171214 Ga0439439_0171214_32_460 124
360 3300042006 Ga0439432_020030 Ga0439432_020030_1717_2145 124
361 3300042007 Ga0439449_0204367 Ga0439449_0204367_93_521 124
362 3300048920 Ga0496117_0001790 Ga0496117_0001790_144_572 124
363 3300048922 Ga0496119_0288868 Ga0496119_0288868_100_528 124
364 3300048924 Ga0496121_0174972 Ga0496121_0174972_509_937 124
365 3300048925 Ga0496122_0000321 Ga0496122_0000321_17260_17688 124
366 3300048926 Ga0496123_0002294 Ga0496123_0002294_7745_8173 124
367 3300048927 Ga0496124_0000558 Ga0496124_0000558_56254_56682 124
368 3300048928 Ga0496125_0000628 Ga0496125_0000628_7334_7762 124
369 3300048929 Ga0496126_0000378 Ga0496126_0000378_86554_86982 124
370 3300048929 Ga0496126_0086643 Ga0496126_0086643_1089_1517 124
371 3300049568 Ga0501031_0715757 Ga0501031_0715757_64_546 124
372 3300049569 Ga0501032_0044975 Ga0501032_0044975_1984_2466 124
373 3300049569 Ga0501032_0090992 Ga0501032_0090992_284_712 124
374 3300049569 Ga0501032_0940381 Ga0501032_0940381_14_442 124
375 3300049570 Ga0501033_0002685 Ga0501033_0002685_3941_4369 124
376 3300049570 Ga0501033_1104080 Ga0501033_1104080_34_516 124
377 3300049573 Ga0501037_0068581 Ga0501037_0068581_982_1410 124
378 3300049579 Ga0501043_0021577 Ga0501043_0021577_3728_4156 124
379 3300049579 Ga0501043_0301906 Ga0501043_0301906_667_1149 124
380 3300049580 Ga0501046_0443277 Ga0501046_0443277_385_813 124
381 3300049581 Ga0501047_0137210 Ga0501047_0137210_1270_1698 124
382 3300049586 Ga0501070_1523495 Ga0501070_1523495_10_438 124
383 3300049776 Ga0501280_015862 Ga0501280_015862_78_506 124
384 3300049822 Ga0501035_0001858 Ga0501035_0001858_10739_11167 124
385 3300049822 Ga0501035_0094160 Ga0501035_0094160_318_800 124
386 3300049823 Ga0501044_0610175 Ga0501044_0610175_152_580 124
387 3300050496 nmdc:mga07m45_599695_c1 nmdc:mga07m45_599695_c1_79_507 124
388 3300050507 nmdc:mga05p37_1161233_c1 nmdc:mga05p37_1161233_c1_75_503 124
389 3300053140 Ga0500573_0006984 Ga0500573_0006984_2735_3163 124
390 3300053140 Ga0500573_0298534 Ga0500573_0298534_241_669 124
391 iso_pu_bacteria 2738543024 2739308607 124
392 3300005339 Ga0070660_100027460 Ga0070660_1000274604 125
393 3300005344 Ga0070661_100013469 Ga0070661_1000134692 125
394 3300005366 Ga0070659_100060715 Ga0070659_1000607153 125
395 3300005366 Ga0070659_100555824 Ga0070659_1005558242 125
396 3300005539 Ga0068853_100039407 Ga0068853_1000394073 125
397 3300005563 Ga0068855_101384584 Ga0068855_1013845841 125
398 3300005578 Ga0068854_100089422 Ga0068854_1000894222 125
399 3300005614 Ga0068856_100112834 Ga0068856_1001128342 125
400 3300005614 Ga0068856_100115814 Ga0068856_1001158141 125
401 3300005616 Ga0068852_100050929 Ga0068852_1000509293 125
402 3300005616 Ga0068852_100113029 Ga0068852_1001130293 125
403 3300009093 Ga0105240_10040307 Ga0105240_100403072 125
404 3300009545 Ga0105237_10387028 Ga0105237_103870282 125
405 3300009551 Ga0105238_10015176 Ga0105238_100151762 125
406 3300009765 Ga0123341_1000054 Ga0123341_100005412 125
407 3300009766 Ga0123342_1013519 Ga0123342_10135195 125
408 3300010375 Ga0105239_10373235 Ga0105239_103732353 125
409 3300013102 Ga0157371_10043386 Ga0157371_100433863 125
410 3300013102 Ga0157371_10167960 Ga0157371_101679602 125
411 3300013104 Ga0157370_10150919 Ga0157370_101509192 125
412 3300013105 Ga0157369_10105860 Ga0157369_101058603 125
413 3300013307 Ga0157372_10208590 Ga0157372_102085902 125
414 3300013307 Ga0157372_11937034 Ga0157372_119370342 125
415 3300014497 Ga0182008_10495417 Ga0182008_104954171 125
416 3300015265 Ga0182005_1004662 Ga0182005_10046622 125
417 3300025294 Ga0209025_1039114 Ga0209025_10391142 125
418 3300025909 Ga0207705_10032925 Ga0207705_100329252 125
419 3300025911 Ga0207654_11167695 Ga0207654_111676951 125
420 3300025913 Ga0207695_10052067 Ga0207695_100520672 125
421 3300025913 Ga0207695_10209038 Ga0207695_102090382 125
422 3300025914 Ga0207671_10134873 Ga0207671_101348732 125
423 3300025919 Ga0207657_10059244 Ga0207657_100592443 125
424 3300025920 Ga0207649_10111513 Ga0207649_101115132 125
425 3300025920 Ga0207649_10475181 Ga0207649_104751812 125
426 3300025924 Ga0207694_10048161 Ga0207694_100481613 125
427 3300025932 Ga0207690_10096223 Ga0207690_100962232 125
428 3300025932 Ga0207690_10638530 Ga0207690_106385302 125
429 3300025949 Ga0207667_10027567 Ga0207667_100275672 125
430 3300026041 Ga0207639_10237092 Ga0207639_102370922 125
431 3300026041 Ga0207639_12268190 Ga0207639_122681901 125
432 3300026067 Ga0207678_10177741 Ga0207678_101777412 125
433 3300026078 Ga0207702_10083818 Ga0207702_100838182 125
434 3300026142 Ga0207698_10041703 Ga0207698_100417032 125
435 3300031730 Ga0307516_10093184 Ga0307516_100931843 125
436 3300037312 Ga0395899_0555648 Ga0395899_0555648_139_570 125
437 3300037418 Ga0395900_0194679 Ga0395900_0194679_1189_1620 125
438 3300037471 Ga0395905_0817723 Ga0395905_0817723_368_799 125
439 3300044842 Ga0466957_0220052 Ga0466957_0220052_129_560 125
440 3300047472 Ga0495686_0234225 Ga0495686_0234225_244_675 125
441 3300048906 Ga0496103_0901182 Ga0496103_0901182_73_519 125
442 3300048922 Ga0496119_0421791 Ga0496119_0421791_114_545 125
443 3300049568 Ga0501031_0075511 Ga0501031_0075511_248_679 125
444 3300049569 Ga0501032_0006049 Ga0501032_0006049_5321_5752 125
445 3300049570 Ga0501033_0001198 Ga0501033_0001198_18521_18952 125
446 3300049571 Ga0501034_0000611 Ga0501034_0000611_49024_49455 125
447 3300049571 Ga0501034_0080065 Ga0501034_0080065_2524_2955 125
448 3300049573 Ga0501037_0000077 Ga0501037_0000077_82904_83335 125
449 3300049574 Ga0501038_0054421 Ga0501038_0054421_935_1366 125
450 3300049579 Ga0501043_0000114 Ga0501043_0000114_41256_41687 125
451 3300049584 Ga0501068_0075333 Ga0501068_0075333_1193_1624 125
452 3300049585 Ga0501069_0000016 Ga0501069_0000016_34535_34966 125
453 3300049586 Ga0501070_0000450 Ga0501070_0000450_26829_27260 125
454 3300049587 Ga0501071_0002157 Ga0501071_0002157_5439_5870 125
455 3300049589 Ga0501073_0015087 Ga0501073_0015087_1472_1903 125
456 3300049590 Ga0501074_0000067 Ga0501074_0000067_19083_19514 125
457 3300049742 Ga0501080_0002371 Ga0501080_0002371_14344_14775 125
458 3300049744 Ga0501083_0000111 Ga0501083_0000111_35335_35766 125
459 3300049822 Ga0501035_0000048 Ga0501035_0000048_144410_144841 125
460 3300049823 Ga0501044_0000003 Ga0501044_0000003_109137_109568 125
461 3300053139 Ga0500568_0077674 Ga0500568_0077674_126_557 125
462 3300054114 Ga0501084_0392713 Ga0501084_0392713_159_590 125
463 3300059507 Ga0587086_114302 Ga0587086_114302_40_471 125
464 3300059508 Ga0587088_016135 Ga0587088_016135_76_507 125
465 3300059641 Ga0587068_106416 Ga0587068_106416_30_461 125
466 3300059644 Ga0587075_013271 Ga0587075_013271_463_894 125
467 3300059645 Ga0587076_045237 Ga0587076_045237_276_707 125
468 3300060344 Ga0587071_029025 Ga0587071_029025_199_630 125
469 3300060353 Ga0501082_0006930 Ga0501082_0006930_6732_7163 125
470 iso_pu_bacteria 2582581299 2585229582 125
471 iso_pu_bacteria 2643221634 2644194537 125
472 iso_pu_bacteria 2791355264 2793348405 125
473 iso_pu_bacteria 2802429605 2805928083 125
474 iso_pu_bacteria 2802429606 2805935444 125
475 iso_pu_bacteria 2838042994 2838048798 125
476 iso_pu_bacteria 2842192696 2842198085 125
477 iso_pu_bacteria 2842264693 2842270379 125
478 iso_pu_bacteria 2842285085 2842286567 125
479 iso_pu_bacteria 2842311132 2842317201 125
480 iso_pu_bacteria 2842317721 2842323735 125
481 iso_pu_bacteria 2842402390 2842403880 125
482 iso_pu_bacteria 2842409023 2842410417 125
483 iso_pu_bacteria 2842415677 2842417065 125
484 iso_pu_bacteria 2842428310 2842434201 125
485 iso_pu_bacteria 2842434925 2842440534 125
486 iso_pu_bacteria 2842441272 2842447186 125
487 iso_pu_bacteria 2842462802 2842468629 125
488 iso_pu_bacteria 2842469257 2842475139 125
489 iso_pu_bacteria 2842489311 2842495406 125
490 iso_pu_bacteria 2842495871 2842499990 125
491 iso_pu_bacteria 2919450847 2919451392 125
492 iso_pu_bacteria 8001845381 8001847917 125
493 iso_pu_bacteria 8024501048 8024502273 125
494 3300003323 rootH1_10019782 rootH1_100197823 126
495 3300005328 Ga0070676_10212871 Ga0070676_102128712 126
496 3300005329 Ga0070683_100057160 Ga0070683_1000571603 126
497 3300005335 Ga0070666_10201911 Ga0070666_102019112 126
498 3300005339 Ga0070660_100285741 Ga0070660_1002857412 126
499 3300005344 Ga0070661_100008136 Ga0070661_10000813610 126
500 3300005344 Ga0070661_100205093 Ga0070661_1002050932 126
501 3300005347 Ga0070668_100105865 Ga0070668_1001058652 126
502 3300005354 Ga0070675_100192304 Ga0070675_1001923042 126
503 3300005355 Ga0070671_100225258 Ga0070671_1002252582 126
504 3300005364 Ga0070673_100018723 Ga0070673_1000187233 126
505 3300005366 Ga0070659_100012347 Ga0070659_1000123478 126
506 3300005366 Ga0070659_100101025 Ga0070659_1001010253 126
507 3300005441 Ga0070700_100414507 Ga0070700_1004145071 126
508 3300005455 Ga0070663_100074188 Ga0070663_1000741883 126
509 3300005456 Ga0070678_100138538 Ga0070678_1001385382 126
510 3300005530 Ga0070679_100837402 Ga0070679_1008374021 126
511 3300005535 Ga0070684_100381065 Ga0070684_1003810652 126
512 3300005539 Ga0068853_100077154 Ga0068853_1000771542 126
513 3300005543 Ga0070672_100786425 Ga0070672_1007864252 126
514 3300005547 Ga0070693_100718899 Ga0070693_1007188991 126
515 3300005548 Ga0070665_100096659 Ga0070665_1000966593 126
516 3300005563 Ga0068855_100025742 Ga0068855_1000257428 126
517 3300005563 Ga0068855_100080077 Ga0068855_1000800774 126
518 3300005577 Ga0068857_100007527 Ga0068857_1000075274 126
519 3300005578 Ga0068854_100066665 Ga0068854_1000666653 126
520 3300005578 Ga0068854_100080736 Ga0068854_1000807362 126
521 3300005614 Ga0068856_100223318 Ga0068856_1002233182 126
522 3300005614 Ga0068856_100249888 Ga0068856_1002498882 126
523 3300005614 Ga0068856_100498433 Ga0068856_1004984332 126
524 3300005616 Ga0068852_100007964 Ga0068852_1000079644 126
525 3300005616 Ga0068852_100045127 Ga0068852_1000451272 126
526 3300005616 Ga0068852_100591142 Ga0068852_1005911422 126
527 3300005718 Ga0068866_10600330 Ga0068866_106003302 126
528 3300005834 Ga0068851_10016419 Ga0068851_100164193 126
529 3300005834 Ga0068851_10058947 Ga0068851_100589472 126
530 3300005842 Ga0068858_100211506 Ga0068858_1002115063 126
531 3300006881 Ga0068865_100392488 Ga0068865_1003924882 126
532 3300009093 Ga0105240_10189863 Ga0105240_101898632 126
533 3300009098 Ga0105245_10199319 Ga0105245_101993192 126
534 3300009174 Ga0105241_11294441 Ga0105241_112944411 126
535 3300009545 Ga0105237_10026573 Ga0105237_100265733 126
536 3300009551 Ga0105238_10052632 Ga0105238_100526324 126
537 3300009551 Ga0105238_10211418 Ga0105238_102114182 126
538 3300010375 Ga0105239_10201351 Ga0105239_102013512 126
539 3300010375 Ga0105239_10315656 Ga0105239_103156563 126
540 3300010375 Ga0105239_10328171 Ga0105239_103281712 126
541 3300013102 Ga0157371_10765515 Ga0157371_107655152 126
542 3300013104 Ga0157370_10148729 Ga0157370_101487293 126
543 3300013104 Ga0157370_10709596 Ga0157370_107095962 126
544 3300013296 Ga0157374_10432640 Ga0157374_104326402 126
545 3300013297 Ga0157378_10054679 Ga0157378_100546792 126
546 3300013297 Ga0157378_10266716 Ga0157378_102667162 126
547 3300013297 Ga0157378_11196274 Ga0157378_111962741 126
548 3300013306 Ga0163162_11416224 Ga0163162_114162242 126
549 3300013307 Ga0157372_10468223 Ga0157372_104682232 126
550 3300013307 Ga0157372_12741704 Ga0157372_127417041 126
551 3300013308 Ga0157375_11133313 Ga0157375_111333132 126
552 3300013308 Ga0157375_11531052 Ga0157375_115310522 126
553 3300014497 Ga0182008_10072474 Ga0182008_100724742 126
554 3300014969 Ga0157376_10483449 Ga0157376_104834492 126
555 3300025321 Ga0207656_10093476 Ga0207656_100934762 126
556 3300025899 Ga0207642_10215804 Ga0207642_102158042 126
557 3300025911 Ga0207654_10022493 Ga0207654_100224934 126
558 3300025913 Ga0207695_10590437 Ga0207695_105904371 126
559 3300025914 Ga0207671_10044229 Ga0207671_100442294 126
560 3300025919 Ga0207657_10003404 Ga0207657_100034048 126
561 3300025920 Ga0207649_10025092 Ga0207649_100250921 126
562 3300025920 Ga0207649_10025957 Ga0207649_100259573 126
563 3300025924 Ga0207694_10059881 Ga0207694_100598813 126
564 3300025924 Ga0207694_10999250 Ga0207694_109992502 126
565 3300025926 Ga0207659_10126363 Ga0207659_101263633 126
566 3300025931 Ga0207644_10309605 Ga0207644_103096052 126
567 3300025932 Ga0207690_10199653 Ga0207690_101996533 126
568 3300025937 Ga0207669_10029972 Ga0207669_100299724 126
569 3300025938 Ga0207704_11032274 Ga0207704_110322741 126
570 3300025940 Ga0207691_10022269 Ga0207691_100222694 126
571 3300025944 Ga0207661_10156209 Ga0207661_101562092 126
572 3300025945 Ga0207679_10196903 Ga0207679_101969032 126
573 3300025949 Ga0207667_10217769 Ga0207667_102177692 126
574 3300025949 Ga0207667_10716407 Ga0207667_107164072 126
575 3300025972 Ga0207668_10524986 Ga0207668_105249862 126
576 3300025981 Ga0207640_10062710 Ga0207640_100627103 126
577 3300025981 Ga0207640_11539430 Ga0207640_115394301 126
578 3300025986 Ga0207658_11409788 Ga0207658_114097882 126
579 3300026023 Ga0207677_10060700 Ga0207677_100607003 126
580 3300026035 Ga0207703_10165180 Ga0207703_101651801 126
581 3300026041 Ga0207639_10016390 Ga0207639_100163906 126
582 3300026067 Ga0207678_10118412 Ga0207678_101184122 126
583 3300026078 Ga0207702_10026350 Ga0207702_100263502 126
584 3300026078 Ga0207702_10321314 Ga0207702_103213142 126
585 3300026089 Ga0207648_10221475 Ga0207648_102214752 126
586 3300026116 Ga0207674_10004838 Ga0207674_100048384 126
587 3300026116 Ga0207674_10201622 Ga0207674_102016224 126
588 3300026121 Ga0207683_10088066 Ga0207683_100880663 126
589 3300026121 Ga0207683_10321178 Ga0207683_103211783 126
590 3300026142 Ga0207698_10015331 Ga0207698_100153312 126
591 3300026142 Ga0207698_10072190 Ga0207698_100721902 126
592 3300028379 Ga0268266_10742379 Ga0268266_107423792 126
593 3300028577 Ga0265318_10031577 Ga0265318_100315773 126
594 3300031247 Ga0265340_10218257 Ga0265340_102182572 126
595 3300031711 Ga0265314_10046761 Ga0265314_100467613 126
596 3300034816 Ga0373930_0022221 Ga0373930_0022221_58_492 126
597 3300035090 Ga0373949_0019242 Ga0373949_0019242_821_1255 126
598 3300035092 Ga0373952_0042611 Ga0373952_0042611_28_462 126
599 3300035112 Ga0373932_0042040 Ga0373932_0042040_297_731 126
600 3300035115 Ga0373941_0165943 Ga0373941_0165943_339_773 126
601 3300035691 Ga0373931_0202569 Ga0373931_0202569_189_623 126
602 3300037068 Ga0373925_0848465 Ga0373925_0848465_92_526 126
603 3300037471 Ga0395905_0205572 Ga0395905_0205572_1145_1591 126
604 3300046507 Ga0495606_0145157 Ga0495606_0145157_598_1032 126
605 3300048917 Ga0496114_0234461 Ga0496114_0234461_475_909 126
606 3300048923 Ga0496120_0250315 Ga0496120_0250315_69_506 126
607 3300048924 Ga0496121_0151447 Ga0496121_0151447_874_1311 126
608 3300049571 Ga0501034_1699161 Ga0501034_1699161_39_473 126
609 3300049742 Ga0501080_0475688 Ga0501080_0475688_269_715 126
610 3300050490 nmdc:mga03n38_564302_c1 nmdc:mga03n38_564302_c1_68_502 126
611 3300054114 Ga0501084_0402871 Ga0501084_0402871_33_467 126
612 3300055283 Ga0500661_030783 Ga0500661_030783_454_888 126
613 iso_pu_bacteria 2509276021 2509388704 126
614 iso_pu_bacteria 2509276033 2509444292 126
615 iso_pu_bacteria 2510065019 2510131145 126
616 iso_pu_bacteria 2510917028 2511186902 126
617 iso_pu_bacteria 2513237088 2513597362 126
618 iso_pu_bacteria 2513237090 2513608194 126
619 iso_pu_bacteria 2513237138 2513869081 126
620 iso_pu_bacteria 2513237144 2513911253 126
621 iso_pu_bacteria 2513237146 2513924549 126
622 iso_pu_bacteria 2515075009 2515110077 126
623 iso_pu_bacteria 2534681796 2535514836 126
624 iso_pu_bacteria 2582581294 2585205568 126
625 iso_pu_bacteria 2582581867 2585398821 126
626 iso_pu_bacteria 2585427528 2585541942 126
627 iso_pu_bacteria 2585427590 2585819059 126
628 iso_pu_bacteria 2585427593 2585840410 126
629 iso_pu_bacteria 2585427594 2585843974 126
630 iso_pu_bacteria 2599185170 2599419487 126
631 iso_pu_bacteria 2599185301 2599939897 126
632 iso_pu_bacteria 2615840624 2616293687 126
633 iso_pu_bacteria 2643221599 2644004665 126
634 iso_pu_bacteria 2643221623 2644132708 126
635 iso_pu_bacteria 2643221643 2644237421 126
636 iso_pu_bacteria 2693429783 2694632522 126
637 iso_pu_bacteria 2693429784 2694639747 126
638 iso_pu_bacteria 2718217882 2719179293 126
639 iso_pu_bacteria 2718217927 2719383863 126
640 iso_pu_bacteria 2718217997 2719663653 126
641 iso_pu_bacteria 2718218009 2719729963 126
642 iso_pu_bacteria 2718218199 2720490072 126
643 iso_pu_bacteria 2718218232 2720611452 126
644 iso_pu_bacteria 2718218233 2720618302 126
645 iso_pu_bacteria 2718218235 2720629705 126
646 iso_pu_bacteria 2718218269 2720773401 126
647 iso_pu_bacteria 2718218363 2721145386 126
648 iso_pu_bacteria 2718218365 2721156902 126
649 iso_pu_bacteria 2718218366 2721162281 126
650 iso_pu_bacteria 2718218423 2721397633 126
651 iso_pu_bacteria 2721755514 2722838451 126
652 iso_pu_bacteria 2721755556 2723025075 126
653 iso_pu_bacteria 2721755684 2723558657 126
654 iso_pu_bacteria 2721755685 2723565227 126
655 iso_pu_bacteria 2721755809 2724036443 126
656 iso_pu_bacteria 2721755810 2724042719 126
657 iso_pu_bacteria 2721755819 2724088008 126
658 iso_pu_bacteria 2721755822 2724102492 126
659 iso_pu_bacteria 2721755823 2724108392 126
660 iso_pu_bacteria 2728369352 2730106011 126
661 iso_pu_bacteria 2728369365 2730162530 126
662 iso_pu_bacteria 2728369397 2730296534 126
663 iso_pu_bacteria 2738541293 2738804511 126
664 iso_pu_bacteria 2738541333 2739036833 126
665 iso_pu_bacteria 2791355259 2793313935 126
666 iso_pu_bacteria 2791355260 2793322229 126
667 iso_pu_bacteria 2791355261 2793329950 126
668 iso_pu_bacteria 2791355263 2793344853 126
669 iso_pu_bacteria 2791355267 2793365620 126
670 iso_pu_bacteria 2802429633 2806046759 126
671 iso_pu_bacteria 2802429634 2806051520 126
672 iso_pu_bacteria 2802429635 2806059509 126
673 iso_pu_bacteria 2802429636 2806066526 126
674 iso_pu_bacteria 2802429637 2806073584 126
675 iso_pu_bacteria 2838016132 2838022536 126
676 iso_pu_bacteria 2838022645 2838028479 126
677 iso_pu_bacteria 2838035591 2838039981 126
678 iso_pu_bacteria 2838048938 2838053852 126
679 iso_pu_bacteria 2838061910 2838065936 126
680 iso_pu_bacteria 2838068647 2838070808 126
681 iso_pu_bacteria 2838661181 2838666134 126
682 iso_pu_bacteria 2838680041 2838680319 126
683 iso_pu_bacteria 2838694306 2838695649 126
684 iso_pu_bacteria 2838707686 2838709025 126
685 iso_pu_bacteria 2841864319 2841868816 126
686 iso_pu_bacteria 2842077413 2842079740 126
687 iso_pu_bacteria 2842118031 2842120358 126
688 iso_pu_bacteria 2842198810 2842204507 126
689 iso_pu_bacteria 2842205361 2842211108 126
690 iso_pu_bacteria 2842237096 2842238436 126
691 iso_pu_bacteria 2842278818 2842284561 126
692 iso_pu_bacteria 2842291075 2842293401 126
693 iso_pu_bacteria 2842341865 2842344348 126
694 iso_pu_bacteria 2842363717 2842367393 126
695 iso_pu_bacteria 2842370503 2842370782 126
696 iso_pu_bacteria 2842377471 2842379798 126
697 iso_pu_bacteria 2842384541 2842386869 126
698 iso_pu_bacteria 2842395702 2842401779 126
699 iso_pu_bacteria 2842422224 2842424423 126
700 iso_pu_bacteria 2842447887 2842452920 126
701 iso_pu_bacteria 2847670302 2847672032 126
702 iso_pu_bacteria 2847686936 2847688342 126
703 iso_pu_bacteria 2856314179 2856318228 126
704 iso_pu_bacteria 2856356410 2856358857 126
705 iso_pu_bacteria 2856364286 2856364875 126
706 iso_pu_bacteria 2857349434 2857354869 126
707 iso_pu_bacteria 2869285874 2869289676 126
708 iso_pu_bacteria 2871429161 2871431742 126
709 iso_pu_bacteria 2871444079 2871449466 126
710 iso_pu_bacteria 2871488783 2871494142 126
711 iso_pu_bacteria 2871495908 2871499004 126
712 iso_pu_bacteria 2874102143 2874103966 126
713 iso_pu_bacteria 2874146452 2874155420 126
714 iso_pu_bacteria 2874155637 2874162277 126
715 iso_pu_bacteria 2876369609 2876375286 126
716 iso_pu_bacteria 2876377896 2876383631 126
717 iso_pu_bacteria 2876392853 2876398821 126
718 iso_pu_bacteria 2876413966 2876420765 126
719 iso_pu_bacteria 2878035449 2878037540 126
720 iso_pu_bacteria 2878745973 2878748348 126
721 iso_pu_bacteria 2878753008 2878756717 126
722 iso_pu_bacteria 2878760144 2878763214 126
723 iso_pu_bacteria 2878767105 2878770192 126
724 iso_pu_bacteria 2881161766 2881163034 126
725 iso_pu_bacteria 2881845957 2881851061 126
726 iso_pu_bacteria 2881861095 2881862540 126
727 iso_pu_bacteria 2882912400 2882915407 126
728 iso_pu_bacteria 2885305155 2885311969 126
729 iso_pu_bacteria 2885318864 2885325345 126
730 iso_pu_bacteria 2885326080 2885329516 126
731 iso_pu_bacteria 2888350351 2888350867 126
732 iso_pu_bacteria 2889010040 2889013214 126
733 iso_pu_bacteria 2889016732 2889021934 126
734 iso_pu_bacteria 2903492973 2903502354 126
735 iso_pu_bacteria 2903492973 2903506025 126
736 iso_pu_bacteria 2903540706 2903543805 126
737 iso_pu_bacteria 2904659560 2904665353 126
738 iso_pu_bacteria 2906308376 2906311965 126
739 iso_pu_bacteria 2906321335 2906323703 126
740 iso_pu_bacteria 2906328253 2906331506 126
741 iso_pu_bacteria 2906354277 2906355129 126
742 iso_pu_bacteria 2906414383 2906418265 126
743 iso_pu_bacteria 2922130491 2922136673 126
744 iso_pu_bacteria 2922185730 2922190562 126
745 iso_pu_bacteria 2923556063 2923556453 126
746 iso_pu_bacteria 2924726620 2924733135 126
747 iso_pu_bacteria 2924784321 2924788306 126
748 iso_pu_bacteria 2933016740 2933020263 126
749 iso_pu_bacteria 2933599457 2933601611 126
750 iso_pu_bacteria 2935894831 2935896171 126
751 iso_pu_bacteria 2936381700 2936387157 126
752 iso_pu_bacteria 2937813078 2937818212 126
753 iso_pu_bacteria 2937891427 2937896415 126
754 iso_pu_bacteria 2937994558 2937997655 126
755 iso_pu_bacteria 2938014810 2938022371 126
756 iso_pu_bacteria 2958041894 2958045475 126
757 iso_pu_bacteria 2958100919 2958104015 126
758 iso_pu_bacteria 2958115193 2958116698 126
759 iso_pu_bacteria 2958130278 2958134049 126
760 iso_pu_bacteria 2958165035 2958168129 126
761 iso_pu_bacteria 2958179912 2958183695 126
762 iso_pu_bacteria 2961077736 2961081661 126
763 iso_pu_bacteria 2961114664 2961120353 126
764 iso_pu_bacteria 2961163497 2961166594 126
765 iso_pu_bacteria 2961170736 2961173007 126
766 iso_pu_bacteria 2965018300 2965021417 126
767 iso_pu_bacteria 2965062239 2965070151 126
768 iso_pu_bacteria 2965119406 2965122593 126
769 iso_pu_bacteria 2967996073 2967998218 126
770 iso_pu_bacteria 2968003550 2968008870 126
771 iso_pu_bacteria 2968091066 2968095694 126
772 iso_pu_bacteria 2968097103 2968099614 126
773 iso_pu_bacteria 2968110612 2968116820 126
774 iso_pu_bacteria 2968117919 2968118546 126
775 iso_pu_bacteria 2968128360 2968131878 126
776 iso_pu_bacteria 2968171901 2968174999 126
777 iso_pu_bacteria 2970503327 2970505601 126
778 iso_pu_bacteria 2970554993 2970558058 126
779 iso_pu_bacteria 2977821940 2977825897 126
780 iso_pu_bacteria 2977843712 2977851308 126
781 iso_pu_bacteria 2977858184 2977860283 126
782 iso_pu_bacteria 2977864932 2977869127 126
783 iso_pu_bacteria 2977942078 2977946652 126
784 iso_pu_bacteria 2977971508 2977974629 126
785 iso_pu_bacteria 2979779861 2979781245 126
786 iso_pu_bacteria 2979808191 2979810322 126
787 iso_pu_bacteria 2987636660 2987643471 126
788 iso_pu_bacteria 2987652177 2987654952 126
789 iso_pu_bacteria 2987659509 2987662605 126
790 iso_pu_bacteria 2996341866 2996347094 126
791 iso_pu_bacteria 2996887358 2996888255 126
792 iso_pu_bacteria 2996893221 2996897864 126
793 iso_pu_bacteria 3004188549 3004191656 126
794 iso_pu_bacteria 3004203850 3004207016 126
795 iso_pu_bacteria 3005409236 3005410906 126
796 iso_pu_bacteria 3005445848 3005445945 126
797 iso_pu_bacteria 3005452660 3005456622 126
798 iso_pu_bacteria 8002285264 8002288015 126
799 iso_pu_bacteria 8004374579 8004378305 126
800 iso_pu_bacteria 8004387939 8004391554 126
801 iso_pu_bacteria 8004445564 8004449249 126
802 iso_pu_bacteria 8004640170 8004646143 126
803 iso_pu_bacteria 8004703790 8004705043 126
804 iso_pu_bacteria 8004714634 8004716923 126
805 iso_pu_bacteria 8005258706 8005261193 126
806 iso_pu_bacteria 8005275841 8005278569 126
807 iso_pu_bacteria 8005282627 8005282891 126
808 iso_pu_bacteria 8005289223 8005291363 126
809 iso_pu_bacteria 8005301065 8005305736 126
810 iso_pu_bacteria 8005321885 8005322782 126
811 iso_pu_bacteria 8005382845 8005385053 126
812 iso_pu_bacteria 8005395548 8005399870 126
813 iso_pu_bacteria 8005430974 8005432668 126
814 iso_pu_bacteria 8005460587 8005460713 126
815 iso_pu_bacteria 8005497431 8005498397 126
816 iso_pu_bacteria 8005542996 8005543508 126
817 iso_pu_bacteria 8005556819 8005560321 126
818 iso_pu_bacteria 8005563573 8005564218 126
819 iso_pu_bacteria 8005570704 8005573782 126
820 iso_pu_bacteria 8005619151 8005619588 126
821 iso_pu_bacteria 8005626139 8005628154 126
822 iso_pu_bacteria 8005668836 8005669806 126
823 iso_pu_bacteria 8005688590 8005692509 126
824 iso_pu_bacteria 8005695170 8005699553 126
825 iso_pu_bacteria 8018127388 8018132830 126
826 iso_pu_bacteria 8018163183 8018167297 126
827 iso_pu_bacteria 8018176218 8018181782 126
828 iso_pu_bacteria 8024479707 8024480004 126
829 iso_pu_bacteria 8056375014 8056376213 126
830 3300002739 JGI25158J39367_1032113 JGI25158J39367_10321131 127
831 3300002987 JGI25159J45721_1002037 JGI25159J45721_10020377 127
832 3300003354 JGI25160J50197_1000012 JGI25160J50197_100001214 127
833 3300003374 JGI25161J50226_1000002 JGI25161J50226_1000002166 127
834 3300004625 Ga0055543_1000050 Ga0055543_100005084 127
835 3300005262 Ga0065165_1000031 Ga0065165_1000031179 127
836 3300005544 Ga0070686_100090655 Ga0070686_1000906552 127
837 3300025208 Ga0209436_111980 Ga0209436_1119801 127
838 3300025284 Ga0209130_1000028 Ga0209130_1000028283 127
839 3300025302 Ga0207426_1000012 Ga0207426_1000012299 127
840 3300031456 Ga0307513_10189961 Ga0307513_101899612 127
841 3300046507 Ga0495606_0354703 Ga0495606_0354703_212_658 127
842 3300046660 Ga0495625_0148169 Ga0495625_0148169_862_1308 127
843 3300049570 Ga0501033_0146538 Ga0501033_0146538_115_552 127
844 3300049574 Ga0501038_0146394 Ga0501038_0146394_27_464 127
845 3300049575 Ga0501039_0013172 Ga0501039_0013172_1644_2081 127
846 3300049578 Ga0501042_0540034 Ga0501042_0540034_52_489 127
847 3300049579 Ga0501043_0301776 Ga0501043_0301776_135_572 127
848 3300049582 Ga0501048_0403341 Ga0501048_0403341_326_763 127
849 3300049584 Ga0501068_0089463 Ga0501068_0089463_1221_1658 127
850 3300049742 Ga0501080_0680795 Ga0501080_0680795_26_463 127
851 iso_pu_bacteria 2958172287 2958179178 127
852 3300049584 Ga0501068_0594196 Ga0501068_0594196_164_604 128
853 3300049588 Ga0501072_0597904 Ga0501072_0597904_374_814 128
854 3300005262 Ga0065165_1027649 Ga0065165_10276492 129
855 3300009093 Ga0105240_10210247 Ga0105240_102102472 129
856 3300013104 Ga0157370_10729841 Ga0157370_107298412 129
857 3300025294 Ga0209025_1019667 Ga0209025_10196674 129
858 3300031852 Ga0307410_10264206 Ga0307410_102642062 129
859 3300046506 Ga0495583_0033574 Ga0495583_0033574_1354_1833 129
860 3300046507 Ga0495606_0068359 Ga0495606_0068359_1501_1980 129
861 3300046515 Ga0495620_0063464 Ga0495620_0063464_303_782 129
862 3300046616 Ga0495668_0039174 Ga0495668_0039174_1273_1752 129
863 3300046660 Ga0495625_0025590 Ga0495625_0025590_428_907 129
864 3300046665 Ga0495661_0020237 Ga0495661_0020237_3480_3959 129
865 3300047472 Ga0495686_0099734 Ga0495686_0099734_421_900 129
866 3300048922 Ga0496119_0194681 Ga0496119_0194681_381_857 129
867 3300048923 Ga0496120_0008764 Ga0496120_0008764_2913_3356 129
868 3300048924 Ga0496121_0123153 Ga0496121_0123153_357_833 129
869 3300048924 Ga0496121_0466751 Ga0496121_0466751_209_685 129
870 3300048925 Ga0496122_0497265 Ga0496122_0497265_32_508 129
871 3300048927 Ga0496124_0789793 Ga0496124_0789793_77_553 129
872 3300048929 Ga0496126_0446599 Ga0496126_0446599_330_806 129
873 3300049586 Ga0501070_0153410 Ga0501070_0153410_1132_1578 129
874 3300049823 Ga0501044_0354038 Ga0501044_0354038_127_573 129
875 3300050496 nmdc:mga07m45_380889_c1 nmdc:mga07m45_380889_c1_161_637 129
876 3300002067 JGI24735J21928_10086643 JGI24735J21928_100866432 130
877 3300002741 JGI25157J39369_1001027 JGI25157J39369_10010277 130
878 3300002773 JGI25152J39213_1001483 JGI25152J39213_100148310 130
879 3300002773 JGI25152J39213_1003180 JGI25152J39213_10031804 130
880 3300002774 JGI25150J39212_1000199 JGI25150J39212_100019929 130
881 3300003187 JGI25151J46595_10001303 JGI25151J46595_100013033 130
882 3300003187 JGI25151J46595_10004870 JGI25151J46595_100048704 130
883 3300003215 JGI25153J46596_10000978 JGI25153J46596_100009783 130
884 3300003316 rootH1_10116783 rootH1_101167832 130
885 3300003323 rootH1_10019781 rootH1_100197812 130
886 3300003354 JGI25160J50197_1003267 JGI25160J50197_10032674 130
887 3300003354 JGI25160J50197_1027133 JGI25160J50197_10271332 130
888 3300003374 JGI25161J50226_1003433 JGI25161J50226_10034335 130
889 3300003578 Ga0006562J51391_1034067 Ga0006562J51391_10340672 130
890 3300003771 Ga0055526_1004786 Ga0055526_10047866 130
891 3300003775 Ga0055524_1001875 Ga0055524_10018752 130
892 3300003775 Ga0055524_1002834 Ga0055524_10028344 130
893 3300003775 Ga0055524_1004206 Ga0055524_10042064 130
894 3300003790 Ga0055528_1000594 Ga0055528_100059427 130
895 3300003790 Ga0055528_1006905 Ga0055528_10069052 130
896 3300003790 Ga0055528_1021981 Ga0055528_10219812 130
897 3300003792 Ga0055540_1000272 Ga0055540_100027237 130
898 3300003792 Ga0055540_1049979 Ga0055540_10499792 130
899 3300004625 Ga0055543_1000774 Ga0055543_100077411 130
900 3300005262 Ga0065165_1004348 Ga0065165_10043484 130
901 3300005331 Ga0070670_100322704 Ga0070670_1003227042 130
902 3300005344 Ga0070661_100613857 Ga0070661_1006138571 130
903 3300005347 Ga0070668_100178826 Ga0070668_1001788261 130
904 3300005355 Ga0070671_100013114 Ga0070671_1000131147 130
905 3300005367 Ga0070667_100270274 Ga0070667_1002702742 130
906 3300005457 Ga0070662_100480687 Ga0070662_1004806872 130
907 3300005539 Ga0068853_100221433 Ga0068853_1002214332 130
908 3300005563 Ga0068855_102094299 Ga0068855_1020942991 130
909 3300005614 Ga0068856_100058011 Ga0068856_1000580113 130
910 3300005614 Ga0068856_101609399 Ga0068856_1016093992 130
911 3300006038 Ga0075365_10006944 Ga0075365_100069445 130
912 3300006038 Ga0075365_10008779 Ga0075365_100087796 130
913 3300006038 Ga0075365_10011572 Ga0075365_100115723 130
914 3300006038 Ga0075365_10161513 Ga0075365_101615132 130
915 3300006042 Ga0075368_10020065 Ga0075368_100200653 130
916 3300006048 Ga0075363_100167894 Ga0075363_1001678942 130
917 3300006048 Ga0075363_100492393 Ga0075363_1004923932 130
918 3300006177 Ga0075362_10000690 Ga0075362_100006907 130
919 3300006177 Ga0075362_10259328 Ga0075362_102593282 130
920 3300006178 Ga0075367_10007331 Ga0075367_100073317 130
921 3300006178 Ga0075367_10075532 Ga0075367_100755322 130
922 3300006178 Ga0075367_10500528 Ga0075367_105005282 130
923 3300006178 Ga0075367_10509172 Ga0075367_105091722 130
924 3300006186 Ga0075369_10014458 Ga0075369_100144582 130
925 3300006186 Ga0075369_10077459 Ga0075369_100774592 130
926 3300006195 Ga0075366_10042198 Ga0075366_100421983 130
927 3300006195 Ga0075366_10879488 Ga0075366_108794881 130
928 3300006353 Ga0075370_10002201 Ga0075370_1000220111 130
929 3300006353 Ga0075370_10256387 Ga0075370_102563872 130
930 3300007076 Ga0075435_100384299 Ga0075435_1003842992 130
931 3300009011 Ga0105251_10014773 Ga0105251_100147732 130
932 3300009036 Ga0105244_10090700 Ga0105244_100907002 130
933 3300009148 Ga0105243_11233550 Ga0105243_112335501 130
934 3300009177 Ga0105248_10766100 Ga0105248_107661002 130
935 3300009545 Ga0105237_10999241 Ga0105237_109992412 130
936 3300009551 Ga0105238_10001439 Ga0105238_1000143923 130
937 3300009765 Ga0123341_1000038 Ga0123341_100003859 130
938 3300009766 Ga0123342_1018935 Ga0123342_10189352 130
939 3300010375 Ga0105239_10201683 Ga0105239_102016831 130
940 3300017792 Ga0163161_10366513 Ga0163161_103665132 130
941 3300025245 Ga0207425_1000012 Ga0207425_100001257 130
942 3300025258 Ga0209129_1000110 Ga0209129_100011057 130
943 3300025258 Ga0209129_1000192 Ga0209129_100019217 130
944 3300025258 Ga0209129_1002601 Ga0209129_10026012 130
945 3300025273 Ga0209673_1000024 Ga0209673_1000024353 130
946 3300025273 Ga0209673_1016778 Ga0209673_10167782 130
947 3300025294 Ga0209025_1000024 Ga0209025_100002457 130
948 3300025294 Ga0209025_1002318 Ga0209025_10023187 130
949 3300025294 Ga0209025_1012802 Ga0209025_10128026 130
950 3300025295 Ga0209564_1001378 Ga0209564_100137824 130
951 3300025295 Ga0209564_1016216 Ga0209564_10162162 130
952 3300025295 Ga0209564_1064569 Ga0209564_10645692 130
953 3300025297 Ga0209758_1000150 Ga0209758_1000150109 130
954 3300025297 Ga0209758_1013507 Ga0209758_10135074 130
955 3300025297 Ga0209758_1014803 Ga0209758_10148032 130
956 3300025297 Ga0209758_1107515 Ga0209758_11075152 130
957 3300025299 Ga0209256_1001654 Ga0209256_10016547 130
958 3300025302 Ga0207426_1006180 Ga0207426_10061802 130
959 3300025303 Ga0209051_1009004 Ga0209051_10090045 130
960 3300025303 Ga0209051_1023500 Ga0209051_10235002 130
961 3300025303 Ga0209051_1048297 Ga0209051_10482972 130
962 3300025904 Ga0207647_10031770 Ga0207647_100317702 130
963 3300025925 Ga0207650_11068244 Ga0207650_110682442 130
964 3300025931 Ga0207644_10129897 Ga0207644_101298972 130
965 3300025933 Ga0207706_10508283 Ga0207706_105082832 130
966 3300025949 Ga0207667_11525029 Ga0207667_115250292 130
967 3300025972 Ga0207668_10044029 Ga0207668_100440292 130
968 3300025986 Ga0207658_10739460 Ga0207658_107394601 130
969 3300026041 Ga0207639_10501444 Ga0207639_105014442 130
970 3300026041 Ga0207639_10844269 Ga0207639_108442692 130
971 3300026078 Ga0207702_10114212 Ga0207702_101142123 130
972 3300026142 Ga0207698_10512156 Ga0207698_105121562 130
973 3300028794 Ga0307515_10026670 Ga0307515_100266705 130
974 3300028794 Ga0307515_10422696 Ga0307515_104226961 130
975 3300031456 Ga0307513_10006535 Ga0307513_100065354 130
976 3300031456 Ga0307513_10497487 Ga0307513_104974872 130
977 3300031731 Ga0307405_10001510 Ga0307405_100015103 130
978 3300031852 Ga0307410_12001072 Ga0307410_120010721 130
979 3300031901 Ga0307406_10002121 Ga0307406_100021217 130
980 3300031911 Ga0307412_10000777 Ga0307412_1000077716 130
981 3300031995 Ga0307409_100700544 Ga0307409_1007005442 130
982 3300037418 Ga0395900_0042983 Ga0395900_0042983_1993_2439 130
983 3300037418 Ga0395900_0073589 Ga0395900_0073589_1479_1925 130
984 3300037471 Ga0395905_0157381 Ga0395905_0157381_1619_2065 130
985 3300038443 Ga0395901_0036925 Ga0395901_0036925_3571_4017 130
986 3300038443 Ga0395901_0067508 Ga0395901_0067508_2461_2907 130
987 3300038443 Ga0395901_0537010 Ga0395901_0537010_282_728 130
988 3300041406 Ga0439439_0023748 Ga0439439_0023748_1017_1490 130
989 3300041413 Ga0439465_0004886 Ga0439465_0004886_3117_3590 130
990 3300041413 Ga0439465_0010793 Ga0439465_0010793_284_760 130
991 3300042012 Ga0439455_0171371 Ga0439455_0171371_118_564 130
992 3300042435 Ga0439434_0048484 Ga0439434_0048484_624_1100 130
993 3300044658 Ga0466972_0203778 Ga0466972_0203778_463_909 130
994 3300044683 Ga0466965_0275141 Ga0466965_0275141_237_683 130
995 3300044901 Ga0466960_0622413 Ga0466960_0622413_152_598 130
996 3300045976 Ga0466967_0672632 Ga0466967_0672632_456_902 130
997 3300046460 Ga0495638_0000418 Ga0495638_0000418_48732_49214 130
998 3300046471 Ga0495650_0028711 Ga0495650_0028711_1554_2030 130
999 3300046512 Ga0495610_0026586 Ga0495610_0026586_371_847 130
1000 3300046514 Ga0495618_0182095 Ga0495618_0182095_746_1204 130
1001 3300046515 Ga0495620_0048549 Ga0495620_0048549_1022_1498 130
1002 3300046519 Ga0495632_0015362 Ga0495632_0015362_2948_3430 130
1003 3300046519 Ga0495632_0030319 Ga0495632_0030319_537_1013 130
1004 3300046530 Ga0495654_0369164 Ga0495654_0369164_46_522 130
1005 3300046536 Ga0495587_0336131 Ga0495587_0336131_31_489 130
1006 3300046665 Ga0495661_0259876 Ga0495661_0259876_48_524 130
1007 3300047469 Ga0495673_0061921 Ga0495673_0061921_252_728 130
1008 3300047472 Ga0495686_0057666 Ga0495686_0057666_1622_2098 130
1009 3300048903 Ga0496100_0577560 Ga0496100_0577560_77_559 130
1010 3300048904 Ga0496101_0422335 Ga0496101_0422335_67_549 130
1011 3300048904 Ga0496101_0517342 Ga0496101_0517342_310_786 130
1012 3300048905 Ga0496102_0502503 Ga0496102_0502503_517_1017 130
1013 3300048905 Ga0496102_0542638 Ga0496102_0542638_24_506 130
1014 3300048905 Ga0496102_0558831 Ga0496102_0558831_473_949 130
1015 3300048907 Ga0496104_0323568 Ga0496104_0323568_527_1009 130
1016 3300048908 Ga0496105_0327317 Ga0496105_0327317_304_786 130
1017 3300048910 Ga0496107_0087497 Ga0496107_0087497_333_833 130
1018 3300048913 Ga0496110_0372368 Ga0496110_0372368_390_872 130
1019 3300048914 Ga0496111_0835875 Ga0496111_0835875_65_547 130
1020 3300048915 Ga0496112_0295832 Ga0496112_0295832_299_745 130
1021 3300048916 Ga0496113_1235776 Ga0496113_1235776_60_542 130
1022 3300048919 Ga0496116_0006249 Ga0496116_0006249_9063_9539 130
1023 3300048919 Ga0496116_0022947 Ga0496116_0022947_2862_3338 130
1024 3300048919 Ga0496116_0045989 Ga0496116_0045989_1847_2323 130
1025 3300048919 Ga0496116_0100424 Ga0496116_0100424_641_1123 130
1026 3300048919 Ga0496116_0181923 Ga0496116_0181923_527_1003 130
1027 3300048920 Ga0496117_0004943 Ga0496117_0004943_496_972 130
1028 3300048920 Ga0496117_0052807 Ga0496117_0052807_481_957 130
1029 3300048921 Ga0496118_0128595 Ga0496118_0128595_511_987 130
1030 3300048921 Ga0496118_0198479 Ga0496118_0198479_499_975 130
1031 3300048922 Ga0496119_0134812 Ga0496119_0134812_146_622 130
1032 3300048922 Ga0496119_0153309 Ga0496119_0153309_398_880 130
1033 3300048924 Ga0496121_0063986 Ga0496121_0063986_1101_1577 130
1034 3300048924 Ga0496121_0286228 Ga0496121_0286228_633_1115 130
1035 3300048924 Ga0496121_0398412 Ga0496121_0398412_63_539 130
1036 3300048925 Ga0496122_0040256 Ga0496122_0040256_1131_1607 130
1037 3300048925 Ga0496122_0084848 Ga0496122_0084848_497_973 130
1038 3300048925 Ga0496122_0120196 Ga0496122_0120196_1080_1556 130
1039 3300048925 Ga0496122_0150948 Ga0496122_0150948_139_615 130
1040 3300048925 Ga0496122_0205082 Ga0496122_0205082_135_617 130
1041 3300048926 Ga0496123_0002453 Ga0496123_0002453_18135_18611 130
1042 3300048926 Ga0496123_0054291 Ga0496123_0054291_1293_1769 130
1043 3300048926 Ga0496123_0097863 Ga0496123_0097863_656_1132 130
1044 3300048927 Ga0496124_0002598 Ga0496124_0002598_10331_10807 130
1045 3300048927 Ga0496124_0004301 Ga0496124_0004301_10853_11329 130
1046 3300048927 Ga0496124_0088748 Ga0496124_0088748_734_1210 130
1047 3300048927 Ga0496124_0490525 Ga0496124_0490525_68_544 130
1048 3300048927 Ga0496124_0563234 Ga0496124_0563234_211_687 130
1049 3300048928 Ga0496125_0006143 Ga0496125_0006143_7089_7565 130
1050 3300048928 Ga0496125_0090448 Ga0496125_0090448_1735_2217 130
1051 3300048929 Ga0496126_0625952 Ga0496126_0625952_318_800 130
1052 3300048929 Ga0496126_0636267 Ga0496126_0636267_296_772 130
1053 3300050490 nmdc:mga03n38_319631_c1 nmdc:mga03n38_319631_c1_230_676 130
1054 3300050492 nmdc:mga0yw44_13252_c1 nmdc:mga0yw44_13252_c1_1756_2202 130
1055 3300050494 nmdc:mga06z11_208041_c1 nmdc:mga06z11_208041_c1_92_538 130
1056 3300050494 nmdc:mga06z11_812958_c1 nmdc:mga06z11_812958_c1_50_526 130
1057 3300050494 nmdc:mga06z11_896727_c1 nmdc:mga06z11_896727_c1_41_523 130
1058 3300050512 nmdc:mga0n895_1204254_c1 nmdc:mga0n895_1204254_c1_74_574 130
1059 3300053116 Ga0500592_024372 Ga0500592_024372_74_520 130
1060 3300053125 Ga0500618_008381 Ga0500618_008381_1629_2105 130
1061 3300053153 Ga0500616_0061423 Ga0500616_0061423_466_912 130
1062 3300053158 Ga0500627_0038334 Ga0500627_0038334_296_742 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05025

RbsD_FucU

RbsD / FucU transport protein family

30

167

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ob5-assembly1.cif.gz_A-2 crystal structure of protein atu2016, putative sugar binding protein 0.8414 1 116
2wcv-assembly1.cif.gz_E-2 crystal structure of bacterial fucu 0.8148 1 116
3mvk-assembly1.cif.gz_G the crystal structure of fucu from bifidobacterium longum to 1.65a 0.8132 4 116
2wcv-assembly1.cif.gz_B crystal structure of bacterial fucu 0.8101 1 116
2wcv-assembly1.cif.gz_A-2 crystal structure of bacterial fucu 0.8093 1 118
ID Description Score Start End Superfamily
af_D4ACG8_1_149_3.40.1650.10 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.8338 1 116 3.40.1650.10
2ob5A00 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.8027 1 116 3.40.1650.10
2wcvA01 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.8001 11 118 3.40.1650.10
af_D4ACG8_1_149_3.40.1650.10 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.7472 1 116 3.40.1650.10
2ob5A00 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.7212 1 116 3.40.1650.10
ID Description Score Start End GO Terms
AF-A0A529Q7L9-F1-model_v4 Transporter 0.9562 1 111 GO:0006004
GO:0016857
GO:0036065
GO:0042806
GO:0062193
AF-A0A529Q7L9-F1-model_v4 Transporter 0.948 1 111 GO:0006004
GO:0016857
GO:0036065
GO:0042806
GO:0062193
AF-A0A352JY90-F1-model_v4 Uncharacterized protein 0.9331 1 67 GO:0006004
GO:0016857
GO:0036065
GO:0042806
GO:0062193
AF-A0A529ZEA1-F1-model_v4 Transporter 0.9204 1 57 GO:0006004
GO:0016857
GO:0036065
GO:0042806
GO:0062193
AF-A0A7C5C158-F1-model_v4 Fucose isomerase 0.918 1 68 GO:0006004
GO:0016857
GO:0036065
GO:0042806
GO:0062193

Feature Viewer

pLDDT pTM Quality
84.7 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map