F488955

General Info

Members Datasets Scaffolds Average Seq Length
1046 550 812 402

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10002142|Ga0075366_1000214210
Length 397
Sequence MSAALPLADLKVVELGTLIAGPYCARLLAEFGADVVKVETPGEGDPLRKWRVLHEGNSLWWYAQARNKKSVTVNLRVKEGQEIVRKLVREADILVENFRPGTLEKWGLSYEELARDNPKLVMVRLSGFGQTGPYKDRTGFGAIGESMGGMRYITGYADRAPVRVGISIGDSLAAMFGVIGALTAIHHRQTSGKGQVVDVALYEAVFAMMESMLPEYGMTGLVRERTGASLPGIVPSNTYLCGDGKYVVIGANGDSIFKRMMVSIGRQDLADDPSLANNAGRVRRTEELDRVIGEWTARHTLDDVLAVLEQAQVPSGKIYSIADIVADMQFQARQMVEAHKLGDGKDVLLPGIVPKLSATPGATRWIGPRLGEHTDEVLKALGYPDEERARLRAAGVI

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231010 Pseudomonas sp. GM25 Isolate Nodule
8 2511231011 Pseudomonas sp. GM30 Isolate Nodule
9 2511231012 Pseudomonas sp. GM33 Isolate Nodule
10 2511231014 Pseudomonas sp. GM48 Isolate Nodule
11 2511231015 Pseudomonas sp. GM49 Isolate Nodule
12 2511231016 Pseudomonas sp. GM50 Isolate Nodule
13 2511231017 Pseudomonas sp. GM55 Isolate Nodule
14 2511231018 Pseudomonas sp. GM60 Isolate Nodule
15 2511231019 Pseudomonas sp. GM67 Isolate Nodule
16 2511231020 Pseudomonas sp. GM74 Isolate Nodule
17 2511231021 Pseudomonas sp. GM78 Isolate Nodule
18 2511231022 Pseudomonas sp. GM79 Isolate Nodule
19 2511231023 Pseudomonas sp. GM80 Isolate Nodule
20 2511231024 Pseudomonas sp. GM84 Isolate Nodule
21 2511231031 Pseudomonas sp. GM16 Isolate Nodule
22 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
23 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
24 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
25 2547132512 Azospira oryzae 6a3 Isolate Unclassified
26 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
27 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
28 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
29 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
30 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
31 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
32 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
33 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
34 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
35 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
36 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
37 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
38 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
39 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
40 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
41 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
42 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
43 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
44 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
45 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
46 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
47 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
48 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
49 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
50 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
51 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
52 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
53 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
54 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
55 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
56 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
57 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
58 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
59 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
60 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
61 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
62 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
63 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
64 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
65 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
66 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
67 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
68 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
69 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
70 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
71 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
72 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
73 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
74 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
75 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
76 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
77 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
78 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
79 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
80 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
81 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
82 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
83 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
84 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
85 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
86 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
87 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
88 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
89 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
90 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
91 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
92 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
93 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
94 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
95 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
96 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
97 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
98 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
99 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
100 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
101 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
102 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
103 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
104 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
105 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
106 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
107 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
108 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
109 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
110 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
111 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
112 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
113 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
114 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
115 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
116 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
117 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
118 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
119 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
120 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
121 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
122 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
123 2765235841 Pseudomonas putida AA7 Isolate Unclassified
124 2773857670 Pseudomonas sp. 478 Isolate Unclassified
125 2773857673 Pseudomonas sp. 443 Isolate Unclassified
126 2784132063 Pseudomonas sp. 424 Isolate Unclassified
127 2784132072 Pseudomonas sp. 460 Isolate Unclassified
128 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
129 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
130 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
131 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
132 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
133 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
134 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
135 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
136 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
137 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
138 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
139 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
140 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
141 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
142 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
143 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
144 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
145 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
146 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
147 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
148 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
149 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
150 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
151 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
152 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
153 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
154 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
155 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
156 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
157 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
158 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
159 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
160 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
161 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
162 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
163 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
164 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
165 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
166 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
167 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
168 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
169 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
170 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
171 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
172 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
173 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
174 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
175 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
176 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
177 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
178 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
179 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
180 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
181 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
182 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
183 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
184 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
185 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
186 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
187 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
188 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
189 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
190 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
191 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
192 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
193 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
194 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
195 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
196 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
197 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
198 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
199 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
200 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
201 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
202 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
203 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
204 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
205 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
206 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
207 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
208 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
209 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
210 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
211 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
212 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
213 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
214 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
215 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
216 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
217 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
218 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
219 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
220 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
221 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
222 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
223 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
224 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
225 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
226 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
227 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
228 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
229 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
230 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
231 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
232 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
233 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
234 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
235 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
236 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
237 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
238 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
239 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
240 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
241 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
242 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
243 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
244 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
245 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
246 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
247 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
248 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
249 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
250 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
251 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
252 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
253 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
254 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
255 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
256 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
257 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
258 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
259 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
260 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
261 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
262 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
263 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
264 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
265 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
266 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
267 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
268 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
269 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
270 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
271 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
272 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
273 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
274 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
275 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
276 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
277 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
278 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
279 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
280 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
281 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
282 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
283 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
284 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
285 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
286 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
287 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
288 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
289 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
290 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
291 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
292 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
293 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
294 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
295 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
296 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
297 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
298 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
299 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
300 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
301 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
302 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
303 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
304 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
305 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
306 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
307 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
308 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
309 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
310 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
311 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
312 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
313 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
314 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
315 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
316 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
317 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
318 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
319 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
320 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
321 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
323 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
324 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
325 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
326 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
327 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
328 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
329 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
330 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
331 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
332 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
333 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
334 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
374 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
375 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
376 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
377 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
378 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
379 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
381 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
383 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
384 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
385 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
386 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
387 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
388 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
389 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
390 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
391 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
392 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
393 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
394 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
395 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
396 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
397 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
398 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
399 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
400 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
401 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
402 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
403 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
404 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
405 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
406 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
407 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
408 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
409 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
410 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
411 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
412 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
413 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
414 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
415 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
416 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
417 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
418 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
419 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
420 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
421 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
422 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
423 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
424 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
425 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
426 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
427 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
428 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
429 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
430 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
431 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
432 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
433 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
434 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
435 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
436 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
437 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
438 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
439 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
440 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
441 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
442 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
443 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
444 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
445 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
446 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
447 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
448 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
449 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
450 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
451 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
452 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
453 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
454 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
455 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
456 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
457 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
458 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
459 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
460 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
461 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
462 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
463 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
464 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
465 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
466 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
467 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
468 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
469 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
470 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
471 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
472 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
473 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
474 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
475 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
476 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
477 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
478 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
479 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
480 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
481 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
482 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
483 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
484 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
485 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
486 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
487 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
488 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
489 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
490 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
491 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
492 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
493 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
494 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
495 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
496 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
497 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
498 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
499 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
500 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
501 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
502 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
503 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
504 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
505 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
506 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
507 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
508 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
509 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
510 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
511 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
512 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
513 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
514 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
515 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
516 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
517 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
518 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
519 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
520 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
521 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
522 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
523 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
524 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
525 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
526 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
527 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
528 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
529 8052494512 Pseudomonas putida LD6 Isolate Unclassified
530 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
531 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
532 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
533 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
534 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
535 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
536 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
537 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
538 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
539 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
540 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
541 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
542 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
543 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
544 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
545 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
546 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
547 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
548 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
549 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
550 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.63
Metatranscriptomes 0
Isolates 22.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.02
Nodule 2.77
Rhizoplane 6.41
Rhizosphere 73.14
Stem 0
Stem Tuber 0
Unclassified 11.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_782 2124908027 Bacteria 15632
2 SwRhRL2b_contig_1365810 2162886007 Bacteria 1828
3 SwRhRL2b_contig_3491391 2162886007 Bacteria 1701
4 JGI25162J39368_1000126 3300002737 Bacteria 84404
5 JGI25162J39368_1000257 3300002737 Bacteria 50817
6 JGI25163J39215_1000103 3300002771 Bacteria 35374
7 JGI25163J39215_1000331 3300002771 Bacteria 15725
8 JGI25164J39214_1000100 3300002772 Bacteria 84404
9 JGI25164J39214_1000202 3300002772 Bacteria 50817
10 JGI25165J46597_1000207 3300003214 Bacteria 84404
11 JGI25165J46597_1000361 3300003214 Bacteria 50817
12 Ga0055538_1000028 3300003751 Bacteria 215806
13 Ga0055539_1000037 3300003752 Bacteria 215806
14 Ga0055533_1000047 3300003756 Bacteria 215806
15 Ga0055532_1000129 3300003758 Bacteria 74882
16 Ga0055525_1000443 3300003759 Bacteria 23895
17 Ga0055536_1000305 3300003781 Bacteria 36930
18 Ga0055536_1000508 3300003781 Bacteria 26882
19 Ga0055536_1001255 3300003781 Bacteria 15613
20 Ga0055530_10000839 3300003791 Bacteria 25345
21 Ga0055530_10000961 3300003791 Bacteria 23411
22 Ga0055530_10001388 3300003791 Bacteria 17936
23 Ga0055540_1000576 3300003792 Bacteria 26893
24 Ga0055540_1000882 3300003792 Bacteria 19857
25 Ga0055540_1001025 3300003792 Bacteria 17936
26 Ga0055531_10004261 3300003794 Bacteria 8790
27 Ga0055541_1000025 3300003841 Bacteria 215806
28 Ga0065714_10000132 3300005288 Bacteria 9150
29 Ga0065714_10005553 3300005288 Bacteria 5099
30 Ga0065714_10005866 3300005288 Bacteria 3874
31 Ga0065714_10006337 3300005288 Bacteria 5135
32 Ga0065714_10011464 3300005288 Bacteria 3426
33 Ga0065714_10065605 3300005288 Bacteria 9222
34 Ga0065714_10065693 3300005288 Bacteria 8841
35 Ga0065714_10066074 3300005288 Bacteria 7683
36 Ga0065714_10072057 3300005288 Bacteria 3438
37 Ga0065714_10073300 3300005288 Bacteria 3186
38 Ga0065704_10001267 3300005289 Bacteria 8578
39 Ga0065704_10005830 3300005289 Bacteria 3028
40 Ga0065704_10009564 3300005289 Bacteria 2207
41 Ga0065704_10075747 3300005289 Bacteria 5439
42 Ga0065704_10086093 3300005289 Bacteria 3153
43 Ga0065704_10105239 3300005289 Bacteria 2102
44 Ga0065712_10000712 3300005290 Bacteria 8657
45 Ga0065712_10002348 3300005290 Bacteria 10512
46 Ga0070658_10078006 3300005327 Unclassified 2718
47 Ga0070683_100002978 3300005329 Bacteria 13582
48 Ga0070670_100002834 3300005331 Bacteria 14342
49 Ga0070670_100004830 3300005331 Bacteria 11325
50 Ga0070670_100011421 3300005331 Bacteria 7596
51 Ga0070677_10014734 3300005333 Unclassified 2758
52 Ga0070666_10049275 3300005335 Unclassified 2830
53 Ga0070680_100320711 3300005336 Bacteria 1315
54 Ga0068868_100001450 3300005338 Bacteria 16360
55 Ga0070687_100021860 3300005343 Bacteria 3015
56 Ga0070661_100000022 3300005344 Bacteria 127714
57 Ga0070661_100001365 3300005344 Bacteria 17047
58 Ga0070668_100167109 3300005347 Bacteria 1788
59 Ga0070669_100001703 3300005353 Bacteria 15924
60 Ga0070669_100036007 3300005353 Bacteria 3586
61 Ga0070675_100048464 3300005354 Unclassified 3484
62 Ga0070671_100012446 3300005355 Bacteria 6851
63 Ga0070674_100041038 3300005356 Unclassified 3133
64 Ga0070673_100000687 3300005364 Bacteria 18684
65 Ga0070673_100017690 3300005364 Bacteria 5076
66 Ga0070667_100071281 3300005367 Unclassified 2960
67 Ga0070700_100087480 3300005441 Bacteria 2025
68 Ga0070694_100038566 3300005444 Bacteria 3175
69 Ga0070708_100269572 3300005445 Bacteria 1601
70 Ga0070678_100000554 3300005456 Bacteria 18234
71 Ga0070662_100000041 3300005457 Bacteria 72879
72 Ga0070662_100017261 3300005457 Unclassified 4862
73 Ga0070681_10005132 3300005458 Bacteria 12632
74 Ga0070681_10009747 3300005458 Bacteria 9453
75 Ga0068867_100022758 3300005459 Bacteria 4483
76 Ga0068867_100155962 3300005459 Bacteria 1797
77 Ga0070685_10162537 3300005466 Bacteria 1424
78 Ga0070706_100283023 3300005467 Bacteria 1547
79 Ga0070707_100074438 3300005468 Bacteria 3275
80 Ga0070697_100220403 3300005536 Bacteria 1617
81 Ga0068853_100005399 3300005539 Bacteria 10011
82 Ga0070672_100006420 3300005543 Bacteria 7902
83 Ga0070686_100078621 3300005544 Bacteria 2178
84 Ga0070695_100029773 3300005545 Bacteria 3395
85 Ga0070695_100140535 3300005545 Bacteria 1674
86 Ga0070665_100065413 3300005548 Bacteria 3647
87 Ga0070665_100091254 3300005548 Bacteria 3052
88 Ga0068855_100155004 3300005563 Bacteria 2603
89 Ga0070664_100000646 3300005564 Bacteria 26728
90 Ga0070664_100002976 3300005564 Bacteria 13707
91 Ga0070664_100087817 3300005564 Bacteria 2689
92 Ga0068857_100085938 3300005577 Bacteria 2812
93 Ga0068852_100001172 3300005616 Bacteria 17355
94 Ga0068859_100063420 3300005617 Bacteria 3726
95 Ga0068864_100003416 3300005618 Bacteria 13134
96 Ga0068866_10036604 3300005718 Bacteria 2405
97 Ga0068851_10000044 3300005834 Bacteria 83228
98 Ga0068851_10000531 3300005834 Bacteria 16632
99 Ga0068863_100048109 3300005841 Bacteria 4044
100 Ga0075363_100104962 3300006048 Bacteria 1567
101 Ga0075364_10021002 3300006051 Bacteria 4112
102 Ga0075364_10049614 3300006051 Bacteria 2738
103 Ga0075432_10004390 3300006058 Bacteria 4803
104 Ga0075432_10008014 3300006058 Bacteria 3603
105 Ga0075432_10012043 3300006058 Bacteria 2938
106 Ga0075362_10027169 3300006177 Bacteria 2448
107 Ga0075366_10002142 3300006195 Bacteria 10048
108 Ga0075366_10026616 3300006195 Bacteria 3389
109 Ga0097621_100002291 3300006237 Bacteria 13108
110 Ga0097621_100005368 3300006237 Bacteria 9031
111 Ga0068871_100001444 3300006358 Bacteria 15897
112 Ga0068871_100022645 3300006358 Bacteria 4847
113 Ga0075428_100002635 3300006844 Bacteria 19521
114 Ga0075431_100034988 3300006847 Bacteria 5174
115 Ga0075433_10117466 3300006852 Bacteria 2360
116 Ga0075429_100238703 3300006880 Bacteria 1592
117 Ga0075429_100300234 3300006880 Bacteria 1406
118 Ga0068865_100011198 3300006881 Bacteria 5607
119 Ga0075436_100118666 3300006914 Bacteria 1850
120 Ga0097620_100063421 3300006931 Bacteria 3726
121 Ga0099823_1000054 3300006944 Bacteria 55085
122 Ga0079104_1000414 3300006946 Bacteria 49214
123 Ga0079104_1000902 3300006946 Bacteria 24116
124 Ga0079104_1015454 3300006946 Bacteria 2262
125 Ga0099826_10003858 3300006948 Bacteria 10330
126 Ga0099794_10000077 3300007265 Bacteria 36156
127 Ga0105251_10001454 3300009011 Bacteria 20349
128 Ga0105251_10002538 3300009011 Bacteria 14210
129 Ga0105251_10003633 3300009011 Bacteria 11079
130 Ga0105251_10004210 3300009011 Bacteria 9953
131 Ga0105251_10007529 3300009011 Bacteria 6693
132 Ga0105251_10008536 3300009011 Bacteria 6147
133 Ga0105251_10011825 3300009011 Bacteria 4967
134 Ga0105251_10032356 3300009011 Bacteria 2607
135 Ga0105251_10046910 3300009011 Bacteria 2078
136 Ga0105244_10004672 3300009036 Bacteria 9337
137 Ga0105244_10004698 3300009036 Bacteria 9308
138 Ga0105244_10005205 3300009036 Bacteria 8705
139 Ga0105244_10006467 3300009036 Bacteria 7578
140 Ga0105244_10014809 3300009036 Bacteria 4495
141 Ga0105244_10024035 3300009036 Bacteria 3331
142 Ga0105244_10035122 3300009036 Bacteria 2635
143 Ga0105250_10002773 3300009092 Bacteria 8609
144 Ga0105250_10003059 3300009092 Bacteria 8070
145 Ga0111539_10004775 3300009094 Bacteria 17692
146 Ga0111539_10052830 3300009094 Bacteria 4836
147 Ga0105245_10374272 3300009098 Bacteria 1417
148 Ga0105243_10000312 3300009148 Bacteria 53545
149 Ga0105243_10002146 3300009148 Bacteria 16669
150 Ga0105243_10159483 3300009148 Bacteria 1944
151 Ga0105241_10027898 3300009174 Bacteria 4204
152 Ga0105242_10002134 3300009176 Bacteria 15610
153 Ga0105242_10027676 3300009176 Bacteria 4505
154 Ga0105242_10030641 3300009176 Bacteria 4296
155 Ga0105248_10026428 3300009177 Bacteria 6458
156 Ga0105248_10143438 3300009177 Bacteria 2695
157 Ga0105248_10186693 3300009177 Unclassified 2336
158 Ga0105237_10001243 3300009545 Bacteria 33994
159 Ga0105237_10027467 3300009545 Bacteria 5810
160 Ga0105238_10022892 3300009551 Bacteria 6369
161 Ga0105239_10203812 3300010375 Bacteria 2216
162 Ga0105246_10001031 3300011119 Bacteria 16018
163 Ga0105246_10014568 3300011119 Bacteria 4947
164 Ga0105246_10018673 3300011119 Bacteria 4421
165 Ga0105246_10107322 3300011119 Bacteria 2044
166 Ga0105246_10120480 3300011119 Bacteria 1943
167 Ga0157345_1000029 3300012498 Bacteria 35524
168 Ga0157373_10001975 3300013100 Bacteria 15547
169 Ga0157373_10004161 3300013100 Bacteria 10911
170 Ga0157373_10017134 3300013100 Bacteria 5276
171 Ga0157373_10018246 3300013100 Bacteria 5110
172 Ga0157373_10032739 3300013100 Bacteria 3741
173 Ga0157373_10033176 3300013100 Bacteria 3715
174 Ga0157373_10182539 3300013100 Bacteria 1478
175 Ga0157371_10001461 3300013102 Bacteria 24500
176 Ga0157371_10008227 3300013102 Bacteria 8336
177 Ga0157371_10015251 3300013102 Bacteria 5771
178 Ga0157370_10001727 3300013104 Bacteria 26898
179 Ga0157370_10032362 3300013104 Bacteria 5106
180 Ga0157369_10002202 3300013105 Bacteria 23480
181 Ga0157369_10066249 3300013105 Bacteria 3886
182 Ga0157369_10075608 3300013105 Bacteria 3610
183 Ga0157374_10001943 3300013296 Bacteria 17328
184 Ga0157378_10006978 3300013297 Bacteria 9854
185 Ga0163162_10005737 3300013306 Bacteria 12003
186 Ga0163162_10011467 3300013306 Bacteria 8645
187 Ga0163162_10022326 3300013306 Bacteria 6238
188 Ga0157372_10003985 3300013307 Bacteria 15853
189 Ga0157372_10014347 3300013307 Bacteria 8471
190 Ga0157375_10002545 3300013308 Bacteria 15823
191 Ga0157375_10022752 3300013308 Bacteria 5772
192 Ga0157375_10023884 3300013308 Bacteria 5648
193 Ga0157375_10034737 3300013308 Bacteria 4806
194 Ga0157375_10080848 3300013308 Bacteria 3289
195 Ga0163163_10077913 3300014325 Bacteria 3310
196 Ga0182008_10000323 3300014497 Bacteria 37661
197 Ga0182008_10001287 3300014497 Bacteria 17171
198 Ga0182008_10004782 3300014497 Bacteria 7832
199 Ga0182008_10005261 3300014497 Bacteria 7402
200 Ga0182008_10005950 3300014497 Bacteria 6878
201 Ga0182008_10007147 3300014497 Bacteria 6182
202 Ga0182008_10007981 3300014497 Bacteria 5805
203 Ga0182008_10091192 3300014497 Bacteria 1502
204 Ga0157377_10009990 3300014745 Unclassified 4681
205 Ga0157377_10047113 3300014745 Bacteria 2414
206 Ga0157379_10046791 3300014968 Bacteria 3860
207 Ga0157376_10010273 3300014969 Bacteria 6837
208 Ga0157376_10091377 3300014969 Bacteria 2637
209 Ga0182006_1002733 3300015261 Bacteria 9452
210 Ga0182006_1003909 3300015261 Bacteria 7464
211 Ga0182006_1004160 3300015261 Bacteria 7185
212 Ga0182006_1006692 3300015261 Bacteria 5332
213 Ga0182006_1029816 3300015261 Bacteria 2209
214 Ga0182006_1062755 3300015261 Bacteria 1397
215 Ga0182007_10002969 3300015262 Bacteria 8218
216 Ga0182007_10004412 3300015262 Bacteria 6376
217 Ga0182005_1000723 3300015265 Bacteria 15152
218 Ga0182005_1001625 3300015265 Bacteria 8769
219 Ga0163161_10013192 3300017792 Bacteria 5743
220 Ga0163161_10016286 3300017792 Bacteria 5189
221 Ga0163161_10026718 3300017792 Bacteria 4090
222 Ga0163161_10046961 3300017792 Bacteria 3117
223 Ga0163161_10075384 3300017792 Bacteria 2475
224 Ga0209435_100960 3300025206 Bacteria 4212
225 Ga0209760_100021 3300025207 Bacteria 163688
226 Ga0209760_100055 3300025207 Bacteria 100237
227 Ga0209784_100032 3300025224 Bacteria 314079
228 Ga0209566_100036 3300025225 Bacteria 314079
229 Ga0209674_100054 3300025226 Bacteria 314079
230 Ga0209147_100055 3300025229 Bacteria 262412
231 Ga0209563_100055 3300025230 Bacteria 314079
232 Ga0207427_100001 3300025231 Bacteria 1410763
233 Ga0207427_100004 3300025231 Bacteria 939600
234 Ga0209437_100003 3300025233 Bacteria 1517827
235 Ga0209437_100028 3300025233 Bacteria 540136
236 Ga0209258_100231 3300025242 Bacteria 104255
237 Ga0209646_1000331 3300025246 Bacteria 35689
238 Ga0209677_100033 3300025253 Bacteria 314079
239 Ga0209233_1000007 3300025261 Bacteria 1411234
240 Ga0209233_1000008 3300025261 Bacteria 1356712
241 Ga0209676_1000056 3300025292 Bacteria 361329
242 Ga0209676_1000101 3300025292 Bacteria 227976
243 Ga0209676_1000503 3300025292 Bacteria 61955
244 Ga0209676_1001307 3300025292 Bacteria 25371
245 Ga0209676_1009559 3300025292 Bacteria 4169
246 Ga0209676_1012648 3300025292 Bacteria 3295
247 Ga0209050_1000041 3300025298 Bacteria 408004
248 Ga0209050_1000060 3300025298 Bacteria 321699
249 Ga0209050_1000361 3300025298 Bacteria 87075
250 Ga0209050_1002054 3300025298 Bacteria 18548
251 Ga0209051_1000037 3300025303 Bacteria 321747
252 Ga0209051_1000061 3300025303 Bacteria 253485
253 Ga0209051_1000085 3300025303 Bacteria 189973
254 Ga0209257_1000635 3300025304 Bacteria 56286
255 Ga0207697_10013697 3300025315 Bacteria 3380
256 Ga0207656_10000022 3300025321 Bacteria 106345
257 Ga0207656_10022519 3300025321 Unclassified 2529
258 Ga0207696_1000032 3300025711 Bacteria 380071
259 Ga0207696_1000129 3300025711 Bacteria 133308
260 Ga0207696_1000262 3300025711 Bacteria 67626
261 Ga0207696_1003053 3300025711 Bacteria 7813
262 Ga0207696_1007660 3300025711 Bacteria 4206
263 Ga0207655_1000005 3300025728 Bacteria 917277
264 Ga0207655_1000015 3300025728 Bacteria 600662
265 Ga0207655_1000166 3300025728 Bacteria 119771
266 Ga0207655_1000357 3300025728 Bacteria 64976
267 Ga0207655_1000408 3300025728 Bacteria 59188
268 Ga0207655_1001002 3300025728 Bacteria 28722
269 Ga0207655_1001218 3300025728 Bacteria 24789
270 Ga0207655_1004877 3300025728 Bacteria 9308
271 Ga0207655_1005286 3300025728 Bacteria 8849
272 Ga0207655_1011306 3300025728 Bacteria 5323
273 Ga0207655_1017457 3300025728 Bacteria 3870
274 Ga0207655_1017539 3300025728 Bacteria 3855
275 Ga0207655_1053386 3300025728 Bacteria 1616
276 Ga0207713_1002613 3300025735 Bacteria 12975
277 Ga0207713_1002881 3300025735 Bacteria 12066
278 Ga0207713_1002896 3300025735 Bacteria 12021
279 Ga0207713_1003306 3300025735 Bacteria 11086
280 Ga0207713_1003614 3300025735 Bacteria 10417
281 Ga0207713_1004933 3300025735 Bacteria 8531
282 Ga0207713_1008401 3300025735 Bacteria 5954
283 Ga0207713_1009219 3300025735 Bacteria 5589
284 Ga0207713_1009521 3300025735 Bacteria 5467
285 Ga0207713_1033219 3300025735 Bacteria 2256
286 Ga0207682_10005007 3300025893 Bacteria 5434
287 Ga0207682_10020357 3300025893 Unclassified 2605
288 Ga0207688_10008168 3300025901 Bacteria 5688
289 Ga0207645_10003020 3300025907 Bacteria 13002
290 Ga0207643_10019424 3300025908 Bacteria 3724
291 Ga0207684_10280441 3300025910 Bacteria 1437
292 Ga0207707_10013303 3300025912 Bacteria 7172
293 Ga0207671_10000034 3300025914 Bacteria 245048
294 Ga0207671_10081121 3300025914 Bacteria 2432
295 Ga0207649_10000006 3300025920 Bacteria 349180
296 Ga0207649_10006645 3300025920 Bacteria 6285
297 Ga0207646_10040819 3300025922 Bacteria 4172
298 Ga0207681_10000978 3300025923 Bacteria 18677
299 Ga0207681_10012413 3300025923 Bacteria 5258
300 Ga0207650_10000092 3300025925 Bacteria 116489
301 Ga0207650_10002213 3300025925 Bacteria 13577
302 Ga0207650_10002270 3300025925 Bacteria 13421
303 Ga0207659_10047034 3300025926 Unclassified 3050
304 Ga0207700_10002511 3300025928 Bacteria 10523
305 Ga0207644_10125667 3300025931 Bacteria 1957
306 Ga0207706_10003133 3300025933 Bacteria 15889
307 Ga0207686_10047967 3300025934 Bacteria 2643
308 Ga0207709_10000134 3300025935 Bacteria 108529
309 Ga0207709_10000678 3300025935 Bacteria 27513
310 Ga0207709_10011829 3300025935 Bacteria 4812
311 Ga0207691_10002145 3300025940 Bacteria 19321
312 Ga0207711_10049864 3300025941 Bacteria 3584
313 Ga0207711_10080218 3300025941 Bacteria 2850
314 Ga0207689_10012165 3300025942 Bacteria 7365
315 Ga0207689_10038913 3300025942 Bacteria 3937
316 Ga0207661_10002649 3300025944 Bacteria 12316
317 Ga0207679_10000010 3300025945 Bacteria 349180
318 Ga0207667_10123563 3300025949 Bacteria 2667
319 Ga0207651_10000832 3300025960 Bacteria 13396
320 Ga0207658_10055038 3300025986 Unclassified 2946
321 Ga0207677_10000800 3300026023 Bacteria 18046
322 Ga0207639_10005905 3300026041 Bacteria 8298
323 Ga0207708_10001343 3300026075 Bacteria 18506
324 Ga0207708_10013845 3300026075 Bacteria 6027
325 Ga0207648_10010894 3300026089 Bacteria 8593
326 Ga0207648_10013748 3300026089 Bacteria 7514
327 Ga0207648_10099709 3300026089 Bacteria 2544
328 Ga0207676_10004537 3300026095 Bacteria 9826
329 Ga0207674_10104924 3300026116 Bacteria 2804
330 Ga0207675_100009090 3300026118 Bacteria 9324
331 Ga0207675_100255916 3300026118 Bacteria 1696
332 Ga0207683_10012662 3300026121 Bacteria 7193
333 Ga0207683_10023777 3300026121 Bacteria 5271
334 Ga0207698_10000853 3300026142 Bacteria 17708
335 Ga0209281_1000010 3300027111 Bacteria 726106
336 Ga0209281_1000049 3300027111 Bacteria 322274
337 Ga0209281_1007384 3300027111 Bacteria 2762
338 Ga0209389_1000002 3300027296 Bacteria 333932
339 Ga0209371_1000572 3300027312 Bacteria 33334
340 Ga0209995_1002923 3300027471 Bacteria 2711
341 Ga0209999_1004007 3300027543 Bacteria 2651
342 Ga0209983_1005804 3300027665 Bacteria 2549
343 Ga0209588_1000008 3300027671 Bacteria 177025
344 Ga0207428_10018896 3300027907 Bacteria 5878
345 Ga0207428_10024567 3300027907 Bacteria 5061
346 Ga0207428_10029635 3300027907 Bacteria 4533
347 Ga0207428_10050689 3300027907 Bacteria 3320
348 Ga0207428_10092373 3300027907 Bacteria 2349
349 Ga0268266_10075856 3300028379 Bacteria 2921
350 Ga0265323_10035030 3300028653 Bacteria 1852
351 Ga0268256_1000499 3300030500 Bacteria 33334
352 Ga0316178_1073272 3300030735 Bacteria 21829
353 Ga0316183_1093468 3300030742 Bacteria 5316
354 Ga0316183_1141541 3300030742 Bacteria 2166
355 Ga0265332_10000004 3300031238 Bacteria 426592
356 Ga0265332_10007136 3300031238 Bacteria 5061
357 Ga0265316_10017973 3300031344 Bacteria 6094
358 Ga0265316_10064765 3300031344 Bacteria 2831
359 Ga0307509_10001698 3300031507 Bacteria 36806
360 Ga0307509_10199971 3300031507 Bacteria 1837
361 Ga0307408_100001076 3300031548 Bacteria 20885
362 Ga0307408_100007882 3300031548 Bacteria 7042
363 Ga0307408_100019289 3300031548 Bacteria 4590
364 Ga0307408_100029500 3300031548 Bacteria 3801
365 Ga0307408_100300883 3300031548 Bacteria 1343
366 Ga0265314_10023451 3300031711 Bacteria 4704
367 Ga0307405_10002721 3300031731 Bacteria 7908
368 Ga0307405_10009155 3300031731 Bacteria 5064
369 Ga0307405_10017437 3300031731 Bacteria 3940
370 Ga0307405_10031126 3300031731 Bacteria 3137
371 Ga0307407_10010099 3300031903 Bacteria 4435
372 Ga0307412_10012578 3300031911 Bacteria 4938
373 Ga0307412_10037581 3300031911 Bacteria 3112
374 Ga0307412_10080411 3300031911 Bacteria 2251
375 Ga0307412_10106499 3300031911 Bacteria 1993
376 Ga0307412_10137847 3300031911 Bacteria 1782
377 Ga0307409_100068134 3300031995 Bacteria 2813
378 Ga0307416_100153613 3300032002 Bacteria 2115
379 Ga0307414_10010851 3300032004 Bacteria 5313
380 Ga0307414_10042546 3300032004 Bacteria 3087
381 Ga0307414_10086035 3300032004 Bacteria 2318
382 Ga0307414_10124919 3300032004 Bacteria 1986
383 Ga0307411_10015517 3300032005 Bacteria 4281
384 Ga0307510_10006155 3300033180 Bacteria 14302
385 Ga0373948_0014714 3300034817 Bacteria 1429
386 Ga0373925_0180932 3300037068 Bacteria 1669
387 Ga0237819_02230 3300038705 Bacteria 4076
388 Ga0439436_0008028 3300041404 Bacteria 3241
389 Ga0439438_000311 3300041405 Bacteria 21962
390 Ga0439438_001307 3300041405 Bacteria 11027
391 Ga0439438_003930 3300041405 Bacteria 5849
392 Ga0439438_005356 3300041405 Bacteria 4735
393 Ga0439438_005616 3300041405 Bacteria 4576
394 Ga0439438_006187 3300041405 Bacteria 4261
395 Ga0439438_007424 3300041405 Bacteria 3747
396 Ga0439438_009552 3300041405 Bacteria 3132
397 Ga0439447_001267 3300041407 Bacteria 9200
398 Ga0439447_004020 3300041407 Bacteria 5143
399 Ga0439447_005496 3300041407 Bacteria 4206
400 Ga0439447_010765 3300041407 Bacteria 2700
401 Ga0439466_0000511 3300041411 Bacteria 14707
402 Ga0439466_0001739 3300041411 Bacteria 8506
403 Ga0439466_0001862 3300041411 Bacteria 8261
404 Ga0439466_0013006 3300041411 Bacteria 3052
405 Ga0439466_0013844 3300041411 Bacteria 2947
406 Ga0439432_002461 3300042006 Bacteria 6978
407 Ga0439432_002654 3300042006 Bacteria 6691
408 Ga0439432_002747 3300042006 Bacteria 6575
409 Ga0439432_003054 3300042006 Bacteria 6232
410 Ga0439432_003222 3300042006 Bacteria 6072
411 Ga0439451_015800 3300042009 Bacteria 1521
412 Ga0439452_000382 3300042010 Bacteria 26524
413 Ga0439452_000510 3300042010 Bacteria 20967
414 Ga0439452_000646 3300042010 Bacteria 17421
415 Ga0439452_001226 3300042010 Bacteria 10941
416 Ga0439452_002237 3300042010 Bacteria 7260
417 Ga0439452_006184 3300042010 Bacteria 3771
418 Ga0439452_006751 3300042010 Bacteria 3570
419 Ga0439456_000096 3300042013 Bacteria 30407
420 Ga0439456_001898 3300042013 Bacteria 4209
421 Ga0439456_008684 3300042013 Bacteria 2097
422 Ga0439463_000222 3300042016 Bacteria 15649
423 Ga0439463_000585 3300042016 Bacteria 10191
424 Ga0439463_005709 3300042016 Bacteria 3090
425 Ga0450911_000096 3300042115 Bacteria 35766
426 Ga0450911_000238 3300042115 Bacteria 20920
427 Ga0450911_000755 3300042115 Bacteria 9217
428 Ga0450919_000450 3300042121 Bacteria 5101
429 Ga0450922_000238 3300042124 Bacteria 5927
430 Ga0450890_000202 3300042127 Bacteria 9083
431 Ga0450902_001384 3300042137 Bacteria 3297
432 Ga0450902_001967 3300042137 Bacteria 2866
433 Ga0450903_001289 3300042138 Bacteria 4684
434 Ga0450903_006830 3300042138 Bacteria 1888
435 Ga0450905_000442 3300042142 Bacteria 5095
436 Ga0450905_001386 3300042142 Bacteria 3082
437 Ga0450906_000574 3300042145 Bacteria 7783
438 Ga0450907_000062 3300042146 Bacteria 42194
439 Ga0450907_001660 3300042146 Bacteria 4661
440 Ga0439446_0001788 3300042156 Bacteria 5012
441 Ga0450909_000168 3300042185 Bacteria 7166
442 Ga0439434_0000411 3300042435 Bacteria 12197
443 Ga0439434_0005796 3300042435 Bacteria 3607
444 Ga0439464_0027861 3300042439 Bacteria 1572
445 Ga0439460_0000562 3300042461 Bacteria 8124
446 Ga0439460_0001729 3300042461 Bacteria 5183
447 Ga0439460_0007966 3300042461 Bacteria 2665
448 Ga0439460_0017953 3300042461 Bacteria 1901
449 Ga0450918_002614 3300042531 Bacteria 3400
450 Ga0451577_0062944 3300042876 Bacteria 3308
451 Ga0451577_0125031 3300042876 Bacteria 2304
452 Ga0439440_0011294 3300042993 Bacteria 1881
453 Ga0453684_0082317 3300044712 Bacteria 4010
454 Ga0451576_0000745 3300045051 Bacteria 64985
455 Ga0495617_000439 3300046452 Bacteria 22486
456 Ga0495617_005046 3300046452 Bacteria 4734
457 Ga0495617_009057 3300046452 Bacteria 3421
458 Ga0495627_001257 3300046453 Bacteria 15663
459 Ga0495627_006483 3300046453 Bacteria 4584
460 Ga0495627_029885 3300046453 Bacteria 1729
461 Ga0495627_054762 3300046453 Bacteria 1192
462 Ga0495603_0029386 3300046455 Bacteria 3314
463 Ga0495603_0100612 3300046455 Bacteria 1687
464 Ga0495590_0002161 3300046457 Bacteria 8242
465 Ga0495590_0002603 3300046457 Bacteria 7457
466 Ga0495590_0003983 3300046457 Bacteria 5998
467 Ga0495590_0005440 3300046457 Bacteria 5055
468 Ga0495590_0005866 3300046457 Bacteria 4823
469 Ga0495591_001543 3300046458 Bacteria 14127
470 Ga0495591_001609 3300046458 Bacteria 13659
471 Ga0495591_002816 3300046458 Bacteria 9370
472 Ga0495591_003923 3300046458 Bacteria 7493
473 Ga0495591_003967 3300046458 Bacteria 7415
474 Ga0495591_005851 3300046458 Bacteria 5584
475 Ga0495591_007471 3300046458 Bacteria 4641
476 Ga0495591_010877 3300046458 Bacteria 3485
477 Ga0495638_0004187 3300046460 Bacteria 10993
478 Ga0495638_0009880 3300046460 Bacteria 6660
479 Ga0495638_0010307 3300046460 Bacteria 6500
480 Ga0495638_0010874 3300046460 Bacteria 6294
481 Ga0495638_0016835 3300046460 Bacteria 4888
482 Ga0495638_0017674 3300046460 Bacteria 4748
483 Ga0495638_0050019 3300046460 Bacteria 2611
484 Ga0495638_0063306 3300046460 Bacteria 2280
485 Ga0495653_0008893 3300046463 Bacteria 8215
486 Ga0495653_0011668 3300046463 Bacteria 7170
487 Ga0495653_0045843 3300046463 Bacteria 3387
488 Ga0495653_0084734 3300046463 Bacteria 2333
489 Ga0495650_0010649 3300046471 Bacteria 5113
490 Ga0495650_0062776 3300046471 Bacteria 1483
491 Ga0495605_0000514 3300046474 Bacteria 33102
492 Ga0495605_0001162 3300046474 Bacteria 17465
493 Ga0495605_0009012 3300046474 Bacteria 5616
494 Ga0495605_0013040 3300046474 Bacteria 4595
495 Ga0495605_0020722 3300046474 Bacteria 3491
496 Ga0495605_0039526 3300046474 Bacteria 2362
497 Ga0495639_0001944 3300046475 Bacteria 9165
498 Ga0495584_0000651 3300046491 Bacteria 23165
499 Ga0495584_0002556 3300046491 Bacteria 10265
500 Ga0495584_0004775 3300046491 Bacteria 7247
501 Ga0495584_0005416 3300046491 Bacteria 6759
502 Ga0495584_0006353 3300046491 Bacteria 6190
503 Ga0495584_0016839 3300046491 Bacteria 3726
504 Ga0495584_0024846 3300046491 Bacteria 3037
505 Ga0495585_0002101 3300046492 Bacteria 14575
506 Ga0495585_0002862 3300046492 Bacteria 12003
507 Ga0495585_0005597 3300046492 Bacteria 7895
508 Ga0495585_0015538 3300046492 Bacteria 4424
509 Ga0495585_0034218 3300046492 Bacteria 2872
510 Ga0495596_0002132 3300046500 Bacteria 10817
511 Ga0495596_0015797 3300046500 Bacteria 3150
512 Ga0495607_0004028 3300046501 Bacteria 11018
513 Ga0495607_0004713 3300046501 Bacteria 9978
514 Ga0495607_0006276 3300046501 Bacteria 8379
515 Ga0495607_0011229 3300046501 Bacteria 5975
516 Ga0495607_0015797 3300046501 Bacteria 4883
517 Ga0495607_0031366 3300046501 Bacteria 3254
518 Ga0495607_0037304 3300046501 Bacteria 2920
519 Ga0495583_0004454 3300046506 Bacteria 10019
520 Ga0495583_0004497 3300046506 Bacteria 9953
521 Ga0495606_0000575 3300046507 Bacteria 58335
522 Ga0495606_0003310 3300046507 Bacteria 17199
523 Ga0495606_0003623 3300046507 Bacteria 16227
524 Ga0495606_0007478 3300046507 Bacteria 9762
525 Ga0495606_0009788 3300046507 Bacteria 8055
526 Ga0495606_0010800 3300046507 Bacteria 7525
527 Ga0495606_0015153 3300046507 Bacteria 5959
528 Ga0495606_0020697 3300046507 Bacteria 4840
529 Ga0495606_0020850 3300046507 Bacteria 4816
530 Ga0495610_0003606 3300046512 Bacteria 11955
531 Ga0495610_0004407 3300046512 Bacteria 10412
532 Ga0495610_0007496 3300046512 Bacteria 7250
533 Ga0495610_0007805 3300046512 Bacteria 7050
534 Ga0495610_0013547 3300046512 Bacteria 4839
535 Ga0495610_0014265 3300046512 Bacteria 4677
536 Ga0495610_0033145 3300046512 Bacteria 2673
537 Ga0495610_0080473 3300046512 Bacteria 1497
538 Ga0495616_0001150 3300046513 Bacteria 18699
539 Ga0495616_0002134 3300046513 Bacteria 13255
540 Ga0495616_0003784 3300046513 Bacteria 9649
541 Ga0495616_0006798 3300046513 Bacteria 6893
542 Ga0495616_0009231 3300046513 Bacteria 5783
543 Ga0495616_0010919 3300046513 Bacteria 5229
544 Ga0495620_0000003 3300046515 Bacteria 345923
545 Ga0495620_0001671 3300046515 Bacteria 13079
546 Ga0495620_0002532 3300046515 Bacteria 10581
547 Ga0495620_0006904 3300046515 Bacteria 6203
548 Ga0495620_0011962 3300046515 Bacteria 4507
549 Ga0495620_0047826 3300046515 Bacteria 1838
550 Ga0495631_0000224 3300046518 Bacteria 38891
551 Ga0495631_0002487 3300046518 Bacteria 10373
552 Ga0495631_0003213 3300046518 Bacteria 9001
553 Ga0495631_0013207 3300046518 Bacteria 4014
554 Ga0495632_0001301 3300046519 Bacteria 21124
555 Ga0495632_0003179 3300046519 Bacteria 11840
556 Ga0495632_0004423 3300046519 Bacteria 9552
557 Ga0495632_0007835 3300046519 Bacteria 6646
558 Ga0495632_0007843 3300046519 Bacteria 6644
559 Ga0495632_0024356 3300046519 Bacteria 3216
560 Ga0495632_0036309 3300046519 Bacteria 2507
561 Ga0495637_0000618 3300046520 Bacteria 25102
562 Ga0495637_0001387 3300046520 Bacteria 14468
563 Ga0495637_0001533 3300046520 Bacteria 13507
564 Ga0495637_0004838 3300046520 Bacteria 6931
565 Ga0495637_0004840 3300046520 Bacteria 6929
566 Ga0495637_0008746 3300046520 Bacteria 4962
567 Ga0495637_0009469 3300046520 Bacteria 4750
568 Ga0495637_0012841 3300046520 Bacteria 3994
569 Ga0495637_0012941 3300046520 Bacteria 3976
570 Ga0495637_0034373 3300046520 Bacteria 2220
571 Ga0495643_0000116 3300046522 Bacteria 130165
572 Ga0495643_0001999 3300046522 Bacteria 17004
573 Ga0495643_0003288 3300046522 Bacteria 11937
574 Ga0495643_0007210 3300046522 Bacteria 7207
575 Ga0495643_0008409 3300046522 Bacteria 6536
576 Ga0495643_0061432 3300046522 Bacteria 1992
577 Ga0495643_0061669 3300046522 Bacteria 1987
578 Ga0495644_0001169 3300046523 Bacteria 10773
579 Ga0495644_0004677 3300046523 Bacteria 5379
580 Ga0495644_0012534 3300046523 Bacteria 3259
581 Ga0495648_0002887 3300046524 Bacteria 15460
582 Ga0495648_0003903 3300046524 Bacteria 12925
583 Ga0495648_0003971 3300046524 Bacteria 12799
584 Ga0495648_0005915 3300046524 Bacteria 10066
585 Ga0495648_0010961 3300046524 Bacteria 6873
586 Ga0495648_0018105 3300046524 Bacteria 5007
587 Ga0495648_0029602 3300046524 Bacteria 3631
588 Ga0495648_0031945 3300046524 Bacteria 3462
589 Ga0495666_0005182 3300046526 Bacteria 6582
590 Ga0495666_0006948 3300046526 Bacteria 5688
591 Ga0495666_0066631 3300046526 Bacteria 1716
592 Ga0495642_0000755 3300046528 Bacteria 15893
593 Ga0495642_0001318 3300046528 Bacteria 11122
594 Ga0495642_0004141 3300046528 Bacteria 5658
595 Ga0495642_0044456 3300046528 Bacteria 1813
596 Ga0495654_0001647 3300046530 Bacteria 15116
597 Ga0495654_0003640 3300046530 Bacteria 9360
598 Ga0495654_0005070 3300046530 Bacteria 7708
599 Ga0495654_0005362 3300046530 Bacteria 7466
600 Ga0495654_0007126 3300046530 Bacteria 6283
601 Ga0495654_0007409 3300046530 Bacteria 6131
602 Ga0495654_0007656 3300046530 Bacteria 6012
603 Ga0495654_0011965 3300046530 Bacteria 4677
604 Ga0495654_0027342 3300046530 Bacteria 2925
605 Ga0495654_0056387 3300046530 Bacteria 1899
606 Ga0495587_0007965 3300046536 Bacteria 6845
607 Ga0495609_0003739 3300046538 Bacteria 8592
608 Ga0495609_0031721 3300046538 Bacteria 2400
609 Ga0495597_0004952 3300046542 Bacteria 7160
610 Ga0495597_0005985 3300046542 Bacteria 6344
611 Ga0495597_0006410 3300046542 Bacteria 6090
612 Ga0495597_0022758 3300046542 Bacteria 2904
613 Ga0495597_0025968 3300046542 Bacteria 2692
614 Ga0495622_0001403 3300046557 Bacteria 12217
615 Ga0495622_0001827 3300046557 Bacteria 10499
616 Ga0495622_0003204 3300046557 Bacteria 7751
617 Ga0495622_0017228 3300046557 Bacteria 3363
618 Ga0495622_0024888 3300046557 Bacteria 2795
619 Ga0495622_0047330 3300046557 Bacteria 1998
620 Ga0495633_0011010 3300046558 Bacteria 4908
621 Ga0495656_0004366 3300046615 Bacteria 4836
622 Ga0495668_0002475 3300046616 Bacteria 15184
623 Ga0495668_0003410 3300046616 Bacteria 11938
624 Ga0495634_0003166 3300046642 Bacteria 13318
625 Ga0495611_0000981 3300046648 Bacteria 15165
626 Ga0495625_0006599 3300046660 Bacteria 10303
627 Ga0495625_0026915 3300046660 Bacteria 4336
628 Ga0495625_0053000 3300046660 Bacteria 2903
629 Ga0495625_0098865 3300046660 Bacteria 2006
630 Ga0495625_0098963 3300046660 Bacteria 2005
631 Ga0495635_0018760 3300046663 Bacteria 4826
632 Ga0495635_0026215 3300046663 Bacteria 4059
633 Ga0495659_0000807 3300046664 Bacteria 11189
634 Ga0495659_0011186 3300046664 Bacteria 2890
635 Ga0495661_0004997 3300046665 Bacteria 9469
636 Ga0495661_0007855 3300046665 Bacteria 7421
637 Ga0495661_0065663 3300046665 Bacteria 2137
638 Ga0495661_0080877 3300046665 Bacteria 1874
639 Ga0495661_0103762 3300046665 Bacteria 1595
640 Ga0495588_0011374 3300046674 Bacteria 4173
641 Ga0495624_0002472 3300046690 Bacteria 14009
642 Ga0495670_0000886 3300046691 Bacteria 14510
643 Ga0495670_0001480 3300046691 Bacteria 11471
644 Ga0495670_0002624 3300046691 Bacteria 8877
645 Ga0495670_0008648 3300046691 Bacteria 5009
646 Ga0495670_0009932 3300046691 Bacteria 4678
647 Ga0495671_0000750 3300046692 Bacteria 23356
648 Ga0495671_0009315 3300046692 Bacteria 5486
649 Ga0495671_0009555 3300046692 Bacteria 5413
650 Ga0495671_0011262 3300046692 Bacteria 4931
651 Ga0495671_0013189 3300046692 Bacteria 4487
652 Ga0495671_0015763 3300046692 Bacteria 4043
653 Ga0495671_0030240 3300046692 Bacteria 2774
654 Ga0495671_0033866 3300046692 Bacteria 2600
655 Ga0495671_0042777 3300046692 Bacteria 2275
656 Ga0495671_0058831 3300046692 Bacteria 1900
657 Ga0495649_0000333 3300046694 Bacteria 40629
658 Ga0495649_0000406 3300046694 Bacteria 37419
659 Ga0495649_0002040 3300046694 Bacteria 14577
660 Ga0495649_0007189 3300046694 Bacteria 6829
661 Ga0495649_0009716 3300046694 Bacteria 5699
662 Ga0495649_0011856 3300046694 Bacteria 5096
663 Ga0495649_0016162 3300046694 Bacteria 4234
664 Ga0495649_0041868 3300046694 Bacteria 2503
665 Ga0495649_0060117 3300046694 Bacteria 2044
666 Ga0495589_0000769 3300046794 Bacteria 20491
667 Ga0495589_0001719 3300046794 Bacteria 12452
668 Ga0495589_0005836 3300046794 Bacteria 6497
669 Ga0495589_0006524 3300046794 Bacteria 6152
670 Ga0495589_0010289 3300046794 Bacteria 4861
671 Ga0495589_0010292 3300046794 Bacteria 4860
672 Ga0495589_0014537 3300046794 Bacteria 4051
673 Ga0495660_0008322 3300046810 Bacteria 6072
674 Ga0495660_0010608 3300046810 Bacteria 5359
675 Ga0495660_0018795 3300046810 Bacteria 3968
676 Ga0495660_0029456 3300046810 Bacteria 3097
677 Ga0495660_0043450 3300046810 Bacteria 2478
678 Ga0495660_0055382 3300046810 Bacteria 2147
679 Ga0495660_0095799 3300046810 Bacteria 1534
680 Ga0495604_0051202 3300047317 Bacteria 3202
681 Ga0495636_0006392 3300047318 Bacteria 4629
682 Ga0495674_0028934 3300047319 Bacteria 5047
683 Ga0495672_0001280 3300047320 Bacteria 25072
684 Ga0495672_0003260 3300047320 Bacteria 14062
685 Ga0495672_0003963 3300047320 Bacteria 12392
686 Ga0495672_0004654 3300047320 Bacteria 11129
687 Ga0495672_0004820 3300047320 Bacteria 10877
688 Ga0495672_0004863 3300047320 Bacteria 10809
689 Ga0495672_0005097 3300047320 Bacteria 10490
690 Ga0495672_0006765 3300047320 Bacteria 8787
691 Ga0495672_0007965 3300047320 Bacteria 7898
692 Ga0495672_0027802 3300047320 Bacteria 3589
693 Ga0495672_0049869 3300047320 Bacteria 2475
694 Ga0495676_0007897 3300047321 Bacteria 9755
695 Ga0495683_0001278 3300047323 Bacteria 17054
696 Ga0495683_0001496 3300047323 Bacteria 15251
697 Ga0495683_0006496 3300047323 Bacteria 6387
698 Ga0495683_0010675 3300047323 Bacteria 4847
699 Ga0495687_001318 3300047443 Bacteria 23203
700 Ga0495687_002198 3300047443 Bacteria 16164
701 Ga0495687_005828 3300047443 Bacteria 7723
702 Ga0495687_011160 3300047443 Bacteria 4853
703 Ga0495675_0009783 3300047444 Bacteria 5980
704 Ga0495677_0001558 3300047445 Bacteria 9246
705 Ga0495679_008195 3300047446 Bacteria 4273
706 Ga0495679_011134 3300047446 Bacteria 3491
707 Ga0495673_0001648 3300047469 Bacteria 17241
708 Ga0495673_0001922 3300047469 Bacteria 15486
709 Ga0495673_0003212 3300047469 Bacteria 10915
710 Ga0495673_0007907 3300047469 Bacteria 6038
711 Ga0495673_0008165 3300047469 Bacteria 5919
712 Ga0495673_0011998 3300047469 Bacteria 4624
713 Ga0495673_0021936 3300047469 Bacteria 3139
714 Ga0495673_0026775 3300047469 Bacteria 2751
715 Ga0495673_0028612 3300047469 Bacteria 2638
716 Ga0495673_0033154 3300047469 Bacteria 2399
717 Ga0495681_0000707 3300047470 Bacteria 25515
718 Ga0495681_0003046 3300047470 Bacteria 11775
719 Ga0495681_0003760 3300047470 Bacteria 10523
720 Ga0495681_0004427 3300047470 Bacteria 9577
721 Ga0495681_0005083 3300047470 Bacteria 8868
722 Ga0495681_0018049 3300047470 Bacteria 3898
723 Ga0495681_0035785 3300047470 Bacteria 2462
724 Ga0495686_0005886 3300047472 Bacteria 9558
725 Ga0495686_0015228 3300047472 Bacteria 5262
726 Ga0495686_0017064 3300047472 Bacteria 4901
727 Ga0495593_0011264 3300047673 Bacteria 5139
728 Ga0495593_0021904 3300047673 Bacteria 3565
729 Ga0495602_0030014 3300048088 Bacteria 5165
730 Ga0495626_0000658 3300048091 Bacteria 33195
731 Ga0495626_0001692 3300048091 Bacteria 16949
732 Ga0495626_0001697 3300048091 Bacteria 16933
733 Ga0495626_0003331 3300048091 Bacteria 10368
734 Ga0495626_0004081 3300048091 Bacteria 9091
735 Ga0495626_0004890 3300048091 Bacteria 8054
736 Ga0495626_0005353 3300048091 Bacteria 7542
737 Ga0496102_0003153 3300048905 Bacteria 13982
738 Ga0496106_0071209 3300048909 Bacteria 2657
739 Ga0496108_0029323 3300048911 Unclassified 4555
740 Ga0496109_0013168 3300048912 Bacteria 7158
741 Ga0496116_0000492 3300048919 Bacteria 54331
742 Ga0496116_0017628 3300048919 Bacteria 5534
743 Ga0496116_0019081 3300048919 Bacteria 5263
744 Ga0496117_0001334 3300048920 Bacteria 36300
745 Ga0496117_0003743 3300048920 Bacteria 17414
746 Ga0496117_0006594 3300048920 Bacteria 11670
747 Ga0496117_0010034 3300048920 Bacteria 8702
748 Ga0496117_0028183 3300048920 Bacteria 4353
749 Ga0496117_0056606 3300048920 Bacteria 2729
750 Ga0496117_0065362 3300048920 Bacteria 2474
751 Ga0496117_0086595 3300048920 Bacteria 2034
752 Ga0496117_0106819 3300048920 Bacteria 1755
753 Ga0496118_0002770 3300048921 Bacteria 22961
754 Ga0496118_0010803 3300048921 Bacteria 8995
755 Ga0496118_0016385 3300048921 Bacteria 6802
756 Ga0496118_0035872 3300048921 Bacteria 4017
757 Ga0496118_0065390 3300048921 Bacteria 2661
758 Ga0496118_0115907 3300048921 Bacteria 1762
759 Ga0496119_0000207 3300048922 Bacteria 83748
760 Ga0496119_0006721 3300048922 Bacteria 10568
761 Ga0496119_0048067 3300048922 Bacteria 2649
762 Ga0496120_0003397 3300048923 Bacteria 14561
763 Ga0496120_0005268 3300048923 Bacteria 10385
764 Ga0496121_0000921 3300048924 Bacteria 53187
765 Ga0496121_0025675 3300048924 Bacteria 5582
766 Ga0496121_0037143 3300048924 Bacteria 4330
767 Ga0496121_0039458 3300048924 Bacteria 4161
768 Ga0496122_0002533 3300048925 Bacteria 25730
769 Ga0496122_0006320 3300048925 Bacteria 13640
770 Ga0496123_0000387 3300048926 Bacteria 82706
771 Ga0496123_0001516 3300048926 Bacteria 32166
772 Ga0496123_0019807 3300048926 Bacteria 5285
773 Ga0496123_0081031 3300048926 Bacteria 1974
774 Ga0496124_0003921 3300048927 Bacteria 17770
775 Ga0496124_0007969 3300048927 Bacteria 11151
776 Ga0496124_0010730 3300048927 Bacteria 9237
777 Ga0496124_0013388 3300048927 Bacteria 8010
778 Ga0496124_0016920 3300048927 Bacteria 6908
779 Ga0496124_0018386 3300048927 Bacteria 6546
780 Ga0496124_0021340 3300048927 Bacteria 5968
781 Ga0496124_0024939 3300048927 Bacteria 5425
782 Ga0496124_0048868 3300048927 Bacteria 3611
783 Ga0496125_0003468 3300048928 Bacteria 19086
784 Ga0496125_0003963 3300048928 Bacteria 17442
785 Ga0496125_0011039 3300048928 Bacteria 9066
786 Ga0496125_0021596 3300048928 Bacteria 6000
787 Ga0496125_0022287 3300048928 Bacteria 5885
788 Ga0496125_0034870 3300048928 Bacteria 4427
789 Ga0496126_0016878 3300048929 Bacteria 7287
790 Ga0496126_0050203 3300048929 Bacteria 3803
791 Ga0496126_0084656 3300048929 Bacteria 2796
792 Ga0495678_001206 3300049459 Bacteria 21235
793 Ga0495678_004100 3300049459 Bacteria 8634
794 Ga0495678_007204 3300049459 Bacteria 5797
795 Ga0495678_009544 3300049459 Bacteria 4792
796 Ga0495678_021940 3300049459 Bacteria 2801
797 Ga0495678_030356 3300049459 Bacteria 2262
798 Ga0495682_0001922 3300049460 Bacteria 10343
799 Ga0495682_0003432 3300049460 Bacteria 7038
800 Ga0501034_0000370 3300049571 Bacteria 76588
801 Ga0501034_0121014 3300049571 Bacteria 2604
802 Ga0501039_0023003 3300049575 Bacteria 4780
803 Ga0501076_0021040 3300049592 Bacteria 4999
804 Ga0501209_013131 3300049656 Bacteria 1785
805 Ga0501226_000005 3300049853 Bacteria 271019
806 nmdc:mga03683_32130_c1 3300050489 Bacteria 2110
807 nmdc:mga0k408_18339_c1 3300050493 Bacteria 3397
808 nmdc:mga09592_310473_c1 3300050508 Bacteria 1367
809 nmdc:mga08y16_116170_c1 3300050511 Bacteria 2786
810 Ga0495619_0019399 3300053085 Bacteria 4322
811 Ga0500572_001966 3300053111 Bacteria 5157
812 Ga0500634_0005001 3300053161 Bacteria 6232

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053085 Ga0495619_0019399 Ga0495619_0019399_1592_2731 351
2 3300034817 Ga0373948_0014714 Ga0373948_0014714_13_1122 361
3 3300046453 Ga0495627_006483 Ga0495627_006483_3426_4571 381
4 3300046660 Ga0495625_0026915 Ga0495625_0026915_23_1168 381
5 3300046665 Ga0495661_0103762 Ga0495661_0103762_429_1583 384
6 3300013308 Ga0157375_10022752 Ga0157375_100227526 386
7 3300046453 Ga0495627_054762 Ga0495627_054762_11_1180 389
8 3300048919 Ga0496116_0019081 Ga0496116_0019081_21_1190 389
9 iso_pu_bacteria 2526164512 2526212174 392
10 3300006237 Ga0097621_100005368 Ga0097621_1000053688 393
11 3300006358 Ga0068871_100022645 Ga0068871_1000226455 393
12 3300009177 Ga0105248_10143438 Ga0105248_101434381 393
13 3300025941 Ga0207711_10049864 Ga0207711_100498643 393
14 iso_pu_bacteria 2808606373 2808904920 394
15 iso_pu_bacteria 2990196909 2990200373 394
16 3300005545 Ga0070695_100029773 Ga0070695_1000297732 395
17 3300006852 Ga0075433_10117466 Ga0075433_101174662 395
18 iso_pu_bacteria 2511231004 2511253971 395
19 iso_pu_bacteria 2511231006 2511264135 395
20 iso_pu_bacteria 2511231007 2511273591 395
21 iso_pu_bacteria 2511231008 2511277060 395
22 iso_pu_bacteria 2511231010 2511289995 395
23 iso_pu_bacteria 2511231011 2511297634 395
24 iso_pu_bacteria 2511231012 2511299851 395
25 iso_pu_bacteria 2511231014 2511315606 395
26 iso_pu_bacteria 2511231015 2511320481 395
27 iso_pu_bacteria 2511231016 2511328848 395
28 iso_pu_bacteria 2511231017 2511332365 395
29 iso_pu_bacteria 2511231018 2511338695 395
30 iso_pu_bacteria 2511231019 2511346043 395
31 iso_pu_bacteria 2511231020 2511352776 395
32 iso_pu_bacteria 2511231021 2511355806 395
33 iso_pu_bacteria 2511231022 2511363789 395
34 iso_pu_bacteria 2511231023 2511369113 395
35 iso_pu_bacteria 2511231024 2511377711 395
36 iso_pu_bacteria 2511231031 2511411086 395
37 iso_pu_bacteria 2511231156 2511823056 395
38 iso_pu_bacteria 2512047018 2512328342 395
39 iso_pu_bacteria 2554235231 2555247766 395
40 iso_pu_bacteria 2554235341 2555668072 395
41 iso_pu_bacteria 2582580891 2583790513 395
42 iso_pu_bacteria 2597489887 2597856286 395
43 iso_pu_bacteria 2597489888 2597865769 395
44 iso_pu_bacteria 2597489889 2597871585 395
45 iso_pu_bacteria 2599185160 2599355071 395
46 iso_pu_bacteria 2599185161 2599361105 395
47 iso_pu_bacteria 2599185162 2599367427 395
48 iso_pu_bacteria 2599185163 2599374217 395
49 iso_pu_bacteria 2599185164 2599380177 395
50 iso_pu_bacteria 2599185165 2599386624 395
51 iso_pu_bacteria 2599185166 2599393075 395
52 iso_pu_bacteria 2599185167 2599399874 395
53 iso_pu_bacteria 2599185168 2599404842 395
54 iso_pu_bacteria 2599185179 2599452657 395
55 iso_pu_bacteria 2599185181 2599461905 395
56 iso_pu_bacteria 2599185182 2599467052 395
57 iso_pu_bacteria 2599185185 2599483458 395
58 iso_pu_bacteria 2599185186 2599491002 395
59 iso_pu_bacteria 2599185188 2599501164 395
60 iso_pu_bacteria 2599185189 2599508254 395
61 iso_pu_bacteria 2599185190 2599514328 395
62 iso_pu_bacteria 2599185191 2599521548 395
63 iso_pu_bacteria 2599185212 2599613877 395
64 iso_pu_bacteria 2599185248 2599770767 395
65 iso_pu_bacteria 2599185257 2599805364 395
66 iso_pu_bacteria 2599185288 2599881923 395
67 iso_pu_bacteria 2599185289 2599886645 395
68 iso_pu_bacteria 2599185290 2599893704 395
69 iso_pu_bacteria 2599185291 2599897014 395
70 iso_pu_bacteria 2599185300 2599934718 395
71 iso_pu_bacteria 2599185302 2599943016 395
72 iso_pu_bacteria 2599185303 2599951696 395
73 iso_pu_bacteria 2599185304 2599953945 395
74 iso_pu_bacteria 2599185305 2599959455 395
75 iso_pu_bacteria 2599185306 2599968024 395
76 iso_pu_bacteria 2599185308 2599979253 395
77 iso_pu_bacteria 2599185309 2599985312 395
78 iso_pu_bacteria 2599185310 2599987236 395
79 iso_pu_bacteria 2599185311 2599995454 395
80 iso_pu_bacteria 2599185312 2599999935 395
81 iso_pu_bacteria 2599185313 2600008806 395
82 iso_pu_bacteria 2599185314 2600013138 395
83 iso_pu_bacteria 2599185315 2600016650 395
84 iso_pu_bacteria 2599185316 2600025329 395
85 iso_pu_bacteria 2599185317 2600029615 395
86 iso_pu_bacteria 2599185318 2600035493 395
87 iso_pu_bacteria 2599185319 2600041340 395
88 iso_pu_bacteria 2599185320 2600045563 395
89 iso_pu_bacteria 2599185321 2600056620 395
90 iso_pu_bacteria 2599185322 2600058469 395
91 iso_pu_bacteria 2599185323 2600063861 395
92 iso_pu_bacteria 2599185324 2600074146 395
93 iso_pu_bacteria 2599185325 2600079826 395
94 iso_pu_bacteria 2599185356 2600214527 395
95 iso_pu_bacteria 2600254930 2600358293 395
96 iso_pu_bacteria 2600254931 2600364069 395
97 iso_pu_bacteria 2600255296 2601692784 395
98 iso_pu_bacteria 2600255313 2601774768 395
99 iso_pu_bacteria 2600255318 2601800102 395
100 iso_pu_bacteria 2603880185 2606074633 395
101 iso_pu_bacteria 2603880199 2606127496 395
102 iso_pu_bacteria 2606217733 2608381262 395
103 iso_pu_bacteria 2619619299 2621297765 395
104 iso_pu_bacteria 2623620443 2624478849 395
105 iso_pu_bacteria 2623620446 2624490371 395
106 iso_pu_bacteria 2643221565 2643842455 395
107 iso_pu_bacteria 2643221571 2643873654 395
108 iso_pu_bacteria 2643221589 2643955316 395
109 iso_pu_bacteria 2643221602 2644023668 395
110 iso_pu_bacteria 2643221633 2644188155 395
111 iso_pu_bacteria 2643221650 2644281563 395
112 iso_pu_bacteria 2643221713 2644623448 395
113 iso_pu_bacteria 2651869719 2652545745 395
114 iso_pu_bacteria 2667528170 2671094487 395
115 iso_pu_bacteria 2667528171 2671097672 395
116 iso_pu_bacteria 2667528176 2671127900 395
117 iso_pu_bacteria 2671180172 2671767901 395
118 iso_pu_bacteria 2675903420 2677897932 395
119 iso_pu_bacteria 2675903515 2678261588 395
120 iso_pu_bacteria 2713897148 2715750785 395
121 iso_pu_bacteria 2713897149 2715757566 395
122 iso_pu_bacteria 2718217725 2718632735 395
123 iso_pu_bacteria 2721755607 2723250501 395
124 iso_pu_bacteria 2738541265 2738670883 395
125 iso_pu_bacteria 2738541282 2738749277 395
126 iso_pu_bacteria 2738541294 2738811295 395
127 iso_pu_bacteria 2738541303 2738858318 395
128 iso_pu_bacteria 2738541309 2738898655 395
129 iso_pu_bacteria 2738543004 2739196590 395
130 iso_pu_bacteria 2738543015 2739257568 395
131 iso_pu_bacteria 2738543020 2739286495 395
132 iso_pu_bacteria 2738543021 2739291808 395
133 iso_pu_bacteria 2738543025 2739316455 395
134 iso_pu_bacteria 2740892503 2743735696 395
135 iso_pu_bacteria 2744054620 2745007937 395
136 iso_pu_bacteria 2765235841 2765582258 395
137 iso_pu_bacteria 2773857670 2774122192 395
138 iso_pu_bacteria 2773857673 2774136672 395
139 iso_pu_bacteria 2784132063 2784260424 395
140 iso_pu_bacteria 2784132072 2784317551 395
141 iso_pu_bacteria 2791355520 2794594386 395
142 iso_pu_bacteria 2806310737 2807409872 395
143 iso_pu_bacteria 2806310745 2807458220 395
144 iso_pu_bacteria 2808606361 2808854109 395
145 iso_pu_bacteria 2808606376 2808923400 395
146 iso_pu_bacteria 2808606377 2808928729 395
147 iso_pu_bacteria 2808606378 2808934141 395
148 iso_pu_bacteria 2808606379 2808943039 395
149 iso_pu_bacteria 2808606380 2808945325 395
150 iso_pu_bacteria 2808606381 2808950850 395
151 iso_pu_bacteria 2808606382 2808956652 395
152 iso_pu_bacteria 2808606383 2808962458 395
153 iso_pu_bacteria 2808606385 2808980200 395
154 iso_pu_bacteria 2808606388 2808995977 395
155 iso_pu_bacteria 2808606389 2808997501 395
156 iso_pu_bacteria 2808606445 2809215788 395
157 iso_pu_bacteria 2811994881 2812370915 395
158 iso_pu_bacteria 2816332298 2817493101 395
159 iso_pu_bacteria 2818991456 2819658406 395
160 iso_pu_bacteria 2818991464 2819702755 395
161 iso_pu_bacteria 2825651385 2825653689 395
162 iso_pu_bacteria 2834028612 2834034198 395
163 iso_pu_bacteria 2842805378 2842808864 395
164 iso_pu_bacteria 2842826826 2842829726 395
165 iso_pu_bacteria 2842832357 2842835681 395
166 iso_pu_bacteria 2842837860 2842843202 395
167 iso_pu_bacteria 2842843487 2842847429 395
168 iso_pu_bacteria 2842854478 2842857244 395
169 iso_pu_bacteria 2844665904 2844668569 395
170 iso_pu_bacteria 2852612431 2852612514 395
171 iso_pu_bacteria 2852657418 2852662716 395
172 iso_pu_bacteria 2852667396 2852669750 395
173 iso_pu_bacteria 2860339153 2860340610 395
174 iso_pu_bacteria 2878029506 2878030813 395
175 iso_pu_bacteria 2880230671 2880231728 395
176 iso_pu_bacteria 2904518522 2904520763 395
177 iso_pu_bacteria 2904550169 2904553087 395
178 iso_pu_bacteria 2908446538 2908451692 395
179 iso_pu_bacteria 2912963787 2912964912 395
180 iso_pu_bacteria 2913036834 2913037928 395
181 iso_pu_bacteria 2917070673 2917071833 395
182 iso_pu_bacteria 2919063839 2919064681 395
183 iso_pu_bacteria 2919155634 2919158856 395
184 iso_pu_bacteria 2919385768 2919385865 395
185 iso_pu_bacteria 2919456309 2919458255 395
186 iso_pu_bacteria 2919481497 2919482835 395
187 iso_pu_bacteria 2919487758 2919490650 395
188 iso_pu_bacteria 2919697872 2919703704 395
189 iso_pu_bacteria 2923153595 2923154705 395
190 iso_pu_bacteria 2923519811 2923525020 395
191 iso_pu_bacteria 2923586266 2923591760 395
192 iso_pu_bacteria 2929144301 2929145380 395
193 iso_pu_bacteria 2929189879 2929194300 395
194 iso_pu_bacteria 2931369376 2931371280 395
195 iso_pu_bacteria 2931390751 2931395574 395
196 iso_pu_bacteria 2931396565 2931399487 395
197 iso_pu_bacteria 2935353572 2935354006 395
198 iso_pu_bacteria 2939636861 2939637056 395
199 iso_pu_bacteria 2939651529 2939653269 395
200 iso_pu_bacteria 2945928738 2945931756 395
201 iso_pu_bacteria 2945961074 2945961396 395
202 iso_pu_bacteria 2946006987 2946007839 395
203 iso_pu_bacteria 2947233263 2947233539 395
204 iso_pu_bacteria 2969304461 2969305638 395
205 iso_pu_bacteria 2974289157 2974292732 395
206 iso_pu_bacteria 2984286254 2984291324 395
207 iso_pu_bacteria 2988728565 2988732924 395
208 iso_pu_bacteria 2998139840 2998141079 395
209 iso_pu_bacteria 3007395558 3007400234 395
210 iso_pu_bacteria 3007419365 3007420716 395
211 iso_pu_bacteria 3007511990 3007512451 395
212 iso_pu_bacteria 3007614139 3007619683 395
213 iso_pu_bacteria 3007619802 3007620979 395
214 iso_pu_bacteria 3007718800 3007721441 395
215 iso_pu_bacteria 3007803356 3007808237 395
216 iso_pu_bacteria 3007855910 3007860960 395
217 iso_pu_bacteria 3007861166 3007863700 395
218 iso_pu_bacteria 3007866637 3007871278 395
219 iso_pu_bacteria 3007872151 3007873367 395
220 iso_pu_bacteria 637000220 637318450 395
221 iso_pu_bacteria 8011350971 8011354286 395
222 iso_pu_bacteria 8015687852 8015688941 395
223 iso_pu_bacteria 8019769354 8019773318 395
224 iso_pu_bacteria 8019775933 8019781854 395
225 iso_pu_bacteria 8029995093 8029999683 395
226 iso_pu_bacteria 8052494512 8052495709 395
227 iso_pu_bacteria 8054285046 8054286184 395
228 iso_pu_bacteria 8054347763 8054351149 395
229 iso_pu_bacteria 8054503363 8054508087 395
230 iso_pu_bacteria 8054929484 8054929518 395
231 iso_pu_bacteria 8055770955 8055772058 395
232 iso_pu_bacteria 8055817908 8055823040 395
233 iso_pu_bacteria 8055878733 8055883270 395
234 iso_pu_bacteria 8056115690 8056120221 395
235 iso_pu_bacteria 8056120720 8056121927 395
236 iso_pu_bacteria 8056125926 8056130789 395
237 iso_pu_bacteria 8056131705 8056136456 395
238 iso_pu_bacteria 8056137416 8056141848 395
239 iso_pu_bacteria 8056143049 8056147901 395
240 iso_pu_bacteria 8056148874 8056153505 395
241 iso_pu_bacteria 8056155041 8056159683 395
242 iso_pu_bacteria 8056161164 8056162708 395
243 iso_pu_bacteria 8056166840 8056169972 395
244 iso_pu_bacteria 8056172158 8056176105 395
245 iso_pu_bacteria 8056177738 8056183403 395
246 iso_pu_bacteria 8056569372 8056569730 395
247 iso_pu_bacteria 8057798959 8057803346 395
248 3300005841 Ga0068863_100048109 Ga0068863_1000481093 396
249 3300010375 Ga0105239_10203812 Ga0105239_102038121 396
250 3300011119 Ga0105246_10120480 Ga0105246_101204802 396
251 3300013308 Ga0157375_10080848 Ga0157375_100808483 396
252 3300014968 Ga0157379_10046791 Ga0157379_100467912 396
253 3300014969 Ga0157376_10091377 Ga0157376_100913771 396
254 3300025942 Ga0207689_10012165 Ga0207689_100121656 396
255 3300026118 Ga0207675_100255916 Ga0207675_1002559162 396
256 3300042016 Ga0439463_000222 Ga0439463_000222_7765_8955 396
257 3300049592 Ga0501076_0021040 Ga0501076_0021040_984_2174 396
258 3300006195 Ga0075366_10002142 Ga0075366_1000214210 397
259 3300006195 Ga0075366_10026616 Ga0075366_100266162 397
260 3300041405 Ga0439438_005356 Ga0439438_005356_345_1538 397
261 3300050493 nmdc:mga0k408_18339_c1 nmdc:mga0k408_18339_c1_855_2048 397
262 3300005544 Ga0070686_100078621 Ga0070686_1000786212 398
263 3300042115 Ga0450911_000096 Ga0450911_000096_5776_6972 398
264 3300049853 Ga0501226_000005 Ga0501226_000005_80290_81486 398
265 2162886007 SwRhRL2b_contig_1365810 SwRhRL2b_0278.00002350 399
266 2162886007 SwRhRL2b_contig_3491391 SwRhRL2b_0428.00001330 399
267 3300002737 JGI25162J39368_1000126 JGI25162J39368_100012642 399
268 3300002737 JGI25162J39368_1000257 JGI25162J39368_100025721 399
269 3300002771 JGI25163J39215_1000103 JGI25163J39215_10001037 399
270 3300002771 JGI25163J39215_1000331 JGI25163J39215_10003315 399
271 3300002772 JGI25164J39214_1000100 JGI25164J39214_100010042 399
272 3300002772 JGI25164J39214_1000202 JGI25164J39214_100020232 399
273 3300003214 JGI25165J46597_1000207 JGI25165J46597_100020742 399
274 3300003214 JGI25165J46597_1000361 JGI25165J46597_100036132 399
275 3300003751 Ga0055538_1000028 Ga0055538_10000286 399
276 3300003752 Ga0055539_1000037 Ga0055539_10000376 399
277 3300003756 Ga0055533_1000047 Ga0055533_10000476 399
278 3300003758 Ga0055532_1000129 Ga0055532_100012966 399
279 3300003759 Ga0055525_1000443 Ga0055525_100044316 399
280 3300003781 Ga0055536_1000305 Ga0055536_10003057 399
281 3300003781 Ga0055536_1000508 Ga0055536_100050817 399
282 3300003781 Ga0055536_1001255 Ga0055536_100125511 399
283 3300003791 Ga0055530_10000839 Ga0055530_1000083917 399
284 3300003791 Ga0055530_10000961 Ga0055530_100009617 399
285 3300003791 Ga0055530_10001388 Ga0055530_1000138813 399
286 3300003792 Ga0055540_1000576 Ga0055540_100057617 399
287 3300003792 Ga0055540_1000882 Ga0055540_10008826 399
288 3300003792 Ga0055540_1001025 Ga0055540_100102513 399
289 3300003794 Ga0055531_10004261 Ga0055531_100042613 399
290 3300003841 Ga0055541_1000025 Ga0055541_10000256 399
291 3300005288 Ga0065714_10000132 Ga0065714_100001323 399
292 3300005288 Ga0065714_10005553 Ga0065714_100055531 399
293 3300005288 Ga0065714_10005866 Ga0065714_100058663 399
294 3300005288 Ga0065714_10006337 Ga0065714_100063373 399
295 3300005288 Ga0065714_10011464 Ga0065714_100114642 399
296 3300005288 Ga0065714_10065605 Ga0065714_100656057 399
297 3300005288 Ga0065714_10065693 Ga0065714_100656938 399
298 3300005288 Ga0065714_10066074 Ga0065714_100660745 399
299 3300005288 Ga0065714_10072057 Ga0065714_100720572 399
300 3300005288 Ga0065714_10073300 Ga0065714_100733003 399
301 3300005289 Ga0065704_10001267 Ga0065704_100012673 399
302 3300005289 Ga0065704_10005830 Ga0065704_100058302 399
303 3300005289 Ga0065704_10009564 Ga0065704_100095643 399
304 3300005289 Ga0065704_10075747 Ga0065704_100757471 399
305 3300005289 Ga0065704_10086093 Ga0065704_100860932 399
306 3300005289 Ga0065704_10105239 Ga0065704_101052392 399
307 3300005290 Ga0065712_10000712 Ga0065712_100007123 399
308 3300005290 Ga0065712_10002348 Ga0065712_100023484 399
309 3300005331 Ga0070670_100004830 Ga0070670_1000048305 399
310 3300005331 Ga0070670_100011421 Ga0070670_1000114214 399
311 3300005344 Ga0070661_100000022 Ga0070661_10000002279 399
312 3300005353 Ga0070669_100001703 Ga0070669_1000017036 399
313 3300005353 Ga0070669_100036007 Ga0070669_1000360072 399
314 3300005457 Ga0070662_100000041 Ga0070662_10000004161 399
315 3300005458 Ga0070681_10009747 Ga0070681_100097476 399
316 3300005459 Ga0068867_100155962 Ga0068867_1001559621 399
317 3300005539 Ga0068853_100005399 Ga0068853_1000053997 399
318 3300005548 Ga0070665_100065413 Ga0070665_1000654133 399
319 3300005563 Ga0068855_100155004 Ga0068855_1001550042 399
320 3300005564 Ga0070664_100000646 Ga0070664_10000064612 399
321 3300005577 Ga0068857_100085938 Ga0068857_1000859382 399
322 3300005834 Ga0068851_10000044 Ga0068851_1000004474 399
323 3300006048 Ga0075363_100104962 Ga0075363_1001049622 399
324 3300006051 Ga0075364_10021002 Ga0075364_100210022 399
325 3300006051 Ga0075364_10049614 Ga0075364_100496141 399
326 3300006058 Ga0075432_10004390 Ga0075432_100043904 399
327 3300006058 Ga0075432_10008014 Ga0075432_100080144 399
328 3300006177 Ga0075362_10027169 Ga0075362_100271692 399
329 3300006944 Ga0099823_1000054 Ga0099823_100005446 399
330 3300006946 Ga0079104_1000414 Ga0079104_10004149 399
331 3300006946 Ga0079104_1000902 Ga0079104_100090210 399
332 3300006946 Ga0079104_1015454 Ga0079104_10154542 399
333 3300006948 Ga0099826_10003858 Ga0099826_100038589 399
334 3300009011 Ga0105251_10001454 Ga0105251_1000145411 399
335 3300009011 Ga0105251_10002538 Ga0105251_1000253810 399
336 3300009011 Ga0105251_10003633 Ga0105251_100036338 399
337 3300009011 Ga0105251_10004210 Ga0105251_100042102 399
338 3300009011 Ga0105251_10007529 Ga0105251_100075294 399
339 3300009011 Ga0105251_10008536 Ga0105251_100085363 399
340 3300009011 Ga0105251_10011825 Ga0105251_100118251 399
341 3300009011 Ga0105251_10032356 Ga0105251_100323562 399
342 3300009011 Ga0105251_10046910 Ga0105251_100469101 399
343 3300009036 Ga0105244_10004672 Ga0105244_100046725 399
344 3300009036 Ga0105244_10004698 Ga0105244_100046985 399
345 3300009036 Ga0105244_10005205 Ga0105244_100052056 399
346 3300009036 Ga0105244_10006467 Ga0105244_100064674 399
347 3300009036 Ga0105244_10024035 Ga0105244_100240351 399
348 3300009036 Ga0105244_10035122 Ga0105244_100351221 399
349 3300009092 Ga0105250_10002773 Ga0105250_100027738 399
350 3300009092 Ga0105250_10003059 Ga0105250_100030593 399
351 3300009148 Ga0105243_10000312 Ga0105243_1000031230 399
352 3300009148 Ga0105243_10002146 Ga0105243_1000214611 399
353 3300009174 Ga0105241_10027898 Ga0105241_100278983 399
354 3300009176 Ga0105242_10002134 Ga0105242_100021347 399
355 3300009177 Ga0105248_10026428 Ga0105248_100264285 399
356 3300009545 Ga0105237_10001243 Ga0105237_100012435 399
357 3300009545 Ga0105237_10027467 Ga0105237_100274672 399
358 3300009551 Ga0105238_10022892 Ga0105238_100228923 399
359 3300011119 Ga0105246_10001031 Ga0105246_100010318 399
360 3300011119 Ga0105246_10018673 Ga0105246_100186735 399
361 3300011119 Ga0105246_10107322 Ga0105246_101073221 399
362 3300012498 Ga0157345_1000029 Ga0157345_10000297 399
363 3300013100 Ga0157373_10001975 Ga0157373_1000197513 399
364 3300013100 Ga0157373_10004161 Ga0157373_100041615 399
365 3300013100 Ga0157373_10018246 Ga0157373_100182466 399
366 3300013100 Ga0157373_10032739 Ga0157373_100327393 399
367 3300013100 Ga0157373_10033176 Ga0157373_100331761 399
368 3300013100 Ga0157373_10182539 Ga0157373_101825392 399
369 3300013102 Ga0157371_10001461 Ga0157371_1000146113 399
370 3300013102 Ga0157371_10008227 Ga0157371_100082274 399
371 3300013102 Ga0157371_10015251 Ga0157371_100152512 399
372 3300013104 Ga0157370_10001727 Ga0157370_1000172719 399
373 3300013105 Ga0157369_10002202 Ga0157369_1000220217 399
374 3300013105 Ga0157369_10066249 Ga0157369_100662495 399
375 3300013105 Ga0157369_10075608 Ga0157369_100756084 399
376 3300013306 Ga0163162_10005737 Ga0163162_100057376 399
377 3300013307 Ga0157372_10003985 Ga0157372_100039858 399
378 3300013307 Ga0157372_10014347 Ga0157372_100143476 399
379 3300013308 Ga0157375_10023884 Ga0157375_100238844 399
380 3300013308 Ga0157375_10034737 Ga0157375_100347375 399
381 3300014497 Ga0182008_10000323 Ga0182008_1000032324 399
382 3300014497 Ga0182008_10001287 Ga0182008_100012876 399
383 3300014497 Ga0182008_10004782 Ga0182008_100047824 399
384 3300014497 Ga0182008_10005950 Ga0182008_100059504 399
385 3300014497 Ga0182008_10007147 Ga0182008_100071475 399
386 3300014497 Ga0182008_10091192 Ga0182008_100911922 399
387 3300015261 Ga0182006_1002733 Ga0182006_10027335 399
388 3300015261 Ga0182006_1004160 Ga0182006_10041603 399
389 3300015261 Ga0182006_1006692 Ga0182006_10066924 399
390 3300015261 Ga0182006_1029816 Ga0182006_10298162 399
391 3300015261 Ga0182006_1062755 Ga0182006_10627551 399
392 3300015262 Ga0182007_10004412 Ga0182007_100044123 399
393 3300015265 Ga0182005_1000723 Ga0182005_100072311 399
394 3300017792 Ga0163161_10013192 Ga0163161_100131921 399
395 3300017792 Ga0163161_10016286 Ga0163161_100162862 399
396 3300017792 Ga0163161_10026718 Ga0163161_100267185 399
397 3300017792 Ga0163161_10046961 Ga0163161_100469612 399
398 3300017792 Ga0163161_10075384 Ga0163161_100753842 399
399 3300025206 Ga0209435_100960 Ga0209435_1009605 399
400 3300025207 Ga0209760_100021 Ga0209760_100021138 399
401 3300025207 Ga0209760_100055 Ga0209760_10005530 399
402 3300025224 Ga0209784_100032 Ga0209784_100032207 399
403 3300025225 Ga0209566_100036 Ga0209566_100036207 399
404 3300025226 Ga0209674_100054 Ga0209674_100054207 399
405 3300025229 Ga0209147_100055 Ga0209147_100055207 399
406 3300025230 Ga0209563_100055 Ga0209563_10005599 399
407 3300025231 Ga0207427_100001 Ga0207427_100001263 399
408 3300025231 Ga0207427_100004 Ga0207427_100004370 399
409 3300025233 Ga0209437_100003 Ga0209437_1000031109 399
410 3300025233 Ga0209437_100028 Ga0209437_100028206 399
411 3300025242 Ga0209258_100231 Ga0209258_10023121 399
412 3300025246 Ga0209646_1000331 Ga0209646_100033117 399
413 3300025253 Ga0209677_100033 Ga0209677_100033207 399
414 3300025261 Ga0209233_1000007 Ga0209233_1000007263 399
415 3300025261 Ga0209233_1000008 Ga0209233_1000008917 399
416 3300025292 Ga0209676_1000056 Ga0209676_100005666 399
417 3300025292 Ga0209676_1000101 Ga0209676_1000101188 399
418 3300025292 Ga0209676_1000503 Ga0209676_100050348 399
419 3300025292 Ga0209676_1001307 Ga0209676_10013076 399
420 3300025292 Ga0209676_1009559 Ga0209676_10095593 399
421 3300025292 Ga0209676_1012648 Ga0209676_10126484 399
422 3300025298 Ga0209050_1000041 Ga0209050_100004117 399
423 3300025298 Ga0209050_1000060 Ga0209050_100006072 399
424 3300025298 Ga0209050_1000361 Ga0209050_100036166 399
425 3300025298 Ga0209050_1002054 Ga0209050_100205412 399
426 3300025303 Ga0209051_1000037 Ga0209051_100003773 399
427 3300025303 Ga0209051_1000061 Ga0209051_100006166 399
428 3300025303 Ga0209051_1000085 Ga0209051_100008517 399
429 3300025304 Ga0209257_1000635 Ga0209257_100063517 399
430 3300025321 Ga0207656_10000022 Ga0207656_1000002228 399
431 3300025711 Ga0207696_1000032 Ga0207696_1000032188 399
432 3300025711 Ga0207696_1000129 Ga0207696_10001294 399
433 3300025711 Ga0207696_1000262 Ga0207696_100026254 399
434 3300025711 Ga0207696_1003053 Ga0207696_10030536 399
435 3300025711 Ga0207696_1007660 Ga0207696_10076603 399
436 3300025728 Ga0207655_1000005 Ga0207655_1000005291 399
437 3300025728 Ga0207655_1000015 Ga0207655_1000015380 399
438 3300025728 Ga0207655_1000166 Ga0207655_1000166104 399
439 3300025728 Ga0207655_1000357 Ga0207655_100035719 399
440 3300025728 Ga0207655_1000408 Ga0207655_100040812 399
441 3300025728 Ga0207655_1001002 Ga0207655_100100221 399
442 3300025728 Ga0207655_1001218 Ga0207655_100121819 399
443 3300025728 Ga0207655_1004877 Ga0207655_10048773 399
444 3300025728 Ga0207655_1005286 Ga0207655_10052862 399
445 3300025728 Ga0207655_1011306 Ga0207655_10113063 399
446 3300025728 Ga0207655_1017457 Ga0207655_10174574 399
447 3300025728 Ga0207655_1017539 Ga0207655_10175391 399
448 3300025728 Ga0207655_1053386 Ga0207655_10533862 399
449 3300025735 Ga0207713_1002613 Ga0207713_10026139 399
450 3300025735 Ga0207713_1002881 Ga0207713_10028816 399
451 3300025735 Ga0207713_1002896 Ga0207713_10028964 399
452 3300025735 Ga0207713_1003306 Ga0207713_10033068 399
453 3300025735 Ga0207713_1003614 Ga0207713_10036147 399
454 3300025735 Ga0207713_1004933 Ga0207713_10049336 399
455 3300025735 Ga0207713_1008401 Ga0207713_10084013 399
456 3300025735 Ga0207713_1009219 Ga0207713_10092192 399
457 3300025735 Ga0207713_1009521 Ga0207713_10095216 399
458 3300025735 Ga0207713_1033219 Ga0207713_10332192 399
459 3300025912 Ga0207707_10013303 Ga0207707_100133035 399
460 3300025914 Ga0207671_10000034 Ga0207671_1000003457 399
461 3300025914 Ga0207671_10081121 Ga0207671_100811212 399
462 3300025920 Ga0207649_10000006 Ga0207649_10000006196 399
463 3300025923 Ga0207681_10000978 Ga0207681_1000097810 399
464 3300025923 Ga0207681_10012413 Ga0207681_100124132 399
465 3300025925 Ga0207650_10000092 Ga0207650_1000009268 399
466 3300025925 Ga0207650_10002270 Ga0207650_100022705 399
467 3300025933 Ga0207706_10003133 Ga0207706_1000313311 399
468 3300025934 Ga0207686_10047967 Ga0207686_100479672 399
469 3300025935 Ga0207709_10000134 Ga0207709_1000013414 399
470 3300025935 Ga0207709_10000678 Ga0207709_1000067817 399
471 3300025935 Ga0207709_10011829 Ga0207709_100118294 399
472 3300025941 Ga0207711_10080218 Ga0207711_100802183 399
473 3300025945 Ga0207679_10000010 Ga0207679_10000010196 399
474 3300025949 Ga0207667_10123563 Ga0207667_101235633 399
475 3300026041 Ga0207639_10005905 Ga0207639_100059056 399
476 3300026089 Ga0207648_10099709 Ga0207648_100997092 399
477 3300026116 Ga0207674_10104924 Ga0207674_101049242 399
478 3300027111 Ga0209281_1000010 Ga0209281_1000010167 399
479 3300027111 Ga0209281_1000049 Ga0209281_1000049233 399
480 3300027111 Ga0209281_1007384 Ga0209281_10073842 399
481 3300027296 Ga0209389_1000002 Ga0209389_1000002306 399
482 3300027312 Ga0209371_1000572 Ga0209371_100057225 399
483 3300027907 Ga0207428_10018896 Ga0207428_100188963 399
484 3300027907 Ga0207428_10024567 Ga0207428_100245673 399
485 3300027907 Ga0207428_10092373 Ga0207428_100923732 399
486 3300028379 Ga0268266_10075856 Ga0268266_100758562 399
487 3300028653 Ga0265323_10035030 Ga0265323_100350302 399
488 3300030500 Ga0268256_1000499 Ga0268256_100049925 399
489 3300030735 Ga0316178_1073272 Ga0316178_107327212 399
490 3300030742 Ga0316183_1093468 Ga0316183_10934683 399
491 3300030742 Ga0316183_1141541 Ga0316183_11415413 399
492 3300031238 Ga0265332_10007136 Ga0265332_100071362 399
493 3300031344 Ga0265316_10017973 Ga0265316_100179738 399
494 3300031507 Ga0307509_10001698 Ga0307509_100016988 399
495 3300031507 Ga0307509_10199971 Ga0307509_101999712 399
496 3300031548 Ga0307408_100001076 Ga0307408_1000010763 399
497 3300031548 Ga0307408_100007882 Ga0307408_1000078825 399
498 3300031548 Ga0307408_100019289 Ga0307408_1000192891 399
499 3300031548 Ga0307408_100029500 Ga0307408_1000295004 399
500 3300031548 Ga0307408_100300883 Ga0307408_1003008831 399
501 3300031731 Ga0307405_10002721 Ga0307405_100027214 399
502 3300031731 Ga0307405_10009155 Ga0307405_100091551 399
503 3300031731 Ga0307405_10017437 Ga0307405_100174371 399
504 3300031731 Ga0307405_10031126 Ga0307405_100311262 399
505 3300031903 Ga0307407_10010099 Ga0307407_100100992 399
506 3300031911 Ga0307412_10012578 Ga0307412_100125784 399
507 3300031911 Ga0307412_10037581 Ga0307412_100375812 399
508 3300031911 Ga0307412_10080411 Ga0307412_100804111 399
509 3300031911 Ga0307412_10106499 Ga0307412_101064992 399
510 3300031911 Ga0307412_10137847 Ga0307412_101378472 399
511 3300031995 Ga0307409_100068134 Ga0307409_1000681342 399
512 3300032002 Ga0307416_100153613 Ga0307416_1001536132 399
513 3300032004 Ga0307414_10010851 Ga0307414_100108513 399
514 3300032004 Ga0307414_10042546 Ga0307414_100425463 399
515 3300032004 Ga0307414_10086035 Ga0307414_100860353 399
516 3300032004 Ga0307414_10124919 Ga0307414_101249192 399
517 3300032005 Ga0307411_10015517 Ga0307411_100155173 399
518 3300033180 Ga0307510_10006155 Ga0307510_100061556 399
519 3300038705 Ga0237819_02230 Ga0237819_02230_2709_3908 399
520 3300041404 Ga0439436_0008028 Ga0439436_0008028_103_1302 399
521 3300041405 Ga0439438_000311 Ga0439438_000311_2488_3687 399
522 3300041405 Ga0439438_003930 Ga0439438_003930_4114_5313 399
523 3300041405 Ga0439438_005616 Ga0439438_005616_3316_4515 399
524 3300041405 Ga0439438_007424 Ga0439438_007424_2150_3349 399
525 3300041405 Ga0439438_009552 Ga0439438_009552_1555_2754 399
526 3300041407 Ga0439447_001267 Ga0439447_001267_3476_4675 399
527 3300041407 Ga0439447_004020 Ga0439447_004020_1032_2231 399
528 3300041411 Ga0439466_0000511 Ga0439466_0000511_5342_6541 399
529 3300041411 Ga0439466_0001739 Ga0439466_0001739_4813_6012 399
530 3300041411 Ga0439466_0001862 Ga0439466_0001862_3998_5197 399
531 3300041411 Ga0439466_0013006 Ga0439466_0013006_449_1648 399
532 3300041411 Ga0439466_0013844 Ga0439466_0013844_18_1217 399
533 3300042006 Ga0439432_002461 Ga0439432_002461_2005_3204 399
534 3300042006 Ga0439432_002654 Ga0439432_002654_3734_4933 399
535 3300042006 Ga0439432_002747 Ga0439432_002747_4524_5723 399
536 3300042006 Ga0439432_003222 Ga0439432_003222_2272_3471 399
537 3300042009 Ga0439451_015800 Ga0439451_015800_74_1273 399
538 3300042010 Ga0439452_000382 Ga0439452_000382_21771_22970 399
539 3300042010 Ga0439452_000510 Ga0439452_000510_16511_17710 399
540 3300042010 Ga0439452_000646 Ga0439452_000646_3545_4744 399
541 3300042010 Ga0439452_002237 Ga0439452_002237_401_1600 399
542 3300042010 Ga0439452_006184 Ga0439452_006184_2359_3558 399
543 3300042010 Ga0439452_006751 Ga0439452_006751_1013_2212 399
544 3300042013 Ga0439456_000096 Ga0439456_000096_22093_23292 399
545 3300042016 Ga0439463_000585 Ga0439463_000585_869_2068 399
546 3300042016 Ga0439463_005709 Ga0439463_005709_208_1407 399
547 3300042115 Ga0450911_000238 Ga0450911_000238_3225_4424 399
548 3300042115 Ga0450911_000755 Ga0450911_000755_7812_9011 399
549 3300042127 Ga0450890_000202 Ga0450890_000202_4357_5556 399
550 3300042137 Ga0450902_001384 Ga0450902_001384_1965_3164 399
551 3300042137 Ga0450902_001967 Ga0450902_001967_1290_2489 399
552 3300042138 Ga0450903_001289 Ga0450903_001289_3426_4625 399
553 3300042142 Ga0450905_001386 Ga0450905_001386_1554_2753 399
554 3300042145 Ga0450906_000574 Ga0450906_000574_6114_7313 399
555 3300042146 Ga0450907_000062 Ga0450907_000062_5611_6810 399
556 3300042156 Ga0439446_0001788 Ga0439446_0001788_2056_3255 399
557 3300042185 Ga0450909_000168 Ga0450909_000168_1302_2501 399
558 3300042435 Ga0439434_0000411 Ga0439434_0000411_3479_4678 399
559 3300042435 Ga0439434_0005796 Ga0439434_0005796_1392_2591 399
560 3300042439 Ga0439464_0027861 Ga0439464_0027861_334_1533 399
561 3300042461 Ga0439460_0007966 Ga0439460_0007966_1303_2502 399
562 3300042876 Ga0451577_0062944 Ga0451577_0062944_521_1720 399
563 3300042876 Ga0451577_0125031 Ga0451577_0125031_366_1577 399
564 3300044712 Ga0453684_0082317 Ga0453684_0082317_1899_3098 399
565 3300045051 Ga0451576_0000745 Ga0451576_0000745_59596_60807 399
566 3300046452 Ga0495617_009057 Ga0495617_009057_697_1896 399
567 3300046453 Ga0495627_001257 Ga0495627_001257_9108_10307 399
568 3300046453 Ga0495627_029885 Ga0495627_029885_417_1616 399
569 3300046457 Ga0495590_0003983 Ga0495590_0003983_1799_2998 399
570 3300046457 Ga0495590_0005440 Ga0495590_0005440_72_1271 399
571 3300046457 Ga0495590_0005866 Ga0495590_0005866_2593_3792 399
572 3300046458 Ga0495591_001543 Ga0495591_001543_9362_10561 399
573 3300046458 Ga0495591_001609 Ga0495591_001609_8846_10045 399
574 3300046458 Ga0495591_002816 Ga0495591_002816_8113_9312 399
575 3300046458 Ga0495591_003923 Ga0495591_003923_3555_4754 399
576 3300046458 Ga0495591_003967 Ga0495591_003967_2673_3872 399
577 3300046458 Ga0495591_010877 Ga0495591_010877_1628_2827 399
578 3300046460 Ga0495638_0004187 Ga0495638_0004187_3143_4342 399
579 3300046460 Ga0495638_0010874 Ga0495638_0010874_1587_2786 399
580 3300046460 Ga0495638_0017674 Ga0495638_0017674_255_1454 399
581 3300046460 Ga0495638_0063306 Ga0495638_0063306_58_1257 399
582 3300046463 Ga0495653_0008893 Ga0495653_0008893_3931_5130 399
583 3300046463 Ga0495653_0045843 Ga0495653_0045843_666_1865 399
584 3300046463 Ga0495653_0084734 Ga0495653_0084734_1036_2235 399
585 3300046471 Ga0495650_0010649 Ga0495650_0010649_3807_5006 399
586 3300046471 Ga0495650_0062776 Ga0495650_0062776_69_1268 399
587 3300046474 Ga0495605_0013040 Ga0495605_0013040_141_1340 399
588 3300046474 Ga0495605_0020722 Ga0495605_0020722_1191_2390 399
589 3300046491 Ga0495584_0000651 Ga0495584_0000651_3542_4741 399
590 3300046491 Ga0495584_0004775 Ga0495584_0004775_3549_4748 399
591 3300046491 Ga0495584_0006353 Ga0495584_0006353_1673_2872 399
592 3300046491 Ga0495584_0016839 Ga0495584_0016839_250_1449 399
593 3300046492 Ga0495585_0002101 Ga0495585_0002101_2627_3826 399
594 3300046492 Ga0495585_0002862 Ga0495585_0002862_7315_8514 399
595 3300046492 Ga0495585_0005597 Ga0495585_0005597_4036_5235 399
596 3300046492 Ga0495585_0015538 Ga0495585_0015538_3176_4375 399
597 3300046492 Ga0495585_0034218 Ga0495585_0034218_588_1787 399
598 3300046500 Ga0495596_0002132 Ga0495596_0002132_3548_4747 399
599 3300046501 Ga0495607_0004713 Ga0495607_0004713_4766_5965 399
600 3300046501 Ga0495607_0006276 Ga0495607_0006276_5178_6377 399
601 3300046501 Ga0495607_0031366 Ga0495607_0031366_1682_2881 399
602 3300046507 Ga0495606_0000575 Ga0495606_0000575_33118_34317 399
603 3300046507 Ga0495606_0003310 Ga0495606_0003310_7838_9037 399
604 3300046507 Ga0495606_0003623 Ga0495606_0003623_11770_12969 399
605 3300046507 Ga0495606_0007478 Ga0495606_0007478_4459_5658 399
606 3300046507 Ga0495606_0010800 Ga0495606_0010800_2180_3379 399
607 3300046507 Ga0495606_0015153 Ga0495606_0015153_1191_2390 399
608 3300046507 Ga0495606_0020697 Ga0495606_0020697_3552_4751 399
609 3300046507 Ga0495606_0020850 Ga0495606_0020850_115_1314 399
610 3300046512 Ga0495610_0003606 Ga0495610_0003606_3585_4784 399
611 3300046512 Ga0495610_0004407 Ga0495610_0004407_2294_3493 399
612 3300046512 Ga0495610_0007805 Ga0495610_0007805_2564_3763 399
613 3300046512 Ga0495610_0014265 Ga0495610_0014265_2702_3901 399
614 3300046512 Ga0495610_0080473 Ga0495610_0080473_221_1420 399
615 3300046513 Ga0495616_0002134 Ga0495616_0002134_7143_8342 399
616 3300046513 Ga0495616_0003784 Ga0495616_0003784_3881_5080 399
617 3300046513 Ga0495616_0006798 Ga0495616_0006798_3393_4592 399
618 3300046513 Ga0495616_0010919 Ga0495616_0010919_972_2171 399
619 3300046515 Ga0495620_0000003 Ga0495620_0000003_91286_92485 399
620 3300046515 Ga0495620_0001671 Ga0495620_0001671_4111_5310 399
621 3300046515 Ga0495620_0002532 Ga0495620_0002532_2245_3444 399
622 3300046515 Ga0495620_0006904 Ga0495620_0006904_4077_5276 399
623 3300046515 Ga0495620_0011962 Ga0495620_0011962_1705_2904 399
624 3300046515 Ga0495620_0047826 Ga0495620_0047826_571_1770 399
625 3300046518 Ga0495631_0000224 Ga0495631_0000224_3602_4801 399
626 3300046518 Ga0495631_0002487 Ga0495631_0002487_4009_5208 399
627 3300046518 Ga0495631_0003213 Ga0495631_0003213_3280_4479 399
628 3300046519 Ga0495632_0004423 Ga0495632_0004423_229_1428 399
629 3300046519 Ga0495632_0007843 Ga0495632_0007843_556_1755 399
630 3300046519 Ga0495632_0024356 Ga0495632_0024356_1818_3017 399
631 3300046519 Ga0495632_0036309 Ga0495632_0036309_207_1406 399
632 3300046520 Ga0495637_0000618 Ga0495637_0000618_18393_19592 399
633 3300046520 Ga0495637_0004838 Ga0495637_0004838_1679_2878 399
634 3300046520 Ga0495637_0004840 Ga0495637_0004840_3335_4534 399
635 3300046520 Ga0495637_0008746 Ga0495637_0008746_3561_4760 399
636 3300046520 Ga0495637_0012941 Ga0495637_0012941_487_1686 399
637 3300046520 Ga0495637_0034373 Ga0495637_0034373_451_1650 399
638 3300046522 Ga0495643_0000116 Ga0495643_0000116_2206_3405 399
639 3300046522 Ga0495643_0001999 Ga0495643_0001999_9189_10388 399
640 3300046522 Ga0495643_0003288 Ga0495643_0003288_8095_9294 399
641 3300046522 Ga0495643_0007210 Ga0495643_0007210_2742_3941 399
642 3300046522 Ga0495643_0061669 Ga0495643_0061669_495_1694 399
643 3300046523 Ga0495644_0001169 Ga0495644_0001169_6611_7810 399
644 3300046523 Ga0495644_0012534 Ga0495644_0012534_150_1349 399
645 3300046524 Ga0495648_0002887 Ga0495648_0002887_5547_6746 399
646 3300046524 Ga0495648_0003903 Ga0495648_0003903_2811_4010 399
647 3300046524 Ga0495648_0005915 Ga0495648_0005915_3536_4735 399
648 3300046524 Ga0495648_0018105 Ga0495648_0018105_49_1248 399
649 3300046524 Ga0495648_0029602 Ga0495648_0029602_186_1385 399
650 3300046524 Ga0495648_0031945 Ga0495648_0031945_1642_2841 399
651 3300046526 Ga0495666_0005182 Ga0495666_0005182_4882_6081 399
652 3300046526 Ga0495666_0006948 Ga0495666_0006948_3161_4360 399
653 3300046530 Ga0495654_0001647 Ga0495654_0001647_7909_9108 399
654 3300046530 Ga0495654_0005362 Ga0495654_0005362_2755_3954 399
655 3300046530 Ga0495654_0007126 Ga0495654_0007126_3802_5001 399
656 3300046530 Ga0495654_0007409 Ga0495654_0007409_4156_5355 399
657 3300046530 Ga0495654_0011965 Ga0495654_0011965_1771_2970 399
658 3300046530 Ga0495654_0027342 Ga0495654_0027342_269_1468 399
659 3300046536 Ga0495587_0007965 Ga0495587_0007965_3487_4686 399
660 3300046542 Ga0495597_0004952 Ga0495597_0004952_1458_2657 399
661 3300046542 Ga0495597_0005985 Ga0495597_0005985_3258_4457 399
662 3300046542 Ga0495597_0022758 Ga0495597_0022758_19_1218 399
663 3300046542 Ga0495597_0025968 Ga0495597_0025968_710_1909 399
664 3300046557 Ga0495622_0001827 Ga0495622_0001827_4199_5398 399
665 3300046558 Ga0495633_0011010 Ga0495633_0011010_3109_4308 399
666 3300046616 Ga0495668_0003410 Ga0495668_0003410_7379_8578 399
667 3300046642 Ga0495634_0003166 Ga0495634_0003166_3450_4649 399
668 3300046660 Ga0495625_0053000 Ga0495625_0053000_1555_2754 399
669 3300046660 Ga0495625_0098963 Ga0495625_0098963_670_1869 399
670 3300046663 Ga0495635_0018760 Ga0495635_0018760_3362_4561 399
671 3300046665 Ga0495661_0004997 Ga0495661_0004997_116_1315 399
672 3300046665 Ga0495661_0007855 Ga0495661_0007855_2506_3705 399
673 3300046665 Ga0495661_0065663 Ga0495661_0065663_69_1268 399
674 3300046665 Ga0495661_0080877 Ga0495661_0080877_635_1834 399
675 3300046690 Ga0495624_0002472 Ga0495624_0002472_8740_9939 399
676 3300046691 Ga0495670_0002624 Ga0495670_0002624_5135_6334 399
677 3300046692 Ga0495671_0000750 Ga0495671_0000750_18464_19663 399
678 3300046692 Ga0495671_0009315 Ga0495671_0009315_2597_3796 399
679 3300046692 Ga0495671_0009555 Ga0495671_0009555_2984_4183 399
680 3300046692 Ga0495671_0013189 Ga0495671_0013189_65_1264 399
681 3300046692 Ga0495671_0030240 Ga0495671_0030240_1512_2711 399
682 3300046692 Ga0495671_0042777 Ga0495671_0042777_710_1909 399
683 3300046692 Ga0495671_0058831 Ga0495671_0058831_108_1307 399
684 3300046694 Ga0495649_0000333 Ga0495649_0000333_32761_33960 399
685 3300046694 Ga0495649_0007189 Ga0495649_0007189_4391_5590 399
686 3300046694 Ga0495649_0016162 Ga0495649_0016162_691_1890 399
687 3300046694 Ga0495649_0041868 Ga0495649_0041868_260_1459 399
688 3300046694 Ga0495649_0060117 Ga0495649_0060117_797_1996 399
689 3300046794 Ga0495589_0001719 Ga0495589_0001719_5281_6480 399
690 3300046794 Ga0495589_0010289 Ga0495589_0010289_10_1209 399
691 3300046810 Ga0495660_0010608 Ga0495660_0010608_62_1261 399
692 3300046810 Ga0495660_0018795 Ga0495660_0018795_1944_3143 399
693 3300046810 Ga0495660_0029456 Ga0495660_0029456_225_1424 399
694 3300046810 Ga0495660_0055382 Ga0495660_0055382_909_2108 399
695 3300046810 Ga0495660_0095799 Ga0495660_0095799_150_1349 399
696 3300047317 Ga0495604_0051202 Ga0495604_0051202_1682_2881 399
697 3300047319 Ga0495674_0028934 Ga0495674_0028934_3041_4240 399
698 3300047320 Ga0495672_0003260 Ga0495672_0003260_4096_5295 399
699 3300047320 Ga0495672_0003963 Ga0495672_0003963_3747_4946 399
700 3300047320 Ga0495672_0004654 Ga0495672_0004654_3133_4332 399
701 3300047320 Ga0495672_0004820 Ga0495672_0004820_2145_3344 399
702 3300047320 Ga0495672_0005097 Ga0495672_0005097_4097_5296 399
703 3300047320 Ga0495672_0007965 Ga0495672_0007965_4040_5239 399
704 3300047320 Ga0495672_0027802 Ga0495672_0027802_2000_3199 399
705 3300047321 Ga0495676_0007897 Ga0495676_0007897_4527_5726 399
706 3300047323 Ga0495683_0001496 Ga0495683_0001496_3562_4761 399
707 3300047323 Ga0495683_0006496 Ga0495683_0006496_1753_2952 399
708 3300047446 Ga0495679_008195 Ga0495679_008195_144_1343 399
709 3300047446 Ga0495679_011134 Ga0495679_011134_2218_3417 399
710 3300047469 Ga0495673_0001648 Ga0495673_0001648_12466_13665 399
711 3300047469 Ga0495673_0003212 Ga0495673_0003212_6154_7353 399
712 3300047469 Ga0495673_0007907 Ga0495673_0007907_570_1769 399
713 3300047469 Ga0495673_0011998 Ga0495673_0011998_3276_4475 399
714 3300047469 Ga0495673_0021936 Ga0495673_0021936_892_2091 399
715 3300047469 Ga0495673_0026775 Ga0495673_0026775_1403_2602 399
716 3300047469 Ga0495673_0033154 Ga0495673_0033154_201_1400 399
717 3300047470 Ga0495681_0003046 Ga0495681_0003046_1460_2659 399
718 3300047470 Ga0495681_0003760 Ga0495681_0003760_3549_4748 399
719 3300047470 Ga0495681_0004427 Ga0495681_0004427_3863_5062 399
720 3300047470 Ga0495681_0005083 Ga0495681_0005083_6614_7813 399
721 3300047470 Ga0495681_0018049 Ga0495681_0018049_2259_3458 399
722 3300047472 Ga0495686_0005886 Ga0495686_0005886_1514_2713 399
723 3300047472 Ga0495686_0015228 Ga0495686_0015228_22_1221 399
724 3300047472 Ga0495686_0017064 Ga0495686_0017064_381_1580 399
725 3300047673 Ga0495593_0011264 Ga0495593_0011264_3086_4285 399
726 3300047673 Ga0495593_0021904 Ga0495593_0021904_1552_2751 399
727 3300048088 Ga0495602_0030014 Ga0495602_0030014_3873_5072 399
728 3300048091 Ga0495626_0000658 Ga0495626_0000658_28426_29625 399
729 3300048091 Ga0495626_0001692 Ga0495626_0001692_3538_4737 399
730 3300048091 Ga0495626_0005353 Ga0495626_0005353_2444_3643 399
731 3300048905 Ga0496102_0003153 Ga0496102_0003153_3562_4761 399
732 3300048909 Ga0496106_0071209 Ga0496106_0071209_200_1399 399
733 3300048919 Ga0496116_0000492 Ga0496116_0000492_17263_18462 399
734 3300048919 Ga0496116_0017628 Ga0496116_0017628_4109_5308 399
735 3300048920 Ga0496117_0001334 Ga0496117_0001334_17275_18474 399
736 3300048920 Ga0496117_0003743 Ga0496117_0003743_8046_9245 399
737 3300048920 Ga0496117_0006594 Ga0496117_0006594_5705_6904 399
738 3300048920 Ga0496117_0010034 Ga0496117_0010034_4652_5851 399
739 3300048920 Ga0496117_0056606 Ga0496117_0056606_1027_2226 399
740 3300048920 Ga0496117_0065362 Ga0496117_0065362_1165_2364 399
741 3300048920 Ga0496117_0086595 Ga0496117_0086595_203_1402 399
742 3300048920 Ga0496117_0106819 Ga0496117_0106819_515_1714 399
743 3300048921 Ga0496118_0002770 Ga0496118_0002770_19435_20634 399
744 3300048921 Ga0496118_0010803 Ga0496118_0010803_7362_8561 399
745 3300048921 Ga0496118_0016385 Ga0496118_0016385_2875_4074 399
746 3300048921 Ga0496118_0035872 Ga0496118_0035872_60_1259 399
747 3300048921 Ga0496118_0065390 Ga0496118_0065390_1306_2505 399
748 3300048921 Ga0496118_0115907 Ga0496118_0115907_504_1703 399
749 3300048922 Ga0496119_0000207 Ga0496119_0000207_23075_24274 399
750 3300048922 Ga0496119_0006721 Ga0496119_0006721_7915_9114 399
751 3300048922 Ga0496119_0048067 Ga0496119_0048067_163_1362 399
752 3300048923 Ga0496120_0003397 Ga0496120_0003397_2637_3836 399
753 3300048923 Ga0496120_0005268 Ga0496120_0005268_8114_9313 399
754 3300048924 Ga0496121_0000921 Ga0496121_0000921_34731_35930 399
755 3300048924 Ga0496121_0025675 Ga0496121_0025675_3869_5068 399
756 3300048924 Ga0496121_0037143 Ga0496121_0037143_2160_3359 399
757 3300048925 Ga0496122_0002533 Ga0496122_0002533_11168_12367 399
758 3300048925 Ga0496122_0006320 Ga0496122_0006320_2739_3938 399
759 3300048926 Ga0496123_0000387 Ga0496123_0000387_7048_8247 399
760 3300048926 Ga0496123_0001516 Ga0496123_0001516_23093_24292 399
761 3300048926 Ga0496123_0019807 Ga0496123_0019807_4010_5209 399
762 3300048926 Ga0496123_0081031 Ga0496123_0081031_51_1250 399
763 3300048927 Ga0496124_0003921 Ga0496124_0003921_8241_9440 399
764 3300048927 Ga0496124_0007969 Ga0496124_0007969_6801_8000 399
765 3300048927 Ga0496124_0010730 Ga0496124_0010730_6089_7288 399
766 3300048927 Ga0496124_0013388 Ga0496124_0013388_4050_5249 399
767 3300048927 Ga0496124_0016920 Ga0496124_0016920_1811_3010 399
768 3300048927 Ga0496124_0018386 Ga0496124_0018386_2617_3816 399
769 3300048927 Ga0496124_0021340 Ga0496124_0021340_4025_5224 399
770 3300048927 Ga0496124_0024939 Ga0496124_0024939_3072_4271 399
771 3300048927 Ga0496124_0048868 Ga0496124_0048868_62_1261 399
772 3300048928 Ga0496125_0003468 Ga0496125_0003468_14961_16160 399
773 3300048928 Ga0496125_0003963 Ga0496125_0003963_8157_9356 399
774 3300048928 Ga0496125_0022287 Ga0496125_0022287_4028_5227 399
775 3300048928 Ga0496125_0034870 Ga0496125_0034870_60_1259 399
776 3300048929 Ga0496126_0016878 Ga0496126_0016878_959_2158 399
777 3300048929 Ga0496126_0050203 Ga0496126_0050203_2194_3393 399
778 3300048929 Ga0496126_0084656 Ga0496126_0084656_80_1279 399
779 3300049459 Ga0495678_004100 Ga0495678_004100_4745_5944 399
780 3300049459 Ga0495678_007204 Ga0495678_007204_4103_5302 399
781 3300049459 Ga0495678_009544 Ga0495678_009544_3256_4455 399
782 3300049459 Ga0495678_030356 Ga0495678_030356_40_1239 399
783 3300049460 Ga0495682_0001922 Ga0495682_0001922_5105_6304 399
784 3300049460 Ga0495682_0003432 Ga0495682_0003432_2697_3896 399
785 3300049656 Ga0501209_013131 Ga0501209_013131_568_1767 399
786 3300050489 nmdc:mga03683_32130_c1 nmdc:mga03683_32130_c1_56_1255 399
787 3300053111 Ga0500572_001966 Ga0500572_001966_18_1217 399
788 3300053161 Ga0500634_0005001 Ga0500634_0005001_3680_4879 399
789 iso_pu_bacteria 2547132512 2548847580 399
790 3300005327 Ga0070658_10078006 Ga0070658_100780062 400
791 3300005329 Ga0070683_100002978 Ga0070683_10000297811 400
792 3300005331 Ga0070670_100002834 Ga0070670_1000028345 400
793 3300005333 Ga0070677_10014734 Ga0070677_100147341 400
794 3300005335 Ga0070666_10049275 Ga0070666_100492752 400
795 3300005336 Ga0070680_100320711 Ga0070680_1003207111 400
796 3300005338 Ga0068868_100001450 Ga0068868_10000145012 400
797 3300005343 Ga0070687_100021860 Ga0070687_1000218603 400
798 3300005344 Ga0070661_100001365 Ga0070661_10000136512 400
799 3300005347 Ga0070668_100167109 Ga0070668_1001671091 400
800 3300005354 Ga0070675_100048464 Ga0070675_1000484643 400
801 3300005355 Ga0070671_100012446 Ga0070671_1000124466 400
802 3300005356 Ga0070674_100041038 Ga0070674_1000410382 400
803 3300005364 Ga0070673_100000687 Ga0070673_10000068716 400
804 3300005364 Ga0070673_100017690 Ga0070673_1000176903 400
805 3300005367 Ga0070667_100071281 Ga0070667_1000712812 400
806 3300005441 Ga0070700_100087480 Ga0070700_1000874802 400
807 3300005444 Ga0070694_100038566 Ga0070694_1000385663 400
808 3300005445 Ga0070708_100269572 Ga0070708_1002695721 400
809 3300005456 Ga0070678_100000554 Ga0070678_10000055414 400
810 3300005457 Ga0070662_100017261 Ga0070662_1000172612 400
811 3300005458 Ga0070681_10005132 Ga0070681_1000513210 400
812 3300005459 Ga0068867_100022758 Ga0068867_1000227584 400
813 3300005466 Ga0070685_10162537 Ga0070685_101625372 400
814 3300005467 Ga0070706_100283023 Ga0070706_1002830231 400
815 3300005536 Ga0070697_100220403 Ga0070697_1002204031 400
816 3300005543 Ga0070672_100006420 Ga0070672_1000064203 400
817 3300005545 Ga0070695_100140535 Ga0070695_1001405351 400
818 3300005548 Ga0070665_100091254 Ga0070665_1000912541 400
819 3300005564 Ga0070664_100002976 Ga0070664_1000029764 400
820 3300005564 Ga0070664_100087817 Ga0070664_1000878172 400
821 3300005616 Ga0068852_100001172 Ga0068852_1000011727 400
822 3300005617 Ga0068859_100063420 Ga0068859_1000634202 400
823 3300005618 Ga0068864_100003416 Ga0068864_10000341611 400
824 3300005718 Ga0068866_10036604 Ga0068866_100366042 400
825 3300005834 Ga0068851_10000531 Ga0068851_100005315 400
826 3300006237 Ga0097621_100002291 Ga0097621_1000022913 400
827 3300006358 Ga0068871_100001444 Ga0068871_10000144411 400
828 3300006844 Ga0075428_100002635 Ga0075428_10000263512 400
829 3300006847 Ga0075431_100034988 Ga0075431_1000349883 400
830 3300006880 Ga0075429_100238703 Ga0075429_1002387032 400
831 3300006880 Ga0075429_100300234 Ga0075429_1003002342 400
832 3300006881 Ga0068865_100011198 Ga0068865_1000111984 400
833 3300006914 Ga0075436_100118666 Ga0075436_1001186661 400
834 3300006931 Ga0097620_100063421 Ga0097620_1000634212 400
835 3300009094 Ga0111539_10004775 Ga0111539_1000477514 400
836 3300009094 Ga0111539_10052830 Ga0111539_100528305 400
837 3300009098 Ga0105245_10374272 Ga0105245_103742722 400
838 3300009148 Ga0105243_10159483 Ga0105243_101594832 400
839 3300009176 Ga0105242_10027676 Ga0105242_100276763 400
840 3300009177 Ga0105248_10186693 Ga0105248_101866932 400
841 3300013296 Ga0157374_10001943 Ga0157374_1000194312 400
842 3300013297 Ga0157378_10006978 Ga0157378_100069785 400
843 3300013306 Ga0163162_10022326 Ga0163162_100223263 400
844 3300013308 Ga0157375_10002545 Ga0157375_100025454 400
845 3300014745 Ga0157377_10009990 Ga0157377_100099902 400
846 3300014745 Ga0157377_10047113 Ga0157377_100471132 400
847 3300014969 Ga0157376_10010273 Ga0157376_100102735 400
848 3300025315 Ga0207697_10013697 Ga0207697_100136973 400
849 3300025321 Ga0207656_10022519 Ga0207656_100225192 400
850 3300025893 Ga0207682_10005007 Ga0207682_100050075 400
851 3300025893 Ga0207682_10020357 Ga0207682_100203573 400
852 3300025901 Ga0207688_10008168 Ga0207688_100081682 400
853 3300025907 Ga0207645_10003020 Ga0207645_1000302012 400
854 3300025908 Ga0207643_10019424 Ga0207643_100194244 400
855 3300025910 Ga0207684_10280441 Ga0207684_102804411 400
856 3300025920 Ga0207649_10006645 Ga0207649_100066454 400
857 3300025922 Ga0207646_10040819 Ga0207646_100408194 400
858 3300025925 Ga0207650_10002213 Ga0207650_1000221311 400
859 3300025926 Ga0207659_10047034 Ga0207659_100470343 400
860 3300025931 Ga0207644_10125667 Ga0207644_101256672 400
861 3300025940 Ga0207691_10002145 Ga0207691_100021453 400
862 3300025942 Ga0207689_10038913 Ga0207689_100389133 400
863 3300025944 Ga0207661_10002649 Ga0207661_1000264911 400
864 3300025960 Ga0207651_10000832 Ga0207651_1000083211 400
865 3300025986 Ga0207658_10055038 Ga0207658_100550383 400
866 3300026023 Ga0207677_10000800 Ga0207677_1000080014 400
867 3300026075 Ga0207708_10001343 Ga0207708_1000134315 400
868 3300026089 Ga0207648_10010894 Ga0207648_100108944 400
869 3300026089 Ga0207648_10013748 Ga0207648_100137488 400
870 3300026095 Ga0207676_10004537 Ga0207676_100045372 400
871 3300026118 Ga0207675_100009090 Ga0207675_10000909010 400
872 3300026121 Ga0207683_10012662 Ga0207683_100126625 400
873 3300026121 Ga0207683_10023777 Ga0207683_100237774 400
874 3300026142 Ga0207698_10000853 Ga0207698_1000085312 400
875 3300027907 Ga0207428_10029635 Ga0207428_100296351 400
876 3300031344 Ga0265316_10064765 Ga0265316_100647653 400
877 3300031711 Ga0265314_10023451 Ga0265314_100234512 400
878 3300037068 Ga0373925_0180932 Ga0373925_0180932_375_1577 400
879 3300046528 Ga0495642_0044456 Ga0495642_0044456_126_1328 400
880 3300048911 Ga0496108_0029323 Ga0496108_0029323_1413_2615 400
881 3300048912 Ga0496109_0013168 Ga0496109_0013168_4135_5337 400
882 3300049575 Ga0501039_0023003 Ga0501039_0023003_1243_2448 400
883 3300050508 nmdc:mga09592_310473_c1 nmdc:mga09592_310473_c1_140_1342 400
884 3300050511 nmdc:mga08y16_116170_c1 nmdc:mga08y16_116170_c1_130_1332 400
885 3300027471 Ga0209995_1002923 Ga0209995_10029232 401
886 3300027543 Ga0209999_1004007 Ga0209999_10040073 401
887 3300027665 Ga0209983_1005804 Ga0209983_10058042 401
888 3300005468 Ga0070707_100074438 Ga0070707_1000744383 402
889 3300025928 Ga0207700_10002511 Ga0207700_1000251112 402
890 3300007265 Ga0099794_10000077 Ga0099794_100000774 403
891 3300026075 Ga0207708_10013845 Ga0207708_100138453 403
892 3300027671 Ga0209588_1000008 Ga0209588_100000882 403
893 3300031238 Ga0265332_10000004 Ga0265332_10000004304 403
894 3300042461 Ga0439460_0017953 Ga0439460_0017953_561_1778 403
895 3300049571 Ga0501034_0121014 Ga0501034_0121014_1029_2240 403
896 3300048928 Ga0496125_0011039 Ga0496125_0011039_3879_5096 405
897 3300014325 Ga0163163_10077913 Ga0163163_100779132 410
898 3300009036 Ga0105244_10014809 Ga0105244_100148093 418
899 3300014497 Ga0182008_10007981 Ga0182008_100079813 418
900 3300015261 Ga0182006_1003909 Ga0182006_10039093 418
901 3300015262 Ga0182007_10002969 Ga0182007_100029695 418
902 3300015265 Ga0182005_1001625 Ga0182005_10016255 418
903 3300046474 Ga0495605_0009012 Ga0495605_0009012_982_2238 418
904 3300046475 Ga0495639_0001944 Ga0495639_0001944_4436_5692 418
905 3300046530 Ga0495654_0003640 Ga0495654_0003640_4804_6060 418
906 3300046557 Ga0495622_0003204 Ga0495622_0003204_2880_4136 418
907 3300046664 Ga0495659_0000807 Ga0495659_0000807_6521_7777 418
908 3300046694 Ga0495649_0011856 Ga0495649_0011856_432_1688 418
909 3300046794 Ga0495589_0014537 Ga0495589_0014537_2602_3858 418
910 3300047320 Ga0495672_0006765 Ga0495672_0006765_6100_7356 418
911 3300047443 Ga0495687_005828 Ga0495687_005828_3393_4649 418
912 3300048091 Ga0495626_0004081 Ga0495626_0004081_4381_5637 418
913 3300048924 Ga0496121_0039458 Ga0496121_0039458_2671_3927 418
914 3300042142 Ga0450905_000442 Ga0450905_000442_2425_3756 423
915 3300013104 Ga0157370_10032362 Ga0157370_100323625 424
916 3300013306 Ga0163162_10011467 Ga0163162_100114675 424
917 3300046455 Ga0495603_0100612 Ga0495603_0100612_236_1510 424
918 3300046530 Ga0495654_0056387 Ga0495654_0056387_428_1702 424
919 3300046557 Ga0495622_0017228 Ga0495622_0017228_429_1703 424
920 3300046691 Ga0495670_0008648 Ga0495670_0008648_3282_4556 424
921 3300046692 Ga0495671_0033866 Ga0495671_0033866_178_1452 424
922 3300046810 Ga0495660_0008322 Ga0495660_0008322_840_2114 424
923 3300049571 Ga0501034_0000370 Ga0501034_0000370_10271_11602 425
924 3300046460 Ga0495638_0009880 Ga0495638_0009880_3402_4682 426
925 3300046460 Ga0495638_0010307 Ga0495638_0010307_3994_5274 426
926 3300046500 Ga0495596_0015797 Ga0495596_0015797_192_1472 426
927 3300046501 Ga0495607_0011229 Ga0495607_0011229_4456_5736 426
928 3300046506 Ga0495583_0004497 Ga0495583_0004497_4023_5303 426
929 3300046512 Ga0495610_0007496 Ga0495610_0007496_5954_7234 426
930 3300046513 Ga0495616_0009231 Ga0495616_0009231_585_1865 426
931 3300046519 Ga0495632_0007835 Ga0495632_0007835_691_1971 426
932 3300046520 Ga0495637_0001387 Ga0495637_0001387_4168_5448 426
933 3300046522 Ga0495643_0008409 Ga0495643_0008409_4091_5371 426
934 3300046523 Ga0495644_0004677 Ga0495644_0004677_20_1300 426
935 3300046524 Ga0495648_0010961 Ga0495648_0010961_1917_3197 426
936 3300046538 Ga0495609_0031721 Ga0495609_0031721_76_1356 426
937 3300046648 Ga0495611_0000981 Ga0495611_0000981_4830_6110 426
938 3300046660 Ga0495625_0098865 Ga0495625_0098865_137_1417 426
939 3300046691 Ga0495670_0001480 Ga0495670_0001480_5330_6610 426
940 3300046692 Ga0495671_0015763 Ga0495671_0015763_1220_2500 426
941 3300046810 Ga0495660_0043450 Ga0495660_0043450_1010_2290 426
942 2124908027 MRS2a_Contig_782 MRS2a_00639330 427
943 3300006058 Ga0075432_10012043 Ga0075432_100120433 427
944 3300009176 Ga0105242_10030641 Ga0105242_100306413 427
945 3300011119 Ga0105246_10014568 Ga0105246_100145684 427
946 3300013100 Ga0157373_10017134 Ga0157373_100171345 427
947 3300014497 Ga0182008_10005261 Ga0182008_100052614 427
948 3300027907 Ga0207428_10050689 Ga0207428_100506892 427
949 3300041405 Ga0439438_001307 Ga0439438_001307_6193_7497 427
950 3300041405 Ga0439438_006187 Ga0439438_006187_2907_4211 427
951 3300041407 Ga0439447_005496 Ga0439447_005496_729_2033 427
952 3300041407 Ga0439447_010765 Ga0439447_010765_918_2201 427
953 3300042006 Ga0439432_003054 Ga0439432_003054_4016_5320 427
954 3300042010 Ga0439452_001226 Ga0439452_001226_6803_8107 427
955 3300042013 Ga0439456_001898 Ga0439456_001898_1559_2842 427
956 3300042013 Ga0439456_008684 Ga0439456_008684_599_1903 427
957 3300042121 Ga0450919_000450 Ga0450919_000450_746_2050 427
958 3300042124 Ga0450922_000238 Ga0450922_000238_3224_4528 427
959 3300042138 Ga0450903_006830 Ga0450903_006830_83_1366 427
960 3300042146 Ga0450907_001660 Ga0450907_001660_3220_4524 427
961 3300042461 Ga0439460_0000562 Ga0439460_0000562_4034_5317 427
962 3300042461 Ga0439460_0001729 Ga0439460_0001729_3483_4787 427
963 3300042531 Ga0450918_002614 Ga0450918_002614_1028_2377 427
964 3300042993 Ga0439440_0011294 Ga0439440_0011294_583_1866 427
965 3300046452 Ga0495617_000439 Ga0495617_000439_3611_4915 427
966 3300046452 Ga0495617_005046 Ga0495617_005046_3377_4681 427
967 3300046455 Ga0495603_0029386 Ga0495603_0029386_1284_2567 427
968 3300046457 Ga0495590_0002161 Ga0495590_0002161_3287_4591 427
969 3300046457 Ga0495590_0002603 Ga0495590_0002603_3782_5086 427
970 3300046458 Ga0495591_005851 Ga0495591_005851_3293_4576 427
971 3300046458 Ga0495591_007471 Ga0495591_007471_3197_4501 427
972 3300046460 Ga0495638_0016835 Ga0495638_0016835_330_1634 427
973 3300046460 Ga0495638_0050019 Ga0495638_0050019_916_2199 427
974 3300046463 Ga0495653_0011668 Ga0495653_0011668_3579_4862 427
975 3300046474 Ga0495605_0000514 Ga0495605_0000514_31275_32579 427
976 3300046474 Ga0495605_0001162 Ga0495605_0001162_3524_4828 427
977 3300046474 Ga0495605_0039526 Ga0495605_0039526_795_2078 427
978 3300046491 Ga0495584_0002556 Ga0495584_0002556_3478_4782 427
979 3300046491 Ga0495584_0005416 Ga0495584_0005416_2769_4073 427
980 3300046491 Ga0495584_0024846 Ga0495584_0024846_511_1794 427
981 3300046501 Ga0495607_0004028 Ga0495607_0004028_3514_4818 427
982 3300046501 Ga0495607_0015797 Ga0495607_0015797_1474_2757 427
983 3300046501 Ga0495607_0037304 Ga0495607_0037304_1012_2316 427
984 3300046506 Ga0495583_0004454 Ga0495583_0004454_5575_6879 427
985 3300046507 Ga0495606_0009788 Ga0495606_0009788_3074_4378 427
986 3300046512 Ga0495610_0013547 Ga0495610_0013547_3446_4750 427
987 3300046512 Ga0495610_0033145 Ga0495610_0033145_1308_2612 427
988 3300046513 Ga0495616_0001150 Ga0495616_0001150_13986_15290 427
989 3300046518 Ga0495631_0013207 Ga0495631_0013207_1102_2385 427
990 3300046519 Ga0495632_0001301 Ga0495632_0001301_17126_18430 427
991 3300046519 Ga0495632_0003179 Ga0495632_0003179_10103_11386 427
992 3300046520 Ga0495637_0001533 Ga0495637_0001533_3540_4844 427
993 3300046520 Ga0495637_0009469 Ga0495637_0009469_104_1408 427
994 3300046520 Ga0495637_0012841 Ga0495637_0012841_526_1809 427
995 3300046522 Ga0495643_0061432 Ga0495643_0061432_15_1298 427
996 3300046524 Ga0495648_0003971 Ga0495648_0003971_3535_4839 427
997 3300046526 Ga0495666_0066631 Ga0495666_0066631_67_1350 427
998 3300046528 Ga0495642_0000755 Ga0495642_0000755_10532_11815 427
999 3300046528 Ga0495642_0001318 Ga0495642_0001318_3512_4816 427
1000 3300046528 Ga0495642_0004141 Ga0495642_0004141_458_1762 427
1001 3300046530 Ga0495654_0005070 Ga0495654_0005070_4937_6241 427
1002 3300046530 Ga0495654_0007656 Ga0495654_0007656_1453_2757 427
1003 3300046538 Ga0495609_0003739 Ga0495609_0003739_3581_4864 427
1004 3300046542 Ga0495597_0006410 Ga0495597_0006410_4530_5834 427
1005 3300046557 Ga0495622_0001403 Ga0495622_0001403_3577_4860 427
1006 3300046557 Ga0495622_0024888 Ga0495622_0024888_1398_2681 427
1007 3300046557 Ga0495622_0047330 Ga0495622_0047330_35_1339 427
1008 3300046615 Ga0495656_0004366 Ga0495656_0004366_3187_4470 427
1009 3300046616 Ga0495668_0002475 Ga0495668_0002475_10445_11749 427
1010 3300046660 Ga0495625_0006599 Ga0495625_0006599_3509_4813 427
1011 3300046663 Ga0495635_0026215 Ga0495635_0026215_2287_3570 427
1012 3300046664 Ga0495659_0011186 Ga0495659_0011186_1402_2685 427
1013 3300046674 Ga0495588_0011374 Ga0495588_0011374_1619_2902 427
1014 3300046691 Ga0495670_0000886 Ga0495670_0000886_9800_11104 427
1015 3300046691 Ga0495670_0009932 Ga0495670_0009932_3344_4648 427
1016 3300046692 Ga0495671_0011262 Ga0495671_0011262_3331_4614 427
1017 3300046694 Ga0495649_0000406 Ga0495649_0000406_2915_4219 427
1018 3300046694 Ga0495649_0002040 Ga0495649_0002040_1223_2527 427
1019 3300046694 Ga0495649_0009716 Ga0495649_0009716_1397_2701 427
1020 3300046794 Ga0495589_0000769 Ga0495589_0000769_2835_4139 427
1021 3300046794 Ga0495589_0005836 Ga0495589_0005836_1817_3100 427
1022 3300046794 Ga0495589_0006524 Ga0495589_0006524_1381_2685 427
1023 3300046794 Ga0495589_0010292 Ga0495589_0010292_3455_4759 427
1024 3300047318 Ga0495636_0006392 Ga0495636_0006392_1964_3268 427
1025 3300047320 Ga0495672_0001280 Ga0495672_0001280_1964_3268 427
1026 3300047320 Ga0495672_0004863 Ga0495672_0004863_6006_7310 427
1027 3300047320 Ga0495672_0049869 Ga0495672_0049869_76_1359 427
1028 3300047323 Ga0495683_0001278 Ga0495683_0001278_12203_13507 427
1029 3300047323 Ga0495683_0010675 Ga0495683_0010675_2187_3470 427
1030 3300047443 Ga0495687_001318 Ga0495687_001318_2777_4081 427
1031 3300047443 Ga0495687_002198 Ga0495687_002198_3252_4556 427
1032 3300047443 Ga0495687_011160 Ga0495687_011160_3496_4800 427
1033 3300047444 Ga0495675_0009783 Ga0495675_0009783_2619_3902 427
1034 3300047445 Ga0495677_0001558 Ga0495677_0001558_4748_6031 427
1035 3300047469 Ga0495673_0001922 Ga0495673_0001922_3576_4880 427
1036 3300047469 Ga0495673_0008165 Ga0495673_0008165_1353_2657 427
1037 3300047469 Ga0495673_0028612 Ga0495673_0028612_10_1314 427
1038 3300047470 Ga0495681_0000707 Ga0495681_0000707_1831_3156 427
1039 3300047470 Ga0495681_0035785 Ga0495681_0035785_1057_2361 427
1040 3300048091 Ga0495626_0001697 Ga0495626_0001697_3326_4630 427
1041 3300048091 Ga0495626_0003331 Ga0495626_0003331_2961_4244 427
1042 3300048091 Ga0495626_0004890 Ga0495626_0004890_2778_4082 427
1043 3300048920 Ga0496117_0028183 Ga0496117_0028183_2968_4272 427
1044 3300048928 Ga0496125_0021596 Ga0496125_0021596_3223_4506 427
1045 3300049459 Ga0495678_001206 Ga0495678_001206_17076_18380 427
1046 3300049459 Ga0495678_021940 Ga0495678_021940_206_1489 427

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

7

374

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hl6-assembly2.cif.gz_C yfde from escherichia coli 0.8978 34 411
4hl6-assembly2.cif.gz_C yfde from escherichia coli 0.8932 34 411
5yit-assembly1.cif.gz_B crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.8814 33 405
5yit-assembly3.cif.gz_E-2 crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.8795 33 403
5yit-assembly2.cif.gz_D crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.8783 33 404
ID Description Score Start End Superfamily
af_Q68FU4_261_348_3.30.1540.10 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9097 258 344 3.30.1540.10
4hl6E02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9026 255 347 3.30.1540.10
4hl6E02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.8937 255 347 3.30.1540.10
4ed9A02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.889 255 347 3.30.1540.10
af_Q68FU4_261_348_3.30.1540.10 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.8814 258 344 3.30.1540.10
ID Description Score Start End GO Terms
AF-A0A6L4Z307-F1-model_v4 L-carnitine dehydratase/bile acid-inducible protein F 0.9751 33 154 GO:0008410
AF-A0A2N2T8D3-F1-model_v4 Formyl-CoA transferase 0.9673 35 128 GO:0008410
AF-A0A316PNQ3-F1-model_v4 CoA transferase 0.9612 33 164 GO:0008410
AF-A0A3M1RQL6-F1-model_v4 CoA transferase 0.9592 33 170 GO:0008410
AF-A0A0F9NUV7-F1-model_v4 Formyl-CoA transferase 0.9483 34 167 GO:0003824

Feature Viewer

pLDDT pTM Quality
84.58 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map