F489195

General Info

Members Datasets Scaffolds Average Seq Length
1057 341 957 301

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10162638|Ga0065714_101626381
Length 323
Sequence MIAIVCVNQKFIVANMETFSSIECFVRSAEVGSFAEAARRLSLTPAAVGKSVAKLEVRLGVRLFQRSTRSLTLTEAGQLFLDQVSGSLTTIQNAVANLSSVEGLPAGTLKVSMGAAFGCLHIVPMLGEFLRRYPAINPDWHFDNRQVDLIAQGFDAAIGGGFELPQGVIARKLSPAHRILVASTDYLQANPEIIEPDDLSHHDGILIRSPQTGRVRSWQLTGRNPQNCRPLMLKARMTMSDSEAACRTAAQGLGIALVSMPFAVGYLQAGTLQRVLPDWFVDDGNISIYYAEHKLLPGKTRAFVDFLIEQFAERGLAQRFSAI

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
4 2511231004 Pseudomonas sp. GM102 Isolate Nodule
5 2511231006 Pseudomonas sp. GM17 Isolate Nodule
6 2511231007 Pseudomonas sp. GM18 Isolate Nodule
7 2511231008 Pseudomonas sp. GM21 Isolate Nodule
8 2511231010 Pseudomonas sp. GM25 Isolate Nodule
9 2511231011 Pseudomonas sp. GM30 Isolate Nodule
10 2511231012 Pseudomonas sp. GM33 Isolate Nodule
11 2511231015 Pseudomonas sp. GM49 Isolate Nodule
12 2511231016 Pseudomonas sp. GM50 Isolate Nodule
13 2511231017 Pseudomonas sp. GM55 Isolate Nodule
14 2511231018 Pseudomonas sp. GM60 Isolate Nodule
15 2511231019 Pseudomonas sp. GM67 Isolate Nodule
16 2511231020 Pseudomonas sp. GM74 Isolate Nodule
17 2511231022 Pseudomonas sp. GM79 Isolate Nodule
18 2511231023 Pseudomonas sp. GM80 Isolate Nodule
19 2511231031 Pseudomonas sp. GM16 Isolate Nodule
20 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
21 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
22 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
23 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
24 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
25 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
26 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
27 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
28 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
29 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
30 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
31 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
32 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
33 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
34 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
35 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
36 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
37 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
38 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
39 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
40 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
41 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
42 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
43 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
44 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
45 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
46 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
47 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
48 2773857670 Pseudomonas sp. 478 Isolate Unclassified
49 2773857673 Pseudomonas sp. 443 Isolate Unclassified
50 2784132063 Pseudomonas sp. 424 Isolate Unclassified
51 2784132072 Pseudomonas sp. 460 Isolate Unclassified
52 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
53 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
54 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
55 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
56 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
57 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
58 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
59 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
60 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
61 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
62 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
63 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
64 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
65 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
66 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
67 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
68 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
69 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
70 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
71 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
72 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
73 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
74 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
75 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
76 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
77 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
78 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
79 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
80 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
81 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
82 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
83 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
84 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
85 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
86 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
87 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
88 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
89 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
90 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
91 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
92 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
93 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
94 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
95 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
96 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
97 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
98 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
99 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
100 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
101 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
102 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
103 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
104 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
105 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
106 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
107 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
108 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
109 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
110 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
111 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
112 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
113 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
114 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
115 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
116 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
117 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
118 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
119 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
120 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
121 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
122 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
123 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
124 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
125 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
126 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
127 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
128 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
129 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
133 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
134 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
135 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
136 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
141 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
142 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
143 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
146 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
153 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
154 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
156 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
158 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
159 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
177 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
180 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
181 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
182 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
183 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
184 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
185 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
186 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
200 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
201 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
202 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
203 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
204 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
205 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
206 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
207 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
208 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
209 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
210 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
211 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
212 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
213 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
214 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
215 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
216 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
217 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
218 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
219 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
220 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
221 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
222 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
223 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
224 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
225 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
226 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
227 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
228 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
229 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
230 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
231 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
232 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
235 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
236 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
237 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
238 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
239 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
240 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
241 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
242 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
243 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
244 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
245 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
246 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
247 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
248 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
251 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
252 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
253 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
254 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
255 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
256 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
257 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
258 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
259 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
260 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
261 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
262 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
263 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
264 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
265 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
266 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
267 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
268 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
269 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
270 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
271 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
272 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
273 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
274 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
275 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
276 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
277 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
278 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
279 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
280 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
281 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
282 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
283 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
284 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
285 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
286 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
287 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
288 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
289 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
290 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
291 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
292 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
293 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
294 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
295 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
296 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
297 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
298 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
299 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
300 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
301 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
302 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
303 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
304 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
307 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
308 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
309 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
310 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
311 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
312 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
313 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
314 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
315 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
316 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
317 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
318 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
319 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
320 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
321 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
322 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
323 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
324 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
325 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
326 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
327 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
328 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
329 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
330 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
331 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
332 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
333 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
334 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
335 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
336 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
337 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
338 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
339 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
340 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
341 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.54
Metatranscriptomes 0
Isolates 9.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.28
Nodule 2.08
Rhizoplane 1.42
Rhizosphere 81.08
Stem 0
Stem Tuber 0
Unclassified 8.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_114 2124908027 Bacteria 11625
2 SwRhRL2b_contig_1674522 2162886007 Bacteria 3160
3 JGI25162J39368_1000042 3300002737 Bacteria 173466
4 JGI25162J39368_1000080 3300002737 Bacteria 113071
5 JGI25154J39366_1004090 3300002738 Bacteria 2754
6 JGI25163J39215_1000151 3300002771 Bacteria 27318
7 JGI25163J39215_1000577 3300002771 Bacteria 10359
8 JGI25163J39215_1001521 3300002771 Bacteria 3645
9 JGI25164J39214_1000023 3300002772 Bacteria 165681
10 JGI25164J39214_1000073 3300002772 Bacteria 98902
11 JGI25165J46597_1000083 3300003214 Bacteria 173466
12 JGI25165J46597_1000152 3300003214 Bacteria 113071
13 rootH1_10263332 3300003323 Bacteria 2220
14 Ga0055538_1000027 3300003751 Bacteria 216576
15 Ga0055539_1000036 3300003752 Bacteria 216576
16 Ga0055533_1000046 3300003756 Bacteria 216576
17 Ga0055532_1000032 3300003758 Bacteria 216568
18 Ga0055525_1000145 3300003759 Bacteria 98169
19 Ga0055526_1001365 3300003771 Bacteria 17475
20 Ga0055536_1000233 3300003781 Bacteria 44539
21 Ga0055536_1004428 3300003781 Bacteria 7188
22 Ga0055536_1005308 3300003781 Bacteria 6337
23 Ga0055530_10000120 3300003791 Bacteria 67749
24 Ga0055530_10000450 3300003791 Bacteria 36555
25 Ga0055530_10003560 3300003791 Bacteria 8762
26 Ga0055530_10015622 3300003791 Bacteria 2467
27 Ga0055540_1000074 3300003792 Bacteria 116719
28 Ga0055540_1000386 3300003792 Bacteria 36555
29 Ga0055540_1000469 3300003792 Bacteria 31188
30 Ga0055531_10001871 3300003794 Bacteria 14764
31 Ga0055541_1000024 3300003841 Bacteria 216576
32 Ga0065714_10003263 3300005288 Bacteria 13582
33 Ga0065714_10004510 3300005288 Bacteria 6739
34 Ga0065714_10009279 3300005288 Bacteria 4622
35 Ga0065714_10066052 3300005288 Bacteria 7753
36 Ga0065714_10079390 3300005288 Bacteria 2514
37 Ga0065714_10162638 3300005288 Bacteria 1039
38 Ga0065704_10071421 3300005289 Bacteria 11249
39 Ga0065704_10083751 3300005289 Bacteria 3423
40 Ga0065712_10008373 3300005290 Bacteria 3289
41 Ga0070670_100000370 3300005331 Bacteria 37444
42 Ga0070669_100000872 3300005353 Bacteria 21981
43 Ga0070669_100164497 3300005353 Bacteria 1726
44 Ga0070662_100000381 3300005457 Bacteria 26477
45 Ga0070662_100054215 3300005457 Bacteria 2905
46 Ga0068853_100010777 3300005539 Bacteria 7405
47 Ga0070665_100681510 3300005548 Bacteria 1041
48 Ga0068854_100055088 3300005578 Bacteria 2861
49 Ga0068851_10000060 3300005834 Bacteria 61362
50 Ga0075364_10025175 3300006051 Bacteria 3786
51 Ga0075364_10142407 3300006051 Bacteria 1613
52 Ga0075432_10001592 3300006058 Bacteria 7452
53 Ga0075432_10038141 3300006058 Bacteria 1674
54 Ga0075362_10012652 3300006177 Bacteria 3358
55 Ga0075362_10044953 3300006177 Bacteria 1960
56 Ga0075369_10013825 3300006186 Bacteria 3212
57 Ga0075369_10038139 3300006186 Bacteria 2049
58 Ga0075369_10080028 3300006186 Bacteria 1448
59 Ga0075436_100211624 3300006914 Bacteria 1374
60 Ga0079104_1000094 3300006946 Bacteria 130202
61 Ga0079104_1000297 3300006946 Bacteria 63122
62 Ga0099826_10021555 3300006948 Bacteria 4826
63 Ga0105251_10000381 3300009011 Bacteria 43616
64 Ga0105251_10007297 3300009011 Bacteria 6844
65 Ga0105251_10013736 3300009011 Bacteria 4512
66 Ga0105251_10019873 3300009011 Bacteria 3536
67 Ga0105251_10108050 3300009011 Bacteria 1269
68 Ga0105244_10012266 3300009036 Bacteria 5075
69 Ga0105244_10023047 3300009036 Bacteria 3421
70 Ga0105244_10036267 3300009036 Bacteria 2584
71 Ga0105244_10043827 3300009036 Bacteria 2306
72 Ga0105244_10051670 3300009036 Bacteria 2094
73 Ga0105244_10053168 3300009036 Bacteria 2059
74 Ga0105244_10055619 3300009036 Bacteria 2004
75 Ga0105250_10000962 3300009092 Bacteria 16882
76 Ga0105250_10002712 3300009092 Bacteria 8749
77 Ga0105250_10040097 3300009092 Bacteria 1878
78 Ga0105250_10049517 3300009092 Bacteria 1685
79 Ga0105240_10105917 3300009093 Bacteria 3412
80 Ga0105243_10000165 3300009148 Bacteria 75663
81 Ga0105243_10000985 3300009148 Bacteria 26521
82 Ga0105243_10198204 3300009148 Bacteria 1759
83 Ga0105246_10000145 3300011119 Bacteria 33222
84 Ga0105246_10004856 3300011119 Bacteria 8191
85 Ga0157345_1000244 3300012498 Bacteria 7758
86 Ga0157373_10006063 3300013100 Bacteria 9039
87 Ga0157373_10007023 3300013100 Bacteria 8391
88 Ga0157373_10008437 3300013100 Bacteria 7651
89 Ga0157373_10009125 3300013100 Bacteria 7336
90 Ga0157373_10035876 3300013100 Bacteria 3559
91 Ga0157373_10058296 3300013100 Bacteria 2738
92 Ga0157371_10002280 3300013102 Bacteria 18488
93 Ga0157371_10003945 3300013102 Bacteria 13175
94 Ga0157371_10008470 3300013102 Bacteria 8185
95 Ga0157371_10017740 3300013102 Bacteria 5281
96 Ga0157370_10093088 3300013104 Bacteria 2828
97 Ga0157370_10192175 3300013104 Bacteria 1895
98 Ga0157370_10227273 3300013104 Bacteria 1727
99 Ga0157370_10231129 3300013104 Bacteria 1712
100 Ga0157369_10009140 3300013105 Bacteria 11340
101 Ga0157369_10018576 3300013105 Bacteria 7794
102 Ga0157369_10045274 3300013105 Bacteria 4787
103 Ga0157369_10215419 3300013105 Bacteria 2011
104 Ga0163162_10016166 3300013306 Bacteria 7296
105 Ga0157372_10007680 3300013307 Bacteria 11473
106 Ga0157375_10027570 3300013308 Bacteria 5310
107 Ga0157375_10131856 3300013308 Bacteria 2619
108 Ga0182008_10001534 3300014497 Bacteria 15376
109 Ga0182008_10002833 3300014497 Bacteria 10723
110 Ga0182008_10002928 3300014497 Bacteria 10534
111 Ga0182008_10003857 3300014497 Bacteria 8904
112 Ga0182008_10006014 3300014497 Bacteria 6833
113 Ga0182008_10008718 3300014497 Bacteria 5513
114 Ga0182006_1000539 3300015261 Bacteria 28730
115 Ga0182006_1002005 3300015261 Bacteria 11470
116 Ga0182006_1002968 3300015261 Bacteria 8949
117 Ga0182006_1003362 3300015261 Bacteria 8230
118 Ga0182006_1037187 3300015261 Bacteria 1931
119 Ga0182007_10002556 3300015262 Bacteria 8957
120 Ga0182007_10005030 3300015262 Bacteria 5870
121 Ga0182007_10013480 3300015262 Bacteria 3115
122 Ga0182005_1001580 3300015265 Bacteria 8987
123 Ga0182005_1006695 3300015265 Bacteria 3498
124 Ga0182005_1011359 3300015265 Bacteria 2540
125 Ga0182005_1016403 3300015265 Bacteria 2060
126 Ga0182005_1036745 3300015265 Bacteria 1332
127 Ga0163161_10003152 3300017792 Bacteria 11636
128 Ga0163161_10015406 3300017792 Bacteria 5330
129 Ga0163161_10037409 3300017792 Bacteria 3479
130 Ga0163161_10091925 3300017792 Bacteria 2246
131 Ga0163161_10244924 3300017792 Bacteria 1395
132 Ga0213872_10000065 3300021361 Bacteria 96648
133 Ga0209760_100065 3300025207 Bacteria 89335
134 Ga0209760_100146 3300025207 Bacteria 44331
135 Ga0209784_100017 3300025224 Bacteria 472003
136 Ga0209566_100014 3300025225 Bacteria 472003
137 Ga0209674_100028 3300025226 Bacteria 472003
138 Ga0209147_100038 3300025229 Bacteria 314497
139 Ga0209563_100032 3300025230 Bacteria 472003
140 Ga0209563_101656 3300025230 Bacteria 5697
141 Ga0207427_100001 3300025231 Bacteria 1410763
142 Ga0207427_100008 3300025231 Bacteria 740731
143 Ga0209437_100003 3300025233 Bacteria 1517827
144 Ga0209437_100014 3300025233 Bacteria 740714
145 Ga0209437_105498 3300025233 Bacteria 2154
146 Ga0209258_100212 3300025242 Bacteria 116067
147 Ga0209646_1000120 3300025246 Bacteria 146035
148 Ga0209646_1000266 3300025246 Bacteria 49739
149 Ga0209677_100018 3300025253 Bacteria 472003
150 Ga0209759_1003251 3300025256 Bacteria 6566
151 Ga0209233_1000007 3300025261 Bacteria 1411234
152 Ga0209233_1000008 3300025261 Bacteria 1356712
153 Ga0209675_1006245 3300025291 Bacteria 4820
154 Ga0209676_1000021 3300025292 Bacteria 609534
155 Ga0209676_1000055 3300025292 Bacteria 361565
156 Ga0209676_1000127 3300025292 Bacteria 189701
157 Ga0209676_1005659 3300025292 Bacteria 6431
158 Ga0209564_1000154 3300025295 Bacteria 166849
159 Ga0209050_1000120 3300025298 Bacteria 198658
160 Ga0209050_1000162 3300025298 Bacteria 155309
161 Ga0209050_1000227 3300025298 Bacteria 123743
162 Ga0209050_1002659 3300025298 Bacteria 14613
163 Ga0209051_1000121 3300025303 Bacteria 146477
164 Ga0209051_1000164 3300025303 Bacteria 124186
165 Ga0209051_1000551 3300025303 Bacteria 45632
166 Ga0209051_1002898 3300025303 Bacteria 11784
167 Ga0209257_1000463 3300025304 Bacteria 74737
168 Ga0209257_1016959 3300025304 Bacteria 2902
169 Ga0207656_10000037 3300025321 Bacteria 59462
170 Ga0207696_1000025 3300025711 Bacteria 418650
171 Ga0207696_1001679 3300025711 Bacteria 11513
172 Ga0207696_1005127 3300025711 Bacteria 5502
173 Ga0207696_1013047 3300025711 Bacteria 2913
174 Ga0207696_1018181 3300025711 Bacteria 2313
175 Ga0207655_1000035 3300025728 Bacteria 359016
176 Ga0207655_1000818 3300025728 Bacteria 33707
177 Ga0207655_1004265 3300025728 Bacteria 10234
178 Ga0207655_1004516 3300025728 Bacteria 9840
179 Ga0207655_1004818 3300025728 Bacteria 9392
180 Ga0207655_1007308 3300025728 Bacteria 7180
181 Ga0207655_1007825 3300025728 Bacteria 6880
182 Ga0207655_1023767 3300025728 Bacteria 3027
183 Ga0207713_1001073 3300025735 Bacteria 23588
184 Ga0207713_1003750 3300025735 Bacteria 10203
185 Ga0207713_1005755 3300025735 Bacteria 7679
186 Ga0207713_1007688 3300025735 Bacteria 6303
187 Ga0207713_1026500 3300025735 Bacteria 2654
188 Ga0207713_1040189 3300025735 Bacteria 1966
189 Ga0207681_10000363 3300025923 Bacteria 32314
190 Ga0207681_10141103 3300025923 Bacteria 1794
191 Ga0207706_10000140 3300025933 Bacteria 78477
192 Ga0207706_10021133 3300025933 Bacteria 5848
193 Ga0207709_10000210 3300025935 Bacteria 75685
194 Ga0207709_10000615 3300025935 Bacteria 29239
195 Ga0207709_10111436 3300025935 Bacteria 1830
196 Ga0207665_10196471 3300025939 Bacteria 1468
197 Ga0207640_10099988 3300025981 Bacteria 2031
198 Ga0207639_10009502 3300026041 Bacteria 6713
199 Ga0207674_10343462 3300026116 Bacteria 1443
200 Ga0209281_1000090 3300027111 Bacteria 242950
201 Ga0209281_1000212 3300027111 Bacteria 130216
202 Ga0209281_1010191 3300027111 Bacteria 2164
203 Ga0209371_1000237 3300027312 Bacteria 69091
204 Ga0207428_10067998 3300027907 Bacteria 2804
205 Ga0207428_10115249 3300027907 Bacteria 2065
206 Ga0207428_10220554 3300027907 Bacteria 1422
207 Ga0268256_1000485 3300030500 Bacteria 34065
208 Ga0307511_10097111 3300030521 Bacteria 1958
209 Ga0314311_1146120 3300030733 Bacteria 4329
210 Ga0316179_1072619 3300030734 Bacteria 2652
211 Ga0316178_1001397 3300030735 Bacteria 8148
212 Ga0316183_1041168 3300030742 Bacteria 3314
213 Ga0316181_1038587 3300030744 Bacteria 12442
214 Ga0307509_10158464 3300031507 Bacteria 2165
215 Ga0307408_100012192 3300031548 Bacteria 5688
216 Ga0307405_10000788 3300031731 Bacteria 12418
217 Ga0307405_10088797 3300031731 Bacteria 2040
218 Ga0307413_10014239 3300031824 Bacteria 4030
219 Ga0307413_10218651 3300031824 Bacteria 1390
220 Ga0307406_10030119 3300031901 Bacteria 3291
221 Ga0307412_10001435 3300031911 Bacteria 13278
222 Ga0307412_10002735 3300031911 Bacteria 9811
223 Ga0307412_10008409 3300031911 Bacteria 5889
224 Ga0307412_10022896 3300031911 Bacteria 3836
225 Ga0307412_10068443 3300031911 Bacteria 2414
226 Ga0307409_100111985 3300031995 Bacteria 2290
227 Ga0307409_100214118 3300031995 Bacteria 1734
228 Ga0307416_100099460 3300032002 Bacteria 2526
229 Ga0307414_10005407 3300032004 Bacteria 7032
230 Ga0307414_10019725 3300032004 Bacteria 4185
231 Ga0307510_10016736 3300033180 Bacteria 8653
232 Ga0395899_0027258 3300037312 Bacteria 4308
233 Ga0395900_0018011 3300037418 Bacteria 7212
234 Ga0395900_0061358 3300037418 Bacteria 3865
235 Ga0395901_0366832 3300038443 Bacteria 1484
236 Ga0237819_03413 3300038705 Bacteria 2824
237 Ga0436361_0094991 3300039447 Bacteria 18798
238 Ga0439436_0005606 3300041404 Bacteria 3850
239 Ga0439438_000344 3300041405 Bacteria 20723
240 Ga0439438_000455 3300041405 Bacteria 18503
241 Ga0439438_001473 3300041405 Bacteria 10376
242 Ga0439438_002512 3300041405 Bacteria 7789
243 Ga0439438_002573 3300041405 Bacteria 7693
244 Ga0439438_004859 3300041405 Bacteria 5053
245 Ga0439438_020336 3300041405 Bacteria 1864
246 Ga0439438_028204 3300041405 Bacteria 1511
247 Ga0439438_029862 3300041405 Bacteria 1457
248 Ga0439438_032368 3300041405 Bacteria 1386
249 Ga0439447_000111 3300041407 Bacteria 27568
250 Ga0439447_001680 3300041407 Bacteria 8130
251 Ga0439447_002653 3300041407 Bacteria 6478
252 Ga0439447_008164 3300041407 Bacteria 3261
253 Ga0439447_008644 3300041407 Bacteria 3142
254 Ga0439447_020906 3300041407 Bacteria 1729
255 Ga0439466_0003641 3300041411 Bacteria 5946
256 Ga0439466_0013152 3300041411 Bacteria 3032
257 Ga0439466_0018546 3300041411 Bacteria 2495
258 Ga0439466_0036404 3300041411 Bacteria 1661
259 Ga0439466_0045870 3300041411 Bacteria 1444
260 Ga0439466_0048618 3300041411 Bacteria 1394
261 Ga0439466_0054466 3300041411 Bacteria 1303
262 Ga0439466_0057363 3300041411 Bacteria 1261
263 Ga0439431_0005836 3300041997 Bacteria 2719
264 Ga0439445_0016035 3300042004 Bacteria 1840
265 Ga0439432_000374 3300042006 Bacteria 16492
266 Ga0439432_001450 3300042006 Bacteria 8905
267 Ga0439432_004536 3300042006 Bacteria 5068
268 Ga0439432_020173 3300042006 Bacteria 2217
269 Ga0439432_023464 3300042006 Bacteria 2033
270 Ga0439451_008640 3300042009 Bacteria 2064
271 Ga0439451_015719 3300042009 Bacteria 1526
272 Ga0439452_000314 3300042010 Bacteria 30929
273 Ga0439452_000863 3300042010 Bacteria 14014
274 Ga0439452_000888 3300042010 Bacteria 13738
275 Ga0439452_000956 3300042010 Bacteria 12976
276 Ga0439452_001263 3300042010 Bacteria 10745
277 Ga0439452_037734 3300042010 Bacteria 1150
278 Ga0439456_000011 3300042013 Bacteria 74739
279 Ga0439456_007618 3300042013 Bacteria 2225
280 Ga0439456_020374 3300042013 Bacteria 1398
281 Ga0439456_024796 3300042013 Bacteria 1272
282 Ga0439456_033454 3300042013 Bacteria 1106
283 Ga0439463_000285 3300042016 Bacteria 14023
284 Ga0439463_010546 3300042016 Bacteria 2270
285 Ga0439463_017147 3300042016 Bacteria 1794
286 Ga0439463_041637 3300042016 Bacteria 1167
287 Ga0450911_000474 3300042115 Bacteria 12911
288 Ga0450911_003296 3300042115 Bacteria 2881
289 Ga0450911_003836 3300042115 Bacteria 2565
290 Ga0450919_004090 3300042121 Bacteria 1793
291 Ga0450902_003176 3300042137 Bacteria 2384
292 Ga0450902_017886 3300042137 Bacteria 1160
293 Ga0450903_000865 3300042138 Bacteria 5850
294 Ga0450903_004787 3300042138 Bacteria 2289
295 Ga0450903_009054 3300042138 Bacteria 1625
296 Ga0450904_002201 3300042139 Bacteria 2380
297 Ga0450904_007130 3300042139 Bacteria 1113
298 Ga0450906_001088 3300042145 Bacteria 5998
299 Ga0450906_002956 3300042145 Bacteria 3692
300 Ga0450907_000048 3300042146 Bacteria 50942
301 Ga0450907_003873 3300042146 Bacteria 2618
302 Ga0450907_008401 3300042146 Bacteria 1717
303 Ga0450910_000207 3300042147 Bacteria 6610
304 Ga0439446_0012282 3300042156 Bacteria 2339
305 Ga0450908_003793 3300042184 Bacteria 2925
306 Ga0450908_019989 3300042184 Bacteria 1178
307 Ga0450909_000318 3300042185 Bacteria 6000
308 Ga0450909_006978 3300042185 Bacteria 1630
309 Ga0450909_010521 3300042185 Bacteria 1352
310 Ga0439434_0002167 3300042435 Bacteria 5696
311 Ga0439434_0009909 3300042435 Bacteria 2804
312 Ga0439460_0001320 3300042461 Bacteria 5829
313 Ga0450901_002567 3300042533 Bacteria 1946
314 Ga0439440_0002966 3300042993 Bacteria 3233
315 Ga0495617_000518 3300046452 Bacteria 20132
316 Ga0495617_002428 3300046452 Bacteria 7411
317 Ga0495617_005698 3300046452 Bacteria 4404
318 Ga0495617_012213 3300046452 Bacteria 2925
319 Ga0495617_017887 3300046452 Bacteria 2396
320 Ga0495617_019798 3300046452 Bacteria 2275
321 Ga0495617_044817 3300046452 Bacteria 1475
322 Ga0495617_064647 3300046452 Bacteria 1206
323 Ga0495627_000013 3300046453 Bacteria 332765
324 Ga0495627_001290 3300046453 Bacteria 15379
325 Ga0495627_002237 3300046453 Bacteria 9588
326 Ga0495627_002583 3300046453 Bacteria 8571
327 Ga0495627_003950 3300046453 Bacteria 6334
328 Ga0495627_017790 3300046453 Bacteria 2408
329 Ga0495603_0032935 3300046455 Bacteria 3118
330 Ga0495603_0144450 3300046455 Bacteria 1383
331 Ga0495590_0000360 3300046457 Bacteria 23310
332 Ga0495590_0000541 3300046457 Bacteria 18142
333 Ga0495590_0002023 3300046457 Bacteria 8524
334 Ga0495590_0003523 3300046457 Bacteria 6379
335 Ga0495590_0005707 3300046457 Bacteria 4894
336 Ga0495590_0007596 3300046457 Bacteria 4169
337 Ga0495590_0020336 3300046457 Bacteria 2360
338 Ga0495590_0057436 3300046457 Bacteria 1360
339 Ga0495590_0077335 3300046457 Bacteria 1171
340 Ga0495591_000114 3300046458 Bacteria 93304
341 Ga0495591_001896 3300046458 Bacteria 12285
342 Ga0495591_002640 3300046458 Bacteria 9803
343 Ga0495591_004809 3300046458 Bacteria 6445
344 Ga0495591_005683 3300046458 Bacteria 5707
345 Ga0495591_007429 3300046458 Bacteria 4660
346 Ga0495591_014562 3300046458 Bacteria 2822
347 Ga0495591_014671 3300046458 Bacteria 2802
348 Ga0495591_016635 3300046458 Bacteria 2552
349 Ga0495591_017128 3300046458 Bacteria 2498
350 Ga0495591_017735 3300046458 Bacteria 2435
351 Ga0495591_019182 3300046458 Bacteria 2296
352 Ga0495591_020731 3300046458 Bacteria 2163
353 Ga0495591_024917 3300046458 Bacteria 1885
354 Ga0495591_032841 3300046458 Bacteria 1541
355 Ga0495591_036453 3300046458 Bacteria 1431
356 Ga0495591_047477 3300046458 Bacteria 1188
357 Ga0495629_0008511 3300046459 Bacteria 7555
358 Ga0495638_0001477 3300046460 Bacteria 21231
359 Ga0495638_0001724 3300046460 Bacteria 19237
360 Ga0495638_0008077 3300046460 Bacteria 7488
361 Ga0495638_0012055 3300046460 Bacteria 5939
362 Ga0495638_0034365 3300046460 Bacteria 3236
363 Ga0495638_0035648 3300046460 Bacteria 3170
364 Ga0495638_0043747 3300046460 Bacteria 2823
365 Ga0495638_0063460 3300046460 Bacteria 2277
366 Ga0495638_0069087 3300046460 Bacteria 2165
367 Ga0495638_0097005 3300046460 Bacteria 1768
368 Ga0495638_0103820 3300046460 Bacteria 1696
369 Ga0495638_0136420 3300046460 Bacteria 1436
370 Ga0495653_0004230 3300046463 Bacteria 11632
371 Ga0495653_0023891 3300046463 Bacteria 4932
372 Ga0495653_0028043 3300046463 Bacteria 4506
373 Ga0495650_0002118 3300046471 Bacteria 16983
374 Ga0495650_0002548 3300046471 Bacteria 14489
375 Ga0495650_0003202 3300046471 Bacteria 12180
376 Ga0495650_0007799 3300046471 Bacteria 6365
377 Ga0495650_0008599 3300046471 Bacteria 5927
378 Ga0495650_0015835 3300046471 Bacteria 3851
379 Ga0495650_0018112 3300046471 Bacteria 3510
380 Ga0495650_0030992 3300046471 Bacteria 2413
381 Ga0495650_0064171 3300046471 Bacteria 1461
382 Ga0495582_0003429 3300046473 Bacteria 8928
383 Ga0495605_0000006 3300046474 Bacteria 361304
384 Ga0495605_0000123 3300046474 Bacteria 101983
385 Ga0495605_0000803 3300046474 Bacteria 22440
386 Ga0495605_0002616 3300046474 Bacteria 11048
387 Ga0495605_0002950 3300046474 Bacteria 10297
388 Ga0495605_0006726 3300046474 Bacteria 6575
389 Ga0495605_0007020 3300046474 Bacteria 6427
390 Ga0495605_0016850 3300046474 Bacteria 3948
391 Ga0495605_0031021 3300046474 Bacteria 2733
392 Ga0495605_0034493 3300046474 Bacteria 2561
393 Ga0495605_0035121 3300046474 Bacteria 2535
394 Ga0495605_0038354 3300046474 Bacteria 2404
395 Ga0495605_0062700 3300046474 Bacteria 1775
396 Ga0495605_0089288 3300046474 Bacteria 1430
397 Ga0495605_0108796 3300046474 Bacteria 1267
398 Ga0495639_0000183 3300046475 Bacteria 33162
399 Ga0495639_0004361 3300046475 Bacteria 6063
400 Ga0495639_0033540 3300046475 Bacteria 2293
401 Ga0495639_0066822 3300046475 Bacteria 1655
402 Ga0495584_0000450 3300046491 Bacteria 28314
403 Ga0495584_0000474 3300046491 Bacteria 27595
404 Ga0495584_0000632 3300046491 Bacteria 23532
405 Ga0495584_0002552 3300046491 Bacteria 10284
406 Ga0495584_0002871 3300046491 Bacteria 9618
407 Ga0495584_0004996 3300046491 Bacteria 7058
408 Ga0495584_0012498 3300046491 Bacteria 4333
409 Ga0495584_0027617 3300046491 Bacteria 2875
410 Ga0495584_0044006 3300046491 Bacteria 2253
411 Ga0495584_0044573 3300046491 Bacteria 2238
412 Ga0495584_0182975 3300046491 Bacteria 1065
413 Ga0495585_0000121 3300046492 Bacteria 84876
414 Ga0495585_0000764 3300046492 Bacteria 28438
415 Ga0495585_0000803 3300046492 Bacteria 27375
416 Ga0495585_0012900 3300046492 Bacteria 4911
417 Ga0495585_0017519 3300046492 Bacteria 4138
418 Ga0495585_0021095 3300046492 Bacteria 3741
419 Ga0495585_0041068 3300046492 Bacteria 2595
420 Ga0495585_0041552 3300046492 Bacteria 2578
421 Ga0495585_0043996 3300046492 Bacteria 2495
422 Ga0495585_0045494 3300046492 Bacteria 2449
423 Ga0495585_0096815 3300046492 Bacteria 1583
424 Ga0495594_0007223 3300046499 Bacteria 5713
425 Ga0495594_0010471 3300046499 Bacteria 4809
426 Ga0495594_0021885 3300046499 Bacteria 3415
427 Ga0495594_0021972 3300046499 Bacteria 3410
428 Ga0495594_0138600 3300046499 Bacteria 1379
429 Ga0495596_0000628 3300046500 Bacteria 22205
430 Ga0495596_0002104 3300046500 Bacteria 10917
431 Ga0495607_0000170 3300046501 Bacteria 69141
432 Ga0495607_0000210 3300046501 Bacteria 62298
433 Ga0495607_0000816 3300046501 Bacteria 29465
434 Ga0495607_0003251 3300046501 Bacteria 12517
435 Ga0495607_0004134 3300046501 Bacteria 10823
436 Ga0495607_0005342 3300046501 Bacteria 9230
437 Ga0495607_0005900 3300046501 Bacteria 8692
438 Ga0495607_0006711 3300046501 Bacteria 8056
439 Ga0495607_0006807 3300046501 Bacteria 7980
440 Ga0495607_0007092 3300046501 Bacteria 7793
441 Ga0495607_0007363 3300046501 Bacteria 7621
442 Ga0495607_0031810 3300046501 Bacteria 3227
443 Ga0495607_0035992 3300046501 Bacteria 2988
444 Ga0495607_0065402 3300046501 Bacteria 2050
445 Ga0495607_0074364 3300046501 Bacteria 1886
446 Ga0495607_0089107 3300046501 Bacteria 1675
447 Ga0495607_0098926 3300046501 Bacteria 1565
448 Ga0495607_0151142 3300046501 Bacteria 1188
449 Ga0495583_0000036 3300046506 Bacteria 246077
450 Ga0495583_0000151 3300046506 Bacteria 117627
451 Ga0495583_0000798 3300046506 Bacteria 38957
452 Ga0495583_0000984 3300046506 Bacteria 32650
453 Ga0495583_0001090 3300046506 Bacteria 30078
454 Ga0495583_0001142 3300046506 Bacteria 28911
455 Ga0495583_0010489 3300046506 Bacteria 5397
456 Ga0495583_0018014 3300046506 Bacteria 3732
457 Ga0495583_0032072 3300046506 Bacteria 2539
458 Ga0495583_0086532 3300046506 Bacteria 1355
459 Ga0495606_0000157 3300046507 Bacteria 118620
460 Ga0495606_0002366 3300046507 Bacteria 22145
461 Ga0495606_0004275 3300046507 Bacteria 14413
462 Ga0495606_0004302 3300046507 Bacteria 14335
463 Ga0495606_0007263 3300046507 Bacteria 9983
464 Ga0495606_0008429 3300046507 Bacteria 8960
465 Ga0495606_0008977 3300046507 Bacteria 8552
466 Ga0495606_0016037 3300046507 Bacteria 5737
467 Ga0495606_0047862 3300046507 Bacteria 2817
468 Ga0495606_0058961 3300046507 Bacteria 2464
469 Ga0495606_0130961 3300046507 Bacteria 1491
470 Ga0495610_0003196 3300046512 Bacteria 12976
471 Ga0495610_0003479 3300046512 Bacteria 12257
472 Ga0495610_0005538 3300046512 Bacteria 8937
473 Ga0495610_0012555 3300046512 Bacteria 5089
474 Ga0495610_0013666 3300046512 Bacteria 4813
475 Ga0495610_0014207 3300046512 Bacteria 4689
476 Ga0495610_0014463 3300046512 Bacteria 4632
477 Ga0495610_0019708 3300046512 Bacteria 3764
478 Ga0495610_0041403 3300046512 Bacteria 2312
479 Ga0495610_0052864 3300046512 Bacteria 1970
480 Ga0495610_0090718 3300046512 Bacteria 1385
481 Ga0495610_0108886 3300046512 Bacteria 1230
482 Ga0495610_0112168 3300046512 Bacteria 1206
483 Ga0495616_0000323 3300046513 Bacteria 38118
484 Ga0495616_0000367 3300046513 Bacteria 35276
485 Ga0495616_0000794 3300046513 Bacteria 23120
486 Ga0495616_0002768 3300046513 Bacteria 11467
487 Ga0495616_0003522 3300046513 Bacteria 10009
488 Ga0495616_0003567 3300046513 Bacteria 9943
489 Ga0495616_0003911 3300046513 Bacteria 9486
490 Ga0495616_0025051 3300046513 Bacteria 3191
491 Ga0495616_0052567 3300046513 Bacteria 2028
492 Ga0495616_0064782 3300046513 Bacteria 1782
493 Ga0495616_0120839 3300046513 Bacteria 1209
494 Ga0495620_0000001 3300046515 Bacteria 386508
495 Ga0495620_0002445 3300046515 Bacteria 10763
496 Ga0495620_0002723 3300046515 Bacteria 10187
497 Ga0495620_0002916 3300046515 Bacteria 9830
498 Ga0495620_0003064 3300046515 Bacteria 9596
499 Ga0495620_0004077 3300046515 Bacteria 8284
500 Ga0495620_0009334 3300046515 Bacteria 5222
501 Ga0495620_0010584 3300046515 Bacteria 4860
502 Ga0495620_0012881 3300046515 Bacteria 4299
503 Ga0495620_0014944 3300046515 Bacteria 3930
504 Ga0495620_0025785 3300046515 Bacteria 2775
505 Ga0495620_0026384 3300046515 Bacteria 2733
506 Ga0495630_0214482 3300046517 Bacteria 1469
507 Ga0495631_0000697 3300046518 Bacteria 21752
508 Ga0495631_0001457 3300046518 Bacteria 14341
509 Ga0495631_0001825 3300046518 Bacteria 12588
510 Ga0495631_0004260 3300046518 Bacteria 7648
511 Ga0495631_0021973 3300046518 Bacteria 2967
512 Ga0495631_0038709 3300046518 Bacteria 2118
513 Ga0495631_0049393 3300046518 Bacteria 1842
514 Ga0495631_0057756 3300046518 Bacteria 1688
515 Ga0495631_0103743 3300046518 Bacteria 1223
516 Ga0495632_0000269 3300046519 Bacteria 51557
517 Ga0495632_0001228 3300046519 Bacteria 21766
518 Ga0495632_0002555 3300046519 Bacteria 13785
519 Ga0495632_0003483 3300046519 Bacteria 11128
520 Ga0495632_0003575 3300046519 Bacteria 10959
521 Ga0495632_0007520 3300046519 Bacteria 6828
522 Ga0495632_0014620 3300046519 Bacteria 4433
523 Ga0495632_0019884 3300046519 Bacteria 3648
524 Ga0495632_0040350 3300046519 Bacteria 2351
525 Ga0495632_0055426 3300046519 Bacteria 1941
526 Ga0495632_0067979 3300046519 Bacteria 1717
527 Ga0495632_0081334 3300046519 Bacteria 1544
528 Ga0495632_0083653 3300046519 Bacteria 1519
529 Ga0495632_0150737 3300046519 Bacteria 1075
530 Ga0495637_0000181 3300046520 Bacteria 48899
531 Ga0495637_0000465 3300046520 Bacteria 29588
532 Ga0495637_0000732 3300046520 Bacteria 22333
533 Ga0495637_0001230 3300046520 Bacteria 15530
534 Ga0495637_0001682 3300046520 Bacteria 12775
535 Ga0495637_0001737 3300046520 Bacteria 12502
536 Ga0495637_0002089 3300046520 Bacteria 11244
537 Ga0495637_0007798 3300046520 Bacteria 5286
538 Ga0495637_0010150 3300046520 Bacteria 4566
539 Ga0495637_0013372 3300046520 Bacteria 3895
540 Ga0495637_0017758 3300046520 Bacteria 3308
541 Ga0495637_0049657 3300046520 Bacteria 1761
542 Ga0495637_0055754 3300046520 Bacteria 1638
543 Ga0495643_0002014 3300046522 Bacteria 16943
544 Ga0495643_0002887 3300046522 Bacteria 13026
545 Ga0495643_0005993 3300046522 Bacteria 8110
546 Ga0495643_0007530 3300046522 Bacteria 7005
547 Ga0495643_0013601 3300046522 Bacteria 4864
548 Ga0495643_0015017 3300046522 Bacteria 4590
549 Ga0495643_0024388 3300046522 Bacteria 3431
550 Ga0495643_0075191 3300046522 Bacteria 1768
551 Ga0495643_0091052 3300046522 Bacteria 1573
552 Ga0495643_0091535 3300046522 Bacteria 1568
553 Ga0495643_0097900 3300046522 Bacteria 1506
554 Ga0495643_0108492 3300046522 Bacteria 1414
555 Ga0495644_0000189 3300046523 Bacteria 29042
556 Ga0495644_0001677 3300046523 Bacteria 8987
557 Ga0495644_0005543 3300046523 Bacteria 4927
558 Ga0495644_0028556 3300046523 Bacteria 2111
559 Ga0495648_0000175 3300046524 Bacteria 74095
560 Ga0495648_0001093 3300046524 Bacteria 27585
561 Ga0495648_0004109 3300046524 Bacteria 12539
562 Ga0495648_0004638 3300046524 Bacteria 11668
563 Ga0495648_0004995 3300046524 Bacteria 11143
564 Ga0495648_0014530 3300046524 Bacteria 5760
565 Ga0495648_0015349 3300046524 Bacteria 5563
566 Ga0495648_0019806 3300046524 Bacteria 4714
567 Ga0495648_0023944 3300046524 Bacteria 4169
568 Ga0495648_0047898 3300046524 Bacteria 2636
569 Ga0495648_0051600 3300046524 Bacteria 2505
570 Ga0495648_0052938 3300046524 Bacteria 2462
571 Ga0495648_0073145 3300046524 Bacteria 1980
572 Ga0495648_0077653 3300046524 Bacteria 1902
573 Ga0495648_0094723 3300046524 Bacteria 1662
574 Ga0495648_0100142 3300046524 Bacteria 1601
575 Ga0495648_0130169 3300046524 Bacteria 1339
576 Ga0495648_0165811 3300046524 Bacteria 1137
577 Ga0495666_0000454 3300046526 Bacteria 18249
578 Ga0495666_0046171 3300046526 Bacteria 2100
579 Ga0495666_0072543 3300046526 Bacteria 1634
580 Ga0495666_0092295 3300046526 Bacteria 1428
581 Ga0495642_0000363 3300046528 Bacteria 24527
582 Ga0495642_0000566 3300046528 Bacteria 18611
583 Ga0495642_0000632 3300046528 Bacteria 17641
584 Ga0495654_0000367 3300046530 Bacteria 39116
585 Ga0495654_0000554 3300046530 Bacteria 30162
586 Ga0495654_0000566 3300046530 Bacteria 29718
587 Ga0495654_0001225 3300046530 Bacteria 18144
588 Ga0495654_0001970 3300046530 Bacteria 13530
589 Ga0495654_0002322 3300046530 Bacteria 12289
590 Ga0495654_0002998 3300046530 Bacteria 10553
591 Ga0495654_0003341 3300046530 Bacteria 9889
592 Ga0495654_0011415 3300046530 Bacteria 4808
593 Ga0495654_0015122 3300046530 Bacteria 4101
594 Ga0495654_0038857 3300046530 Bacteria 2377
595 Ga0495654_0056569 3300046530 Bacteria 1895
596 Ga0495654_0059393 3300046530 Bacteria 1842
597 Ga0495654_0061251 3300046530 Bacteria 1807
598 Ga0495654_0076237 3300046530 Bacteria 1580
599 Ga0495654_0076762 3300046530 Bacteria 1573
600 Ga0495654_0088364 3300046530 Bacteria 1441
601 Ga0495654_0109115 3300046530 Bacteria 1264
602 Ga0495654_0128574 3300046530 Bacteria 1139
603 Ga0495586_0003121 3300046535 Bacteria 8914
604 Ga0495587_0001819 3300046536 Bacteria 14238
605 Ga0495587_0014592 3300046536 Bacteria 4923
606 Ga0495587_0192818 3300046536 Bacteria 1153
607 Ga0495609_0000029 3300046538 Bacteria 217067
608 Ga0495609_0000035 3300046538 Bacteria 196269
609 Ga0495609_0001173 3300046538 Bacteria 18080
610 Ga0495609_0002757 3300046538 Bacteria 10575
611 Ga0495609_0006882 3300046538 Bacteria 5744
612 Ga0495609_0022566 3300046538 Bacteria 2898
613 Ga0495609_0024467 3300046538 Bacteria 2770
614 Ga0495609_0028435 3300046538 Bacteria 2550
615 Ga0495609_0039504 3300046538 Bacteria 2124
616 Ga0495609_0085184 3300046538 Bacteria 1378
617 Ga0495609_0086281 3300046538 Bacteria 1368
618 Ga0495597_0000408 3300046542 Bacteria 37089
619 Ga0495597_0000563 3300046542 Bacteria 30796
620 Ga0495597_0003108 3300046542 Bacteria 9973
621 Ga0495597_0011912 3300046542 Bacteria 4206
622 Ga0495597_0014974 3300046542 Bacteria 3681
623 Ga0495597_0027784 3300046542 Bacteria 2592
624 Ga0495597_0032487 3300046542 Bacteria 2368
625 Ga0495597_0036303 3300046542 Bacteria 2219
626 Ga0495597_0062432 3300046542 Bacteria 1621
627 Ga0495597_0102393 3300046542 Bacteria 1206
628 Ga0495645_0157200 3300046543 Bacteria 1574
629 Ga0495645_0180040 3300046543 Bacteria 1449
630 Ga0495622_0003413 3300046557 Bacteria 7488
631 Ga0495622_0030249 3300046557 Bacteria 2530
632 Ga0495622_0034055 3300046557 Bacteria 2376
633 Ga0495622_0070440 3300046557 Bacteria 1614
634 Ga0495622_0070462 3300046557 Bacteria 1613
635 Ga0495622_0102108 3300046557 Bacteria 1314
636 Ga0495633_0000016 3300046558 Bacteria 250457
637 Ga0495633_0003310 3300046558 Bacteria 10833
638 Ga0495633_0030903 3300046558 Bacteria 2599
639 Ga0495633_0078521 3300046558 Bacteria 1537
640 Ga0495633_0080585 3300046558 Bacteria 1515
641 Ga0495656_0068569 3300046615 Bacteria 1568
642 Ga0495668_0004481 3300046616 Bacteria 9896
643 Ga0495668_0008265 3300046616 Bacteria 6519
644 Ga0495668_0033325 3300046616 Bacteria 2894
645 Ga0495668_0053900 3300046616 Bacteria 2223
646 Ga0495668_0066522 3300046616 Bacteria 1983
647 Ga0495634_0000987 3300046642 Bacteria 26793
648 Ga0495634_0138108 3300046642 Bacteria 1549
649 Ga0495611_0000884 3300046648 Bacteria 16286
650 Ga0495611_0001277 3300046648 Bacteria 12892
651 Ga0495611_0001931 3300046648 Bacteria 9850
652 Ga0495611_0073108 3300046648 Bacteria 1569
653 Ga0495625_0003465 3300046660 Bacteria 15709
654 Ga0495625_0006990 3300046660 Bacteria 9945
655 Ga0495625_0009387 3300046660 Bacteria 8189
656 Ga0495625_0012193 3300046660 Bacteria 6971
657 Ga0495625_0012681 3300046660 Bacteria 6816
658 Ga0495625_0023277 3300046660 Bacteria 4733
659 Ga0495625_0063978 3300046660 Bacteria 2596
660 Ga0495625_0091685 3300046660 Bacteria 2100
661 Ga0495625_0126180 3300046660 Bacteria 1737
662 Ga0495635_0001192 3300046663 Bacteria 17318
663 Ga0495635_0001309 3300046663 Bacteria 16593
664 Ga0495659_0000178 3300046664 Bacteria 27974
665 Ga0495659_0005146 3300046664 Bacteria 4110
666 Ga0495659_0020333 3300046664 Bacteria 2229
667 Ga0495661_0000004 3300046665 Bacteria 555340
668 Ga0495661_0000041 3300046665 Bacteria 151138
669 Ga0495661_0000443 3300046665 Bacteria 43820
670 Ga0495661_0002851 3300046665 Bacteria 13084
671 Ga0495661_0004231 3300046665 Bacteria 10429
672 Ga0495661_0041164 3300046665 Bacteria 2860
673 Ga0495661_0051614 3300046665 Bacteria 2482
674 Ga0495661_0059516 3300046665 Bacteria 2273
675 Ga0495661_0093672 3300046665 Bacteria 1704
676 Ga0495661_0105934 3300046665 Bacteria 1574
677 Ga0495661_0107744 3300046665 Bacteria 1557
678 Ga0495661_0121222 3300046665 Bacteria 1444
679 Ga0495661_0131874 3300046665 Bacteria 1368
680 Ga0495661_0136213 3300046665 Bacteria 1340
681 Ga0495661_0143362 3300046665 Bacteria 1297
682 Ga0495588_0006969 3300046674 Bacteria 5123
683 Ga0495588_0049161 3300046674 Bacteria 2168
684 Ga0495588_0068926 3300046674 Bacteria 1838
685 Ga0495657_0148443 3300046675 Bacteria 1457
686 Ga0495623_0001699 3300046679 Bacteria 14793
687 Ga0495646_0016084 3300046680 Bacteria 4747
688 Ga0495646_0041337 3300046680 Bacteria 2833
689 Ga0495646_0053712 3300046680 Bacteria 2427
690 Ga0495669_0000851 3300046684 Bacteria 12922
691 Ga0495669_0047111 3300046684 Bacteria 1925
692 Ga0495613_0056365 3300046689 Bacteria 2886
693 Ga0495613_0058414 3300046689 Bacteria 2831
694 Ga0495624_0003574 3300046690 Bacteria 11509
695 Ga0495670_0000486 3300046691 Bacteria 18796
696 Ga0495670_0001265 3300046691 Bacteria 12354
697 Ga0495670_0001497 3300046691 Bacteria 11396
698 Ga0495670_0024383 3300046691 Bacteria 2989
699 Ga0495670_0025561 3300046691 Bacteria 2921
700 Ga0495670_0035892 3300046691 Bacteria 2469
701 Ga0495670_0054106 3300046691 Bacteria 2010
702 Ga0495670_0085907 3300046691 Bacteria 1606
703 Ga0495671_0000482 3300046692 Bacteria 30969
704 Ga0495671_0000601 3300046692 Bacteria 26551
705 Ga0495671_0004805 3300046692 Bacteria 7982
706 Ga0495671_0007709 3300046692 Bacteria 6109
707 Ga0495671_0008261 3300046692 Bacteria 5867
708 Ga0495671_0008972 3300046692 Bacteria 5613
709 Ga0495671_0012135 3300046692 Bacteria 4709
710 Ga0495671_0012224 3300046692 Bacteria 4692
711 Ga0495671_0013914 3300046692 Bacteria 4340
712 Ga0495671_0015661 3300046692 Bacteria 4057
713 Ga0495671_0016849 3300046692 Bacteria 3895
714 Ga0495671_0018204 3300046692 Bacteria 3729
715 Ga0495671_0053178 3300046692 Bacteria 2010
716 Ga0495671_0098295 3300046692 Bacteria 1431
717 Ga0495671_0108743 3300046692 Bacteria 1354
718 Ga0495649_0001167 3300046694 Bacteria 20408
719 Ga0495649_0001548 3300046694 Bacteria 17251
720 Ga0495649_0001698 3300046694 Bacteria 16297
721 Ga0495649_0006257 3300046694 Bacteria 7413
722 Ga0495649_0008403 3300046694 Bacteria 6211
723 Ga0495649_0013110 3300046694 Bacteria 4791
724 Ga0495649_0019220 3300046694 Bacteria 3838
725 Ga0495649_0030826 3300046694 Bacteria 2959
726 Ga0495649_0032209 3300046694 Bacteria 2889
727 Ga0495649_0038708 3300046694 Bacteria 2615
728 Ga0495649_0045894 3300046694 Bacteria 2380
729 Ga0495649_0046020 3300046694 Bacteria 2377
730 Ga0495649_0086844 3300046694 Bacteria 1669
731 Ga0495649_0087470 3300046694 Bacteria 1663
732 Ga0495589_0000661 3300046794 Bacteria 22582
733 Ga0495589_0000703 3300046794 Bacteria 21795
734 Ga0495589_0001161 3300046794 Bacteria 15687
735 Ga0495589_0001812 3300046794 Bacteria 12152
736 Ga0495589_0002880 3300046794 Bacteria 9527
737 Ga0495589_0007973 3300046794 Bacteria 5542
738 Ga0495589_0031700 3300046794 Bacteria 2660
739 Ga0495589_0032360 3300046794 Bacteria 2629
740 Ga0495600_0080214 3300046809 Bacteria 2130
741 Ga0495660_0002383 3300046810 Bacteria 11994
742 Ga0495660_0002556 3300046810 Bacteria 11595
743 Ga0495660_0002687 3300046810 Bacteria 11237
744 Ga0495660_0003468 3300046810 Bacteria 9746
745 Ga0495660_0006631 3300046810 Bacteria 6842
746 Ga0495660_0006907 3300046810 Bacteria 6684
747 Ga0495660_0007655 3300046810 Bacteria 6344
748 Ga0495660_0011802 3300046810 Bacteria 5065
749 Ga0495660_0012293 3300046810 Bacteria 4966
750 Ga0495660_0021664 3300046810 Bacteria 3677
751 Ga0495660_0073851 3300046810 Bacteria 1802
752 Ga0495660_0122529 3300046810 Bacteria 1313
753 Ga0495660_0134918 3300046810 Bacteria 1234
754 Ga0495581_0006489 3300047315 Bacteria 6785
755 Ga0495581_0029165 3300047315 Bacteria 3198
756 Ga0495604_0003977 3300047317 Bacteria 11755
757 Ga0495604_0026397 3300047317 Bacteria 4623
758 Ga0495604_0044774 3300047317 Bacteria 3455
759 Ga0495672_0000877 3300047320 Bacteria 31616
760 Ga0495672_0001109 3300047320 Bacteria 27317
761 Ga0495672_0001910 3300047320 Bacteria 19773
762 Ga0495672_0002123 3300047320 Bacteria 18582
763 Ga0495672_0002540 3300047320 Bacteria 16637
764 Ga0495672_0004329 3300047320 Bacteria 11695
765 Ga0495672_0004833 3300047320 Bacteria 10858
766 Ga0495672_0006354 3300047320 Bacteria 9182
767 Ga0495672_0006507 3300047320 Bacteria 9028
768 Ga0495672_0009188 3300047320 Bacteria 7198
769 Ga0495672_0016576 3300047320 Bacteria 4959
770 Ga0495672_0060065 3300047320 Bacteria 2197
771 Ga0495672_0097176 3300047320 Bacteria 1604
772 Ga0495672_0122290 3300047320 Bacteria 1381
773 Ga0495672_0144065 3300047320 Bacteria 1241
774 Ga0495672_0150480 3300047320 Bacteria 1207
775 Ga0495672_0157057 3300047320 Bacteria 1173
776 Ga0495676_0000023 3300047321 Bacteria 156478
777 Ga0495676_0006673 3300047321 Bacteria 10635
778 Ga0495676_0099611 3300047321 Bacteria 2153
779 Ga0495680_0016952 3300047322 Bacteria 6238
780 Ga0495680_0056878 3300047322 Bacteria 3027
781 Ga0495680_0112133 3300047322 Bacteria 2020
782 Ga0495683_0000074 3300047323 Bacteria 100733
783 Ga0495683_0001314 3300047323 Bacteria 16684
784 Ga0495683_0001677 3300047323 Bacteria 14100
785 Ga0495683_0002188 3300047323 Bacteria 11984
786 Ga0495683_0009509 3300047323 Bacteria 5177
787 Ga0495683_0012737 3300047323 Bacteria 4413
788 Ga0495683_0012876 3300047323 Bacteria 4385
789 Ga0495683_0016179 3300047323 Bacteria 3873
790 Ga0495683_0030459 3300047323 Bacteria 2752
791 Ga0495683_0031467 3300047323 Bacteria 2704
792 Ga0495683_0032579 3300047323 Bacteria 2654
793 Ga0495683_0088145 3300047323 Bacteria 1506
794 Ga0495683_0106330 3300047323 Bacteria 1344
795 Ga0495683_0136531 3300047323 Bacteria 1152
796 Ga0495687_002455 3300047443 Bacteria 14853
797 Ga0495687_003593 3300047443 Bacteria 11109
798 Ga0495687_003805 3300047443 Bacteria 10643
799 Ga0495687_025999 3300047443 Bacteria 2759
800 Ga0495675_0000472 3300047444 Bacteria 26436
801 Ga0495675_0028961 3300047444 Bacteria 3530
802 Ga0495675_0124658 3300047444 Bacteria 1603
803 Ga0495677_0000918 3300047445 Bacteria 11869
804 Ga0495679_000127 3300047446 Bacteria 67885
805 Ga0495679_000256 3300047446 Bacteria 44090
806 Ga0495679_000967 3300047446 Bacteria 17725
807 Ga0495679_001112 3300047446 Bacteria 16216
808 Ga0495679_003273 3300047446 Bacteria 7847
809 Ga0495679_007971 3300047446 Bacteria 4356
810 Ga0495679_018990 3300047446 Bacteria 2425
811 Ga0495679_019950 3300047446 Bacteria 2344
812 Ga0495679_021208 3300047446 Bacteria 2248
813 Ga0495679_045388 3300047446 Bacteria 1342
814 Ga0495673_0000205 3300047469 Bacteria 89721
815 Ga0495673_0000504 3300047469 Bacteria 41358
816 Ga0495673_0000850 3300047469 Bacteria 28391
817 Ga0495673_0000954 3300047469 Bacteria 26138
818 Ga0495673_0001805 3300047469 Bacteria 16207
819 Ga0495673_0002219 3300047469 Bacteria 13973
820 Ga0495673_0003148 3300047469 Bacteria 11051
821 Ga0495673_0004720 3300047469 Bacteria 8451
822 Ga0495673_0005001 3300047469 Bacteria 8136
823 Ga0495673_0006401 3300047469 Bacteria 6924
824 Ga0495673_0010501 3300047469 Bacteria 5029
825 Ga0495673_0015833 3300047469 Bacteria 3873
826 Ga0495673_0021256 3300047469 Bacteria 3210
827 Ga0495673_0028268 3300047469 Bacteria 2657
828 Ga0495673_0034630 3300047469 Bacteria 2333
829 Ga0495673_0035355 3300047469 Bacteria 2303
830 Ga0495673_0041246 3300047469 Bacteria 2079
831 Ga0495673_0050649 3300047469 Bacteria 1821
832 Ga0495673_0071575 3300047469 Bacteria 1457
833 Ga0495681_0000709 3300047470 Bacteria 25468
834 Ga0495681_0001350 3300047470 Bacteria 18550
835 Ga0495681_0003227 3300047470 Bacteria 11371
836 Ga0495681_0003467 3300047470 Bacteria 10965
837 Ga0495681_0004718 3300047470 Bacteria 9240
838 Ga0495681_0006092 3300047470 Bacteria 7969
839 Ga0495681_0009210 3300047470 Bacteria 6104
840 Ga0495681_0010075 3300047470 Bacteria 5755
841 Ga0495681_0029385 3300047470 Bacteria 2813
842 Ga0495681_0037054 3300047470 Bacteria 2406
843 Ga0495681_0039918 3300047470 Bacteria 2288
844 Ga0495681_0040963 3300047470 Bacteria 2252
845 Ga0495681_0041796 3300047470 Bacteria 2224
846 Ga0495681_0045634 3300047470 Bacteria 2095
847 Ga0495681_0046539 3300047470 Bacteria 2067
848 Ga0495681_0047188 3300047470 Bacteria 2050
849 Ga0495684_0022641 3300047471 Bacteria 4832
850 Ga0495686_0003486 3300047472 Bacteria 13603
851 Ga0495686_0012830 3300047472 Bacteria 5845
852 Ga0495686_0018058 3300047472 Bacteria 4740
853 Ga0495686_0063263 3300047472 Bacteria 2293
854 Ga0495686_0076043 3300047472 Bacteria 2057
855 Ga0495593_0000227 3300047673 Bacteria 30157
856 Ga0495593_0013500 3300047673 Bacteria 4657
857 Ga0495593_0038661 3300047673 Bacteria 2576
858 Ga0495593_0101346 3300047673 Bacteria 1476
859 Ga0495602_0020643 3300048088 Bacteria 6506
860 Ga0495626_0000229 3300048091 Bacteria 65975
861 Ga0495626_0001207 3300048091 Bacteria 21354
862 Ga0495626_0001242 3300048091 Bacteria 20935
863 Ga0495626_0002576 3300048091 Bacteria 12402
864 Ga0495626_0002586 3300048091 Bacteria 12372
865 Ga0495626_0005047 3300048091 Bacteria 7874
866 Ga0495626_0011764 3300048091 Bacteria 4612
867 Ga0495626_0028415 3300048091 Bacteria 2712
868 Ga0495626_0036277 3300048091 Bacteria 2349
869 Ga0495626_0110405 3300048091 Bacteria 1191
870 Ga0496102_0000995 3300048905 Bacteria 26661
871 Ga0496103_0006446 3300048906 Bacteria 7005
872 Ga0496110_0192608 3300048913 Bacteria 1851
873 Ga0496110_0229758 3300048913 Bacteria 1687
874 Ga0496111_0153045 3300048914 Bacteria 1711
875 Ga0496114_0011888 3300048917 Bacteria 6966
876 Ga0496114_0538083 3300048917 Bacteria 1033
877 Ga0496116_0000185 3300048919 Bacteria 123912
878 Ga0496116_0003145 3300048919 Bacteria 16560
879 Ga0496116_0004302 3300048919 Bacteria 13629
880 Ga0496116_0011016 3300048919 Bacteria 7523
881 Ga0496116_0013678 3300048919 Bacteria 6525
882 Ga0496116_0048280 3300048919 Bacteria 2858
883 Ga0496117_0001839 3300048920 Bacteria 28701
884 Ga0496117_0003817 3300048920 Bacteria 17153
885 Ga0496117_0013724 3300048920 Bacteria 7039
886 Ga0496117_0018553 3300048920 Bacteria 5755
887 Ga0496117_0045393 3300048920 Bacteria 3173
888 Ga0496117_0099960 3300048920 Bacteria 1838
889 Ga0496118_0002876 3300048921 Bacteria 22449
890 Ga0496118_0004315 3300048921 Bacteria 16965
891 Ga0496118_0051495 3300048921 Bacteria 3149
892 Ga0496118_0052441 3300048921 Bacteria 3111
893 Ga0496118_0063289 3300048921 Bacteria 2723
894 Ga0496119_0062370 3300048922 Bacteria 2221
895 Ga0496119_0073057 3300048922 Bacteria 2001
896 Ga0496121_0001963 3300048924 Bacteria 32764
897 Ga0496121_0017962 3300048924 Bacteria 7170
898 Ga0496121_0036797 3300048924 Bacteria 4356
899 Ga0496121_0128321 3300048924 Bacteria 1903
900 Ga0496121_0199046 3300048924 Bacteria 1429
901 Ga0496122_0001997 3300048925 Bacteria 30380
902 Ga0496122_0002734 3300048925 Bacteria 24394
903 Ga0496122_0010016 3300048925 Bacteria 9863
904 Ga0496122_0022832 3300048925 Bacteria 5542
905 Ga0496122_0113038 3300048925 Bacteria 1775
906 Ga0496123_0001245 3300048926 Bacteria 36883
907 Ga0496123_0002963 3300048926 Bacteria 19770
908 Ga0496123_0004932 3300048926 Bacteria 13685
909 Ga0496123_0009246 3300048926 Bacteria 8905
910 Ga0496124_0000031 3300048927 Bacteria 344232
911 Ga0496124_0001844 3300048927 Bacteria 29264
912 Ga0496124_0068544 3300048927 Bacteria 2948
913 Ga0496124_0106535 3300048927 Bacteria 2263
914 Ga0496124_0131832 3300048927 Bacteria 1984
915 Ga0496124_0153875 3300048927 Bacteria 1801
916 Ga0496124_0254129 3300048927 Bacteria 1297
917 Ga0496125_0015770 3300048928 Bacteria 7284
918 Ga0496125_0020724 3300048928 Bacteria 6163
919 Ga0496125_0149835 3300048928 Bacteria 1604
920 Ga0496125_0182090 3300048928 Bacteria 1398
921 Ga0496126_0121592 3300048929 Bacteria 2263
922 Ga0496126_0249263 3300048929 Bacteria 1480
923 Ga0495678_000036 3300049459 Bacteria 198018
924 Ga0495678_000120 3300049459 Bacteria 91473
925 Ga0495678_000682 3300049459 Bacteria 31220
926 Ga0495678_000830 3300049459 Bacteria 27652
927 Ga0495678_001470 3300049459 Bacteria 18457
928 Ga0495678_004259 3300049459 Bacteria 8365
929 Ga0495678_007824 3300049459 Bacteria 5495
930 Ga0495678_008376 3300049459 Bacteria 5222
931 Ga0495678_010837 3300049459 Bacteria 4400
932 Ga0495678_020338 3300049459 Bacteria 2942
933 Ga0495678_021019 3300049459 Bacteria 2880
934 Ga0495678_026138 3300049459 Bacteria 2496
935 Ga0495678_028278 3300049459 Bacteria 2368
936 Ga0495678_039484 3300049459 Bacteria 1903
937 Ga0495678_061393 3300049459 Bacteria 1410
938 Ga0495682_0000018 3300049460 Bacteria 229211
939 Ga0495682_0000560 3300049460 Bacteria 25464
940 Ga0495682_0003709 3300049460 Bacteria 6730
941 Ga0495682_0021052 3300049460 Bacteria 2445
942 Ga0495682_0039196 3300049460 Bacteria 1739
943 Ga0495682_0052451 3300049460 Bacteria 1482
944 Ga0495682_0054021 3300049460 Bacteria 1458
945 Ga0501222_002159 3300049662 Bacteria 2728
946 Ga0501241_001449 3300049758 Bacteria 4821
947 nmdc:mga03683_19196_c1 3300050489 Bacteria 2607
948 nmdc:mga03683_29638_c1 3300050489 Bacteria 2183
949 nmdc:mga00v17_143317_c1 3300050491 Bacteria 1533
950 nmdc:mga08x19_259456_c1 3300050514 Bacteria 1201
951 nmdc:mga0sz30_27534_c1 3300050516 Bacteria 2335
952 nmdc:mga0sz30_69135_c1 3300050516 Bacteria 1518
953 Ga0500572_001470 3300053111 Bacteria 6405
954 Ga0500572_078144 3300053111 Bacteria 1033
955 Ga0500608_002153 3300053122 Bacteria 7075
956 Ga0500573_0021459 3300053140 Bacteria 3701
957 Ga0500586_045869 3300053145 Bacteria 1496

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047444 Ga0495675_0000472 Ga0495675_0000472_155_937 241
2 3300006186 Ga0075369_10038139 Ga0075369_100381392 267
3 3300027907 Ga0207428_10115249 Ga0207428_101152492 267
4 3300050516 nmdc:mga0sz30_69135_c1 nmdc:mga0sz30_69135_c1_245_1168 267
5 3300050489 nmdc:mga03683_29638_c1 nmdc:mga03683_29638_c1_13_840 268
6 3300047320 Ga0495672_0001910 Ga0495672_0001910_714_1637 273
7 3300003791 Ga0055530_10000450 Ga0055530_100004507 274
8 3300003792 Ga0055540_1000386 Ga0055540_10003867 274
9 3300015262 Ga0182007_10013480 Ga0182007_100134803 274
10 3300025298 Ga0209050_1000227 Ga0209050_100022734 274
11 3300025303 Ga0209051_1000164 Ga0209051_100016435 274
12 3300025304 Ga0209257_1016959 Ga0209257_10169593 274
13 3300046455 Ga0495603_0144450 Ga0495603_0144450_518_1366 274
14 3300046491 Ga0495584_0182975 Ga0495584_0182975_109_1032 274
15 3300046530 Ga0495654_0002998 Ga0495654_0002998_6417_7340 274
16 3300006946 Ga0079104_1000094 Ga0079104_100009435 275
17 3300027111 Ga0209281_1000212 Ga0209281_100021297 275
18 3300027907 Ga0207428_10220554 Ga0207428_102205542 275
19 3300042013 Ga0439456_000011 Ga0439456_000011_6762_7694 275
20 3300046474 Ga0495605_0007020 Ga0495605_0007020_1111_2043 275
21 3300046507 Ga0495606_0008977 Ga0495606_0008977_467_1399 275
22 3300046530 Ga0495654_0015122 Ga0495654_0015122_3235_4086 275
23 3300038705 Ga0237819_03413 Ga0237819_03413_1845_2795 276
24 3300041405 Ga0439438_029862 Ga0439438_029862_63_986 276
25 3300041411 Ga0439466_0054466 Ga0439466_0054466_231_1154 276
26 3300041997 Ga0439431_0005836 Ga0439431_0005836_506_1429 276
27 3300046474 Ga0495605_0000006 Ga0495605_0000006_280615_281538 277
28 3300046501 Ga0495607_0074364 Ga0495607_0074364_446_1369 277
29 3300046506 Ga0495583_0001142 Ga0495583_0001142_4378_5310 277
30 3300046520 Ga0495637_0000465 Ga0495637_0000465_1107_2030 277
31 3300047469 Ga0495673_0004720 Ga0495673_0004720_3206_4129 277
32 3300049459 Ga0495678_000120 Ga0495678_000120_52811_53734 277
33 3300046526 Ga0495666_0000454 Ga0495666_0000454_1371_2294 278
34 3300047317 Ga0495604_0044774 Ga0495604_0044774_597_1520 278
35 3300047444 Ga0495675_0028961 Ga0495675_0028961_180_1103 278
36 3300047673 Ga0495593_0000227 Ga0495593_0000227_28113_29036 278
37 3300005288 Ga0065714_10079390 Ga0065714_100793903 280
38 3300005353 Ga0070669_100164497 Ga0070669_1001644972 280
39 3300025923 Ga0207681_10141103 Ga0207681_101411032 280
40 3300042016 Ga0439463_000285 Ga0439463_000285_6420_7343 280
41 2162886007 SwRhRL2b_contig_1674522 SwRhRL2b_0701.00005210 281
42 3300005288 Ga0065714_10003263 Ga0065714_100032636 281
43 3300005289 Ga0065704_10071421 Ga0065704_100714212 281
44 3300005548 Ga0070665_100681510 Ga0070665_1006815101 281
45 3300013100 Ga0157373_10007023 Ga0157373_100070234 281
46 3300015262 Ga0182007_10005030 Ga0182007_100050304 281
47 3300046463 Ga0495653_0028043 Ga0495653_0028043_3384_4307 281
48 3300046512 Ga0495610_0003479 Ga0495610_0003479_3238_4161 281
49 3300046517 Ga0495630_0214482 Ga0495630_0214482_377_1300 281
50 3300046675 Ga0495657_0148443 Ga0495657_0148443_444_1367 281
51 3300047470 Ga0495681_0001350 Ga0495681_0001350_15859_16782 281
52 3300048920 Ga0496117_0045393 Ga0496117_0045393_1456_2385 281
53 3300048921 Ga0496118_0051495 Ga0496118_0051495_896_1825 281
54 3300005289 Ga0065704_10083751 Ga0065704_100837513 282
55 3300013102 Ga0157371_10008470 Ga0157371_100084706 282
56 3300013105 Ga0157369_10215419 Ga0157369_102154192 282
57 3300030744 Ga0316181_1038587 Ga0316181_103858717 282
58 3300046492 Ga0495585_0000803 Ga0495585_0000803_3309_4235 282
59 3300047443 Ga0495687_003805 Ga0495687_003805_8331_9254 282
60 3300049460 Ga0495682_0054021 Ga0495682_0054021_517_1440 282
61 iso_pu_bacteria 2923634449 2923638218 282
62 3300013306 Ga0163162_10016166 Ga0163162_100161664 283
63 3300046474 Ga0495605_0035121 Ga0495605_0035121_781_1704 283
64 3300046506 Ga0495583_0001090 Ga0495583_0001090_9376_10299 283
65 3300046530 Ga0495654_0000554 Ga0495654_0000554_9458_10381 283
66 3300046530 Ga0495654_0011415 Ga0495654_0011415_2331_3263 283
67 3300047472 Ga0495686_0076043 Ga0495686_0076043_114_1049 283
68 3300003751 Ga0055538_1000027 Ga0055538_100002748 284
69 3300003752 Ga0055539_1000036 Ga0055539_100003648 284
70 3300003756 Ga0055533_1000046 Ga0055533_100004648 284
71 3300003758 Ga0055532_1000032 Ga0055532_100003248 284
72 3300003759 Ga0055525_1000145 Ga0055525_100014548 284
73 3300003841 Ga0055541_1000024 Ga0055541_100002448 284
74 3300025224 Ga0209784_100017 Ga0209784_100017399 284
75 3300025225 Ga0209566_100014 Ga0209566_100014399 284
76 3300025226 Ga0209674_100028 Ga0209674_100028399 284
77 3300025229 Ga0209147_100038 Ga0209147_100038254 284
78 3300025230 Ga0209563_100032 Ga0209563_100032399 284
79 3300025242 Ga0209258_100212 Ga0209258_10021260 284
80 3300025246 Ga0209646_1000266 Ga0209646_100026612 284
81 3300025253 Ga0209677_100018 Ga0209677_100018399 284
82 3300031731 Ga0307405_10088797 Ga0307405_100887972 284
83 3300031911 Ga0307412_10002735 Ga0307412_100027354 284
84 3300032004 Ga0307414_10019725 Ga0307414_100197253 284
85 3300046457 Ga0495590_0020336 Ga0495590_0020336_994_1917 284
86 3300046530 Ga0495654_0001225 Ga0495654_0001225_2811_3734 284
87 3300046660 Ga0495625_0023277 Ga0495625_0023277_169_1092 284
88 3300047469 Ga0495673_0000504 Ga0495673_0000504_3553_4476 284
89 3300003781 Ga0055536_1004428 Ga0055536_10044283 285
90 3300003791 Ga0055530_10003560 Ga0055530_100035604 285
91 3300003792 Ga0055540_1000469 Ga0055540_100046924 285
92 3300003794 Ga0055531_10001871 Ga0055531_100018718 285
93 3300005457 Ga0070662_100054215 Ga0070662_1000542153 285
94 3300006186 Ga0075369_10080028 Ga0075369_100800282 285
95 3300006948 Ga0099826_10021555 Ga0099826_100215553 285
96 3300009011 Ga0105251_10019873 Ga0105251_100198734 285
97 3300009036 Ga0105244_10012266 Ga0105244_100122664 285
98 3300009036 Ga0105244_10023047 Ga0105244_100230473 285
99 3300009092 Ga0105250_10040097 Ga0105250_100400972 285
100 3300009092 Ga0105250_10049517 Ga0105250_100495171 285
101 3300011119 Ga0105246_10004856 Ga0105246_100048564 285
102 3300025292 Ga0209676_1000055 Ga0209676_10000554 285
103 3300025298 Ga0209050_1000120 Ga0209050_1000120146 285
104 3300025303 Ga0209051_1000551 Ga0209051_10005514 285
105 3300025304 Ga0209257_1000463 Ga0209257_100046352 285
106 3300025711 Ga0207696_1013047 Ga0207696_10130472 285
107 3300025728 Ga0207655_1000818 Ga0207655_100081826 285
108 3300025728 Ga0207655_1004818 Ga0207655_10048183 285
109 3300025728 Ga0207655_1007825 Ga0207655_10078254 285
110 3300025735 Ga0207713_1007688 Ga0207713_10076884 285
111 3300025935 Ga0207709_10000615 Ga0207709_100006154 285
112 3300031824 Ga0307413_10218651 Ga0307413_102186512 285
113 3300046452 Ga0495617_005698 Ga0495617_005698_235_1158 285
114 3300046458 Ga0495591_019182 Ga0495591_019182_912_1835 285
115 3300046501 Ga0495607_0007092 Ga0495607_0007092_6371_7294 285
116 3300046507 Ga0495606_0008429 Ga0495606_0008429_3586_4509 285
117 3300046512 Ga0495610_0052864 Ga0495610_0052864_419_1342 285
118 3300046513 Ga0495616_0003911 Ga0495616_0003911_7966_8889 285
119 3300046515 Ga0495620_0026384 Ga0495620_0026384_1001_1924 285
120 3300046518 Ga0495631_0000697 Ga0495631_0000697_10881_11804 285
121 3300046524 Ga0495648_0052938 Ga0495648_0052938_1490_2413 285
122 3300046558 Ga0495633_0003310 Ga0495633_0003310_4089_5012 285
123 3300046665 Ga0495661_0107744 Ga0495661_0107744_169_1092 285
124 3300046694 Ga0495649_0086844 Ga0495649_0086844_489_1412 285
125 3300047320 Ga0495672_0144065 Ga0495672_0144065_123_1046 285
126 3300047446 Ga0495679_021208 Ga0495679_021208_560_1483 285
127 3300047469 Ga0495673_0001805 Ga0495673_0001805_7514_8437 285
128 3300047470 Ga0495681_0039918 Ga0495681_0039918_1009_1932 285
129 3300048920 Ga0496117_0099960 Ga0496117_0099960_66_992 285
130 3300048922 Ga0496119_0062370 Ga0496119_0062370_453_1379 285
131 3300048927 Ga0496124_0254129 Ga0496124_0254129_261_1187 285
132 3300048928 Ga0496125_0015770 Ga0496125_0015770_140_1063 285
133 3300049460 Ga0495682_0021052 Ga0495682_0021052_1442_2365 285
134 3300013100 Ga0157373_10008437 Ga0157373_100084374 286
135 3300014497 Ga0182008_10008718 Ga0182008_100087184 286
136 3300017792 Ga0163161_10091925 Ga0163161_100919252 286
137 3300042010 Ga0439452_000314 Ga0439452_000314_23457_24380 286
138 3300046492 Ga0495585_0000121 Ga0495585_0000121_70515_71438 286
139 3300046501 Ga0495607_0000816 Ga0495607_0000816_23845_24768 286
140 3300046524 Ga0495648_0000175 Ga0495648_0000175_4929_5852 286
141 3300046557 Ga0495622_0070440 Ga0495622_0070440_23_946 286
142 3300046692 Ga0495671_0098295 Ga0495671_0098295_488_1411 286
143 3300009092 Ga0105250_10000962 Ga0105250_1000096216 287
144 3300013307 Ga0157372_10007680 Ga0157372_100076805 287
145 3300014497 Ga0182008_10006014 Ga0182008_100060143 287
146 3300015261 Ga0182006_1003362 Ga0182006_10033623 287
147 3300025230 Ga0209563_101656 Ga0209563_1016569 287
148 3300025711 Ga0207696_1000025 Ga0207696_1000025210 287
149 3300025933 Ga0207706_10021133 Ga0207706_100211334 287
150 3300042993 Ga0439440_0002966 Ga0439440_0002966_1297_2220 287
151 3300046474 Ga0495605_0000803 Ga0495605_0000803_12327_13250 287
152 3300047470 Ga0495681_0010075 Ga0495681_0010075_4547_5473 287
153 3300048917 Ga0496114_0011888 Ga0496114_0011888_5938_6876 287
154 3300048919 Ga0496116_0011016 Ga0496116_0011016_5160_6086 287
155 3300048920 Ga0496117_0013724 Ga0496117_0013724_5608_6534 287
156 3300048921 Ga0496118_0052441 Ga0496118_0052441_2153_3079 287
157 3300048924 Ga0496121_0017962 Ga0496121_0017962_4696_5622 287
158 3300048925 Ga0496122_0113038 Ga0496122_0113038_761_1687 287
159 3300003781 Ga0055536_1000233 Ga0055536_100023333 288
160 3300003791 Ga0055530_10000120 Ga0055530_1000012033 288
161 3300003792 Ga0055540_1000074 Ga0055540_100007432 288
162 3300013100 Ga0157373_10035876 Ga0157373_100358762 288
163 3300025292 Ga0209676_1000021 Ga0209676_1000021416 288
164 3300025298 Ga0209050_1000162 Ga0209050_100016273 288
165 3300025303 Ga0209051_1000121 Ga0209051_100012179 288
166 3300027312 Ga0209371_1000237 Ga0209371_100023727 288
167 3300030500 Ga0268256_1000485 Ga0268256_100048516 288
168 3300042016 Ga0439463_017147 Ga0439463_017147_288_1211 288
169 3300042115 Ga0450911_003296 Ga0450911_003296_762_1688 288
170 3300042533 Ga0450901_002567 Ga0450901_002567_465_1388 288
171 3300046460 Ga0495638_0012055 Ga0495638_0012055_4442_5368 288
172 3300046491 Ga0495584_0004996 Ga0495584_0004996_3202_4128 288
173 3300046519 Ga0495632_0014620 Ga0495632_0014620_2030_2956 288
174 3300046542 Ga0495597_0027784 Ga0495597_0027784_655_1581 288
175 3300046665 Ga0495661_0093672 Ga0495661_0093672_515_1441 288
176 3300046692 Ga0495671_0108743 Ga0495671_0108743_303_1229 288
177 3300046694 Ga0495649_0046020 Ga0495649_0046020_1069_1995 288
178 3300047470 Ga0495681_0040963 Ga0495681_0040963_1172_2098 288
179 3300047472 Ga0495686_0018058 Ga0495686_0018058_3391_4317 288
180 3300048927 Ga0496124_0068544 Ga0496124_0068544_1906_2886 288
181 3300009011 Ga0105251_10013736 Ga0105251_100137364 289
182 3300025291 Ga0209675_1006245 Ga0209675_10062454 289
183 3300025735 Ga0207713_1005755 Ga0207713_10057554 289
184 3300030733 Ga0314311_1146120 Ga0314311_11461202 289
185 3300030742 Ga0316183_1041168 Ga0316183_10411682 289
186 3300031548 Ga0307408_100012192 Ga0307408_1000121923 289
187 3300031731 Ga0307405_10000788 Ga0307405_1000078810 289
188 3300031824 Ga0307413_10014239 Ga0307413_100142395 289
189 3300031901 Ga0307406_10030119 Ga0307406_100301193 289
190 3300031911 Ga0307412_10001435 Ga0307412_1000143511 289
191 3300031995 Ga0307409_100111985 Ga0307409_1001119852 289
192 3300032002 Ga0307416_100099460 Ga0307416_1000994601 289
193 3300032004 Ga0307414_10005407 Ga0307414_100054076 289
194 3300046557 Ga0495622_0102108 Ga0495622_0102108_379_1302 289
195 3300049662 Ga0501222_002159 Ga0501222_002159_508_1431 289
196 3300053122 Ga0500608_002153 Ga0500608_002153_6069_6968 289
197 3300002737 JGI25162J39368_1000042 JGI25162J39368_1000042122 290
198 3300002771 JGI25163J39215_1000577 JGI25163J39215_10005771 290
199 3300002771 JGI25163J39215_1001521 JGI25163J39215_10015215 290
200 3300002772 JGI25164J39214_1000023 JGI25164J39214_100002346 290
201 3300003214 JGI25165J46597_1000083 JGI25165J46597_100008353 290
202 3300009011 Ga0105251_10108050 Ga0105251_101080501 290
203 3300009036 Ga0105244_10055619 Ga0105244_100556192 290
204 3300009148 Ga0105243_10000985 Ga0105243_100009854 290
205 3300015265 Ga0182005_1006695 Ga0182005_10066951 290
206 3300025207 Ga0209760_100065 Ga0209760_100065102 290
207 3300025231 Ga0207427_100008 Ga0207427_100008575 290
208 3300025233 Ga0209437_100014 Ga0209437_100014136 290
209 3300025261 Ga0209233_1000008 Ga0209233_1000008136 290
210 3300025939 Ga0207665_10196471 Ga0207665_101964712 290
211 3300027907 Ga0207428_10067998 Ga0207428_100679982 290
212 3300046457 Ga0495590_0077335 Ga0495590_0077335_60_983 290
213 3300046458 Ga0495591_024917 Ga0495591_024917_492_1442 290
214 3300046460 Ga0495638_0008077 Ga0495638_0008077_6472_7395 290
215 3300046491 Ga0495584_0002871 Ga0495584_0002871_762_1685 290
216 3300046501 Ga0495607_0006807 Ga0495607_0006807_6587_7537 290
217 3300046506 Ga0495583_0000984 Ga0495583_0000984_13917_14867 290
218 3300046507 Ga0495606_0002366 Ga0495606_0002366_7129_8052 290
219 3300046515 Ga0495620_0002916 Ga0495620_0002916_616_1539 290
220 3300046518 Ga0495631_0001825 Ga0495631_0001825_5562_6512 290
221 3300046519 Ga0495632_0003575 Ga0495632_0003575_288_1238 290
222 3300046520 Ga0495637_0055754 Ga0495637_0055754_545_1468 290
223 3300046522 Ga0495643_0002887 Ga0495643_0002887_6811_7761 290
224 3300046522 Ga0495643_0091052 Ga0495643_0091052_306_1229 290
225 3300046524 Ga0495648_0001093 Ga0495648_0001093_17231_18181 290
226 3300046524 Ga0495648_0004995 Ga0495648_0004995_4025_4948 290
227 3300046530 Ga0495654_0038857 Ga0495654_0038857_387_1310 290
228 3300046648 Ga0495611_0073108 Ga0495611_0073108_16_966 290
229 3300046660 Ga0495625_0012193 Ga0495625_0012193_127_1050 290
230 3300046664 Ga0495659_0020333 Ga0495659_0020333_1029_1976 290
231 3300046665 Ga0495661_0004231 Ga0495661_0004231_6421_7371 290
232 3300046665 Ga0495661_0105934 Ga0495661_0105934_593_1516 290
233 3300046691 Ga0495670_0025561 Ga0495670_0025561_36_959 290
234 3300046692 Ga0495671_0004805 Ga0495671_0004805_3601_4551 290
235 3300046692 Ga0495671_0016849 Ga0495671_0016849_1529_2452 290
236 3300046694 Ga0495649_0006257 Ga0495649_0006257_240_1163 290
237 3300046794 Ga0495589_0002880 Ga0495589_0002880_1442_2365 290
238 3300046810 Ga0495660_0006631 Ga0495660_0006631_5421_6344 290
239 3300047320 Ga0495672_0016576 Ga0495672_0016576_378_1328 290
240 3300047320 Ga0495672_0150480 Ga0495672_0150480_121_1044 290
241 3300047323 Ga0495683_0009509 Ga0495683_0009509_716_1639 290
242 3300047469 Ga0495673_0000850 Ga0495673_0000850_15906_16856 290
243 3300047470 Ga0495681_0003227 Ga0495681_0003227_3620_4543 290
244 3300047472 Ga0495686_0063263 Ga0495686_0063263_72_995 290
245 3300049459 Ga0495678_008376 Ga0495678_008376_3222_4172 290
246 3300041405 Ga0439438_001473 Ga0439438_001473_6348_7271 291
247 3300041407 Ga0439447_008164 Ga0439447_008164_229_1152 291
248 3300041411 Ga0439466_0013152 Ga0439466_0013152_144_1067 291
249 3300041411 Ga0439466_0057363 Ga0439466_0057363_207_1130 291
250 3300042006 Ga0439432_020173 Ga0439432_020173_487_1410 291
251 3300042009 Ga0439451_008640 Ga0439451_008640_425_1348 291
252 3300042010 Ga0439452_037734 Ga0439452_037734_121_1044 291
253 3300042013 Ga0439456_020374 Ga0439456_020374_433_1356 291
254 3300042016 Ga0439463_041637 Ga0439463_041637_101_1024 291
255 3300042115 Ga0450911_003836 Ga0450911_003836_812_1735 291
256 3300042145 Ga0450906_002956 Ga0450906_002956_2116_3039 291
257 3300042146 Ga0450907_003873 Ga0450907_003873_43_966 291
258 3300042156 Ga0439446_0012282 Ga0439446_0012282_599_1522 291
259 3300042184 Ga0450908_003793 Ga0450908_003793_1566_2489 291
260 3300042185 Ga0450909_000318 Ga0450909_000318_4850_5773 291
261 3300046452 Ga0495617_000518 Ga0495617_000518_5464_6387 291
262 3300046457 Ga0495590_0000360 Ga0495590_0000360_5503_6426 291
263 3300046471 Ga0495650_0002118 Ga0495650_0002118_13717_14640 291
264 3300046474 Ga0495605_0002950 Ga0495605_0002950_4942_5865 291
265 3300046491 Ga0495584_0000474 Ga0495584_0000474_24866_25789 291
266 3300046491 Ga0495584_0000632 Ga0495584_0000632_10368_11291 291
267 3300046491 Ga0495584_0002552 Ga0495584_0002552_8279_9202 291
268 3300046501 Ga0495607_0000170 Ga0495607_0000170_56632_57555 291
269 3300046501 Ga0495607_0003251 Ga0495607_0003251_1898_2821 291
270 3300046506 Ga0495583_0086532 Ga0495583_0086532_376_1299 291
271 3300046513 Ga0495616_0000794 Ga0495616_0000794_16713_17636 291
272 3300046519 Ga0495632_0001228 Ga0495632_0001228_15369_16292 291
273 3300046520 Ga0495637_0001737 Ga0495637_0001737_6781_7704 291
274 3300046522 Ga0495643_0005993 Ga0495643_0005993_2755_3678 291
275 3300046524 Ga0495648_0051600 Ga0495648_0051600_1213_2136 291
276 3300046526 Ga0495666_0072543 Ga0495666_0072543_42_965 291
277 3300046528 Ga0495642_0000632 Ga0495642_0000632_1629_2552 291
278 3300046536 Ga0495587_0001819 Ga0495587_0001819_11814_12737 291
279 3300046538 Ga0495609_0001173 Ga0495609_0001173_7697_8620 291
280 3300046642 Ga0495634_0000987 Ga0495634_0000987_1469_2392 291
281 3300046648 Ga0495611_0000884 Ga0495611_0000884_13745_14668 291
282 3300046660 Ga0495625_0091685 Ga0495625_0091685_169_1092 291
283 3300046663 Ga0495635_0001309 Ga0495635_0001309_15268_16191 291
284 3300046680 Ga0495646_0041337 Ga0495646_0041337_1252_2175 291
285 3300046691 Ga0495670_0001265 Ga0495670_0001265_9495_10418 291
286 3300046691 Ga0495670_0085907 Ga0495670_0085907_46_969 291
287 3300046692 Ga0495671_0000601 Ga0495671_0000601_13387_14310 291
288 3300046694 Ga0495649_0001167 Ga0495649_0001167_11634_12557 291
289 3300046794 Ga0495589_0001812 Ga0495589_0001812_617_1540 291
290 3300047320 Ga0495672_0002123 Ga0495672_0002123_8998_9921 291
291 3300047323 Ga0495683_0032579 Ga0495683_0032579_1013_1936 291
292 3300047443 Ga0495687_002455 Ga0495687_002455_12583_13506 291
293 3300047469 Ga0495673_0003148 Ga0495673_0003148_6213_7136 291
294 3300047469 Ga0495673_0034630 Ga0495673_0034630_63_986 291
295 3300048091 Ga0495626_0001207 Ga0495626_0001207_5305_6228 291
296 3300048905 Ga0496102_0000995 Ga0496102_0000995_1535_2458 291
297 3300048906 Ga0496103_0006446 Ga0496103_0006446_4581_5504 291
298 3300048917 Ga0496114_0538083 Ga0496114_0538083_49_972 291
299 3300048920 Ga0496117_0018553 Ga0496117_0018553_575_1498 291
300 3300048921 Ga0496118_0063289 Ga0496118_0063289_657_1580 291
301 3300048924 Ga0496121_0128321 Ga0496121_0128321_495_1418 291
302 3300048929 Ga0496126_0249263 Ga0496126_0249263_523_1446 291
303 3300049459 Ga0495678_000830 Ga0495678_000830_15134_16057 291
304 3300049459 Ga0495678_001470 Ga0495678_001470_17484_18407 291
305 3300025728 Ga0207655_1000035 Ga0207655_100003518 292
306 3300025735 Ga0207713_1040189 Ga0207713_10401891 292
307 3300046520 Ga0495637_0001230 Ga0495637_0001230_11339_12265 292
308 3300047323 Ga0495683_0106330 Ga0495683_0106330_151_1077 292
309 3300049460 Ga0495682_0000018 Ga0495682_0000018_212977_213900 292
310 3300005353 Ga0070669_100000872 Ga0070669_10000087216 293
311 3300005457 Ga0070662_100000381 Ga0070662_10000038124 293
312 3300005539 Ga0068853_100010777 Ga0068853_1000107777 293
313 3300005578 Ga0068854_100055088 Ga0068854_1000550882 293
314 3300005834 Ga0068851_10000060 Ga0068851_1000006028 293
315 3300009011 Ga0105251_10000381 Ga0105251_1000038153 293
316 3300013105 Ga0157369_10009140 Ga0157369_1000914010 293
317 3300013308 Ga0157375_10027570 Ga0157375_100275703 293
318 3300014497 Ga0182008_10001534 Ga0182008_1000153417 293
319 3300014497 Ga0182008_10003857 Ga0182008_100038577 293
320 3300015261 Ga0182006_1000539 Ga0182006_100053923 293
321 3300017792 Ga0163161_10015406 Ga0163161_100154062 293
322 3300017792 Ga0163161_10037409 Ga0163161_100374093 293
323 3300025321 Ga0207656_10000037 Ga0207656_1000003736 293
324 3300025735 Ga0207713_1001073 Ga0207713_10010733 293
325 3300025923 Ga0207681_10000363 Ga0207681_1000036320 293
326 3300025933 Ga0207706_10000140 Ga0207706_1000014014 293
327 3300025981 Ga0207640_10099988 Ga0207640_100999882 293
328 3300026041 Ga0207639_10009502 Ga0207639_100095026 293
329 3300030521 Ga0307511_10097111 Ga0307511_100971111 293
330 3300031507 Ga0307509_10158464 Ga0307509_101584642 293
331 3300042006 Ga0439432_000374 Ga0439432_000374_8784_9707 293
332 3300046507 Ga0495606_0130961 Ga0495606_0130961_80_1003 293
333 3300046519 Ga0495632_0055426 Ga0495632_0055426_882_1805 293
334 3300046530 Ga0495654_0059393 Ga0495654_0059393_717_1640 293
335 3300046530 Ga0495654_0061251 Ga0495654_0061251_201_1130 293
336 3300046810 Ga0495660_0021664 Ga0495660_0021664_1972_2904 293
337 3300047320 Ga0495672_0000877 Ga0495672_0000877_6616_7539 293
338 3300047320 Ga0495672_0097176 Ga0495672_0097176_539_1462 293
339 3300047446 Ga0495679_000967 Ga0495679_000967_13435_14358 293
340 3300047446 Ga0495679_001112 Ga0495679_001112_8413_9339 293
341 3300047470 Ga0495681_0045634 Ga0495681_0045634_181_1104 293
342 3300048922 Ga0496119_0073057 Ga0496119_0073057_58_987 293
343 3300048924 Ga0496121_0036797 Ga0496121_0036797_3224_4153 293
344 3300048927 Ga0496124_0106535 Ga0496124_0106535_980_1909 293
345 3300048928 Ga0496125_0149835 Ga0496125_0149835_99_1028 293
346 iso_pu_bacteria 2808606386 2808984997 293
347 iso_pu_bacteria 2808606415 2809130129 293
348 iso_pu_bacteria 2808606419 2809150394 293
349 iso_pu_bacteria 2852618963 2852621382 293
350 3300006051 Ga0075364_10142407 Ga0075364_101424072 294
351 3300006177 Ga0075362_10044953 Ga0075362_100449532 294
352 3300006186 Ga0075369_10013825 Ga0075369_100138251 294
353 3300013105 Ga0157369_10045274 Ga0157369_100452746 294
354 3300050489 nmdc:mga03683_19196_c1 nmdc:mga03683_19196_c1_1461_2384 294
355 3300050516 nmdc:mga0sz30_27534_c1 nmdc:mga0sz30_27534_c1_945_1868 294
356 3300009011 Ga0105251_10007297 Ga0105251_100072979 296
357 3300013102 Ga0157371_10003945 Ga0157371_100039454 296
358 3300025735 Ga0207713_1026500 Ga0207713_10265003 296
359 3300046457 Ga0495590_0003523 Ga0495590_0003523_1270_2193 296
360 3300046458 Ga0495591_032841 Ga0495591_032841_125_1048 296
361 3300046460 Ga0495638_0001724 Ga0495638_0001724_14924_15847 296
362 3300046474 Ga0495605_0031021 Ga0495605_0031021_520_1443 296
363 3300046491 Ga0495584_0044573 Ga0495584_0044573_687_1610 296
364 3300046492 Ga0495585_0096815 Ga0495585_0096815_646_1569 296
365 3300046501 Ga0495607_0031810 Ga0495607_0031810_1206_2129 296
366 3300046519 Ga0495632_0067979 Ga0495632_0067979_206_1129 296
367 3300046522 Ga0495643_0091535 Ga0495643_0091535_60_983 296
368 3300046523 Ga0495644_0000189 Ga0495644_0000189_24685_25608 296
369 3300046542 Ga0495597_0036303 Ga0495597_0036303_633_1556 296
370 3300046692 Ga0495671_0013914 Ga0495671_0013914_3244_4167 296
371 3300046694 Ga0495649_0001698 Ga0495649_0001698_14178_15101 296
372 3300046810 Ga0495660_0006907 Ga0495660_0006907_5247_6170 296
373 3300047320 Ga0495672_0001109 Ga0495672_0001109_3522_4445 296
374 3300047323 Ga0495683_0016179 Ga0495683_0016179_1700_2623 296
375 3300047469 Ga0495673_0000954 Ga0495673_0000954_21811_22734 296
376 3300048927 Ga0496124_0001844 Ga0496124_0001844_3427_4350 296
377 3300049459 Ga0495678_028278 Ga0495678_028278_989_1912 296
378 iso_pu_bacteria 2511231003 2511250311 296
379 iso_pu_bacteria 2511231004 2511255931 296
380 iso_pu_bacteria 2511231006 2511268072 296
381 iso_pu_bacteria 2511231007 2511274857 296
382 iso_pu_bacteria 2511231010 2511293006 296
383 iso_pu_bacteria 2511231011 2511296813 296
384 iso_pu_bacteria 2511231012 2511300215 296
385 iso_pu_bacteria 2511231015 2511317150 296
386 iso_pu_bacteria 2511231016 2511323902 296
387 iso_pu_bacteria 2511231018 2511337532 296
388 iso_pu_bacteria 2511231019 2511345994 296
389 iso_pu_bacteria 2511231020 2511349456 296
390 iso_pu_bacteria 2511231022 2511364761 296
391 iso_pu_bacteria 2512047018 2512327009 296
392 iso_pu_bacteria 2597489888 2597865346 296
393 iso_pu_bacteria 2599185167 2599400468 296
394 iso_pu_bacteria 2599185188 2599504412 296
395 iso_pu_bacteria 2599185189 2599508517 296
396 iso_pu_bacteria 2600255296 2601689411 296
397 iso_pu_bacteria 2600255318 2601795669 296
398 iso_pu_bacteria 2603880185 2606075485 296
399 iso_pu_bacteria 2603880199 2606128348 296
400 iso_pu_bacteria 2619619299 2621298116 296
401 iso_pu_bacteria 2623620443 2624479611 296
402 iso_pu_bacteria 2623620446 2624493372 296
403 iso_pu_bacteria 2643221565 2643846214 296
404 iso_pu_bacteria 2643221589 2643952738 296
405 iso_pu_bacteria 2643221602 2644022500 296
406 iso_pu_bacteria 2643221603 2644027505 296
407 iso_pu_bacteria 2643221633 2644188705 296
408 iso_pu_bacteria 2643221713 2644622169 296
409 iso_pu_bacteria 2713897149 2715757875 296
410 iso_pu_bacteria 2721755607 2723250091 296
411 iso_pu_bacteria 2738541265 2738671501 296
412 iso_pu_bacteria 2738541282 2738749895 296
413 iso_pu_bacteria 2738541303 2738858935 296
414 iso_pu_bacteria 2738543004 2739201151 296
415 iso_pu_bacteria 2738543015 2739262088 296
416 iso_pu_bacteria 2773857670 2774121183 296
417 iso_pu_bacteria 2784132072 2784316625 296
418 iso_pu_bacteria 2808606377 2808927539 296
419 iso_pu_bacteria 2808606381 2808949921 296
420 iso_pu_bacteria 2808606382 2808957795 296
421 iso_pu_bacteria 2808606445 2809216545 296
422 iso_pu_bacteria 2816332298 2817492744 296
423 iso_pu_bacteria 2842826826 2842827440 296
424 iso_pu_bacteria 2842832357 2842832518 296
425 iso_pu_bacteria 2842837860 2842842681 296
426 iso_pu_bacteria 2842843487 2842848504 296
427 iso_pu_bacteria 2852657418 2852659098 296
428 iso_pu_bacteria 2860339153 2860339841 296
429 iso_pu_bacteria 2860867994 2860871834 296
430 iso_pu_bacteria 2878029506 2878031615 296
431 iso_pu_bacteria 2880230671 2880232484 296
432 iso_pu_bacteria 2904518522 2904523773 296
433 iso_pu_bacteria 2908446538 2908451282 296
434 iso_pu_bacteria 2919385768 2919386589 296
435 iso_pu_bacteria 2919456309 2919456933 296
436 iso_pu_bacteria 2919487758 2919491137 296
437 iso_pu_bacteria 2919697872 2919699353 296
438 iso_pu_bacteria 2923586266 2923589891 296
439 iso_pu_bacteria 2931390751 2931395208 296
440 iso_pu_bacteria 2931396565 2931400265 296
441 iso_pu_bacteria 2939636861 2939639571 296
442 iso_pu_bacteria 2969304461 2969306404 296
443 iso_pu_bacteria 3007395558 3007401007 296
444 iso_pu_bacteria 3007511990 3007513164 296
445 iso_pu_bacteria 3007614139 3007616809 296
446 iso_pu_bacteria 3007619802 3007625696 296
447 iso_pu_bacteria 3007718800 3007719315 296
448 iso_pu_bacteria 3007855910 3007857723 296
449 iso_pu_bacteria 3007861166 3007862971 296
450 iso_pu_bacteria 8054347763 8054350540 296
451 iso_pu_bacteria 8055817908 8055822647 296
452 iso_pu_bacteria 8056125926 8056130014 296
453 iso_pu_bacteria 8056155041 8056156021 296
454 iso_pu_bacteria 8056166840 8056169195 296
455 iso_pu_bacteria 8056177738 8056183754 296
456 3300002738 JGI25154J39366_1004090 JGI25154J39366_10040903 297
457 3300025233 Ga0209437_105498 Ga0209437_1054982 297
458 3300025246 Ga0209646_1000120 Ga0209646_100012084 297
459 3300046692 Ga0495671_0008972 Ga0495671_0008972_2168_3091 297
460 3300005288 Ga0065714_10009279 Ga0065714_100092792 298
461 3300005288 Ga0065714_10066052 Ga0065714_100660522 298
462 3300006946 Ga0079104_1000297 Ga0079104_100029747 298
463 3300013100 Ga0157373_10006063 Ga0157373_100060633 298
464 3300013100 Ga0157373_10009125 Ga0157373_100091254 298
465 3300027111 Ga0209281_1000090 Ga0209281_1000090177 298
466 3300041405 Ga0439438_000455 Ga0439438_000455_15690_16613 298
467 3300041407 Ga0439447_008644 Ga0439447_008644_1618_2541 298
468 3300041411 Ga0439466_0018546 Ga0439466_0018546_442_1365 298
469 3300042006 Ga0439432_004536 Ga0439432_004536_3606_4529 298
470 3300042121 Ga0450919_004090 Ga0450919_004090_489_1412 298
471 3300042138 Ga0450903_004787 Ga0450903_004787_68_991 298
472 3300042146 Ga0450907_000048 Ga0450907_000048_10487_11410 298
473 3300042147 Ga0450910_000207 Ga0450910_000207_250_1173 298
474 3300042184 Ga0450908_019989 Ga0450908_019989_63_986 298
475 3300042185 Ga0450909_010521 Ga0450909_010521_311_1234 298
476 3300042435 Ga0439434_0009909 Ga0439434_0009909_1315_2238 298
477 3300042461 Ga0439460_0001320 Ga0439460_0001320_1559_2482 298
478 3300046452 Ga0495617_064647 Ga0495617_064647_180_1103 298
479 3300046457 Ga0495590_0000541 Ga0495590_0000541_15860_16783 298
480 3300046457 Ga0495590_0057436 Ga0495590_0057436_413_1336 298
481 3300046458 Ga0495591_020731 Ga0495591_020731_780_1703 298
482 3300046460 Ga0495638_0043747 Ga0495638_0043747_551_1474 298
483 3300046471 Ga0495650_0064171 Ga0495650_0064171_481_1404 298
484 3300046474 Ga0495605_0002616 Ga0495605_0002616_1684_2607 298
485 3300046474 Ga0495605_0089288 Ga0495605_0089288_291_1214 298
486 3300046491 Ga0495584_0044006 Ga0495584_0044006_321_1244 298
487 3300046492 Ga0495585_0045494 Ga0495585_0045494_828_1751 298
488 3300046501 Ga0495607_0035992 Ga0495607_0035992_559_1482 298
489 3300046507 Ga0495606_0058961 Ga0495606_0058961_697_1620 298
490 3300046512 Ga0495610_0014207 Ga0495610_0014207_534_1457 298
491 3300046512 Ga0495610_0014463 Ga0495610_0014463_3119_4042 298
492 3300046512 Ga0495610_0041403 Ga0495610_0041403_386_1309 298
493 3300046513 Ga0495616_0052567 Ga0495616_0052567_644_1567 298
494 3300046513 Ga0495616_0064782 Ga0495616_0064782_836_1759 298
495 3300046515 Ga0495620_0010584 Ga0495620_0010584_444_1367 298
496 3300046518 Ga0495631_0049393 Ga0495631_0049393_197_1120 298
497 3300046518 Ga0495631_0057756 Ga0495631_0057756_288_1211 298
498 3300046519 Ga0495632_0000269 Ga0495632_0000269_49127_50050 298
499 3300046519 Ga0495632_0081334 Ga0495632_0081334_564_1487 298
500 3300046520 Ga0495637_0002089 Ga0495637_0002089_9319_10242 298
501 3300046522 Ga0495643_0108492 Ga0495643_0108492_358_1281 298
502 3300046523 Ga0495644_0028556 Ga0495644_0028556_1160_2083 298
503 3300046524 Ga0495648_0004109 Ga0495648_0004109_1587_2510 298
504 3300046524 Ga0495648_0077653 Ga0495648_0077653_341_1264 298
505 3300046524 Ga0495648_0165811 Ga0495648_0165811_43_966 298
506 3300046528 Ga0495642_0000363 Ga0495642_0000363_5370_6293 298
507 3300046530 Ga0495654_0076762 Ga0495654_0076762_593_1516 298
508 3300046530 Ga0495654_0088364 Ga0495654_0088364_425_1348 298
509 3300046542 Ga0495597_0102393 Ga0495597_0102393_29_952 298
510 3300046665 Ga0495661_0041164 Ga0495661_0041164_1422_2345 298
511 3300046674 Ga0495588_0049161 Ga0495588_0049161_742_1665 298
512 3300046684 Ga0495669_0000851 Ga0495669_0000851_1003_1926 298
513 3300046684 Ga0495669_0047111 Ga0495669_0047111_419_1342 298
514 3300046691 Ga0495670_0000486 Ga0495670_0000486_79_1002 298
515 3300046694 Ga0495649_0038708 Ga0495649_0038708_627_1550 298
516 3300046794 Ga0495589_0007973 Ga0495589_0007973_1994_2917 298
517 3300046794 Ga0495589_0032360 Ga0495589_0032360_687_1610 298
518 3300046810 Ga0495660_0122529 Ga0495660_0122529_93_1016 298
519 3300046810 Ga0495660_0134918 Ga0495660_0134918_114_1037 298
520 3300047320 Ga0495672_0002540 Ga0495672_0002540_1587_2510 298
521 3300047320 Ga0495672_0006507 Ga0495672_0006507_6551_7474 298
522 3300047321 Ga0495676_0006673 Ga0495676_0006673_7305_8228 298
523 3300047323 Ga0495683_0001314 Ga0495683_0001314_204_1127 298
524 3300047443 Ga0495687_003593 Ga0495687_003593_8350_9273 298
525 3300047445 Ga0495677_0000918 Ga0495677_0000918_9639_10562 298
526 3300047446 Ga0495679_019950 Ga0495679_019950_1172_2095 298
527 3300047446 Ga0495679_045388 Ga0495679_045388_265_1188 298
528 3300047469 Ga0495673_0021256 Ga0495673_0021256_1433_2356 298
529 3300047469 Ga0495673_0028268 Ga0495673_0028268_1154_2077 298
530 3300048091 Ga0495626_0011764 Ga0495626_0011764_674_1597 298
531 3300048927 Ga0496124_0131832 Ga0496124_0131832_948_1874 298
532 3300048928 Ga0496125_0182090 Ga0496125_0182090_415_1341 298
533 iso_pu_bacteria 2511231008 2511276746 298
534 3300006058 Ga0075432_10038141 Ga0075432_100381412 299
535 3300009036 Ga0105244_10036267 Ga0105244_100362673 299
536 3300013104 Ga0157370_10192175 Ga0157370_101921751 299
537 3300015265 Ga0182005_1016403 Ga0182005_10164032 299
538 3300017792 Ga0163161_10244924 Ga0163161_102449241 299
539 3300025728 Ga0207655_1023767 Ga0207655_10237673 299
540 3300026116 Ga0207674_10343462 Ga0207674_103434622 299
541 3300046475 Ga0495639_0066822 Ga0495639_0066822_508_1431 299
542 3300046491 Ga0495584_0000450 Ga0495584_0000450_1186_2109 299
543 3300046492 Ga0495585_0021095 Ga0495585_0021095_588_1511 299
544 3300046499 Ga0495594_0138600 Ga0495594_0138600_208_1131 299
545 3300046520 Ga0495637_0049657 Ga0495637_0049657_467_1390 299
546 3300046530 Ga0495654_0056569 Ga0495654_0056569_316_1239 299
547 3300046538 Ga0495609_0039504 Ga0495609_0039504_667_1590 299
548 3300046557 Ga0495622_0070462 Ga0495622_0070462_226_1149 299
549 3300046660 Ga0495625_0006990 Ga0495625_0006990_1140_2063 299
550 3300046674 Ga0495588_0068926 Ga0495588_0068926_362_1285 299
551 3300046691 Ga0495670_0054106 Ga0495670_0054106_432_1355 299
552 3300046692 Ga0495671_0053178 Ga0495671_0053178_206_1129 299
553 3300047323 Ga0495683_0001677 Ga0495683_0001677_8862_9785 299
554 3300047470 Ga0495681_0000709 Ga0495681_0000709_23006_23929 299
555 3300047470 Ga0495681_0006092 Ga0495681_0006092_180_1103 299
556 3300048924 Ga0496121_0199046 Ga0496121_0199046_345_1268 299
557 iso_pu_bacteria 2599185307 2599973125 299
558 2124908027 MRS2a_Contig_114 MRS2a_00016180 300
559 3300002737 JGI25162J39368_1000080 JGI25162J39368_100008050 300
560 3300002771 JGI25163J39215_1000151 JGI25163J39215_10001514 300
561 3300002772 JGI25164J39214_1000073 JGI25164J39214_100007343 300
562 3300003214 JGI25165J46597_1000152 JGI25165J46597_100015254 300
563 3300003323 rootH1_10263332 rootH1_102633322 300
564 3300003771 Ga0055526_1001365 Ga0055526_10013659 300
565 3300003781 Ga0055536_1005308 Ga0055536_10053084 300
566 3300003791 Ga0055530_10015622 Ga0055530_100156222 300
567 3300005288 Ga0065714_10004510 Ga0065714_100045103 300
568 3300005288 Ga0065714_10162638 Ga0065714_101626381 300
569 3300005290 Ga0065712_10008373 Ga0065712_100083732 300
570 3300005331 Ga0070670_100000370 Ga0070670_10000037016 300
571 3300006051 Ga0075364_10025175 Ga0075364_100251752 300
572 3300006058 Ga0075432_10001592 Ga0075432_100015923 300
573 3300006177 Ga0075362_10012652 Ga0075362_100126523 300
574 3300006914 Ga0075436_100211624 Ga0075436_1002116242 300
575 3300009036 Ga0105244_10043827 Ga0105244_100438272 300
576 3300009036 Ga0105244_10051670 Ga0105244_100516703 300
577 3300009036 Ga0105244_10053168 Ga0105244_100531683 300
578 3300009092 Ga0105250_10002712 Ga0105250_100027124 300
579 3300009093 Ga0105240_10105917 Ga0105240_101059172 300
580 3300009148 Ga0105243_10000165 Ga0105243_1000016556 300
581 3300009148 Ga0105243_10198204 Ga0105243_101982041 300
582 3300011119 Ga0105246_10000145 Ga0105246_1000014510 300
583 3300012498 Ga0157345_1000244 Ga0157345_10002444 300
584 3300013100 Ga0157373_10058296 Ga0157373_100582961 300
585 3300013102 Ga0157371_10002280 Ga0157371_100022807 300
586 3300013102 Ga0157371_10017740 Ga0157371_100177404 300
587 3300013104 Ga0157370_10093088 Ga0157370_100930882 300
588 3300013104 Ga0157370_10227273 Ga0157370_102272732 300
589 3300013104 Ga0157370_10231129 Ga0157370_102311292 300
590 3300013105 Ga0157369_10018576 Ga0157369_100185765 300
591 3300013308 Ga0157375_10131856 Ga0157375_101318562 300
592 3300014497 Ga0182008_10002833 Ga0182008_100028336 300
593 3300014497 Ga0182008_10002928 Ga0182008_100029287 300
594 3300015261 Ga0182006_1002005 Ga0182006_10020057 300
595 3300015261 Ga0182006_1002968 Ga0182006_10029684 300
596 3300015261 Ga0182006_1037187 Ga0182006_10371872 300
597 3300015262 Ga0182007_10002556 Ga0182007_100025564 300
598 3300015265 Ga0182005_1001580 Ga0182005_10015804 300
599 3300015265 Ga0182005_1011359 Ga0182005_10113593 300
600 3300015265 Ga0182005_1036745 Ga0182005_10367452 300
601 3300017792 Ga0163161_10003152 Ga0163161_100031527 300
602 3300021361 Ga0213872_10000065 Ga0213872_1000006556 300
603 3300025207 Ga0209760_100146 Ga0209760_10014617 300
604 3300025231 Ga0207427_100001 Ga0207427_1000011109 300
605 3300025233 Ga0209437_100003 Ga0209437_100003263 300
606 3300025256 Ga0209759_1003251 Ga0209759_10032512 300
607 3300025261 Ga0209233_1000007 Ga0209233_10000071109 300
608 3300025292 Ga0209676_1000127 Ga0209676_1000127132 300
609 3300025292 Ga0209676_1005659 Ga0209676_10056594 300
610 3300025295 Ga0209564_1000154 Ga0209564_1000154108 300
611 3300025298 Ga0209050_1002659 Ga0209050_10026594 300
612 3300025303 Ga0209051_1002898 Ga0209051_10028988 300
613 3300025711 Ga0207696_1001679 Ga0207696_10016794 300
614 3300025711 Ga0207696_1005127 Ga0207696_10051273 300
615 3300025711 Ga0207696_1018181 Ga0207696_10181811 300
616 3300025728 Ga0207655_1004265 Ga0207655_10042653 300
617 3300025728 Ga0207655_1004516 Ga0207655_10045169 300
618 3300025728 Ga0207655_1007308 Ga0207655_10073084 300
619 3300025735 Ga0207713_1003750 Ga0207713_100375013 300
620 3300025935 Ga0207709_10000210 Ga0207709_1000021020 300
621 3300025935 Ga0207709_10111436 Ga0207709_101114362 300
622 3300027111 Ga0209281_1010191 Ga0209281_10101912 300
623 3300030734 Ga0316179_1072619 Ga0316179_10726193 300
624 3300030735 Ga0316178_1001397 Ga0316178_10013976 300
625 3300031911 Ga0307412_10008409 Ga0307412_100084093 300
626 3300031911 Ga0307412_10022896 Ga0307412_100228962 300
627 3300031911 Ga0307412_10068443 Ga0307412_100684431 300
628 3300031995 Ga0307409_100214118 Ga0307409_1002141182 300
629 3300033180 Ga0307510_10016736 Ga0307510_100167363 300
630 3300037312 Ga0395899_0027258 Ga0395899_0027258_3203_4129 300
631 3300037418 Ga0395900_0018011 Ga0395900_0018011_4548_5474 300
632 3300037418 Ga0395900_0061358 Ga0395900_0061358_2138_3064 300
633 3300038443 Ga0395901_0366832 Ga0395901_0366832_67_993 300
634 3300039447 Ga0436361_0094991 Ga0436361_0094991_11295_12218 300
635 3300041404 Ga0439436_0005606 Ga0439436_0005606_1054_2007 300
636 3300041405 Ga0439438_000344 Ga0439438_000344_16171_17094 300
637 3300041405 Ga0439438_002512 Ga0439438_002512_1752_2675 300
638 3300041405 Ga0439438_002573 Ga0439438_002573_2092_3015 300
639 3300041405 Ga0439438_004859 Ga0439438_004859_3617_4540 300
640 3300041405 Ga0439438_020336 Ga0439438_020336_142_1074 300
641 3300041405 Ga0439438_028204 Ga0439438_028204_236_1159 300
642 3300041405 Ga0439438_032368 Ga0439438_032368_222_1145 300
643 3300041407 Ga0439447_000111 Ga0439447_000111_23173_24096 300
644 3300041407 Ga0439447_001680 Ga0439447_001680_6414_7337 300
645 3300041407 Ga0439447_002653 Ga0439447_002653_5260_6183 300
646 3300041407 Ga0439447_020906 Ga0439447_020906_64_987 300
647 3300041411 Ga0439466_0003641 Ga0439466_0003641_2422_3375 300
648 3300041411 Ga0439466_0036404 Ga0439466_0036404_400_1323 300
649 3300041411 Ga0439466_0045870 Ga0439466_0045870_376_1299 300
650 3300041411 Ga0439466_0048618 Ga0439466_0048618_337_1260 300
651 3300042004 Ga0439445_0016035 Ga0439445_0016035_408_1331 300
652 3300042006 Ga0439432_001450 Ga0439432_001450_6948_7871 300
653 3300042006 Ga0439432_023464 Ga0439432_023464_1081_2013 300
654 3300042009 Ga0439451_015719 Ga0439451_015719_523_1446 300
655 3300042010 Ga0439452_000863 Ga0439452_000863_7650_8618 300
656 3300042010 Ga0439452_000888 Ga0439452_000888_12247_13170 300
657 3300042010 Ga0439452_000956 Ga0439452_000956_5404_6336 300
658 3300042010 Ga0439452_001263 Ga0439452_001263_5390_6313 300
659 3300042013 Ga0439456_007618 Ga0439456_007618_679_1647 300
660 3300042013 Ga0439456_024796 Ga0439456_024796_113_1036 300
661 3300042013 Ga0439456_033454 Ga0439456_033454_61_984 300
662 3300042016 Ga0439463_010546 Ga0439463_010546_1178_2101 300
663 3300042115 Ga0450911_000474 Ga0450911_000474_7938_8861 300
664 3300042137 Ga0450902_003176 Ga0450902_003176_939_1862 300
665 3300042137 Ga0450902_017886 Ga0450902_017886_199_1122 300
666 3300042138 Ga0450903_000865 Ga0450903_000865_4452_5375 300
667 3300042138 Ga0450903_009054 Ga0450903_009054_409_1332 300
668 3300042139 Ga0450904_002201 Ga0450904_002201_267_1190 300
669 3300042139 Ga0450904_007130 Ga0450904_007130_40_966 300
670 3300042145 Ga0450906_001088 Ga0450906_001088_398_1321 300
671 3300042146 Ga0450907_008401 Ga0450907_008401_361_1284 300
672 3300042185 Ga0450909_006978 Ga0450909_006978_359_1282 300
673 3300042435 Ga0439434_0002167 Ga0439434_0002167_1660_2613 300
674 3300046452 Ga0495617_002428 Ga0495617_002428_1431_2357 300
675 3300046452 Ga0495617_012213 Ga0495617_012213_1217_2143 300
676 3300046452 Ga0495617_017887 Ga0495617_017887_64_987 300
677 3300046452 Ga0495617_019798 Ga0495617_019798_608_1531 300
678 3300046452 Ga0495617_044817 Ga0495617_044817_293_1219 300
679 3300046453 Ga0495627_000013 Ga0495627_000013_128544_129467 300
680 3300046453 Ga0495627_001290 Ga0495627_001290_5154_6080 300
681 3300046453 Ga0495627_002237 Ga0495627_002237_5284_6210 300
682 3300046453 Ga0495627_002583 Ga0495627_002583_4248_5174 300
683 3300046453 Ga0495627_003950 Ga0495627_003950_4092_5015 300
684 3300046453 Ga0495627_017790 Ga0495627_017790_441_1364 300
685 3300046455 Ga0495603_0032935 Ga0495603_0032935_1115_2038 300
686 3300046457 Ga0495590_0002023 Ga0495590_0002023_1295_2218 300
687 3300046457 Ga0495590_0005707 Ga0495590_0005707_3460_4386 300
688 3300046457 Ga0495590_0007596 Ga0495590_0007596_1000_1923 300
689 3300046458 Ga0495591_000114 Ga0495591_000114_10248_11171 300
690 3300046458 Ga0495591_001896 Ga0495591_001896_7911_8837 300
691 3300046458 Ga0495591_002640 Ga0495591_002640_5198_6169 300
692 3300046458 Ga0495591_004809 Ga0495591_004809_2078_3004 300
693 3300046458 Ga0495591_005683 Ga0495591_005683_3124_4047 300
694 3300046458 Ga0495591_007429 Ga0495591_007429_3396_4322 300
695 3300046458 Ga0495591_014562 Ga0495591_014562_520_1443 300
696 3300046458 Ga0495591_014671 Ga0495591_014671_618_1544 300
697 3300046458 Ga0495591_016635 Ga0495591_016635_1010_1933 300
698 3300046458 Ga0495591_017128 Ga0495591_017128_387_1313 300
699 3300046458 Ga0495591_017735 Ga0495591_017735_1004_1927 300
700 3300046458 Ga0495591_036453 Ga0495591_036453_302_1225 300
701 3300046458 Ga0495591_047477 Ga0495591_047477_210_1133 300
702 3300046459 Ga0495629_0008511 Ga0495629_0008511_6300_7223 300
703 3300046460 Ga0495638_0001477 Ga0495638_0001477_170_1096 300
704 3300046460 Ga0495638_0034365 Ga0495638_0034365_185_1108 300
705 3300046460 Ga0495638_0035648 Ga0495638_0035648_1266_2189 300
706 3300046460 Ga0495638_0063460 Ga0495638_0063460_193_1119 300
707 3300046460 Ga0495638_0069087 Ga0495638_0069087_344_1267 300
708 3300046460 Ga0495638_0097005 Ga0495638_0097005_466_1392 300
709 3300046460 Ga0495638_0103820 Ga0495638_0103820_383_1309 300
710 3300046460 Ga0495638_0136420 Ga0495638_0136420_95_1018 300
711 3300046463 Ga0495653_0004230 Ga0495653_0004230_3304_4230 300
712 3300046463 Ga0495653_0023891 Ga0495653_0023891_2920_3843 300
713 3300046471 Ga0495650_0002548 Ga0495650_0002548_12975_13907 300
714 3300046471 Ga0495650_0003202 Ga0495650_0003202_6858_7781 300
715 3300046471 Ga0495650_0007799 Ga0495650_0007799_3586_4509 300
716 3300046471 Ga0495650_0008599 Ga0495650_0008599_1666_2592 300
717 3300046471 Ga0495650_0015835 Ga0495650_0015835_2386_3309 300
718 3300046471 Ga0495650_0018112 Ga0495650_0018112_336_1262 300
719 3300046471 Ga0495650_0030992 Ga0495650_0030992_391_1317 300
720 3300046473 Ga0495582_0003429 Ga0495582_0003429_1656_2579 300
721 3300046474 Ga0495605_0000123 Ga0495605_0000123_22843_23766 300
722 3300046474 Ga0495605_0006726 Ga0495605_0006726_1962_2888 300
723 3300046474 Ga0495605_0016850 Ga0495605_0016850_838_1761 300
724 3300046474 Ga0495605_0034493 Ga0495605_0034493_1175_2098 300
725 3300046474 Ga0495605_0038354 Ga0495605_0038354_158_1081 300
726 3300046474 Ga0495605_0062700 Ga0495605_0062700_135_1061 300
727 3300046474 Ga0495605_0108796 Ga0495605_0108796_194_1117 300
728 3300046475 Ga0495639_0000183 Ga0495639_0000183_21923_22846 300
729 3300046475 Ga0495639_0004361 Ga0495639_0004361_4474_5397 300
730 3300046475 Ga0495639_0033540 Ga0495639_0033540_1327_2250 300
731 3300046491 Ga0495584_0012498 Ga0495584_0012498_3338_4264 300
732 3300046491 Ga0495584_0027617 Ga0495584_0027617_1634_2560 300
733 3300046492 Ga0495585_0000764 Ga0495585_0000764_3427_4353 300
734 3300046492 Ga0495585_0012900 Ga0495585_0012900_3359_4285 300
735 3300046492 Ga0495585_0017519 Ga0495585_0017519_1255_2178 300
736 3300046492 Ga0495585_0041068 Ga0495585_0041068_606_1529 300
737 3300046492 Ga0495585_0041552 Ga0495585_0041552_425_1351 300
738 3300046492 Ga0495585_0043996 Ga0495585_0043996_111_1037 300
739 3300046499 Ga0495594_0007223 Ga0495594_0007223_3117_4040 300
740 3300046499 Ga0495594_0010471 Ga0495594_0010471_2557_3480 300
741 3300046499 Ga0495594_0021885 Ga0495594_0021885_1380_2303 300
742 3300046499 Ga0495594_0021972 Ga0495594_0021972_460_1383 300
743 3300046500 Ga0495596_0000628 Ga0495596_0000628_17859_18782 300
744 3300046500 Ga0495596_0002104 Ga0495596_0002104_5154_6080 300
745 3300046501 Ga0495607_0000210 Ga0495607_0000210_36062_36994 300
746 3300046501 Ga0495607_0004134 Ga0495607_0004134_8937_9860 300
747 3300046501 Ga0495607_0005342 Ga0495607_0005342_4994_5917 300
748 3300046501 Ga0495607_0005900 Ga0495607_0005900_2945_3877 300
749 3300046501 Ga0495607_0006711 Ga0495607_0006711_3462_4388 300
750 3300046501 Ga0495607_0007363 Ga0495607_0007363_3301_4227 300
751 3300046501 Ga0495607_0065402 Ga0495607_0065402_552_1478 300
752 3300046501 Ga0495607_0089107 Ga0495607_0089107_668_1591 300
753 3300046501 Ga0495607_0098926 Ga0495607_0098926_340_1263 300
754 3300046501 Ga0495607_0151142 Ga0495607_0151142_190_1161 300
755 3300046506 Ga0495583_0000036 Ga0495583_0000036_32207_33130 300
756 3300046506 Ga0495583_0000151 Ga0495583_0000151_3225_4157 300
757 3300046506 Ga0495583_0000798 Ga0495583_0000798_36846_37769 300
758 3300046506 Ga0495583_0010489 Ga0495583_0010489_1091_2017 300
759 3300046506 Ga0495583_0018014 Ga0495583_0018014_2261_3184 300
760 3300046506 Ga0495583_0032072 Ga0495583_0032072_1248_2171 300
761 3300046507 Ga0495606_0000157 Ga0495606_0000157_11760_12683 300
762 3300046507 Ga0495606_0004275 Ga0495606_0004275_13108_14031 300
763 3300046507 Ga0495606_0004302 Ga0495606_0004302_3433_4359 300
764 3300046507 Ga0495606_0007263 Ga0495606_0007263_3455_4381 300
765 3300046507 Ga0495606_0016037 Ga0495606_0016037_3377_4303 300
766 3300046507 Ga0495606_0047862 Ga0495606_0047862_281_1213 300
767 3300046512 Ga0495610_0003196 Ga0495610_0003196_845_1768 300
768 3300046512 Ga0495610_0005538 Ga0495610_0005538_4561_5487 300
769 3300046512 Ga0495610_0012555 Ga0495610_0012555_3463_4395 300
770 3300046512 Ga0495610_0013666 Ga0495610_0013666_1371_2297 300
771 3300046512 Ga0495610_0019708 Ga0495610_0019708_795_1718 300
772 3300046512 Ga0495610_0090718 Ga0495610_0090718_390_1313 300
773 3300046512 Ga0495610_0108886 Ga0495610_0108886_274_1197 300
774 3300046512 Ga0495610_0112168 Ga0495610_0112168_209_1132 300
775 3300046513 Ga0495616_0000323 Ga0495616_0000323_35759_36682 300
776 3300046513 Ga0495616_0000367 Ga0495616_0000367_30891_31817 300
777 3300046513 Ga0495616_0002768 Ga0495616_0002768_7093_8019 300
778 3300046513 Ga0495616_0003522 Ga0495616_0003522_5655_6581 300
779 3300046513 Ga0495616_0003567 Ga0495616_0003567_5727_6653 300
780 3300046513 Ga0495616_0025051 Ga0495616_0025051_1210_2133 300
781 3300046513 Ga0495616_0120839 Ga0495616_0120839_113_1039 300
782 3300046515 Ga0495620_0000001 Ga0495620_0000001_307365_308288 300
783 3300046515 Ga0495620_0002445 Ga0495620_0002445_1967_2893 300
784 3300046515 Ga0495620_0002723 Ga0495620_0002723_5804_6730 300
785 3300046515 Ga0495620_0003064 Ga0495620_0003064_1098_2030 300
786 3300046515 Ga0495620_0004077 Ga0495620_0004077_6513_7445 300
787 3300046515 Ga0495620_0009334 Ga0495620_0009334_3193_4116 300
788 3300046515 Ga0495620_0012881 Ga0495620_0012881_836_1759 300
789 3300046515 Ga0495620_0014944 Ga0495620_0014944_1619_2545 300
790 3300046515 Ga0495620_0025785 Ga0495620_0025785_710_1636 300
791 3300046518 Ga0495631_0001457 Ga0495631_0001457_7647_8573 300
792 3300046518 Ga0495631_0004260 Ga0495631_0004260_1420_2343 300
793 3300046518 Ga0495631_0021973 Ga0495631_0021973_1035_1958 300
794 3300046518 Ga0495631_0038709 Ga0495631_0038709_1130_2053 300
795 3300046518 Ga0495631_0103743 Ga0495631_0103743_83_1009 300
796 3300046519 Ga0495632_0002555 Ga0495632_0002555_7604_8530 300
797 3300046519 Ga0495632_0003483 Ga0495632_0003483_5452_6375 300
798 3300046519 Ga0495632_0007520 Ga0495632_0007520_1975_2901 300
799 3300046519 Ga0495632_0019884 Ga0495632_0019884_1338_2261 300
800 3300046519 Ga0495632_0040350 Ga0495632_0040350_327_1253 300
801 3300046519 Ga0495632_0083653 Ga0495632_0083653_217_1143 300
802 3300046519 Ga0495632_0150737 Ga0495632_0150737_31_957 300
803 3300046520 Ga0495637_0000181 Ga0495637_0000181_42965_43888 300
804 3300046520 Ga0495637_0000732 Ga0495637_0000732_13446_14372 300
805 3300046520 Ga0495637_0001682 Ga0495637_0001682_1259_2185 300
806 3300046520 Ga0495637_0007798 Ga0495637_0007798_596_1522 300
807 3300046520 Ga0495637_0010150 Ga0495637_0010150_2539_3462 300
808 3300046520 Ga0495637_0013372 Ga0495637_0013372_1491_2417 300
809 3300046520 Ga0495637_0017758 Ga0495637_0017758_1108_2031 300
810 3300046522 Ga0495643_0002014 Ga0495643_0002014_9741_10664 300
811 3300046522 Ga0495643_0007530 Ga0495643_0007530_1526_2452 300
812 3300046522 Ga0495643_0013601 Ga0495643_0013601_1376_2299 300
813 3300046522 Ga0495643_0015017 Ga0495643_0015017_3361_4284 300
814 3300046522 Ga0495643_0024388 Ga0495643_0024388_1873_2799 300
815 3300046522 Ga0495643_0075191 Ga0495643_0075191_814_1740 300
816 3300046522 Ga0495643_0097900 Ga0495643_0097900_209_1132 300
817 3300046523 Ga0495644_0001677 Ga0495644_0001677_7165_8088 300
818 3300046523 Ga0495644_0005543 Ga0495644_0005543_3710_4636 300
819 3300046524 Ga0495648_0004638 Ga0495648_0004638_7528_8451 300
820 3300046524 Ga0495648_0014530 Ga0495648_0014530_3657_4583 300
821 3300046524 Ga0495648_0015349 Ga0495648_0015349_4151_5077 300
822 3300046524 Ga0495648_0019806 Ga0495648_0019806_1482_2405 300
823 3300046524 Ga0495648_0023944 Ga0495648_0023944_1319_2245 300
824 3300046524 Ga0495648_0047898 Ga0495648_0047898_420_1346 300
825 3300046524 Ga0495648_0073145 Ga0495648_0073145_70_993 300
826 3300046524 Ga0495648_0094723 Ga0495648_0094723_257_1183 300
827 3300046524 Ga0495648_0100142 Ga0495648_0100142_24_947 300
828 3300046524 Ga0495648_0130169 Ga0495648_0130169_285_1208 300
829 3300046526 Ga0495666_0046171 Ga0495666_0046171_376_1299 300
830 3300046526 Ga0495666_0092295 Ga0495666_0092295_148_1074 300
831 3300046528 Ga0495642_0000566 Ga0495642_0000566_1403_2326 300
832 3300046530 Ga0495654_0000367 Ga0495654_0000367_33699_34622 300
833 3300046530 Ga0495654_0000566 Ga0495654_0000566_21856_22779 300
834 3300046530 Ga0495654_0001970 Ga0495654_0001970_1446_2369 300
835 3300046530 Ga0495654_0002322 Ga0495654_0002322_3449_4375 300
836 3300046530 Ga0495654_0003341 Ga0495654_0003341_1813_2736 300
837 3300046530 Ga0495654_0076237 Ga0495654_0076237_541_1467 300
838 3300046530 Ga0495654_0109115 Ga0495654_0109115_203_1129 300
839 3300046530 Ga0495654_0128574 Ga0495654_0128574_155_1081 300
840 3300046535 Ga0495586_0003121 Ga0495586_0003121_7432_8355 300
841 3300046536 Ga0495587_0014592 Ga0495587_0014592_633_1556 300
842 3300046536 Ga0495587_0192818 Ga0495587_0192818_190_1116 300
843 3300046538 Ga0495609_0000029 Ga0495609_0000029_24096_25019 300
844 3300046538 Ga0495609_0000035 Ga0495609_0000035_119416_120339 300
845 3300046538 Ga0495609_0002757 Ga0495609_0002757_3907_4833 300
846 3300046538 Ga0495609_0006882 Ga0495609_0006882_3345_4271 300
847 3300046538 Ga0495609_0022566 Ga0495609_0022566_1421_2347 300
848 3300046538 Ga0495609_0024467 Ga0495609_0024467_1243_2169 300
849 3300046538 Ga0495609_0028435 Ga0495609_0028435_611_1534 300
850 3300046538 Ga0495609_0085184 Ga0495609_0085184_31_957 300
851 3300046538 Ga0495609_0086281 Ga0495609_0086281_163_1089 300
852 3300046542 Ga0495597_0000408 Ga0495597_0000408_28999_29922 300
853 3300046542 Ga0495597_0000563 Ga0495597_0000563_9795_10718 300
854 3300046542 Ga0495597_0003108 Ga0495597_0003108_3439_4365 300
855 3300046542 Ga0495597_0011912 Ga0495597_0011912_1379_2302 300
856 3300046542 Ga0495597_0014974 Ga0495597_0014974_1386_2309 300
857 3300046542 Ga0495597_0032487 Ga0495597_0032487_977_1900 300
858 3300046542 Ga0495597_0062432 Ga0495597_0062432_327_1250 300
859 3300046543 Ga0495645_0157200 Ga0495645_0157200_171_1097 300
860 3300046543 Ga0495645_0180040 Ga0495645_0180040_456_1379 300
861 3300046557 Ga0495622_0003413 Ga0495622_0003413_5115_6038 300
862 3300046557 Ga0495622_0030249 Ga0495622_0030249_1015_1938 300
863 3300046557 Ga0495622_0034055 Ga0495622_0034055_197_1120 300
864 3300046558 Ga0495633_0000016 Ga0495633_0000016_171385_172308 300
865 3300046558 Ga0495633_0030903 Ga0495633_0030903_232_1158 300
866 3300046558 Ga0495633_0078521 Ga0495633_0078521_34_957 300
867 3300046558 Ga0495633_0080585 Ga0495633_0080585_434_1435 300
868 3300046615 Ga0495656_0068569 Ga0495656_0068569_452_1375 300
869 3300046616 Ga0495668_0004481 Ga0495668_0004481_3340_4311 300
870 3300046616 Ga0495668_0008265 Ga0495668_0008265_3368_4291 300
871 3300046616 Ga0495668_0033325 Ga0495668_0033325_395_1321 300
872 3300046616 Ga0495668_0053900 Ga0495668_0053900_1039_1965 300
873 3300046616 Ga0495668_0066522 Ga0495668_0066522_705_1628 300
874 3300046642 Ga0495634_0138108 Ga0495634_0138108_266_1192 300
875 3300046648 Ga0495611_0001277 Ga0495611_0001277_3654_4580 300
876 3300046648 Ga0495611_0001931 Ga0495611_0001931_7980_8903 300
877 3300046660 Ga0495625_0003465 Ga0495625_0003465_7428_8354 300
878 3300046660 Ga0495625_0009387 Ga0495625_0009387_4795_5718 300
879 3300046660 Ga0495625_0012681 Ga0495625_0012681_3490_4416 300
880 3300046660 Ga0495625_0063978 Ga0495625_0063978_1142_2065 300
881 3300046660 Ga0495625_0126180 Ga0495625_0126180_691_1662 300
882 3300046663 Ga0495635_0001192 Ga0495635_0001192_140_1063 300
883 3300046664 Ga0495659_0000178 Ga0495659_0000178_17178_18101 300
884 3300046664 Ga0495659_0005146 Ga0495659_0005146_1703_2626 300
885 3300046665 Ga0495661_0000004 Ga0495661_0000004_198561_199484 300
886 3300046665 Ga0495661_0000041 Ga0495661_0000041_109871_110794 300
887 3300046665 Ga0495661_0000443 Ga0495661_0000443_11810_12742 300
888 3300046665 Ga0495661_0002851 Ga0495661_0002851_10338_11261 300
889 3300046665 Ga0495661_0051614 Ga0495661_0051614_407_1333 300
890 3300046665 Ga0495661_0059516 Ga0495661_0059516_1133_2056 300
891 3300046665 Ga0495661_0121222 Ga0495661_0121222_61_984 300
892 3300046665 Ga0495661_0131874 Ga0495661_0131874_413_1339 300
893 3300046665 Ga0495661_0136213 Ga0495661_0136213_171_1094 300
894 3300046665 Ga0495661_0143362 Ga0495661_0143362_181_1104 300
895 3300046674 Ga0495588_0006969 Ga0495588_0006969_1225_2148 300
896 3300046679 Ga0495623_0001699 Ga0495623_0001699_3383_4306 300
897 3300046680 Ga0495646_0016084 Ga0495646_0016084_3162_4088 300
898 3300046680 Ga0495646_0053712 Ga0495646_0053712_1296_2219 300
899 3300046689 Ga0495613_0056365 Ga0495613_0056365_1346_2272 300
900 3300046689 Ga0495613_0058414 Ga0495613_0058414_980_1903 300
901 3300046690 Ga0495624_0003574 Ga0495624_0003574_3525_4451 300
902 3300046691 Ga0495670_0001497 Ga0495670_0001497_3345_4271 300
903 3300046691 Ga0495670_0024383 Ga0495670_0024383_2044_2967 300
904 3300046691 Ga0495670_0035892 Ga0495670_0035892_1434_2357 300
905 3300046692 Ga0495671_0000482 Ga0495671_0000482_29391_30317 300
906 3300046692 Ga0495671_0007709 Ga0495671_0007709_1736_2662 300
907 3300046692 Ga0495671_0008261 Ga0495671_0008261_3262_4188 300
908 3300046692 Ga0495671_0012135 Ga0495671_0012135_1362_2285 300
909 3300046692 Ga0495671_0012224 Ga0495671_0012224_847_1773 300
910 3300046692 Ga0495671_0015661 Ga0495671_0015661_2733_3656 300
911 3300046692 Ga0495671_0018204 Ga0495671_0018204_506_1432 300
912 3300046694 Ga0495649_0001548 Ga0495649_0001548_1452_2375 300
913 3300046694 Ga0495649_0008403 Ga0495649_0008403_3438_4364 300
914 3300046694 Ga0495649_0013110 Ga0495649_0013110_3777_4700 300
915 3300046694 Ga0495649_0019220 Ga0495649_0019220_2858_3781 300
916 3300046694 Ga0495649_0030826 Ga0495649_0030826_318_1244 300
917 3300046694 Ga0495649_0032209 Ga0495649_0032209_1677_2603 300
918 3300046694 Ga0495649_0045894 Ga0495649_0045894_883_1806 300
919 3300046694 Ga0495649_0087470 Ga0495649_0087470_607_1533 300
920 3300046794 Ga0495589_0000661 Ga0495589_0000661_20622_21545 300
921 3300046794 Ga0495589_0000703 Ga0495589_0000703_3570_4496 300
922 3300046794 Ga0495589_0001161 Ga0495589_0001161_13412_14335 300
923 3300046794 Ga0495589_0031700 Ga0495589_0031700_579_1502 300
924 3300046809 Ga0495600_0080214 Ga0495600_0080214_678_1604 300
925 3300046810 Ga0495660_0002383 Ga0495660_0002383_7177_8103 300
926 3300046810 Ga0495660_0002556 Ga0495660_0002556_1260_2183 300
927 3300046810 Ga0495660_0002687 Ga0495660_0002687_2759_3682 300
928 3300046810 Ga0495660_0003468 Ga0495660_0003468_5730_6653 300
929 3300046810 Ga0495660_0007655 Ga0495660_0007655_4670_5596 300
930 3300046810 Ga0495660_0011802 Ga0495660_0011802_2731_3657 300
931 3300046810 Ga0495660_0012293 Ga0495660_0012293_2228_3151 300
932 3300046810 Ga0495660_0073851 Ga0495660_0073851_286_1212 300
933 3300047315 Ga0495581_0006489 Ga0495581_0006489_5846_6769 300
934 3300047315 Ga0495581_0029165 Ga0495581_0029165_1601_2524 300
935 3300047317 Ga0495604_0003977 Ga0495604_0003977_103_1026 300
936 3300047317 Ga0495604_0026397 Ga0495604_0026397_705_1631 300
937 3300047320 Ga0495672_0004329 Ga0495672_0004329_657_1580 300
938 3300047320 Ga0495672_0004833 Ga0495672_0004833_3400_4326 300
939 3300047320 Ga0495672_0006354 Ga0495672_0006354_6397_7329 300
940 3300047320 Ga0495672_0009188 Ga0495672_0009188_5411_6337 300
941 3300047320 Ga0495672_0060065 Ga0495672_0060065_783_1706 300
942 3300047320 Ga0495672_0122290 Ga0495672_0122290_86_1009 300
943 3300047320 Ga0495672_0157057 Ga0495672_0157057_195_1121 300
944 3300047321 Ga0495676_0000023 Ga0495676_0000023_26054_26977 300
945 3300047321 Ga0495676_0099611 Ga0495676_0099611_566_1492 300
946 3300047322 Ga0495680_0016952 Ga0495680_0016952_1066_1992 300
947 3300047322 Ga0495680_0056878 Ga0495680_0056878_1734_2657 300
948 3300047322 Ga0495680_0112133 Ga0495680_0112133_60_983 300
949 3300047323 Ga0495683_0000074 Ga0495683_0000074_21612_22535 300
950 3300047323 Ga0495683_0002188 Ga0495683_0002188_3539_4462 300
951 3300047323 Ga0495683_0012737 Ga0495683_0012737_1228_2154 300
952 3300047323 Ga0495683_0012876 Ga0495683_0012876_1139_2062 300
953 3300047323 Ga0495683_0030459 Ga0495683_0030459_629_1555 300
954 3300047323 Ga0495683_0031467 Ga0495683_0031467_638_1561 300
955 3300047323 Ga0495683_0088145 Ga0495683_0088145_226_1149 300
956 3300047323 Ga0495683_0136531 Ga0495683_0136531_16_987 300
957 3300047443 Ga0495687_025999 Ga0495687_025999_1348_2271 300
958 3300047444 Ga0495675_0124658 Ga0495675_0124658_454_1380 300
959 3300047446 Ga0495679_000127 Ga0495679_000127_40636_41559 300
960 3300047446 Ga0495679_000256 Ga0495679_000256_39837_40760 300
961 3300047446 Ga0495679_003273 Ga0495679_003273_1407_2333 300
962 3300047446 Ga0495679_007971 Ga0495679_007971_558_1484 300
963 3300047446 Ga0495679_018990 Ga0495679_018990_407_1333 300
964 3300047469 Ga0495673_0000205 Ga0495673_0000205_87728_88660 300
965 3300047469 Ga0495673_0002219 Ga0495673_0002219_12507_13430 300
966 3300047469 Ga0495673_0005001 Ga0495673_0005001_3298_4224 300
967 3300047469 Ga0495673_0006401 Ga0495673_0006401_5101_6024 300
968 3300047469 Ga0495673_0010501 Ga0495673_0010501_2153_3079 300
969 3300047469 Ga0495673_0015833 Ga0495673_0015833_2391_3314 300
970 3300047469 Ga0495673_0035355 Ga0495673_0035355_421_1347 300
971 3300047469 Ga0495673_0041246 Ga0495673_0041246_585_1511 300
972 3300047469 Ga0495673_0050649 Ga0495673_0050649_396_1319 300
973 3300047469 Ga0495673_0071575 Ga0495673_0071575_281_1207 300
974 3300047470 Ga0495681_0003467 Ga0495681_0003467_4886_5812 300
975 3300047470 Ga0495681_0004718 Ga0495681_0004718_3449_4375 300
976 3300047470 Ga0495681_0009210 Ga0495681_0009210_3301_4227 300
977 3300047470 Ga0495681_0029385 Ga0495681_0029385_554_1477 300
978 3300047470 Ga0495681_0037054 Ga0495681_0037054_502_1425 300
979 3300047470 Ga0495681_0041796 Ga0495681_0041796_1129_2055 300
980 3300047470 Ga0495681_0046539 Ga0495681_0046539_12_935 300
981 3300047470 Ga0495681_0047188 Ga0495681_0047188_690_1613 300
982 3300047471 Ga0495684_0022641 Ga0495684_0022641_3438_4364 300
983 3300047472 Ga0495686_0003486 Ga0495686_0003486_5606_6532 300
984 3300047472 Ga0495686_0012830 Ga0495686_0012830_3795_4721 300
985 3300047673 Ga0495593_0013500 Ga0495593_0013500_243_1169 300
986 3300047673 Ga0495593_0038661 Ga0495593_0038661_72_995 300
987 3300047673 Ga0495593_0101346 Ga0495593_0101346_53_976 300
988 3300048088 Ga0495602_0020643 Ga0495602_0020643_2056_2982 300
989 3300048091 Ga0495626_0000229 Ga0495626_0000229_61478_62401 300
990 3300048091 Ga0495626_0001242 Ga0495626_0001242_10180_11103 300
991 3300048091 Ga0495626_0002576 Ga0495626_0002576_10247_11170 300
992 3300048091 Ga0495626_0002586 Ga0495626_0002586_8958_9881 300
993 3300048091 Ga0495626_0005047 Ga0495626_0005047_3449_4375 300
994 3300048091 Ga0495626_0028415 Ga0495626_0028415_119_1045 300
995 3300048091 Ga0495626_0036277 Ga0495626_0036277_1082_2008 300
996 3300048091 Ga0495626_0110405 Ga0495626_0110405_185_1111 300
997 3300048913 Ga0496110_0192608 Ga0496110_0192608_338_1261 300
998 3300048913 Ga0496110_0229758 Ga0496110_0229758_59_982 300
999 3300048914 Ga0496111_0153045 Ga0496111_0153045_650_1573 300
1000 3300048919 Ga0496116_0000185 Ga0496116_0000185_80199_81122 300
1001 3300048919 Ga0496116_0003145 Ga0496116_0003145_3379_4302 300
1002 3300048919 Ga0496116_0004302 Ga0496116_0004302_4746_5672 300
1003 3300048919 Ga0496116_0013678 Ga0496116_0013678_2597_3520 300
1004 3300048919 Ga0496116_0048280 Ga0496116_0048280_452_1375 300
1005 3300048920 Ga0496117_0001839 Ga0496117_0001839_813_1736 300
1006 3300048920 Ga0496117_0003817 Ga0496117_0003817_3259_4182 300
1007 3300048921 Ga0496118_0002876 Ga0496118_0002876_20365_21288 300
1008 3300048921 Ga0496118_0004315 Ga0496118_0004315_12825_13748 300
1009 3300048924 Ga0496121_0001963 Ga0496121_0001963_7006_7929 300
1010 3300048925 Ga0496122_0001997 Ga0496122_0001997_26307_27230 300
1011 3300048925 Ga0496122_0002734 Ga0496122_0002734_21489_22412 300
1012 3300048925 Ga0496122_0010016 Ga0496122_0010016_3365_4288 300
1013 3300048925 Ga0496122_0022832 Ga0496122_0022832_493_1416 300
1014 3300048926 Ga0496123_0001245 Ga0496123_0001245_6542_7465 300
1015 3300048926 Ga0496123_0002963 Ga0496123_0002963_6689_7612 300
1016 3300048926 Ga0496123_0004932 Ga0496123_0004932_2895_3818 300
1017 3300048926 Ga0496123_0009246 Ga0496123_0009246_5826_6800 300
1018 3300048927 Ga0496124_0000031 Ga0496124_0000031_181615_182538 300
1019 3300048927 Ga0496124_0153875 Ga0496124_0153875_686_1609 300
1020 3300048928 Ga0496125_0020724 Ga0496125_0020724_4215_5138 300
1021 3300048929 Ga0496126_0121592 Ga0496126_0121592_250_1173 300
1022 3300049459 Ga0495678_000036 Ga0495678_000036_15034_15957 300
1023 3300049459 Ga0495678_000682 Ga0495678_000682_7209_8135 300
1024 3300049459 Ga0495678_004259 Ga0495678_004259_4578_5501 300
1025 3300049459 Ga0495678_007824 Ga0495678_007824_2459_3382 300
1026 3300049459 Ga0495678_010837 Ga0495678_010837_3404_4330 300
1027 3300049459 Ga0495678_020338 Ga0495678_020338_1094_2017 300
1028 3300049459 Ga0495678_021019 Ga0495678_021019_229_1155 300
1029 3300049459 Ga0495678_026138 Ga0495678_026138_715_1641 300
1030 3300049459 Ga0495678_039484 Ga0495678_039484_961_1887 300
1031 3300049459 Ga0495678_061393 Ga0495678_061393_441_1367 300
1032 3300049460 Ga0495682_0000560 Ga0495682_0000560_7046_7978 300
1033 3300049460 Ga0495682_0003709 Ga0495682_0003709_2311_3282 300
1034 3300049460 Ga0495682_0039196 Ga0495682_0039196_151_1077 300
1035 3300049460 Ga0495682_0052451 Ga0495682_0052451_267_1190 300
1036 3300049758 Ga0501241_001449 Ga0501241_001449_3366_4289 300
1037 3300050491 nmdc:mga00v17_143317_c1 nmdc:mga00v17_143317_c1_565_1488 300
1038 3300050514 nmdc:mga08x19_259456_c1 nmdc:mga08x19_259456_c1_126_1049 300
1039 3300053111 Ga0500572_001470 Ga0500572_001470_3363_4289 300
1040 3300053111 Ga0500572_078144 Ga0500572_078144_15_938 300
1041 3300053140 Ga0500573_0021459 Ga0500573_0021459_579_1502 300
1042 3300053145 Ga0500586_045869 Ga0500586_045869_499_1425 300
1043 iso_pu_bacteria 2511231017 2511331498 300
1044 iso_pu_bacteria 2511231023 2511368774 300
1045 iso_pu_bacteria 2511231031 2511414685 300
1046 iso_pu_bacteria 2713897148 2715753242 300
1047 iso_pu_bacteria 2738543025 2739315721 300
1048 iso_pu_bacteria 2773857673 2774135435 300
1049 iso_pu_bacteria 2784132063 2784265481 300
1050 iso_pu_bacteria 2818991456 2819654375 300
1051 iso_pu_bacteria 2974289157 2974291898 300
1052 iso_pu_bacteria 2998139840 2998141802 300
1053 iso_pu_bacteria 8019775933 8019776377 300
1054 iso_pu_bacteria 8029995093 8029998899 300
1055 iso_pu_bacteria 8056120720 8056124554 300
1056 iso_pu_bacteria 8056172158 8056175345 300
1057 iso_pu_bacteria 8056569372 8056571523 300

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

19

78

0.97

PF03466

LysR_substrate

LysR substrate binding domain

102

312

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p7n-assembly2.cif.gz_B crystal structure of light activated transcription factor el222 from erythrobacter litoralis 0.9003 5 47
7trv-assembly1.cif.gz_A crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.8984 4 84
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.897 4 84
7trv-assembly1.cif.gz_B crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.8813 4 86
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.8759 4 87
ID Description Score Start End Superfamily
2dbbB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9641 18 42 1.10.10.10
af_P52696_4_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.947 4 87 1.10.10.10
af_Q57083_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9466 5 81 1.10.10.10
3fzvC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9446 4 74 1.10.10.10
af_P0ACR7_1_84_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.943 5 82 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2D9T6E9-F1-model_v4 LysR family transcriptional regulator 0.8866 89 287
AF-V7DAT4-F1-model_v4 LysR family transcriptional regulator 0.8715 89 286
AF-A0A2Z6TGP7-F1-model_v4 deleted 0.8659 49 285
AF-A0A530K009-F1-model_v4 LysR family transcriptional regulator 0.8649 56 287 GO:0003700
GO:0006351
GO:0043565
AF-A0A7Y4T7C7-F1-model_v4 LysR family transcriptional regulator 0.8646 109 288 GO:0003700
GO:0006351
GO:0043565

Feature Viewer

pLDDT pTM Quality
87.9 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map