F489060

General Info

Members Datasets Scaffolds Average Seq Length
1050 346 2100 102

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0491768|Ga0436365_0491768_29_403
Length 124
Sequence VAAGARRIAGEREQRSRARADPMTRRLYDVAHCRAGDKGNTSILSLIAYRDEDYALLVEKVTAEAVARHMRDIVAGEIRRYEMPNLSALQFVCEHALSGGVTTSLALDAHGKSLSYALLEMPLD

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
205 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
206 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
207 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
208 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
209 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
210 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
211 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
212 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
213 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
216 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
217 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
218 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
219 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
220 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
221 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
222 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
225 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
226 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
227 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
228 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
229 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
230 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
231 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
232 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
233 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
234 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
235 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
236 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
237 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
238 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
239 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
240 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
241 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
242 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
243 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
244 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
245 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
246 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
247 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
248 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
249 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
250 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
251 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
252 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
253 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
254 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
255 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
256 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
257 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
258 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
259 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
260 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
261 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
262 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
263 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
264 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
265 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
266 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
267 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
268 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
269 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
270 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
271 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
272 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
273 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
274 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
275 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
276 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
277 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
278 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
279 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
280 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
281 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
282 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
283 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
284 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
285 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
286 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
287 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
288 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
289 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
290 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
291 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
295 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
296 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
299 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
300 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
303 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
304 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
305 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
306 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
318 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
319 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
320 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
321 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
322 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
323 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
324 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
325 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
326 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
327 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
328 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
329 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
331 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
332 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
333 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
334 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
335 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
336 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
337 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
338 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
339 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
340 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
341 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
342 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
343 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
344 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
345 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
346 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 2.38
Rhizosphere 96.76
Stem 0
Stem Tuber 0
Unclassified 12.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0491768 3300039437 Bacteria 2447
2 JGI24749J21850_1036463 3300002076 Bacteria 714
3 JGI24034J26672_10016662 3300002239 Bacteria 1133
4 JGI24034J26672_10017609 3300002239 Bacteria 1106
5 JGI25406J46586_10044898 3300003203 Bacteria 1526
6 rootL2_10111629 3300003322 Bacteria 6053
7 rootL2_10246789 3300003322 Bacteria 1244
8 rootH1_10357398 3300003323 Bacteria 1686
9 Ga0065712_10195423 3300005290 Bacteria 1130
10 Ga0065712_10233644 3300005290 Bacteria 1004
11 Ga0065712_10796922 3300005290 Unclassified 513
12 Ga0065715_10012019 3300005293 Bacteria 2315
13 Ga0065715_10243522 3300005293 Bacteria 1191
14 Ga0065707_10154639 3300005295 Bacteria 1621
15 Ga0065707_10886342 3300005295 Unclassified 571
16 Ga0070658_11410741 3300005327 Bacteria 604
17 Ga0070676_10022339 3300005328 Bacteria 3547
18 Ga0070676_10073915 3300005328 Bacteria 2052
19 Ga0070676_10095884 3300005328 Bacteria 1825
20 Ga0070676_10726990 3300005328 Bacteria 727
21 Ga0070676_11159719 3300005328 Bacteria 586
22 Ga0070676_11308480 3300005328 Bacteria 554
23 Ga0070676_11493966 3300005328 Unclassified 520
24 Ga0070690_100001184 3300005330 Bacteria 13432
25 Ga0070690_100010547 3300005330 Bacteria 5382
26 Ga0070690_100022322 3300005330 Bacteria 3871
27 Ga0070690_100593266 3300005330 Bacteria 840
28 Ga0070690_100612508 3300005330 Bacteria 828
29 Ga0070690_100782708 3300005330 Bacteria 739
30 Ga0070670_100011863 3300005331 Bacteria 7451
31 Ga0070670_100022231 3300005331 Bacteria 5458
32 Ga0070670_100047776 3300005331 Bacteria 3683
33 Ga0070670_100215649 3300005331 Bacteria 1669
34 Ga0070670_100218488 3300005331 Bacteria 1658
35 Ga0070670_100311492 3300005331 Bacteria 1378
36 Ga0070670_100374241 3300005331 Bacteria 1254
37 Ga0070670_101146021 3300005331 Bacteria 710
38 Ga0070670_101156192 3300005331 Bacteria 707
39 Ga0070670_101851297 3300005331 Bacteria 556
40 Ga0070677_10011248 3300005333 Bacteria 3081
41 Ga0070677_10031083 3300005333 Bacteria 2038
42 Ga0070677_10046625 3300005333 Unclassified 1734
43 Ga0070677_10145655 3300005333 Unclassified 1097
44 Ga0070677_10332901 3300005333 Bacteria 781
45 Ga0068869_100000600 3300005334 Bacteria 20255
46 Ga0068869_100012758 3300005334 Bacteria 5558
47 Ga0068869_100227284 3300005334 Bacteria 1481
48 Ga0070666_10004080 3300005335 Bacteria 8868
49 Ga0070666_10215072 3300005335 Unclassified 1354
50 Ga0070666_10310449 3300005335 Bacteria 1124
51 Ga0070666_10670542 3300005335 Bacteria 759
52 Ga0070666_10706722 3300005335 Unclassified 739
53 Ga0070666_10962730 3300005335 Bacteria 632
54 Ga0070680_100000089 3300005336 Bacteria 51222
55 Ga0070680_101752842 3300005336 Unclassified 538
56 Ga0070682_100002252 3300005337 Bacteria 10695
57 Ga0070682_101120199 3300005337 Bacteria 660
58 Ga0070682_101661337 3300005337 Unclassified 554
59 Ga0068868_100002798 3300005338 Bacteria 12085
60 Ga0068868_100031616 3300005338 Bacteria 4068
61 Ga0068868_100073751 3300005338 Bacteria 2725
62 Ga0068868_100078053 3300005338 Bacteria 2650
63 Ga0068868_100461730 3300005338 Bacteria 1106
64 Ga0068868_100546755 3300005338 Bacteria 1020
65 Ga0068868_101081859 3300005338 Bacteria 737
66 Ga0070660_100487712 3300005339 Bacteria 1024
67 Ga0070689_100004821 3300005340 Bacteria 9154
68 Ga0070689_100056001 3300005340 Bacteria 3056
69 Ga0070689_100395525 3300005340 Unclassified 1167
70 Ga0070689_101274043 3300005340 Unclassified 661
71 Ga0070689_101789345 3300005340 Bacteria 560
72 Ga0070691_10000090 3300005341 Bacteria 25810
73 Ga0070687_100002477 3300005343 Bacteria 6945
74 Ga0070687_100187829 3300005343 Unclassified 1243
75 Ga0070661_100625415 3300005344 Bacteria 872
76 Ga0070692_10011321 3300005345 Bacteria 4091
77 Ga0070692_10014339 3300005345 Bacteria 3720
78 Ga0070668_100004105 3300005347 Bacteria 10778
79 Ga0070668_100005712 3300005347 Bacteria 9222
80 Ga0070668_100067830 3300005347 Bacteria 2772
81 Ga0070668_100074755 3300005347 Bacteria 2644
82 Ga0070668_100215784 3300005347 Bacteria 1580
83 Ga0070668_100319357 3300005347 Bacteria 1307
84 Ga0070668_100883841 3300005347 Bacteria 798
85 Ga0070668_101053266 3300005347 Bacteria 733
86 Ga0070668_101928603 3300005347 Unclassified 544
87 Ga0070669_100043440 3300005353 Bacteria 3273
88 Ga0070669_100054195 3300005353 Bacteria 2937
89 Ga0070669_100135994 3300005353 Unclassified 1890
90 Ga0070669_100180667 3300005353 Bacteria 1650
91 Ga0070669_100276669 3300005353 Bacteria 1344
92 Ga0070669_100287893 3300005353 Bacteria 1318
93 Ga0070669_100460689 3300005353 Unclassified 1049
94 Ga0070669_100658643 3300005353 Bacteria 881
95 Ga0070669_100716593 3300005353 Unclassified 846
96 Ga0070669_100740128 3300005353 Bacteria 832
97 Ga0070669_100973304 3300005353 Bacteria 727
98 Ga0070669_101400751 3300005353 Bacteria 607
99 Ga0070675_100008280 3300005354 Bacteria 8066
100 Ga0070675_100024981 3300005354 Bacteria 4788
101 Ga0070675_100052902 3300005354 Bacteria 3339
102 Ga0070675_100098096 3300005354 Bacteria 2464
103 Ga0070675_100143294 3300005354 Bacteria 2044
104 Ga0070675_100155173 3300005354 Bacteria 1965
105 Ga0070675_100214228 3300005354 Bacteria 1675
106 Ga0070675_100402674 3300005354 Bacteria 1221
107 Ga0070675_100831685 3300005354 Bacteria 845
108 Ga0070675_101664968 3300005354 Bacteria 589
109 Ga0070671_100057949 3300005355 Bacteria 3224
110 Ga0070671_100066539 3300005355 Bacteria 3003
111 Ga0070671_100106278 3300005355 Bacteria 2356
112 Ga0070671_100388250 3300005355 Bacteria 1193
113 Ga0070671_100474358 3300005355 Bacteria 1075
114 Ga0070671_100629704 3300005355 Bacteria 928
115 Ga0070674_100037897 3300005356 Bacteria 3245
116 Ga0070674_100076671 3300005356 Bacteria 2377
117 Ga0070674_100712306 3300005356 Bacteria 859
118 Ga0070674_100819534 3300005356 Bacteria 805
119 Ga0070673_100027683 3300005364 Bacteria 4205
120 Ga0070673_100028828 3300005364 Bacteria 4134
121 Ga0070673_100124507 3300005364 Bacteria 2155
122 Ga0070673_100142888 3300005364 Bacteria 2020
123 Ga0070673_100189698 3300005364 Bacteria 1765
124 Ga0070673_100295353 3300005364 Bacteria 1425
125 Ga0070673_100472988 3300005364 Bacteria 1130
126 Ga0070673_101359730 3300005364 Unclassified 668
127 Ga0070688_100030869 3300005365 Bacteria 3219
128 Ga0070688_100047067 3300005365 Bacteria 2674
129 Ga0070688_100097321 3300005365 Bacteria 1934
130 Ga0070688_100152344 3300005365 Bacteria 1581
131 Ga0070688_100733112 3300005365 Unclassified 768
132 Ga0070659_100040234 3300005366 Bacteria 3652
133 Ga0070659_100553758 3300005366 Bacteria 985
134 Ga0070659_100633172 3300005366 Bacteria 921
135 Ga0070667_100003984 3300005367 Bacteria 12518
136 Ga0070667_100016589 3300005367 Bacteria 6095
137 Ga0070667_100115402 3300005367 Bacteria 2332
138 Ga0070667_100153432 3300005367 Bacteria 2025
139 Ga0070667_100294783 3300005367 Bacteria 1459
140 Ga0070667_100420228 3300005367 Bacteria 1219
141 Ga0070667_100506384 3300005367 Bacteria 1107
142 Ga0070667_100585281 3300005367 Bacteria 1027
143 Ga0070667_100613290 3300005367 Bacteria 1003
144 Ga0070667_100932435 3300005367 Unclassified 809
145 Ga0070667_101932763 3300005367 Bacteria 555
146 Ga0070703_10105839 3300005406 Bacteria 999
147 Ga0070709_10023745 3300005434 Bacteria 3605
148 Ga0070709_10077065 3300005434 Unclassified 2166
149 Ga0070709_10139272 3300005434 Bacteria 1665
150 Ga0070709_10167927 3300005434 Bacteria 1531
151 Ga0070714_100032603 3300005435 Bacteria 4350
152 Ga0070714_101846026 3300005435 Bacteria 590
153 Ga0070713_100000609 3300005436 Bacteria 22799
154 Ga0070713_100005755 3300005436 Bacteria 8514
155 Ga0070710_10106108 3300005437 Bacteria 1680
156 Ga0070701_10003274 3300005438 Bacteria 6380
157 Ga0070701_10110800 3300005438 Bacteria 1533
158 Ga0070701_10152765 3300005438 Bacteria 1331
159 Ga0070701_10454319 3300005438 Bacteria 823
160 Ga0070711_100301861 3300005439 Bacteria 1274
161 Ga0070705_100000867 3300005440 Bacteria 16937
162 Ga0070705_100017068 3300005440 Bacteria 3782
163 Ga0070705_100283961 3300005440 Bacteria 1178
164 Ga0070705_100365593 3300005440 Bacteria 1057
165 Ga0070700_100021237 3300005441 Bacteria 3772
166 Ga0070700_100127943 3300005441 Bacteria 1710
167 Ga0070700_100227630 3300005441 Unclassified 1325
168 Ga0070694_100002010 3300005444 Bacteria 12085
169 Ga0070694_100264959 3300005444 Bacteria 1305
170 Ga0070708_100286995 3300005445 Bacteria 1549
171 Ga0070708_101050018 3300005445 Bacteria 763
172 Ga0070708_101251063 3300005445 Bacteria 694
173 Ga0070708_101301893 3300005445 Bacteria 679
174 Ga0070663_100070492 3300005455 Bacteria 2542
175 Ga0070663_100334476 3300005455 Bacteria 1222
176 Ga0070663_100506735 3300005455 Bacteria 1003
177 Ga0070663_101728094 3300005455 Bacteria 560
178 Ga0070678_100006574 3300005456 Bacteria 6832
179 Ga0070678_100045450 3300005456 Bacteria 3142
180 Ga0070678_100127818 3300005456 Bacteria 2014
181 Ga0070678_100248602 3300005456 Bacteria 1490
182 Ga0070662_100780299 3300005457 Bacteria 812
183 Ga0068867_100001413 3300005459 Bacteria 16602
184 Ga0068867_100003822 3300005459 Bacteria 10588
185 Ga0068867_100015183 3300005459 Bacteria 5462
186 Ga0068867_100057720 3300005459 Bacteria 2875
187 Ga0068867_100075133 3300005459 Bacteria 2534
188 Ga0068867_100131535 3300005459 Bacteria 1945
189 Ga0068867_100339936 3300005459 Bacteria 1249
190 Ga0068867_100375249 3300005459 Bacteria 1193
191 Ga0068867_101129198 3300005459 Bacteria 717
192 Ga0070685_10056226 3300005466 Bacteria 2287
193 Ga0070685_10066779 3300005466 Bacteria 2121
194 Ga0070706_100078396 3300005467 Bacteria 3059
195 Ga0070706_100190690 3300005467 Bacteria 1915
196 Ga0070707_100029147 3300005468 Bacteria 5254
197 Ga0070707_100046212 3300005468 Bacteria 4167
198 Ga0070707_100081190 3300005468 Bacteria 3130
199 Ga0070707_100544615 3300005468 Bacteria 1123
200 Ga0070698_100788988 3300005471 Bacteria 894
201 Ga0070698_100860841 3300005471 Bacteria 851
202 Ga0070699_100032855 3300005518 Bacteria 4482
203 Ga0070699_100034816 3300005518 Bacteria 4351
204 Ga0070699_100082325 3300005518 Bacteria 2806
205 Ga0070679_100014304 3300005530 Bacteria 7621
206 Ga0070684_100009154 3300005535 Bacteria 7787
207 Ga0070684_101407123 3300005535 Bacteria 657
208 Ga0070697_100003333 3300005536 Bacteria 12334
209 Ga0070697_100148578 3300005536 Bacteria 1974
210 Ga0070697_100504909 3300005536 Bacteria 1058
211 Ga0070697_101063053 3300005536 Bacteria 720
212 Ga0068853_100007854 3300005539 Bacteria 8555
213 Ga0068853_100183149 3300005539 Bacteria 1900
214 Ga0068853_100373928 3300005539 Bacteria 1330
215 Ga0068853_100538826 3300005539 Bacteria 1105
216 Ga0068853_102313137 3300005539 Bacteria 521
217 Ga0070672_100005616 3300005543 Bacteria 8343
218 Ga0070672_100069542 3300005543 Bacteria 2795
219 Ga0070672_100261520 3300005543 Bacteria 1459
220 Ga0070672_100332735 3300005543 Bacteria 1292
221 Ga0070672_100351553 3300005543 Bacteria 1256
222 Ga0070672_100423407 3300005543 Unclassified 1144
223 Ga0070672_100826033 3300005543 Bacteria 816
224 Ga0070672_101093561 3300005543 Bacteria 708
225 Ga0070672_101814947 3300005543 Unclassified 548
226 Ga0070686_100001706 3300005544 Bacteria 12291
227 Ga0070686_100060453 3300005544 Bacteria 2445
228 Ga0070686_100253212 3300005544 Bacteria 1287
229 Ga0070686_101523439 3300005544 Bacteria 564
230 Ga0070695_100001399 3300005545 Bacteria 13371
231 Ga0070695_100001729 3300005545 Bacteria 12278
232 Ga0070695_100982778 3300005545 Bacteria 686
233 Ga0070696_100000958 3300005546 Bacteria 18702
234 Ga0070696_100007091 3300005546 Bacteria 7484
235 Ga0070696_100257710 3300005546 Bacteria 1321
236 Ga0070696_100259181 3300005546 Bacteria 1318
237 Ga0070693_100000477 3300005547 Bacteria 17942
238 Ga0070693_100289224 3300005547 Bacteria 1100
239 Ga0070693_100689677 3300005547 Bacteria 747
240 Ga0070665_100005380 3300005548 Bacteria 13221
241 Ga0070665_100150076 3300005548 Bacteria 2333
242 Ga0070665_100433683 3300005548 Unclassified 1323
243 Ga0070665_100771712 3300005548 Bacteria 974
244 Ga0070665_101068352 3300005548 Bacteria 819
245 Ga0070704_100001643 3300005549 Bacteria 12121
246 Ga0070704_100082335 3300005549 Bacteria 2373
247 Ga0070704_100258629 3300005549 Bacteria 1433
248 Ga0070704_100563303 3300005549 Bacteria 997
249 Ga0068855_100007998 3300005563 Bacteria 12773
250 Ga0068855_100256114 3300005563 Bacteria 1951
251 Ga0070664_100016535 3300005564 Bacteria 6049
252 Ga0070664_100043132 3300005564 Bacteria 3806
253 Ga0070664_100056637 3300005564 Unclassified 3331
254 Ga0070664_100184945 3300005564 Bacteria 1854
255 Ga0070664_100318122 3300005564 Bacteria 1409
256 Ga0070664_100990386 3300005564 Unclassified 790
257 Ga0070664_101551716 3300005564 Bacteria 627
258 Ga0068857_100069366 3300005577 Bacteria 3139
259 Ga0068857_100269749 3300005577 Bacteria 1564
260 Ga0068857_101346692 3300005577 Bacteria 694
261 Ga0068854_100003287 3300005578 Bacteria 10067
262 Ga0068856_100072248 3300005614 Bacteria 3416
263 Ga0070702_100000452 3300005615 Bacteria 14615
264 Ga0070702_100107339 3300005615 Bacteria 1724
265 Ga0070702_100281550 3300005615 Bacteria 1142
266 Ga0070702_100835110 3300005615 Bacteria 716
267 Ga0070702_101129607 3300005615 Bacteria 628
268 Ga0068852_100119362 3300005616 Bacteria 2411
269 Ga0068852_100183264 3300005616 Bacteria 1970
270 Ga0068852_100335141 3300005616 Bacteria 1473
271 Ga0068852_100377495 3300005616 Bacteria 1390
272 Ga0068852_100925982 3300005616 Unclassified 889
273 Ga0068859_100000190 3300005617 Bacteria 59517
274 Ga0068859_100009178 3300005617 Bacteria 9986
275 Ga0068859_100039128 3300005617 Bacteria 4757
276 Ga0068859_100195615 3300005617 Unclassified 2106
277 Ga0068859_100326018 3300005617 Bacteria 1629
278 Ga0068859_100806080 3300005617 Bacteria 1026
279 Ga0068859_101027147 3300005617 Unclassified 906
280 Ga0068859_101942813 3300005617 Bacteria 650
281 Ga0068859_102968084 3300005617 Unclassified 519
282 Ga0068864_100015339 3300005618 Bacteria 6369
283 Ga0068864_100207723 3300005618 Bacteria 1802
284 Ga0068864_100255533 3300005618 Bacteria 1628
285 Ga0068864_100333204 3300005618 Bacteria 1428
286 Ga0068864_100468324 3300005618 Bacteria 1207
287 Ga0068864_100853144 3300005618 Bacteria 897
288 Ga0068864_100941276 3300005618 Unclassified 854
289 Ga0068864_101659816 3300005618 Bacteria 643
290 Ga0068866_10013277 3300005718 Bacteria 3610
291 Ga0068866_10060977 3300005718 Bacteria 1957
292 Ga0068866_11043093 3300005718 Bacteria 583
293 Ga0068861_100001570 3300005719 Bacteria 14527
294 Ga0068861_100004155 3300005719 Bacteria 9709
295 Ga0068861_100205533 3300005719 Bacteria 1656
296 Ga0068861_100583106 3300005719 Bacteria 1024
297 Ga0068861_100654952 3300005719 Bacteria 971
298 Ga0068861_100794948 3300005719 Bacteria 887
299 Ga0068851_10316091 3300005834 Bacteria 901
300 Ga0068870_10011843 3300005840 Bacteria 4057
301 Ga0068870_10080999 3300005840 Bacteria 1795
302 Ga0068870_10083921 3300005840 Bacteria 1767
303 Ga0068870_10199939 3300005840 Bacteria 1211
304 Ga0068870_10345380 3300005840 Unclassified 953
305 Ga0068863_100047447 3300005841 Bacteria 4073
306 Ga0068863_100089211 3300005841 Bacteria 2923
307 Ga0068863_100126391 3300005841 Bacteria 2439
308 Ga0068863_100129415 3300005841 Bacteria 2410
309 Ga0068863_100159296 3300005841 Bacteria 2162
310 Ga0068863_100237343 3300005841 Bacteria 1760
311 Ga0068863_100390701 3300005841 Bacteria 1359
312 Ga0068863_100572274 3300005841 Bacteria 1117
313 Ga0068863_100575234 3300005841 Bacteria 1114
314 Ga0068863_100583216 3300005841 Bacteria 1106
315 Ga0068863_100625600 3300005841 Bacteria 1067
316 Ga0068863_100639191 3300005841 Bacteria 1055
317 Ga0068863_101021452 3300005841 Bacteria 830
318 Ga0068863_101381408 3300005841 Unclassified 712
319 Ga0068863_101891916 3300005841 Bacteria 607
320 Ga0068863_102212844 3300005841 Unclassified 560
321 Ga0068858_100005045 3300005842 Bacteria 12942
322 Ga0068858_100008322 3300005842 Bacteria 9978
323 Ga0068858_100018606 3300005842 Bacteria 6504
324 Ga0068858_100130753 3300005842 Bacteria 2354
325 Ga0068858_100154382 3300005842 Bacteria 2159
326 Ga0068858_100164927 3300005842 Bacteria 2087
327 Ga0068858_100541139 3300005842 Bacteria 1127
328 Ga0068858_101015513 3300005842 Bacteria 813
329 Ga0068858_101214864 3300005842 Bacteria 741
330 Ga0068860_100005089 3300005843 Bacteria 13371
331 Ga0068860_100042047 3300005843 Bacteria 4367
332 Ga0068860_100056913 3300005843 Bacteria 3716
333 Ga0068860_100120996 3300005843 Bacteria 2507
334 Ga0068860_100153217 3300005843 Bacteria 2220
335 Ga0068860_100231048 3300005843 Bacteria 1797
336 Ga0068860_100266466 3300005843 Unclassified 1671
337 Ga0068860_100383022 3300005843 Bacteria 1389
338 Ga0068860_100845569 3300005843 Unclassified 930
339 Ga0068862_100003474 3300005844 Bacteria 13542
340 Ga0068862_100027707 3300005844 Bacteria 4770
341 Ga0068862_100121076 3300005844 Bacteria 2307
342 Ga0068862_100198006 3300005844 Bacteria 1810
343 Ga0081455_10250061 3300005937 Bacteria 1297
344 Ga0081539_10000686 3300005985 Bacteria 67858
345 Ga0070717_10238946 3300006028 Bacteria 1601
346 Ga0070717_10577561 3300006028 Bacteria 1019
347 Ga0070716_100240727 3300006173 Bacteria 1227
348 Ga0070716_100640890 3300006173 Unclassified 804
349 Ga0070716_100652919 3300006173 Unclassified 798
350 Ga0070712_100081195 3300006175 Bacteria 2349
351 Ga0070712_100221213 3300006175 Bacteria 1499
352 Ga0097621_100004855 3300006237 Bacteria 9419
353 Ga0097621_100008477 3300006237 Bacteria 7404
354 Ga0097621_100125674 3300006237 Bacteria 2178
355 Ga0097621_100127291 3300006237 Bacteria 2164
356 Ga0097621_100142265 3300006237 Bacteria 2050
357 Ga0097621_100187440 3300006237 Unclassified 1790
358 Ga0097621_100370550 3300006237 Unclassified 1277
359 Ga0097621_100401283 3300006237 Bacteria 1227
360 Ga0097621_100412700 3300006237 Bacteria 1211
361 Ga0097621_100451718 3300006237 Bacteria 1158
362 Ga0097621_100756758 3300006237 Bacteria 898
363 Ga0097621_101075977 3300006237 Bacteria 754
364 Ga0097621_101378620 3300006237 Unclassified 667
365 Ga0068871_100000744 3300006358 Bacteria 22076
366 Ga0068871_100064948 3300006358 Bacteria 2988
367 Ga0068871_100134028 3300006358 Bacteria 2102
368 Ga0068871_100461070 3300006358 Bacteria 1140
369 Ga0068871_101854662 3300006358 Bacteria 573
370 Ga0075428_100001109 3300006844 Bacteria 28681
371 Ga0075430_100000805 3300006846 Bacteria 24399
372 Ga0075431_100109392 3300006847 Bacteria 2853
373 Ga0075431_100975572 3300006847 Bacteria 815
374 Ga0075433_10595527 3300006852 Bacteria 971
375 Ga0075433_11261151 3300006852 Unclassified 641
376 Ga0075434_100334076 3300006871 Bacteria 1536
377 Ga0075434_100755870 3300006871 Unclassified 989
378 Ga0075434_102609978 3300006871 Bacteria 506
379 Ga0075429_100000103 3300006880 Bacteria 47421
380 Ga0075429_100378132 3300006880 Bacteria 1240
381 Ga0068865_100001413 3300006881 Bacteria 13989
382 Ga0068865_100088783 3300006881 Bacteria 2237
383 Ga0068865_100260281 3300006881 Bacteria 1373
384 Ga0068865_100290969 3300006881 Bacteria 1304
385 Ga0068865_100299438 3300006881 Bacteria 1287
386 Ga0075436_100016128 3300006914 Bacteria 5115
387 Ga0075436_100016906 3300006914 Bacteria 4992
388 Ga0075436_100019590 3300006914 Bacteria 4637
389 Ga0097620_100000190 3300006931 Bacteria 59517
390 Ga0097620_100009178 3300006931 Bacteria 9986
391 Ga0097620_100039127 3300006931 Bacteria 4757
392 Ga0097620_100195605 3300006931 Unclassified 2106
393 Ga0097620_100326008 3300006931 Bacteria 1629
394 Ga0097620_100806104 3300006931 Bacteria 1026
395 Ga0097620_101027172 3300006931 Unclassified 906
396 Ga0097620_101942836 3300006931 Bacteria 650
397 Ga0097620_102968045 3300006931 Unclassified 519
398 Ga0075435_100025369 3300007076 Bacteria 4614
399 Ga0075435_100072503 3300007076 Bacteria 2813
400 Ga0105250_10009045 3300009092 Bacteria 4208
401 Ga0105250_10131302 3300009092 Bacteria 1034
402 Ga0105240_10044211 3300009093 Bacteria 5663
403 Ga0105240_10663855 3300009093 Bacteria 1141
404 Ga0111539_10078831 3300009094 Bacteria 3874
405 Ga0105245_10003518 3300009098 Bacteria 14009
406 Ga0105245_10004048 3300009098 Bacteria 13028
407 Ga0105245_10526897 3300009098 Unclassified 1201
408 Ga0105247_10077658 3300009101 Bacteria 2087
409 Ga0105247_10193005 3300009101 Bacteria 1364
410 Ga0105247_10282093 3300009101 Bacteria 1146
411 Ga0114129_10002499 3300009147 Bacteria 25510
412 Ga0114129_10382051 3300009147 Bacteria 1860
413 Ga0114129_10512906 3300009147 Bacteria 1564
414 Ga0105243_10003728 3300009148 Bacteria 12223
415 Ga0105243_10023277 3300009148 Bacteria 4714
416 Ga0105243_10200197 3300009148 Bacteria 1751
417 Ga0105243_10207722 3300009148 Bacteria 1722
418 Ga0105243_10560885 3300009148 Unclassified 1093
419 Ga0105243_10952378 3300009148 Bacteria 858
420 Ga0105243_11302351 3300009148 Unclassified 744
421 Ga0105241_10020295 3300009174 Bacteria 4909
422 Ga0105241_10100532 3300009174 Bacteria 2298
423 Ga0105242_10001851 3300009176 Bacteria 16595
424 Ga0105242_10041737 3300009176 Bacteria 3701
425 Ga0105242_11246144 3300009176 Bacteria 765
426 Ga0105248_10008315 3300009177 Bacteria 11401
427 Ga0105248_10029077 3300009177 Bacteria 6161
428 Ga0105248_10068152 3300009177 Bacteria 3996
429 Ga0105248_10289186 3300009177 Bacteria 1845
430 Ga0105248_10540409 3300009177 Bacteria 1315
431 Ga0105248_11010071 3300009177 Unclassified 940
432 Ga0105248_11041265 3300009177 Bacteria 925
433 Ga0105248_11228805 3300009177 Bacteria 847
434 Ga0105248_11326657 3300009177 Bacteria 814
435 Ga0105248_11513191 3300009177 Unclassified 760
436 Ga0105237_10003465 3300009545 Bacteria 18709
437 Ga0105237_10239783 3300009545 Bacteria 1814
438 Ga0105238_12007506 3300009551 Bacteria 612
439 Ga0105249_10000917 3300009553 Bacteria 26070
440 Ga0105249_10778780 3300009553 Bacteria 1020
441 Ga0105249_10802680 3300009553 Bacteria 1005
442 Ga0105249_11041944 3300009553 Unclassified 887
443 Ga0105249_11916517 3300009553 Bacteria 665
444 Ga0105249_12366527 3300009553 Bacteria 604
445 Ga0099796_10326047 3300010159 Bacteria 656
446 Ga0105239_10048833 3300010375 Bacteria 4640
447 Ga0105246_10035899 3300011119 Bacteria 3316
448 Ga0105246_11204264 3300011119 Unclassified 697
449 Ga0105246_11683566 3300011119 Bacteria 602
450 Ga0157341_1038870 3300012494 Bacteria 544
451 Ga0157373_10067391 3300013100 Bacteria 2531
452 Ga0157371_10005188 3300013102 Bacteria 11086
453 Ga0157371_10102818 3300013102 Bacteria 2027
454 Ga0157371_11395335 3300013102 Unclassified 544
455 Ga0157370_10023742 3300013104 Bacteria 6085
456 Ga0157370_10041847 3300013104 Bacteria 4417
457 Ga0157374_10116997 3300013296 Unclassified 2569
458 Ga0157374_10218057 3300013296 Bacteria 1872
459 Ga0157374_10251570 3300013296 Unclassified 1739
460 Ga0157374_10681879 3300013296 Bacteria 1040
461 Ga0157374_11683367 3300013296 Bacteria 659
462 Ga0157374_11984709 3300013296 Bacteria 608
463 Ga0157374_12562375 3300013296 Bacteria 538
464 Ga0157378_10004976 3300013297 Bacteria 11655
465 Ga0157378_10040155 3300013297 Bacteria 4149
466 Ga0157378_10052967 3300013297 Bacteria 3612
467 Ga0157378_10102680 3300013297 Bacteria 2612
468 Ga0157378_10548683 3300013297 Unclassified 1161
469 Ga0157378_10744002 3300013297 Bacteria 1003
470 Ga0157378_10885917 3300013297 Bacteria 922
471 Ga0157378_10984511 3300013297 Bacteria 877
472 Ga0157378_11309044 3300013297 Bacteria 766
473 Ga0163162_10025974 3300013306 Bacteria 5788
474 Ga0163162_10035941 3300013306 Bacteria 4935
475 Ga0163162_10037746 3300013306 Bacteria 4822
476 Ga0163162_10141918 3300013306 Bacteria 2516
477 Ga0163162_10190991 3300013306 Unclassified 2176
478 Ga0163162_10200319 3300013306 Bacteria 2125
479 Ga0163162_10259810 3300013306 Bacteria 1868
480 Ga0163162_10290875 3300013306 Unclassified 1766
481 Ga0163162_10416177 3300013306 Bacteria 1476
482 Ga0163162_10421530 3300013306 Bacteria 1467
483 Ga0163162_10606040 3300013306 Bacteria 1221
484 Ga0163162_11045492 3300013306 Bacteria 924
485 Ga0163162_11379633 3300013306 Bacteria 802
486 Ga0163162_12349403 3300013306 Bacteria 613
487 Ga0163162_12386271 3300013306 Bacteria 608
488 Ga0157372_11674775 3300013307 Bacteria 732
489 Ga0157375_10005914 3300013308 Bacteria 10664
490 Ga0157375_10050023 3300013308 Unclassified 4098
491 Ga0157375_10059092 3300013308 Bacteria 3796
492 Ga0157375_10095810 3300013308 Bacteria 3039
493 Ga0157375_10128543 3300013308 Bacteria 2651
494 Ga0157375_10152888 3300013308 Bacteria 2444
495 Ga0157375_10276605 3300013308 Bacteria 1841
496 Ga0157375_10349458 3300013308 Bacteria 1644
497 Ga0157375_10885994 3300013308 Bacteria 1037
498 Ga0157375_11094998 3300013308 Bacteria 932
499 Ga0157375_11323570 3300013308 Bacteria 847
500 Ga0157375_11667325 3300013308 Bacteria 754
501 Ga0163163_10002834 3300014325 Bacteria 14652
502 Ga0163163_10007819 3300014325 Bacteria 9454
503 Ga0163163_10028667 3300014325 Bacteria 5350
504 Ga0163163_10042799 3300014325 Bacteria 4437
505 Ga0163163_10060600 3300014325 Bacteria 3748
506 Ga0163163_11387580 3300014325 Bacteria 764
507 Ga0157380_10037401 3300014326 Bacteria 3761
508 Ga0157380_10051207 3300014326 Bacteria 3265
509 Ga0157380_10119222 3300014326 Bacteria 2232
510 Ga0157380_10214098 3300014326 Bacteria 1719
511 Ga0157380_10216221 3300014326 Bacteria 1712
512 Ga0157380_10723513 3300014326 Bacteria 1003
513 Ga0157380_11405446 3300014326 Bacteria 748
514 Ga0157377_10084809 3300014745 Bacteria 1859
515 Ga0157377_10486770 3300014745 Bacteria 859
516 Ga0157377_11215065 3300014745 Unclassified 584
517 Ga0157379_10009832 3300014968 Bacteria 8336
518 Ga0157379_10042927 3300014968 Bacteria 4038
519 Ga0157379_10043738 3300014968 Bacteria 3999
520 Ga0157379_10118398 3300014968 Bacteria 2382
521 Ga0157379_10154814 3300014968 Bacteria 2067
522 Ga0157379_10156711 3300014968 Bacteria 2055
523 Ga0157379_10213384 3300014968 Unclassified 1748
524 Ga0157379_10671625 3300014968 Bacteria 971
525 Ga0157379_11196565 3300014968 Unclassified 731
526 Ga0157379_12053084 3300014968 Bacteria 566
527 Ga0157376_10010610 3300014969 Bacteria 6747
528 Ga0157376_10023748 3300014969 Unclassified 4804
529 Ga0157376_10028030 3300014969 Bacteria 4472
530 Ga0157376_10102555 3300014969 Bacteria 2503
531 Ga0157376_10168618 3300014969 Bacteria 1991
532 Ga0157376_10265467 3300014969 Bacteria 1610
533 Ga0157376_10300936 3300014969 Bacteria 1518
534 Ga0157376_10739573 3300014969 Bacteria 992
535 Ga0157376_10945248 3300014969 Bacteria 882
536 Ga0157376_11503419 3300014969 Unclassified 706
537 Ga0163161_10045046 3300017792 Bacteria 3180
538 Ga0163161_10060020 3300017792 Bacteria 2767
539 Ga0163161_10070462 3300017792 Bacteria 2556
540 Ga0163161_10087974 3300017792 Bacteria 2296
541 Ga0163161_10113064 3300017792 Bacteria 2032
542 Ga0163161_11597823 3300017792 Unclassified 575
543 Ga0206356_10202351 3300020070 Bacteria 620
544 Ga0209147_100142 3300025229 Bacteria 113692
545 Ga0209257_1000005 3300025304 Bacteria 1592528
546 Ga0207697_10041261 3300025315 Bacteria 1895
547 Ga0207697_10113027 3300025315 Unclassified 1164
548 Ga0207697_10539182 3300025315 Bacteria 514
549 Ga0207656_10514288 3300025321 Bacteria 608
550 Ga0207696_1094178 3300025711 Bacteria 819
551 Ga0207655_1009036 3300025728 Bacteria 6240
552 Ga0207713_1007325 3300025735 Bacteria 6536
553 Ga0207653_10029926 3300025885 Bacteria 1755
554 Ga0207682_10001787 3300025893 Bacteria 9854
555 Ga0207682_10015683 3300025893 Bacteria 2951
556 Ga0207682_10150491 3300025893 Bacteria 1049
557 Ga0207682_10155618 3300025893 Bacteria 1033
558 Ga0207682_10476560 3300025893 Unclassified 591
559 Ga0207692_10121074 3300025898 Bacteria 1466
560 Ga0207642_10001241 3300025899 Bacteria 7896
561 Ga0207642_10007559 3300025899 Bacteria 3678
562 Ga0207642_10015283 3300025899 Bacteria 2856
563 Ga0207642_10716940 3300025899 Bacteria 631
564 Ga0207710_10077112 3300025900 Bacteria 1539
565 Ga0207688_10007284 3300025901 Bacteria 6021
566 Ga0207688_10010878 3300025901 Bacteria 4952
567 Ga0207688_10029187 3300025901 Bacteria 3036
568 Ga0207680_10084536 3300025903 Bacteria 2002
569 Ga0207680_10084573 3300025903 Bacteria 2002
570 Ga0207680_10093729 3300025903 Unclassified 1916
571 Ga0207680_10692057 3300025903 Bacteria 730
572 Ga0207647_10755127 3300025904 Bacteria 526
573 Ga0207699_10030705 3300025906 Bacteria 3010
574 Ga0207699_10101030 3300025906 Bacteria 1830
575 Ga0207645_10037393 3300025907 Bacteria 3114
576 Ga0207645_10097575 3300025907 Bacteria 1894
577 Ga0207645_10151234 3300025907 Bacteria 1515
578 Ga0207645_10722402 3300025907 Bacteria 677
579 Ga0207643_10011925 3300025908 Bacteria 4693
580 Ga0207643_10027841 3300025908 Bacteria 3136
581 Ga0207643_10107948 3300025908 Bacteria 1637
582 Ga0207643_10442945 3300025908 Bacteria 826
583 Ga0207684_10013275 3300025910 Bacteria 7127
584 Ga0207684_10093025 3300025910 Bacteria 2570
585 Ga0207654_10007036 3300025911 Bacteria 5666
586 Ga0207654_10018726 3300025911 Bacteria 3639
587 Ga0207654_10738514 3300025911 Bacteria 709
588 Ga0207707_10030085 3300025912 Bacteria 4748
589 Ga0207695_11474181 3300025913 Bacteria 561
590 Ga0207671_10001288 3300025914 Bacteria 29500
591 Ga0207671_11052305 3300025914 Unclassified 640
592 Ga0207693_10202177 3300025915 Bacteria 1562
593 Ga0207693_10321910 3300025915 Bacteria 1210
594 Ga0207663_10173889 3300025916 Bacteria 1532
595 Ga0207663_10805862 3300025916 Bacteria 748
596 Ga0207660_10002436 3300025917 Bacteria 12221
597 Ga0207662_10005001 3300025918 Bacteria 7018
598 Ga0207662_10169346 3300025918 Bacteria 1400
599 Ga0207649_10173416 3300025920 Bacteria 1504
600 Ga0207652_10336042 3300025921 Bacteria 1364
601 Ga0207646_10004138 3300025922 Bacteria 15931
602 Ga0207646_10073225 3300025922 Bacteria 3060
603 Ga0207681_10009819 3300025923 Bacteria 5853
604 Ga0207681_10011021 3300025923 Bacteria 5552
605 Ga0207681_10259552 3300025923 Bacteria 1360
606 Ga0207681_10334942 3300025923 Bacteria 1207
607 Ga0207681_10727512 3300025923 Bacteria 826
608 Ga0207681_10806108 3300025923 Bacteria 784
609 Ga0207681_11622056 3300025923 Unclassified 541
610 Ga0207650_10006811 3300025925 Bacteria 7793
611 Ga0207650_10042084 3300025925 Bacteria 3351
612 Ga0207650_10061115 3300025925 Bacteria 2812
613 Ga0207650_10109708 3300025925 Bacteria 2134
614 Ga0207650_10226483 3300025925 Bacteria 1506
615 Ga0207650_10395876 3300025925 Bacteria 1143
616 Ga0207650_10769109 3300025925 Bacteria 815
617 Ga0207650_11709819 3300025925 Unclassified 533
618 Ga0207659_10007017 3300025926 Bacteria 6918
619 Ga0207659_10020731 3300025926 Bacteria 4351
620 Ga0207659_10023971 3300025926 Bacteria 4082
621 Ga0207659_10024612 3300025926 Bacteria 4037
622 Ga0207659_10128179 3300025926 Bacteria 1954
623 Ga0207659_10140709 3300025926 Bacteria 1873
624 Ga0207659_10153947 3300025926 Bacteria 1798
625 Ga0207659_10330453 3300025926 Bacteria 1260
626 Ga0207659_10439491 3300025926 Bacteria 1097
627 Ga0207687_10001873 3300025927 Bacteria 14478
628 Ga0207687_10004970 3300025927 Bacteria 8814
629 Ga0207700_10000197 3300025928 Bacteria 35916
630 Ga0207700_10009482 3300025928 Bacteria 6085
631 Ga0207664_10002031 3300025929 Bacteria 13325
632 Ga0207664_11487243 3300025929 Bacteria 599
633 Ga0207664_11864044 3300025929 Bacteria 524
634 Ga0207644_10015052 3300025931 Bacteria 5189
635 Ga0207644_10035865 3300025931 Bacteria 3478
636 Ga0207644_10041677 3300025931 Bacteria 3249
637 Ga0207644_10077680 3300025931 Bacteria 2445
638 Ga0207644_10136270 3300025931 Unclassified 1885
639 Ga0207644_10328818 3300025931 Bacteria 1237
640 Ga0207644_10417958 3300025931 Bacteria 1098
641 Ga0207690_10022173 3300025932 Bacteria 3946
642 Ga0207690_10039029 3300025932 Bacteria 3096
643 Ga0207690_10521447 3300025932 Bacteria 963
644 Ga0207690_10681917 3300025932 Bacteria 844
645 Ga0207706_10003530 3300025933 Bacteria 14932
646 Ga0207706_10454228 3300025933 Bacteria 1108
647 Ga0207706_11448173 3300025933 Bacteria 562
648 Ga0207686_10000992 3300025934 Bacteria 16854
649 Ga0207686_10344481 3300025934 Bacteria 1120
650 Ga0207686_10399732 3300025934 Unclassified 1046
651 Ga0207686_10596510 3300025934 Bacteria 869
652 Ga0207686_11494067 3300025934 Bacteria 557
653 Ga0207709_10001315 3300025935 Bacteria 17635
654 Ga0207709_10106927 3300025935 Bacteria 1862
655 Ga0207709_10454353 3300025935 Bacteria 991
656 Ga0207709_10573166 3300025935 Bacteria 890
657 Ga0207709_11824076 3300025935 Unclassified 506
658 Ga0207670_10001450 3300025936 Bacteria 12451
659 Ga0207670_10051120 3300025936 Bacteria 2773
660 Ga0207670_10110472 3300025936 Bacteria 1981
661 Ga0207670_10349229 3300025936 Unclassified 1171
662 Ga0207669_10110430 3300025937 Bacteria 1841
663 Ga0207669_10161170 3300025937 Bacteria 1584
664 Ga0207669_10359486 3300025937 Bacteria 1128
665 Ga0207669_10409575 3300025937 Bacteria 1064
666 Ga0207704_10000483 3300025938 Bacteria 17756
667 Ga0207704_10057467 3300025938 Bacteria 2390
668 Ga0207704_10139554 3300025938 Bacteria 1693
669 Ga0207704_10365862 3300025938 Bacteria 1127
670 Ga0207704_10604942 3300025938 Bacteria 898
671 Ga0207691_10002471 3300025940 Bacteria 18081
672 Ga0207691_10024141 3300025940 Bacteria 5718
673 Ga0207691_10025390 3300025940 Bacteria 5564
674 Ga0207691_10102574 3300025940 Bacteria 2552
675 Ga0207691_10130855 3300025940 Bacteria 2217
676 Ga0207691_10213818 3300025940 Bacteria 1674
677 Ga0207691_10276029 3300025940 Bacteria 1447
678 Ga0207691_10276150 3300025940 Bacteria 1446
679 Ga0207691_10451219 3300025940 Bacteria 1094
680 Ga0207711_10002471 3300025941 Bacteria 16492
681 Ga0207711_10053510 3300025941 Bacteria 3462
682 Ga0207711_10147640 3300025941 Bacteria 2119
683 Ga0207711_10422889 3300025941 Bacteria 1239
684 Ga0207711_10687509 3300025941 Bacteria 954
685 Ga0207689_10000007 3300025942 Bacteria 132362
686 Ga0207689_10000402 3300025942 Bacteria 40537
687 Ga0207689_10041700 3300025942 Bacteria 3798
688 Ga0207689_10299756 3300025942 Bacteria 1332
689 Ga0207689_11313300 3300025942 Bacteria 608
690 Ga0207689_11715741 3300025942 Unclassified 520
691 Ga0207661_10233259 3300025944 Bacteria 1630
692 Ga0207661_10355745 3300025944 Bacteria 1322
693 Ga0207661_10444549 3300025944 Bacteria 1180
694 Ga0207679_10002477 3300025945 Bacteria 11367
695 Ga0207679_10045557 3300025945 Bacteria 3173
696 Ga0207679_10064759 3300025945 Bacteria 2733
697 Ga0207679_10581508 3300025945 Unclassified 1007
698 Ga0207679_11003048 3300025945 Bacteria 765
699 Ga0207667_10008307 3300025949 Bacteria 12352
700 Ga0207651_10049003 3300025960 Unclassified 2859
701 Ga0207651_10085936 3300025960 Bacteria 2284
702 Ga0207651_10116430 3300025960 Bacteria 2017
703 Ga0207651_10214969 3300025960 Bacteria 1550
704 Ga0207651_10428658 3300025960 Bacteria 1130
705 Ga0207651_10605546 3300025960 Unclassified 958
706 Ga0207651_11925774 3300025960 Bacteria 531
707 Ga0207712_10007660 3300025961 Bacteria 6829
708 Ga0207712_10535703 3300025961 Bacteria 1005
709 Ga0207712_11659644 3300025961 Bacteria 573
710 Ga0207668_10009057 3300025972 Bacteria 5949
711 Ga0207668_10017897 3300025972 Bacteria 4449
712 Ga0207668_10028643 3300025972 Bacteria 3644
713 Ga0207668_10037659 3300025972 Bacteria 3239
714 Ga0207668_10061412 3300025972 Bacteria 2643
715 Ga0207668_10197505 3300025972 Bacteria 1599
716 Ga0207668_10529079 3300025972 Unclassified 1018
717 Ga0207668_10668724 3300025972 Bacteria 910
718 Ga0207668_10741515 3300025972 Bacteria 866
719 Ga0207640_11510218 3300025981 Bacteria 604
720 Ga0207658_10027934 3300025986 Bacteria 3969
721 Ga0207658_10044943 3300025986 Bacteria 3217
722 Ga0207658_10145343 3300025986 Bacteria 1925
723 Ga0207658_10226963 3300025986 Unclassified 1574
724 Ga0207658_10262983 3300025986 Unclassified 1471
725 Ga0207658_10272047 3300025986 Bacteria 1448
726 Ga0207658_10475250 3300025986 Bacteria 1110
727 Ga0207658_10575769 3300025986 Bacteria 1010
728 Ga0207658_10587577 3300025986 Bacteria 999
729 Ga0207658_11092603 3300025986 Unclassified 728
730 Ga0207658_11716078 3300025986 Bacteria 573
731 Ga0207658_12088257 3300025986 Bacteria 515
732 Ga0207677_10006914 3300026023 Bacteria 6237
733 Ga0207677_10018064 3300026023 Bacteria 4225
734 Ga0207677_10033011 3300026023 Bacteria 3333
735 Ga0207677_10033449 3300026023 Bacteria 3318
736 Ga0207677_10331842 3300026023 Bacteria 1268
737 Ga0207677_10755519 3300026023 Unclassified 867
738 Ga0207677_11375950 3300026023 Unclassified 650
739 Ga0207677_11450973 3300026023 Bacteria 633
740 Ga0207703_10016221 3300026035 Bacteria 5806
741 Ga0207703_10016296 3300026035 Bacteria 5793
742 Ga0207703_10053366 3300026035 Bacteria 3285
743 Ga0207703_10163421 3300026035 Bacteria 1952
744 Ga0207703_10404915 3300026035 Bacteria 1266
745 Ga0207703_10999521 3300026035 Unclassified 802
746 Ga0207703_11537991 3300026035 Bacteria 640
747 Ga0207703_11627494 3300026035 Bacteria 621
748 Ga0207703_11639261 3300026035 Bacteria 619
749 Ga0207639_10016924 3300026041 Bacteria 5166
750 Ga0207639_10142523 3300026041 Bacteria 1998
751 Ga0207639_10289172 3300026041 Bacteria 1444
752 Ga0207639_10443295 3300026041 Bacteria 1177
753 Ga0207678_10061284 3300026067 Bacteria 3236
754 Ga0207678_10098237 3300026067 Bacteria 2502
755 Ga0207678_10142881 3300026067 Bacteria 2043
756 Ga0207678_10525420 3300026067 Bacteria 1033
757 Ga0207678_10860982 3300026067 Bacteria 801
758 Ga0207708_10004704 3300026075 Bacteria 10040
759 Ga0207708_10024916 3300026075 Bacteria 4526
760 Ga0207708_10037898 3300026075 Bacteria 3673
761 Ga0207708_10458523 3300026075 Bacteria 1063
762 Ga0207702_10271663 3300026078 Bacteria 1599
763 Ga0207641_10007979 3300026088 Bacteria 8774
764 Ga0207641_10026607 3300026088 Unclassified 4776
765 Ga0207641_10037790 3300026088 Bacteria 4034
766 Ga0207641_10073211 3300026088 Bacteria 2952
767 Ga0207641_10187360 3300026088 Bacteria 1899
768 Ga0207641_10190701 3300026088 Bacteria 1884
769 Ga0207641_10327420 3300026088 Bacteria 1454
770 Ga0207641_10528307 3300026088 Bacteria 1148
771 Ga0207641_10645251 3300026088 Bacteria 1039
772 Ga0207641_10645404 3300026088 Bacteria 1039
773 Ga0207641_10875001 3300026088 Bacteria 891
774 Ga0207641_11178436 3300026088 Bacteria 765
775 Ga0207641_11297294 3300026088 Unclassified 728
776 Ga0207648_10000135 3300026089 Bacteria 73544
777 Ga0207648_10002076 3300026089 Bacteria 21830
778 Ga0207648_10002692 3300026089 Bacteria 18906
779 Ga0207648_10022256 3300026089 Bacteria 5695
780 Ga0207648_10024314 3300026089 Bacteria 5409
781 Ga0207648_10131297 3300026089 Bacteria 2205
782 Ga0207648_10226783 3300026089 Bacteria 1661
783 Ga0207648_10395884 3300026089 Bacteria 1251
784 Ga0207648_10688005 3300026089 Bacteria 947
785 Ga0207676_10001081 3300026095 Bacteria 20734
786 Ga0207676_10023468 3300026095 Bacteria 4551
787 Ga0207676_10033439 3300026095 Bacteria 3885
788 Ga0207676_10135942 3300026095 Bacteria 2097
789 Ga0207676_10370303 3300026095 Bacteria 1330
790 Ga0207676_10557919 3300026095 Bacteria 1095
791 Ga0207676_10581485 3300026095 Unclassified 1073
792 Ga0207676_11036876 3300026095 Bacteria 809
793 Ga0207674_10005160 3300026116 Bacteria 15570
794 Ga0207674_10020949 3300026116 Bacteria 7052
795 Ga0207674_10271640 3300026116 Bacteria 1643
796 Ga0207674_10886282 3300026116 Bacteria 860
797 Ga0207675_100000825 3300026118 Bacteria 30861
798 Ga0207675_100001481 3300026118 Bacteria 23585
799 Ga0207675_100030548 3300026118 Bacteria 5019
800 Ga0207675_100049669 3300026118 Bacteria 3914
801 Ga0207675_100246345 3300026118 Bacteria 1728
802 Ga0207683_10000163 3300026121 Bacteria 56559
803 Ga0207683_10018834 3300026121 Bacteria 5889
804 Ga0207683_10210623 3300026121 Unclassified 1769
805 Ga0207683_10316195 3300026121 Bacteria 1430
806 Ga0207683_10493307 3300026121 Unclassified 1131
807 Ga0207683_11212527 3300026121 Bacteria 699
808 Ga0207683_11588578 3300026121 Bacteria 603
809 Ga0207683_11639939 3300026121 Bacteria 592
810 Ga0207698_10292042 3300026142 Unclassified 1513
811 Ga0207698_10555351 3300026142 Bacteria 1126
812 Ga0207698_11123279 3300026142 Bacteria 799
813 Ga0207698_11594783 3300026142 Bacteria 668
814 Ga0207698_11952542 3300026142 Bacteria 601
815 Ga0207698_12199339 3300026142 Bacteria 564
816 Ga0207428_10000265 3300027907 Bacteria 70984
817 Ga0268266_10076722 3300028379 Bacteria 2905
818 Ga0268266_10701879 3300028379 Bacteria 975
819 Ga0268266_10838458 3300028379 Bacteria 888
820 Ga0268266_10880035 3300028379 Unclassified 866
821 Ga0268265_10002564 3300028380 Bacteria 13587
822 Ga0268265_10028998 3300028380 Bacteria 3968
823 Ga0268265_10088690 3300028380 Bacteria 2465
824 Ga0268265_10235487 3300028380 Bacteria 1612
825 Ga0268265_12673879 3300028380 Bacteria 504
826 Ga0268264_10001495 3300028381 Bacteria 21802
827 Ga0268264_10001677 3300028381 Bacteria 20404
828 Ga0268264_10013555 3300028381 Bacteria 6711
829 Ga0268264_10097445 3300028381 Bacteria 2549
830 Ga0268264_10142747 3300028381 Bacteria 2137
831 Ga0268264_10156316 3300028381 Bacteria 2050
832 Ga0268264_10457001 3300028381 Unclassified 1238
833 Ga0268264_11337784 3300028381 Unclassified 727
834 Ga0265318_10011670 3300028577 Bacteria 3771
835 Ga0265338_10524241 3300028800 Bacteria 832
836 Ga0265330_10005170 3300031235 Bacteria 6528
837 Ga0265332_10001424 3300031238 Bacteria 13421
838 Ga0265328_10018777 3300031239 Bacteria 2662
839 Ga0265320_10071553 3300031240 Bacteria 1633
840 Ga0265325_10267159 3300031241 Bacteria 770
841 Ga0265329_10005009 3300031242 Bacteria 5415
842 Ga0265331_10002718 3300031250 Bacteria 11780
843 Ga0265316_10248253 3300031344 Bacteria 1307
844 Ga0307408_101363156 3300031548 Unclassified 667
845 Ga0316575_10192934 3300031665 Unclassified 847
846 Ga0265314_10048395 3300031711 Bacteria 2984
847 Ga0265342_10041598 3300031712 Bacteria 2782
848 Ga0307413_10217895 3300031824 Bacteria 1392
849 Ga0307413_10222847 3300031824 Bacteria 1379
850 Ga0307410_10118568 3300031852 Bacteria 1926
851 Ga0307406_12023948 3300031901 Unclassified 515
852 Ga0307412_11004787 3300031911 Bacteria 737
853 Ga0307409_100186990 3300031995 Bacteria 1840
854 Ga0307409_100280813 3300031995 Bacteria 1539
855 Ga0307409_101252414 3300031995 Unclassified 766
856 Ga0307409_101717917 3300031995 Unclassified 656
857 Ga0307416_100051765 3300032002 Bacteria 3283
858 Ga0307416_101496171 3300032002 Bacteria 781
859 Ga0307416_101972498 3300032002 Bacteria 687
860 Ga0307416_102455570 3300032002 Unclassified 620
861 Ga0307416_102769417 3300032002 Bacteria 586
862 Ga0307414_10132306 3300032004 Unclassified 1938
863 Ga0307411_10171222 3300032005 Bacteria 1638
864 Ga0307411_10371349 3300032005 Unclassified 1173
865 Ga0373930_0007926 3300034816 Bacteria 1844
866 Ga0373930_0099426 3300034816 Bacteria 690
867 Ga0373948_0042561 3300034817 Bacteria 954
868 Ga0373950_0028574 3300034818 Bacteria 1022
869 Ga0373950_0158365 3300034818 Bacteria 522
870 Ga0373958_0015958 3300034819 Bacteria 1333
871 Ga0373959_0118750 3300034820 Bacteria 644
872 Ga0373938_0054844 3300034957 Unclassified 919
873 Ga0373926_0162205 3300035083 Unclassified 854
874 Ga0373928_0002493 3300035084 Bacteria 3559
875 Ga0373928_0114553 3300035084 Bacteria 716
876 Ga0373934_0423175 3300035086 Unclassified 557
877 Ga0373940_0001220 3300035088 Bacteria 4541
878 Ga0373940_0329634 3300035088 Bacteria 531
879 Ga0373949_0122159 3300035090 Bacteria 732
880 Ga0373932_0001104 3300035112 Bacteria 7784
881 Ga0373932_0019006 3300035112 Bacteria 1785
882 Ga0373932_0114753 3300035112 Bacteria 892
883 Ga0373932_0295995 3300035112 Bacteria 602
884 Ga0373939_0004301 3300035114 Bacteria 3365
885 Ga0373939_0054909 3300035114 Bacteria 1249
886 Ga0373941_0133510 3300035115 Bacteria 896
887 Ga0373956_0257518 3300035119 Unclassified 830
888 Ga0373960_0211304 3300035121 Bacteria 690
889 Ga0373943_0345476 3300035170 Bacteria 852
890 Ga0373946_0020950 3300035171 Bacteria 2531
891 Ga0373946_0040890 3300035171 Bacteria 1899
892 Ga0373955_0036108 3300035172 Unclassified 2621
893 Ga0373942_0036025 3300035207 Bacteria 1330
894 Ga0373942_0264595 3300035207 Bacteria 588
895 Ga0373961_0041294 3300035241 Bacteria 1332
896 Ga0373961_0106631 3300035241 Bacteria 913
897 Ga0373962_0007140 3300035242 Bacteria 2729
898 Ga0316574_0163483 3300035398 Unclassified 1433
899 Ga0373931_0000878 3300035691 Bacteria 12684
900 Ga0373931_0008612 3300035691 Bacteria 4846
901 Ga0373931_0011830 3300035691 Bacteria 4220
902 Ga0373931_0078380 3300035691 Bacteria 1818
903 Ga0373931_0380789 3300035691 Bacteria 889
904 Ga0373931_0531919 3300035691 Bacteria 762
905 Ga0373931_0848404 3300035691 Unclassified 611
906 Ga0373935_0005977 3300035692 Bacteria 7224
907 Ga0373935_0020268 3300035692 Bacteria 4061
908 Ga0373927_0011316 3300035695 Bacteria 5938
909 Ga0373947_0014750 3300035725 Bacteria 4483
910 Ga0373947_0606926 3300035725 Bacteria 746
911 Ga0373937_2050039 3300036401 Unclassified 518
912 Ga0373925_0013424 3300037068 Bacteria 5928
913 Ga0451795_1585515 3300041456 Bacteria 1013
914 Ga0451798_0299832 3300041458 Unclassified 518
915 Ga0451802_0008001 3300041460 Unclassified 622
916 Ga0451807_0486980 3300041486 Bacteria 622
917 Ga0451807_1113873 3300041486 Unclassified 794
918 Ga0451853_2183455 3300041512 Bacteria 657
919 Ga0451577_0172114 3300042876 Bacteria 1951
920 Ga0453683_0385345 3300044673 Bacteria 903
921 Ga0453683_0908082 3300044673 Bacteria 582
922 Ga0453684_2299142 3300044712 Bacteria 536
923 Ga0451576_0023689 3300045051 Bacteria 6643
924 Ga0451576_0026048 3300045051 Bacteria 6292
925 Ga0451576_0034819 3300045051 Bacteria 5346
926 Ga0451576_0051930 3300045051 Bacteria 4297
927 Ga0451576_0570162 3300045051 Bacteria 1189
928 Ga0451576_0654504 3300045051 Unclassified 1104
929 Ga0451576_0820813 3300045051 Bacteria 976
930 Ga0451576_1520021 3300045051 Bacteria 695
931 Ga0495603_0021636 3300046455 Bacteria 3895
932 Ga0495651_0027875 3300046462 Bacteria 4402
933 Ga0495584_0162552 3300046491 Bacteria 1135
934 Ga0495585_0331887 3300046492 Bacteria 742
935 Ga0495596_0312681 3300046500 Bacteria 611
936 Ga0495608_0406883 3300046511 Bacteria 832
937 Ga0495608_0684582 3300046511 Bacteria 611
938 Ga0495616_0057729 3300046513 Bacteria 1913
939 Ga0495628_0467574 3300046516 Unclassified 914
940 Ga0495630_0637142 3300046517 Unclassified 816
941 Ga0495642_0041824 3300046528 Bacteria 1865
942 Ga0495642_0047751 3300046528 Bacteria 1754
943 Ga0495640_0328729 3300046533 Unclassified 946
944 Ga0495587_0044357 3300046536 Bacteria 2645
945 Ga0495598_0050538 3300046537 Bacteria 1250
946 Ga0495621_0029634 3300046539 Bacteria 1867
947 Ga0495621_0405812 3300046539 Bacteria 578
948 Ga0495634_0342360 3300046642 Unclassified 897
949 Ga0495625_0001454 3300046660 Bacteria 28754
950 Ga0495625_0433072 3300046660 Bacteria 815
951 Ga0495635_0165507 3300046663 Unclassified 1505
952 Ga0495659_0216681 3300046664 Bacteria 789
953 Ga0495658_0035457 3300046683 Bacteria 2745
954 Ga0495669_0009872 3300046684 Bacteria 4033
955 Ga0495669_0389599 3300046684 Unclassified 675
956 Ga0495669_0485045 3300046684 Bacteria 601
957 Ga0495600_0109589 3300046809 Bacteria 1798
958 Ga0495604_0743674 3300047317 Unclassified 621
959 Ga0495636_0262679 3300047318 Bacteria 801
960 Ga0495674_0505184 3300047319 Bacteria 967
961 Ga0495676_0591690 3300047321 Bacteria 723
962 Ga0495680_0998260 3300047322 Unclassified 535
963 Ga0495684_0226424 3300047471 Bacteria 1369
964 Ga0496100_0791207 3300048903 Bacteria 743
965 Ga0496100_1355792 3300048903 Bacteria 561
966 Ga0496102_0097842 3300048905 Bacteria 2722
967 Ga0496102_0511742 3300048905 Bacteria 1123
968 Ga0496103_0072104 3300048906 Bacteria 2163
969 Ga0496106_1560292 3300048909 Bacteria 507
970 Ga0496108_0026673 3300048911 Bacteria 4768
971 Ga0496108_0728311 3300048911 Bacteria 859
972 Ga0496109_0033337 3300048912 Bacteria 4633
973 Ga0496110_0038548 3300048913 Unclassified 4159
974 Ga0496110_0194631 3300048913 Bacteria 1841
975 Ga0496110_0791147 3300048913 Unclassified 853
976 Ga0496110_1434212 3300048913 Bacteria 600
977 Ga0496111_0122281 3300048914 Unclassified 1923
978 Ga0496112_0095981 3300048915 Bacteria 2935
979 Ga0496113_0102260 3300048916 Bacteria 2222
980 Ga0496114_0066291 3300048917 Bacteria 3027
981 Ga0496114_0620186 3300048917 Bacteria 953
982 Ga0496115_0368436 3300048918 Bacteria 1170
983 Ga0496115_0514833 3300048918 Bacteria 960
984 Ga0496122_0158443 3300048925 Bacteria 1385
985 Ga0495678_021754 3300049459 Bacteria 2818
986 Ga0501296_048620 3300049519 Bacteria 616
987 Ga0501031_0380550 3300049568 Bacteria 913
988 Ga0501033_0717608 3300049570 Bacteria 679
989 Ga0501036_0357026 3300049572 Bacteria 1220
990 Ga0501037_0235369 3300049573 Bacteria 1285
991 Ga0501038_0039088 3300049574 Bacteria 4152
992 Ga0501039_0006938 3300049575 Bacteria 8621
993 Ga0501040_0034834 3300049576 Bacteria 3411
994 Ga0501041_0109527 3300049577 Bacteria 1713
995 Ga0501042_0043302 3300049578 Bacteria 3205
996 Ga0501046_1020934 3300049580 Bacteria 573
997 Ga0501048_0055237 3300049582 Bacteria 2820
998 Ga0501048_0352878 3300049582 Bacteria 1049
999 Ga0501067_0262088 3300049583 Bacteria 962
1000 Ga0501069_1015017 3300049585 Bacteria 507
1001 Ga0501071_0057591 3300049587 Bacteria 2809
1002 Ga0501071_0084432 3300049587 Bacteria 2327
1003 Ga0501072_0020342 3300049588 Bacteria 5142
1004 Ga0501074_0035118 3300049590 Bacteria 3633
1005 Ga0501074_0985219 3300049590 Bacteria 593
1006 Ga0501075_0015553 3300049591 Bacteria 5460
1007 Ga0501075_0073707 3300049591 Bacteria 2582
1008 Ga0501075_0222954 3300049591 Bacteria 1438
1009 Ga0501076_0020834 3300049592 Bacteria 5021
1010 Ga0501198_127473 3300049649 Bacteria 542
1011 Ga0501079_0130933 3300049741 Bacteria 1952
1012 Ga0501079_0696819 3300049741 Bacteria 799
1013 Ga0501080_0083912 3300049742 Bacteria 2960
1014 Ga0501081_0016602 3300049743 Bacteria 4869
1015 Ga0501081_0265110 3300049743 Bacteria 1256
1016 Ga0501083_0075548 3300049744 Bacteria 2238
1017 Ga0501035_0078353 3300049822 Bacteria 2920
1018 Ga0501045_0011088 3300049824 Bacteria 6316
1019 nmdc:mga0k408_1328_c1 3300050493 Bacteria 5943
1020 nmdc:mga05p37_130869_c1 3300050507 Bacteria 3078
1021 nmdc:mga05p37_834_c1 3300050507 Bacteria 34530
1022 nmdc:mga09592_13051_c1 3300050508 Bacteria 6782
1023 nmdc:mga09592_1514594_c1 3300050508 Bacteria 545
1024 nmdc:mga09592_335308_c1 3300050508 Bacteria 1309
1025 nmdc:mga0qj67_58889_c1 3300050509 Bacteria 3046
1026 nmdc:mga06r32_151512_c1 3300050510 Bacteria 1161
1027 nmdc:mga06r32_29306_c1 3300050510 Bacteria 5157
1028 nmdc:mga08y16_383271_c1 3300050511 Bacteria 1441
1029 nmdc:mga08y16_645_c1 3300050511 Bacteria 32765
1030 nmdc:mga0n895_131253_c1 3300050512 Bacteria 2530
1031 nmdc:mga0n895_1585733_c1 3300050512 Bacteria 619
1032 nmdc:mga0n895_381076_c1 3300050512 Bacteria 1427
1033 nmdc:mga0n895_759572_c1 3300050512 Bacteria 962
1034 nmdc:mga0rr50_158351_c1 3300050513 Bacteria 1836
1035 nmdc:mga0rr50_61591_c1 3300050513 Bacteria 2827
1036 nmdc:mga08x19_118249_c1 3300050514 Bacteria 1774
1037 nmdc:mga08x19_74342_c1 3300050514 Bacteria 2220
1038 nmdc:mga08x19_777023_c1 3300050514 Bacteria 680
1039 nmdc:mga08x19_84539_c1 3300050514 Bacteria 2087
1040 nmdc:mga0a205_1174879_c1 3300050515 Bacteria 615
1041 Ga0495601_0664440 3300053077 Bacteria 666
1042 Ga0495612_0020407 3300053078 Bacteria 2656
1043 Ga0495619_0240798 3300053085 Unclassified 1254
1044 Ga0501084_0017901 3300054114 Bacteria 5899
1045 Ga0501084_0397330 3300054114 Bacteria 1165
1046 Ga0501082_0006065 3300060353 Bacteria 10493
1047 Ga0530510_0057372 3300061734 Bacteria 2813
1048 Ga0530510_0259464 3300061734 Bacteria 1296
1049 Ga0530510_0637569 3300061734 Bacteria 811
1050 Ga0530510_1193665 3300061734 Bacteria 583
1051 Ga0436365_0491768
1052 JGI24749J21850_1036463
1053 JGI24034J26672_10016662
1054 JGI24034J26672_10017609
1055 JGI25406J46586_10044898
1056 rootL2_10111629
1057 rootL2_10246789
1058 rootH1_10357398
1059 Ga0065712_10195423
1060 Ga0065712_10233644
1061 Ga0065712_10796922
1062 Ga0065715_10012019
1063 Ga0065715_10243522
1064 Ga0065707_10154639
1065 Ga0065707_10886342
1066 Ga0070658_11410741
1067 Ga0070676_10022339
1068 Ga0070676_10073915
1069 Ga0070676_10095884
1070 Ga0070676_10726990
1071 Ga0070676_11159719
1072 Ga0070676_11308480
1073 Ga0070676_11493966
1074 Ga0070690_100001184
1075 Ga0070690_100010547
1076 Ga0070690_100022322
1077 Ga0070690_100593266
1078 Ga0070690_100612508
1079 Ga0070690_100782708
1080 Ga0070670_100011863
1081 Ga0070670_100022231
1082 Ga0070670_100047776
1083 Ga0070670_100215649
1084 Ga0070670_100218488
1085 Ga0070670_100311492
1086 Ga0070670_100374241
1087 Ga0070670_101146021
1088 Ga0070670_101156192
1089 Ga0070670_101851297
1090 Ga0070677_10011248
1091 Ga0070677_10031083
1092 Ga0070677_10046625
1093 Ga0070677_10145655
1094 Ga0070677_10332901
1095 Ga0068869_100000600
1096 Ga0068869_100012758
1097 Ga0068869_100227284
1098 Ga0070666_10004080
1099 Ga0070666_10215072
1100 Ga0070666_10310449
1101 Ga0070666_10670542
1102 Ga0070666_10706722
1103 Ga0070666_10962730
1104 Ga0070680_100000089
1105 Ga0070680_101752842
1106 Ga0070682_100002252
1107 Ga0070682_101120199
1108 Ga0070682_101661337
1109 Ga0068868_100002798
1110 Ga0068868_100031616
1111 Ga0068868_100073751
1112 Ga0068868_100078053
1113 Ga0068868_100461730
1114 Ga0068868_100546755
1115 Ga0068868_101081859
1116 Ga0070660_100487712
1117 Ga0070689_100004821
1118 Ga0070689_100056001
1119 Ga0070689_100395525
1120 Ga0070689_101274043
1121 Ga0070689_101789345
1122 Ga0070691_10000090
1123 Ga0070687_100002477
1124 Ga0070687_100187829
1125 Ga0070661_100625415
1126 Ga0070692_10011321
1127 Ga0070692_10014339
1128 Ga0070668_100004105
1129 Ga0070668_100005712
1130 Ga0070668_100067830
1131 Ga0070668_100074755
1132 Ga0070668_100215784
1133 Ga0070668_100319357
1134 Ga0070668_100883841
1135 Ga0070668_101053266
1136 Ga0070668_101928603
1137 Ga0070669_100043440
1138 Ga0070669_100054195
1139 Ga0070669_100135994
1140 Ga0070669_100180667
1141 Ga0070669_100276669
1142 Ga0070669_100287893
1143 Ga0070669_100460689
1144 Ga0070669_100658643
1145 Ga0070669_100716593
1146 Ga0070669_100740128
1147 Ga0070669_100973304
1148 Ga0070669_101400751
1149 Ga0070675_100008280
1150 Ga0070675_100024981
1151 Ga0070675_100052902
1152 Ga0070675_100098096
1153 Ga0070675_100143294
1154 Ga0070675_100155173
1155 Ga0070675_100214228
1156 Ga0070675_100402674
1157 Ga0070675_100831685
1158 Ga0070675_101664968
1159 Ga0070671_100057949
1160 Ga0070671_100066539
1161 Ga0070671_100106278
1162 Ga0070671_100388250
1163 Ga0070671_100474358
1164 Ga0070671_100629704
1165 Ga0070674_100037897
1166 Ga0070674_100076671
1167 Ga0070674_100712306
1168 Ga0070674_100819534
1169 Ga0070673_100027683
1170 Ga0070673_100028828
1171 Ga0070673_100124507
1172 Ga0070673_100142888
1173 Ga0070673_100189698
1174 Ga0070673_100295353
1175 Ga0070673_100472988
1176 Ga0070673_101359730
1177 Ga0070688_100030869
1178 Ga0070688_100047067
1179 Ga0070688_100097321
1180 Ga0070688_100152344
1181 Ga0070688_100733112
1182 Ga0070659_100040234
1183 Ga0070659_100553758
1184 Ga0070659_100633172
1185 Ga0070667_100003984
1186 Ga0070667_100016589
1187 Ga0070667_100115402
1188 Ga0070667_100153432
1189 Ga0070667_100294783
1190 Ga0070667_100420228
1191 Ga0070667_100506384
1192 Ga0070667_100585281
1193 Ga0070667_100613290
1194 Ga0070667_100932435
1195 Ga0070667_101932763
1196 Ga0070703_10105839
1197 Ga0070709_10023745
1198 Ga0070709_10077065
1199 Ga0070709_10139272
1200 Ga0070709_10167927
1201 Ga0070714_100032603
1202 Ga0070714_101846026
1203 Ga0070713_100000609
1204 Ga0070713_100005755
1205 Ga0070710_10106108
1206 Ga0070701_10003274
1207 Ga0070701_10110800
1208 Ga0070701_10152765
1209 Ga0070701_10454319
1210 Ga0070711_100301861
1211 Ga0070705_100000867
1212 Ga0070705_100017068
1213 Ga0070705_100283961
1214 Ga0070705_100365593
1215 Ga0070700_100021237
1216 Ga0070700_100127943
1217 Ga0070700_100227630
1218 Ga0070694_100002010
1219 Ga0070694_100264959
1220 Ga0070708_100286995
1221 Ga0070708_101050018
1222 Ga0070708_101251063
1223 Ga0070708_101301893
1224 Ga0070663_100070492
1225 Ga0070663_100334476
1226 Ga0070663_100506735
1227 Ga0070663_101728094
1228 Ga0070678_100006574
1229 Ga0070678_100045450
1230 Ga0070678_100127818
1231 Ga0070678_100248602
1232 Ga0070662_100780299
1233 Ga0068867_100001413
1234 Ga0068867_100003822
1235 Ga0068867_100015183
1236 Ga0068867_100057720
1237 Ga0068867_100075133
1238 Ga0068867_100131535
1239 Ga0068867_100339936
1240 Ga0068867_100375249
1241 Ga0068867_101129198
1242 Ga0070685_10056226
1243 Ga0070685_10066779
1244 Ga0070706_100078396
1245 Ga0070706_100190690
1246 Ga0070707_100029147
1247 Ga0070707_100046212
1248 Ga0070707_100081190
1249 Ga0070707_100544615
1250 Ga0070698_100788988
1251 Ga0070698_100860841
1252 Ga0070699_100032855
1253 Ga0070699_100034816
1254 Ga0070699_100082325
1255 Ga0070679_100014304
1256 Ga0070684_100009154
1257 Ga0070684_101407123
1258 Ga0070697_100003333
1259 Ga0070697_100148578
1260 Ga0070697_100504909
1261 Ga0070697_101063053
1262 Ga0068853_100007854
1263 Ga0068853_100183149
1264 Ga0068853_100373928
1265 Ga0068853_100538826
1266 Ga0068853_102313137
1267 Ga0070672_100005616
1268 Ga0070672_100069542
1269 Ga0070672_100261520
1270 Ga0070672_100332735
1271 Ga0070672_100351553
1272 Ga0070672_100423407
1273 Ga0070672_100826033
1274 Ga0070672_101093561
1275 Ga0070672_101814947
1276 Ga0070686_100001706
1277 Ga0070686_100060453
1278 Ga0070686_100253212
1279 Ga0070686_101523439
1280 Ga0070695_100001399
1281 Ga0070695_100001729
1282 Ga0070695_100982778
1283 Ga0070696_100000958
1284 Ga0070696_100007091
1285 Ga0070696_100257710
1286 Ga0070696_100259181
1287 Ga0070693_100000477
1288 Ga0070693_100289224
1289 Ga0070693_100689677
1290 Ga0070665_100005380
1291 Ga0070665_100150076
1292 Ga0070665_100433683
1293 Ga0070665_100771712
1294 Ga0070665_101068352
1295 Ga0070704_100001643
1296 Ga0070704_100082335
1297 Ga0070704_100258629
1298 Ga0070704_100563303
1299 Ga0068855_100007998
1300 Ga0068855_100256114
1301 Ga0070664_100016535
1302 Ga0070664_100043132
1303 Ga0070664_100056637
1304 Ga0070664_100184945
1305 Ga0070664_100318122
1306 Ga0070664_100990386
1307 Ga0070664_101551716
1308 Ga0068857_100069366
1309 Ga0068857_100269749
1310 Ga0068857_101346692
1311 Ga0068854_100003287
1312 Ga0068856_100072248
1313 Ga0070702_100000452
1314 Ga0070702_100107339
1315 Ga0070702_100281550
1316 Ga0070702_100835110
1317 Ga0070702_101129607
1318 Ga0068852_100119362
1319 Ga0068852_100183264
1320 Ga0068852_100335141
1321 Ga0068852_100377495
1322 Ga0068852_100925982
1323 Ga0068859_100000190
1324 Ga0068859_100009178
1325 Ga0068859_100039128
1326 Ga0068859_100195615
1327 Ga0068859_100326018
1328 Ga0068859_100806080
1329 Ga0068859_101027147
1330 Ga0068859_101942813
1331 Ga0068859_102968084
1332 Ga0068864_100015339
1333 Ga0068864_100207723
1334 Ga0068864_100255533
1335 Ga0068864_100333204
1336 Ga0068864_100468324
1337 Ga0068864_100853144
1338 Ga0068864_100941276
1339 Ga0068864_101659816
1340 Ga0068866_10013277
1341 Ga0068866_10060977
1342 Ga0068866_11043093
1343 Ga0068861_100001570
1344 Ga0068861_100004155
1345 Ga0068861_100205533
1346 Ga0068861_100583106
1347 Ga0068861_100654952
1348 Ga0068861_100794948
1349 Ga0068851_10316091
1350 Ga0068870_10011843
1351 Ga0068870_10080999
1352 Ga0068870_10083921
1353 Ga0068870_10199939
1354 Ga0068870_10345380
1355 Ga0068863_100047447
1356 Ga0068863_100089211
1357 Ga0068863_100126391
1358 Ga0068863_100129415
1359 Ga0068863_100159296
1360 Ga0068863_100237343
1361 Ga0068863_100390701
1362 Ga0068863_100572274
1363 Ga0068863_100575234
1364 Ga0068863_100583216
1365 Ga0068863_100625600
1366 Ga0068863_100639191
1367 Ga0068863_101021452
1368 Ga0068863_101381408
1369 Ga0068863_101891916
1370 Ga0068863_102212844
1371 Ga0068858_100005045
1372 Ga0068858_100008322
1373 Ga0068858_100018606
1374 Ga0068858_100130753
1375 Ga0068858_100154382
1376 Ga0068858_100164927
1377 Ga0068858_100541139
1378 Ga0068858_101015513
1379 Ga0068858_101214864
1380 Ga0068860_100005089
1381 Ga0068860_100042047
1382 Ga0068860_100056913
1383 Ga0068860_100120996
1384 Ga0068860_100153217
1385 Ga0068860_100231048
1386 Ga0068860_100266466
1387 Ga0068860_100383022
1388 Ga0068860_100845569
1389 Ga0068862_100003474
1390 Ga0068862_100027707
1391 Ga0068862_100121076
1392 Ga0068862_100198006
1393 Ga0081455_10250061
1394 Ga0081539_10000686
1395 Ga0070717_10238946
1396 Ga0070717_10577561
1397 Ga0070716_100240727
1398 Ga0070716_100640890
1399 Ga0070716_100652919
1400 Ga0070712_100081195
1401 Ga0070712_100221213
1402 Ga0097621_100004855
1403 Ga0097621_100008477
1404 Ga0097621_100125674
1405 Ga0097621_100127291
1406 Ga0097621_100142265
1407 Ga0097621_100187440
1408 Ga0097621_100370550
1409 Ga0097621_100401283
1410 Ga0097621_100412700
1411 Ga0097621_100451718
1412 Ga0097621_100756758
1413 Ga0097621_101075977
1414 Ga0097621_101378620
1415 Ga0068871_100000744
1416 Ga0068871_100064948
1417 Ga0068871_100134028
1418 Ga0068871_100461070
1419 Ga0068871_101854662
1420 Ga0075428_100001109
1421 Ga0075430_100000805
1422 Ga0075431_100109392
1423 Ga0075431_100975572
1424 Ga0075433_10595527
1425 Ga0075433_11261151
1426 Ga0075434_100334076
1427 Ga0075434_100755870
1428 Ga0075434_102609978
1429 Ga0075429_100000103
1430 Ga0075429_100378132
1431 Ga0068865_100001413
1432 Ga0068865_100088783
1433 Ga0068865_100260281
1434 Ga0068865_100290969
1435 Ga0068865_100299438
1436 Ga0075436_100016128
1437 Ga0075436_100016906
1438 Ga0075436_100019590
1439 Ga0097620_100000190
1440 Ga0097620_100009178
1441 Ga0097620_100039127
1442 Ga0097620_100195605
1443 Ga0097620_100326008
1444 Ga0097620_100806104
1445 Ga0097620_101027172
1446 Ga0097620_101942836
1447 Ga0097620_102968045
1448 Ga0075435_100025369
1449 Ga0075435_100072503
1450 Ga0105250_10009045
1451 Ga0105250_10131302
1452 Ga0105240_10044211
1453 Ga0105240_10663855
1454 Ga0111539_10078831
1455 Ga0105245_10003518
1456 Ga0105245_10004048
1457 Ga0105245_10526897
1458 Ga0105247_10077658
1459 Ga0105247_10193005
1460 Ga0105247_10282093
1461 Ga0114129_10002499
1462 Ga0114129_10382051
1463 Ga0114129_10512906
1464 Ga0105243_10003728
1465 Ga0105243_10023277
1466 Ga0105243_10200197
1467 Ga0105243_10207722
1468 Ga0105243_10560885
1469 Ga0105243_10952378
1470 Ga0105243_11302351
1471 Ga0105241_10020295
1472 Ga0105241_10100532
1473 Ga0105242_10001851
1474 Ga0105242_10041737
1475 Ga0105242_11246144
1476 Ga0105248_10008315
1477 Ga0105248_10029077
1478 Ga0105248_10068152
1479 Ga0105248_10289186
1480 Ga0105248_10540409
1481 Ga0105248_11010071
1482 Ga0105248_11041265
1483 Ga0105248_11228805
1484 Ga0105248_11326657
1485 Ga0105248_11513191
1486 Ga0105237_10003465
1487 Ga0105237_10239783
1488 Ga0105238_12007506
1489 Ga0105249_10000917
1490 Ga0105249_10778780
1491 Ga0105249_10802680
1492 Ga0105249_11041944
1493 Ga0105249_11916517
1494 Ga0105249_12366527
1495 Ga0099796_10326047
1496 Ga0105239_10048833
1497 Ga0105246_10035899
1498 Ga0105246_11204264
1499 Ga0105246_11683566
1500 Ga0157341_1038870
1501 Ga0157373_10067391
1502 Ga0157371_10005188
1503 Ga0157371_10102818
1504 Ga0157371_11395335
1505 Ga0157370_10023742
1506 Ga0157370_10041847
1507 Ga0157374_10116997
1508 Ga0157374_10218057
1509 Ga0157374_10251570
1510 Ga0157374_10681879
1511 Ga0157374_11683367
1512 Ga0157374_11984709
1513 Ga0157374_12562375
1514 Ga0157378_10004976
1515 Ga0157378_10040155
1516 Ga0157378_10052967
1517 Ga0157378_10102680
1518 Ga0157378_10548683
1519 Ga0157378_10744002
1520 Ga0157378_10885917
1521 Ga0157378_10984511
1522 Ga0157378_11309044
1523 Ga0163162_10025974
1524 Ga0163162_10035941
1525 Ga0163162_10037746
1526 Ga0163162_10141918
1527 Ga0163162_10190991
1528 Ga0163162_10200319
1529 Ga0163162_10259810
1530 Ga0163162_10290875
1531 Ga0163162_10416177
1532 Ga0163162_10421530
1533 Ga0163162_10606040
1534 Ga0163162_11045492
1535 Ga0163162_11379633
1536 Ga0163162_12349403
1537 Ga0163162_12386271
1538 Ga0157372_11674775
1539 Ga0157375_10005914
1540 Ga0157375_10050023
1541 Ga0157375_10059092
1542 Ga0157375_10095810
1543 Ga0157375_10128543
1544 Ga0157375_10152888
1545 Ga0157375_10276605
1546 Ga0157375_10349458
1547 Ga0157375_10885994
1548 Ga0157375_11094998
1549 Ga0157375_11323570
1550 Ga0157375_11667325
1551 Ga0163163_10002834
1552 Ga0163163_10007819
1553 Ga0163163_10028667
1554 Ga0163163_10042799
1555 Ga0163163_10060600
1556 Ga0163163_11387580
1557 Ga0157380_10037401
1558 Ga0157380_10051207
1559 Ga0157380_10119222
1560 Ga0157380_10214098
1561 Ga0157380_10216221
1562 Ga0157380_10723513
1563 Ga0157380_11405446
1564 Ga0157377_10084809
1565 Ga0157377_10486770
1566 Ga0157377_11215065
1567 Ga0157379_10009832
1568 Ga0157379_10042927
1569 Ga0157379_10043738
1570 Ga0157379_10118398
1571 Ga0157379_10154814
1572 Ga0157379_10156711
1573 Ga0157379_10213384
1574 Ga0157379_10671625
1575 Ga0157379_11196565
1576 Ga0157379_12053084
1577 Ga0157376_10010610
1578 Ga0157376_10023748
1579 Ga0157376_10028030
1580 Ga0157376_10102555
1581 Ga0157376_10168618
1582 Ga0157376_10265467
1583 Ga0157376_10300936
1584 Ga0157376_10739573
1585 Ga0157376_10945248
1586 Ga0157376_11503419
1587 Ga0163161_10045046
1588 Ga0163161_10060020
1589 Ga0163161_10070462
1590 Ga0163161_10087974
1591 Ga0163161_10113064
1592 Ga0163161_11597823
1593 Ga0206356_10202351
1594 Ga0209147_100142
1595 Ga0209257_1000005
1596 Ga0207697_10041261
1597 Ga0207697_10113027
1598 Ga0207697_10539182
1599 Ga0207656_10514288
1600 Ga0207696_1094178
1601 Ga0207655_1009036
1602 Ga0207713_1007325
1603 Ga0207653_10029926
1604 Ga0207682_10001787
1605 Ga0207682_10015683
1606 Ga0207682_10150491
1607 Ga0207682_10155618
1608 Ga0207682_10476560
1609 Ga0207692_10121074
1610 Ga0207642_10001241
1611 Ga0207642_10007559
1612 Ga0207642_10015283
1613 Ga0207642_10716940
1614 Ga0207710_10077112
1615 Ga0207688_10007284
1616 Ga0207688_10010878
1617 Ga0207688_10029187
1618 Ga0207680_10084536
1619 Ga0207680_10084573
1620 Ga0207680_10093729
1621 Ga0207680_10692057
1622 Ga0207647_10755127
1623 Ga0207699_10030705
1624 Ga0207699_10101030
1625 Ga0207645_10037393
1626 Ga0207645_10097575
1627 Ga0207645_10151234
1628 Ga0207645_10722402
1629 Ga0207643_10011925
1630 Ga0207643_10027841
1631 Ga0207643_10107948
1632 Ga0207643_10442945
1633 Ga0207684_10013275
1634 Ga0207684_10093025
1635 Ga0207654_10007036
1636 Ga0207654_10018726
1637 Ga0207654_10738514
1638 Ga0207707_10030085
1639 Ga0207695_11474181
1640 Ga0207671_10001288
1641 Ga0207671_11052305
1642 Ga0207693_10202177
1643 Ga0207693_10321910
1644 Ga0207663_10173889
1645 Ga0207663_10805862
1646 Ga0207660_10002436
1647 Ga0207662_10005001
1648 Ga0207662_10169346
1649 Ga0207649_10173416
1650 Ga0207652_10336042
1651 Ga0207646_10004138
1652 Ga0207646_10073225
1653 Ga0207681_10009819
1654 Ga0207681_10011021
1655 Ga0207681_10259552
1656 Ga0207681_10334942
1657 Ga0207681_10727512
1658 Ga0207681_10806108
1659 Ga0207681_11622056
1660 Ga0207650_10006811
1661 Ga0207650_10042084
1662 Ga0207650_10061115
1663 Ga0207650_10109708
1664 Ga0207650_10226483
1665 Ga0207650_10395876
1666 Ga0207650_10769109
1667 Ga0207650_11709819
1668 Ga0207659_10007017
1669 Ga0207659_10020731
1670 Ga0207659_10023971
1671 Ga0207659_10024612
1672 Ga0207659_10128179
1673 Ga0207659_10140709
1674 Ga0207659_10153947
1675 Ga0207659_10330453
1676 Ga0207659_10439491
1677 Ga0207687_10001873
1678 Ga0207687_10004970
1679 Ga0207700_10000197
1680 Ga0207700_10009482
1681 Ga0207664_10002031
1682 Ga0207664_11487243
1683 Ga0207664_11864044
1684 Ga0207644_10015052
1685 Ga0207644_10035865
1686 Ga0207644_10041677
1687 Ga0207644_10077680
1688 Ga0207644_10136270
1689 Ga0207644_10328818
1690 Ga0207644_10417958
1691 Ga0207690_10022173
1692 Ga0207690_10039029
1693 Ga0207690_10521447
1694 Ga0207690_10681917
1695 Ga0207706_10003530
1696 Ga0207706_10454228
1697 Ga0207706_11448173
1698 Ga0207686_10000992
1699 Ga0207686_10344481
1700 Ga0207686_10399732
1701 Ga0207686_10596510
1702 Ga0207686_11494067
1703 Ga0207709_10001315
1704 Ga0207709_10106927
1705 Ga0207709_10454353
1706 Ga0207709_10573166
1707 Ga0207709_11824076
1708 Ga0207670_10001450
1709 Ga0207670_10051120
1710 Ga0207670_10110472
1711 Ga0207670_10349229
1712 Ga0207669_10110430
1713 Ga0207669_10161170
1714 Ga0207669_10359486
1715 Ga0207669_10409575
1716 Ga0207704_10000483
1717 Ga0207704_10057467
1718 Ga0207704_10139554
1719 Ga0207704_10365862
1720 Ga0207704_10604942
1721 Ga0207691_10002471
1722 Ga0207691_10024141
1723 Ga0207691_10025390
1724 Ga0207691_10102574
1725 Ga0207691_10130855
1726 Ga0207691_10213818
1727 Ga0207691_10276029
1728 Ga0207691_10276150
1729 Ga0207691_10451219
1730 Ga0207711_10002471
1731 Ga0207711_10053510
1732 Ga0207711_10147640
1733 Ga0207711_10422889
1734 Ga0207711_10687509
1735 Ga0207689_10000007
1736 Ga0207689_10000402
1737 Ga0207689_10041700
1738 Ga0207689_10299756
1739 Ga0207689_11313300
1740 Ga0207689_11715741
1741 Ga0207661_10233259
1742 Ga0207661_10355745
1743 Ga0207661_10444549
1744 Ga0207679_10002477
1745 Ga0207679_10045557
1746 Ga0207679_10064759
1747 Ga0207679_10581508
1748 Ga0207679_11003048
1749 Ga0207667_10008307
1750 Ga0207651_10049003
1751 Ga0207651_10085936
1752 Ga0207651_10116430
1753 Ga0207651_10214969
1754 Ga0207651_10428658
1755 Ga0207651_10605546
1756 Ga0207651_11925774
1757 Ga0207712_10007660
1758 Ga0207712_10535703
1759 Ga0207712_11659644
1760 Ga0207668_10009057
1761 Ga0207668_10017897
1762 Ga0207668_10028643
1763 Ga0207668_10037659
1764 Ga0207668_10061412
1765 Ga0207668_10197505
1766 Ga0207668_10529079
1767 Ga0207668_10668724
1768 Ga0207668_10741515
1769 Ga0207640_11510218
1770 Ga0207658_10027934
1771 Ga0207658_10044943
1772 Ga0207658_10145343
1773 Ga0207658_10226963
1774 Ga0207658_10262983
1775 Ga0207658_10272047
1776 Ga0207658_10475250
1777 Ga0207658_10575769
1778 Ga0207658_10587577
1779 Ga0207658_11092603
1780 Ga0207658_11716078
1781 Ga0207658_12088257
1782 Ga0207677_10006914
1783 Ga0207677_10018064
1784 Ga0207677_10033011
1785 Ga0207677_10033449
1786 Ga0207677_10331842
1787 Ga0207677_10755519
1788 Ga0207677_11375950
1789 Ga0207677_11450973
1790 Ga0207703_10016221
1791 Ga0207703_10016296
1792 Ga0207703_10053366
1793 Ga0207703_10163421
1794 Ga0207703_10404915
1795 Ga0207703_10999521
1796 Ga0207703_11537991
1797 Ga0207703_11627494
1798 Ga0207703_11639261
1799 Ga0207639_10016924
1800 Ga0207639_10142523
1801 Ga0207639_10289172
1802 Ga0207639_10443295
1803 Ga0207678_10061284
1804 Ga0207678_10098237
1805 Ga0207678_10142881
1806 Ga0207678_10525420
1807 Ga0207678_10860982
1808 Ga0207708_10004704
1809 Ga0207708_10024916
1810 Ga0207708_10037898
1811 Ga0207708_10458523
1812 Ga0207702_10271663
1813 Ga0207641_10007979
1814 Ga0207641_10026607
1815 Ga0207641_10037790
1816 Ga0207641_10073211
1817 Ga0207641_10187360
1818 Ga0207641_10190701
1819 Ga0207641_10327420
1820 Ga0207641_10528307
1821 Ga0207641_10645251
1822 Ga0207641_10645404
1823 Ga0207641_10875001
1824 Ga0207641_11178436
1825 Ga0207641_11297294
1826 Ga0207648_10000135
1827 Ga0207648_10002076
1828 Ga0207648_10002692
1829 Ga0207648_10022256
1830 Ga0207648_10024314
1831 Ga0207648_10131297
1832 Ga0207648_10226783
1833 Ga0207648_10395884
1834 Ga0207648_10688005
1835 Ga0207676_10001081
1836 Ga0207676_10023468
1837 Ga0207676_10033439
1838 Ga0207676_10135942
1839 Ga0207676_10370303
1840 Ga0207676_10557919
1841 Ga0207676_10581485
1842 Ga0207676_11036876
1843 Ga0207674_10005160
1844 Ga0207674_10020949
1845 Ga0207674_10271640
1846 Ga0207674_10886282
1847 Ga0207675_100000825
1848 Ga0207675_100001481
1849 Ga0207675_100030548
1850 Ga0207675_100049669
1851 Ga0207675_100246345
1852 Ga0207683_10000163
1853 Ga0207683_10018834
1854 Ga0207683_10210623
1855 Ga0207683_10316195
1856 Ga0207683_10493307
1857 Ga0207683_11212527
1858 Ga0207683_11588578
1859 Ga0207683_11639939
1860 Ga0207698_10292042
1861 Ga0207698_10555351
1862 Ga0207698_11123279
1863 Ga0207698_11594783
1864 Ga0207698_11952542
1865 Ga0207698_12199339
1866 Ga0207428_10000265
1867 Ga0268266_10076722
1868 Ga0268266_10701879
1869 Ga0268266_10838458
1870 Ga0268266_10880035
1871 Ga0268265_10002564
1872 Ga0268265_10028998
1873 Ga0268265_10088690
1874 Ga0268265_10235487
1875 Ga0268265_12673879
1876 Ga0268264_10001495
1877 Ga0268264_10001677
1878 Ga0268264_10013555
1879 Ga0268264_10097445
1880 Ga0268264_10142747
1881 Ga0268264_10156316
1882 Ga0268264_10457001
1883 Ga0268264_11337784
1884 Ga0265318_10011670
1885 Ga0265338_10524241
1886 Ga0265330_10005170
1887 Ga0265332_10001424
1888 Ga0265328_10018777
1889 Ga0265320_10071553
1890 Ga0265325_10267159
1891 Ga0265329_10005009
1892 Ga0265331_10002718
1893 Ga0265316_10248253
1894 Ga0307408_101363156
1895 Ga0316575_10192934
1896 Ga0265314_10048395
1897 Ga0265342_10041598
1898 Ga0307413_10217895
1899 Ga0307413_10222847
1900 Ga0307410_10118568
1901 Ga0307406_12023948
1902 Ga0307412_11004787
1903 Ga0307409_100186990
1904 Ga0307409_100280813
1905 Ga0307409_101252414
1906 Ga0307409_101717917
1907 Ga0307416_100051765
1908 Ga0307416_101496171
1909 Ga0307416_101972498
1910 Ga0307416_102455570
1911 Ga0307416_102769417
1912 Ga0307414_10132306
1913 Ga0307411_10171222
1914 Ga0307411_10371349
1915 Ga0373930_0007926
1916 Ga0373930_0099426
1917 Ga0373948_0042561
1918 Ga0373950_0028574
1919 Ga0373950_0158365
1920 Ga0373958_0015958
1921 Ga0373959_0118750
1922 Ga0373938_0054844
1923 Ga0373926_0162205
1924 Ga0373928_0002493
1925 Ga0373928_0114553
1926 Ga0373934_0423175
1927 Ga0373940_0001220
1928 Ga0373940_0329634
1929 Ga0373949_0122159
1930 Ga0373932_0001104
1931 Ga0373932_0019006
1932 Ga0373932_0114753
1933 Ga0373932_0295995
1934 Ga0373939_0004301
1935 Ga0373939_0054909
1936 Ga0373941_0133510
1937 Ga0373956_0257518
1938 Ga0373960_0211304
1939 Ga0373943_0345476
1940 Ga0373946_0020950
1941 Ga0373946_0040890
1942 Ga0373955_0036108
1943 Ga0373942_0036025
1944 Ga0373942_0264595
1945 Ga0373961_0041294
1946 Ga0373961_0106631
1947 Ga0373962_0007140
1948 Ga0316574_0163483
1949 Ga0373931_0000878
1950 Ga0373931_0008612
1951 Ga0373931_0011830
1952 Ga0373931_0078380
1953 Ga0373931_0380789
1954 Ga0373931_0531919
1955 Ga0373931_0848404
1956 Ga0373935_0005977
1957 Ga0373935_0020268
1958 Ga0373927_0011316
1959 Ga0373947_0014750
1960 Ga0373947_0606926
1961 Ga0373937_2050039
1962 Ga0373925_0013424
1963 Ga0451795_1585515
1964 Ga0451798_0299832
1965 Ga0451802_0008001
1966 Ga0451807_0486980
1967 Ga0451807_1113873
1968 Ga0451853_2183455
1969 Ga0451577_0172114
1970 Ga0453683_0385345
1971 Ga0453683_0908082
1972 Ga0453684_2299142
1973 Ga0451576_0023689
1974 Ga0451576_0026048
1975 Ga0451576_0034819
1976 Ga0451576_0051930
1977 Ga0451576_0570162
1978 Ga0451576_0654504
1979 Ga0451576_0820813
1980 Ga0451576_1520021
1981 Ga0495603_0021636
1982 Ga0495651_0027875
1983 Ga0495584_0162552
1984 Ga0495585_0331887
1985 Ga0495596_0312681
1986 Ga0495608_0406883
1987 Ga0495608_0684582
1988 Ga0495616_0057729
1989 Ga0495628_0467574
1990 Ga0495630_0637142
1991 Ga0495642_0041824
1992 Ga0495642_0047751
1993 Ga0495640_0328729
1994 Ga0495587_0044357
1995 Ga0495598_0050538
1996 Ga0495621_0029634
1997 Ga0495621_0405812
1998 Ga0495634_0342360
1999 Ga0495625_0001454
2000 Ga0495625_0433072
2001 Ga0495635_0165507
2002 Ga0495659_0216681
2003 Ga0495658_0035457
2004 Ga0495669_0009872
2005 Ga0495669_0389599
2006 Ga0495669_0485045
2007 Ga0495600_0109589
2008 Ga0495604_0743674
2009 Ga0495636_0262679
2010 Ga0495674_0505184
2011 Ga0495676_0591690
2012 Ga0495680_0998260
2013 Ga0495684_0226424
2014 Ga0496100_0791207
2015 Ga0496100_1355792
2016 Ga0496102_0097842
2017 Ga0496102_0511742
2018 Ga0496103_0072104
2019 Ga0496106_1560292
2020 Ga0496108_0026673
2021 Ga0496108_0728311
2022 Ga0496109_0033337
2023 Ga0496110_0038548
2024 Ga0496110_0194631
2025 Ga0496110_0791147
2026 Ga0496110_1434212
2027 Ga0496111_0122281
2028 Ga0496112_0095981
2029 Ga0496113_0102260
2030 Ga0496114_0066291
2031 Ga0496114_0620186
2032 Ga0496115_0368436
2033 Ga0496115_0514833
2034 Ga0496122_0158443
2035 Ga0495678_021754
2036 Ga0501296_048620
2037 Ga0501031_0380550
2038 Ga0501033_0717608
2039 Ga0501036_0357026
2040 Ga0501037_0235369
2041 Ga0501038_0039088
2042 Ga0501039_0006938
2043 Ga0501040_0034834
2044 Ga0501041_0109527
2045 Ga0501042_0043302
2046 Ga0501046_1020934
2047 Ga0501048_0055237
2048 Ga0501048_0352878
2049 Ga0501067_0262088
2050 Ga0501069_1015017
2051 Ga0501071_0057591
2052 Ga0501071_0084432
2053 Ga0501072_0020342
2054 Ga0501074_0035118
2055 Ga0501074_0985219
2056 Ga0501075_0015553
2057 Ga0501075_0073707
2058 Ga0501075_0222954
2059 Ga0501076_0020834
2060 Ga0501198_127473
2061 Ga0501079_0130933
2062 Ga0501079_0696819
2063 Ga0501080_0083912
2064 Ga0501081_0016602
2065 Ga0501081_0265110
2066 Ga0501083_0075548
2067 Ga0501035_0078353
2068 Ga0501045_0011088
2069 nmdc:mga0k408_1328_c1
2070 nmdc:mga05p37_130869_c1
2071 nmdc:mga05p37_834_c1
2072 nmdc:mga09592_13051_c1
2073 nmdc:mga09592_1514594_c1
2074 nmdc:mga09592_335308_c1
2075 nmdc:mga0qj67_58889_c1
2076 nmdc:mga06r32_151512_c1
2077 nmdc:mga06r32_29306_c1
2078 nmdc:mga08y16_383271_c1
2079 nmdc:mga08y16_645_c1
2080 nmdc:mga0n895_131253_c1
2081 nmdc:mga0n895_1585733_c1
2082 nmdc:mga0n895_381076_c1
2083 nmdc:mga0n895_759572_c1
2084 nmdc:mga0rr50_158351_c1
2085 nmdc:mga0rr50_61591_c1
2086 nmdc:mga08x19_118249_c1
2087 nmdc:mga08x19_74342_c1
2088 nmdc:mga08x19_777023_c1
2089 nmdc:mga08x19_84539_c1
2090 nmdc:mga0a205_1174879_c1
2091 Ga0495601_0664440
2092 Ga0495612_0020407
2093 Ga0495619_0240798
2094 Ga0501084_0017901
2095 Ga0501084_0397330
2096 Ga0501082_0006065
2097 Ga0530510_0057372
2098 Ga0530510_0259464
2099 Ga0530510_0637569
2100 Ga0530510_1193665

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF23544

25

124

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xvi-assembly4.cif.gz_D crystal structure of megabody mb-nb207-c7hopq_a12 0.7101 53 73
8t5j-assembly1.cif.gz_A crystal structure of outer membrane lipoprotein carrier protein (lola) from francisella philomiragia 0.7089 5 32
7upa-assembly1.cif.gz_C prefusion-stabilized nipah virus fusion protein complexed with fab 1h8 0.7069 53 73
8foi-assembly1.cif.gz_J native gaba-a receptor from the mouse brain, alpha1-beta2-gamma2 subtype, in complex with gaba and allopregnanolone 0.6997 53 75
7mwr-assembly1.cif.gz_A structure of de novo designed beta sheet heterodimer lhd101a53/b4 0.6911 9 72
ID Description Score Start End Superfamily
af_Q55CI7_27_128_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8176 40 73 3.30.70.330
af_F1QXB5_683_811_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.7724 40 72 3.30.70.330
6gq8B00 Mainly Beta;Sandwich;Immunoglobulin-like;SOR catalytic domain 0.748 8 26 2.60.40.730
af_P26952_236_335_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7404 8 28 2.60.40.10
1do6A00 Mainly Beta;Sandwich;Immunoglobulin-like;SOR catalytic domain 0.735 8 26 2.60.40.730
ID Description Score Start End GO Terms
AF-A0A351ZU22-F1-model_v4 Uncharacterized protein 0.9719 1 70
AF-A0A3D3RUI2-F1-model_v4 deleted 0.9587 3 79
AF-A0A5C6XVF3-F1-model_v4 deleted 0.9559 3 76
AF-A0A3D3RUI2-F1-model_v4 deleted 0.9468 3 79
AF-A0A351ZU22-F1-model_v4 Uncharacterized protein 0.9457 1 70

Map