F488809
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1040 | 408 | 1040 | 283 |
Family's Representative Sequence
| Representative Sequence | 3300005439|Ga0070711_100165148|Ga0070711_1001651482 |
| Length | 334 |
| Sequence | MVGQTPSIRILKSLNPLIKMLCSIADSRAARFRRGDNGQKLRAGGPSDRYALVMENFVFLAVLFAAACHAGWNALIKVGLDPLSTTTLISIGSGAVALVFTPLVGAPAGAAWPWLVASVAIHLVYFASLIETYRTGDLGQVYPIARGAAPLMTATVTTFFIGEKLSVVGWVGIFALIAGVLLLSARGGRELARIDRRAIGFAFFTALTVCAYSVVDGVGARLSANPNAYSVWLFIGIAVVMLPYALFRDGREVIPAMQRFWQRGLAGGALQFLSYGIAIWAMTAAPIAVVATLRETSVLFGAVIAVVVLKEPLRAVRIIAACLIVFGLILIRLQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 9 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 10 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 11 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 12 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 13 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 14 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 15 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 16 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 17 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 18 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 19 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 20 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 21 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 22 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 23 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 69 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 87 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 89 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 90 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 91 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 92 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 93 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 94 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 95 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 96 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 97 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 98 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 99 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 100 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 101 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 103 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 104 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 108 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 109 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 111 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 112 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 113 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 114 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 115 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 116 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 117 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 118 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 119 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 120 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 122 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 123 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 141 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 156 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 157 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 229 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 233 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 234 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 235 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 236 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 237 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 238 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 239 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 240 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 241 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 242 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 243 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 244 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 245 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 246 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 249 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 251 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 254 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 255 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 258 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 259 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 261 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 262 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 263 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 267 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 268 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 269 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 272 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 273 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 274 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 277 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 278 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 279 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 280 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 281 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 282 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 346 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 347 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 348 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 349 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 350 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 351 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 354 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 355 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 356 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 357 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 358 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 359 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 388 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 389 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 390 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 391 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 406 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.06 |
| Nodule | 0 |
| Rhizoplane | 10.67 |
| Rhizosphere | 88.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214745210 | 2209111006 | Bacteria | 15141 |
| 2 | ARcpr5oldR_c000144 | 3300000041 | Bacteria | 12262 |
| 3 | ARSoilYngRDRAFT_c00009 | 3300000042 | Bacteria | 30468 |
| 4 | ARcpr5yngRDRAFT_c000006 | 3300000043 | Bacteria | 44193 |
| 5 | ARSoilOldRDRAFT_c000102 | 3300000044 | Bacteria | 16000 |
| 6 | ARCol0oldRDRAFT_c00372 | 3300000045 | Bacteria | 4333 |
| 7 | ARCol0yngRDRAFT_1000031 | 3300000652 | Bacteria | 25026 |
| 8 | JGI24032J14994_100083 | 3300001430 | Bacteria | 4098 |
| 9 | JGI24752J21851_1003042 | 3300001976 | Bacteria | 2222 |
| 10 | JGI24746J21847_1002186 | 3300001977 | Bacteria | 3125 |
| 11 | JGI24747J21853_1006367 | 3300001978 | Bacteria | 1115 |
| 12 | JGI24739J22299_10001142 | 3300001989 | Bacteria | 9904 |
| 13 | JGI24739J22299_10001990 | 3300001989 | Bacteria | 7825 |
| 14 | JGI24737J22298_10001546 | 3300001990 | Bacteria | 8175 |
| 15 | JGI24737J22298_10010151 | 3300001990 | Unclassified | 3117 |
| 16 | JGI24743J22301_10026307 | 3300001991 | Bacteria | 1132 |
| 17 | JGI24750J21931_1000491 | 3300002070 | Bacteria | 6207 |
| 18 | JGI24738J21930_10000010 | 3300002075 | Bacteria | 37976 |
| 19 | JGI24749J21850_1000579 | 3300002076 | Bacteria | 5347 |
| 20 | JGI24744J21845_10006762 | 3300002077 | Bacteria | 2373 |
| 21 | JGI24035J26624_1000653 | 3300002126 | Bacteria | 3209 |
| 22 | JGI24033J26618_1000465 | 3300002155 | Bacteria | 3989 |
| 23 | JGI24034J26672_10000494 | 3300002239 | Bacteria | 5114 |
| 24 | JGI24742J22300_10000278 | 3300002244 | Bacteria | 7696 |
| 25 | Ga0065717_1001969 | 3300005276 | Bacteria | 4623 |
| 26 | Ga0065704_10076177 | 3300005289 | Bacteria | 5232 |
| 27 | Ga0065712_10010165 | 3300005290 | Unclassified | 3514 |
| 28 | Ga0065712_10082229 | 3300005290 | Bacteria | 2930 |
| 29 | Ga0065712_10170888 | 3300005290 | Bacteria | 1244 |
| 30 | Ga0065715_10089173 | 3300005293 | Bacteria | 13131 |
| 31 | Ga0065715_10120090 | 3300005293 | Bacteria | 2267 |
| 32 | Ga0070658_10026708 | 3300005327 | Bacteria | 4634 |
| 33 | Ga0070676_10000978 | 3300005328 | Bacteria | 14208 |
| 34 | Ga0070676_10090580 | 3300005328 | Bacteria | 1873 |
| 35 | Ga0070683_100001166 | 3300005329 | Bacteria | 19905 |
| 36 | Ga0070683_100215473 | 3300005329 | Unclassified | 1824 |
| 37 | Ga0070690_100001038 | 3300005330 | Bacteria | 14220 |
| 38 | Ga0070690_100015198 | 3300005330 | Bacteria | 4586 |
| 39 | Ga0070690_100029526 | 3300005330 | Bacteria | 3402 |
| 40 | Ga0070690_100042920 | 3300005330 | Bacteria | 2865 |
| 41 | Ga0070670_100003635 | 3300005331 | Bacteria | 12843 |
| 42 | Ga0070670_100012172 | 3300005331 | Bacteria | 7359 |
| 43 | Ga0070670_100294418 | 3300005331 | Unclassified | 1419 |
| 44 | Ga0070677_10000126 | 3300005333 | Bacteria | 25482 |
| 45 | Ga0068869_100002872 | 3300005334 | Bacteria | 10456 |
| 46 | Ga0068869_100122501 | 3300005334 | Bacteria | 1990 |
| 47 | Ga0068869_100555603 | 3300005334 | Bacteria | 965 |
| 48 | Ga0070666_10007115 | 3300005335 | Bacteria | 6901 |
| 49 | Ga0070666_10042300 | 3300005335 | Bacteria | 3048 |
| 50 | Ga0070680_100003349 | 3300005336 | Bacteria | 11958 |
| 51 | Ga0070680_100008343 | 3300005336 | Bacteria | 7929 |
| 52 | Ga0070680_100041804 | 3300005336 | Bacteria | 3717 |
| 53 | Ga0070680_100069911 | 3300005336 | Bacteria | 2883 |
| 54 | Ga0070682_100000641 | 3300005337 | Bacteria | 21233 |
| 55 | Ga0068868_100003027 | 3300005338 | Bacteria | 11693 |
| 56 | Ga0070660_100002411 | 3300005339 | Bacteria | 12843 |
| 57 | Ga0070660_100034540 | 3300005339 | Bacteria | 3822 |
| 58 | Ga0070660_100049153 | 3300005339 | Bacteria | 3241 |
| 59 | Ga0070660_100204578 | 3300005339 | Bacteria | 1602 |
| 60 | Ga0070689_100004089 | 3300005340 | Bacteria | 9825 |
| 61 | Ga0070689_100004527 | 3300005340 | Bacteria | 9413 |
| 62 | Ga0070689_100040803 | 3300005340 | Bacteria | 3559 |
| 63 | Ga0070691_10049070 | 3300005341 | Bacteria | 2010 |
| 64 | Ga0070687_100000085 | 3300005343 | Bacteria | 30647 |
| 65 | Ga0070687_100028353 | 3300005343 | Bacteria | 2715 |
| 66 | Ga0070661_100000307 | 3300005344 | Bacteria | 39479 |
| 67 | Ga0070661_100025875 | 3300005344 | Bacteria | 4217 |
| 68 | Ga0070661_100105180 | 3300005344 | Unclassified | 2103 |
| 69 | Ga0070661_100405484 | 3300005344 | Bacteria | 1078 |
| 70 | Ga0070692_10003918 | 3300005345 | Bacteria | 6137 |
| 71 | Ga0070692_10035591 | 3300005345 | Bacteria | 2522 |
| 72 | Ga0070668_100001248 | 3300005347 | Bacteria | 18134 |
| 73 | Ga0070668_100054836 | 3300005347 | Bacteria | 3076 |
| 74 | Ga0070669_100000571 | 3300005353 | Bacteria | 27367 |
| 75 | Ga0070675_100008609 | 3300005354 | Bacteria | 7923 |
| 76 | Ga0070675_100020365 | 3300005354 | Bacteria | 5295 |
| 77 | Ga0070675_100063073 | 3300005354 | Bacteria | 3063 |
| 78 | Ga0070675_100246924 | 3300005354 | Unclassified | 1561 |
| 79 | Ga0070671_100000104 | 3300005355 | Bacteria | 53922 |
| 80 | Ga0070671_100072021 | 3300005355 | Unclassified | 2885 |
| 81 | Ga0070674_100000238 | 3300005356 | Bacteria | 27260 |
| 82 | Ga0070674_100035821 | 3300005356 | Bacteria | 3326 |
| 83 | Ga0070674_100066460 | 3300005356 | Bacteria | 2534 |
| 84 | Ga0070673_100000152 | 3300005364 | Bacteria | 33183 |
| 85 | Ga0070673_100118963 | 3300005364 | Bacteria | 2200 |
| 86 | Ga0070673_100136582 | 3300005364 | Bacteria | 2064 |
| 87 | Ga0070688_100005902 | 3300005365 | Bacteria | 6485 |
| 88 | Ga0070688_100008100 | 3300005365 | Bacteria | 5693 |
| 89 | Ga0070688_100039619 | 3300005365 | Bacteria | 2884 |
| 90 | Ga0070659_100000551 | 3300005366 | Bacteria | 27372 |
| 91 | Ga0070659_100053119 | 3300005366 | Unclassified | 3189 |
| 92 | Ga0070667_100009897 | 3300005367 | Bacteria | 7904 |
| 93 | Ga0070667_100031049 | 3300005367 | Bacteria | 4454 |
| 94 | Ga0070667_100054697 | 3300005367 | Unclassified | 3370 |
| 95 | Ga0070667_100326336 | 3300005367 | Bacteria | 1386 |
| 96 | Ga0070703_10004978 | 3300005406 | Bacteria | 3708 |
| 97 | Ga0070709_10062929 | 3300005434 | Bacteria | 2367 |
| 98 | Ga0070714_100045087 | 3300005435 | Bacteria | 3735 |
| 99 | Ga0070714_100045879 | 3300005435 | Bacteria | 3705 |
| 100 | Ga0070714_100151122 | 3300005435 | Bacteria | 2093 |
| 101 | Ga0070714_100164539 | 3300005435 | Unclassified | 2009 |
| 102 | Ga0070713_100007389 | 3300005436 | Bacteria | 7708 |
| 103 | Ga0070713_100099207 | 3300005436 | Bacteria | 2519 |
| 104 | Ga0070713_100135912 | 3300005436 | Unclassified | 2172 |
| 105 | Ga0070713_100456005 | 3300005436 | Unclassified | 1201 |
| 106 | Ga0070710_10041960 | 3300005437 | Bacteria | 2528 |
| 107 | Ga0070710_10070468 | 3300005437 | Bacteria | 2014 |
| 108 | Ga0070710_10103898 | 3300005437 | Bacteria | 1696 |
| 109 | Ga0070701_10087275 | 3300005438 | Bacteria | 1702 |
| 110 | Ga0070701_10190757 | 3300005438 | Bacteria | 1206 |
| 111 | Ga0070711_100158736 | 3300005439 | Unclassified | 1712 |
| 112 | Ga0070711_100165148 | 3300005439 | Unclassified | 1682 |
| 113 | Ga0070711_100300453 | 3300005439 | Unclassified | 1276 |
| 114 | Ga0070705_100000148 | 3300005440 | Bacteria | 41687 |
| 115 | Ga0070705_100066789 | 3300005440 | Bacteria | 2158 |
| 116 | Ga0070705_100286652 | 3300005440 | Bacteria | 1173 |
| 117 | Ga0070705_100349918 | 3300005440 | Bacteria | 1077 |
| 118 | Ga0070700_100000277 | 3300005441 | Bacteria | 27391 |
| 119 | Ga0070700_100031131 | 3300005441 | Bacteria | 3194 |
| 120 | Ga0070694_100001507 | 3300005444 | Bacteria | 13661 |
| 121 | Ga0070694_100016824 | 3300005444 | Bacteria | 4610 |
| 122 | Ga0070694_100021063 | 3300005444 | Bacteria | 4161 |
| 123 | Ga0070694_100073471 | 3300005444 | Unclassified | 2362 |
| 124 | Ga0070708_100027462 | 3300005445 | Bacteria | 4884 |
| 125 | Ga0070663_100000522 | 3300005455 | Bacteria | 20244 |
| 126 | Ga0070663_100017769 | 3300005455 | Bacteria | 4649 |
| 127 | Ga0070663_100028232 | 3300005455 | Unclassified | 3818 |
| 128 | Ga0070663_100494731 | 3300005455 | Bacteria | 1014 |
| 129 | Ga0070678_100000718 | 3300005456 | Bacteria | 16435 |
| 130 | Ga0070678_100011460 | 3300005456 | Bacteria | 5470 |
| 131 | Ga0070678_100042025 | 3300005456 | Bacteria | 3246 |
| 132 | Ga0070662_100001666 | 3300005457 | Bacteria | 13661 |
| 133 | Ga0070662_100015894 | 3300005457 | Bacteria | 5047 |
| 134 | Ga0070662_100060423 | 3300005457 | Bacteria | 2764 |
| 135 | Ga0070681_10014569 | 3300005458 | Bacteria | 7825 |
| 136 | Ga0070681_10052540 | 3300005458 | Bacteria | 4064 |
| 137 | Ga0070681_10306708 | 3300005458 | Bacteria | 1497 |
| 138 | Ga0070681_10320548 | 3300005458 | Bacteria | 1459 |
| 139 | Ga0068867_100006623 | 3300005459 | Bacteria | 8186 |
| 140 | Ga0068867_100012024 | 3300005459 | Bacteria | 6112 |
| 141 | Ga0070685_10002221 | 3300005466 | Bacteria | 10015 |
| 142 | Ga0070685_10004005 | 3300005466 | Bacteria | 7442 |
| 143 | Ga0070685_10024466 | 3300005466 | Bacteria | 3317 |
| 144 | Ga0070706_100147399 | 3300005467 | Bacteria | 2198 |
| 145 | Ga0070699_100011505 | 3300005518 | Bacteria | 7639 |
| 146 | Ga0070699_100320219 | 3300005518 | Bacteria | 1394 |
| 147 | Ga0070679_100014561 | 3300005530 | Bacteria | 7557 |
| 148 | Ga0070679_100082633 | 3300005530 | Bacteria | 3202 |
| 149 | Ga0070679_100397378 | 3300005530 | Bacteria | 1324 |
| 150 | Ga0070684_100000894 | 3300005535 | Bacteria | 21105 |
| 151 | Ga0070684_100127730 | 3300005535 | Bacteria | 2291 |
| 152 | Ga0070684_100224857 | 3300005535 | Bacteria | 1713 |
| 153 | Ga0070684_100750412 | 3300005535 | Bacteria | 911 |
| 154 | Ga0070697_100023189 | 3300005536 | Bacteria | 4935 |
| 155 | Ga0070697_100174431 | 3300005536 | Bacteria | 1821 |
| 156 | Ga0068853_100020627 | 3300005539 | Bacteria | 5480 |
| 157 | Ga0068853_100191830 | 3300005539 | Bacteria | 1857 |
| 158 | Ga0068853_100209643 | 3300005539 | Bacteria | 1776 |
| 159 | Ga0070672_100000088 | 3300005543 | Bacteria | 44394 |
| 160 | Ga0070672_100172591 | 3300005543 | Bacteria | 1799 |
| 161 | Ga0070686_100000719 | 3300005544 | Bacteria | 19252 |
| 162 | Ga0070686_100028453 | 3300005544 | Bacteria | 3390 |
| 163 | Ga0070686_100029585 | 3300005544 | Bacteria | 3333 |
| 164 | Ga0070686_100040116 | 3300005544 | Bacteria | 2920 |
| 165 | Ga0070696_100020775 | 3300005546 | Bacteria | 4448 |
| 166 | Ga0070696_100068057 | 3300005546 | Bacteria | 2499 |
| 167 | Ga0070696_100227825 | 3300005546 | Bacteria | 1401 |
| 168 | Ga0070693_100000134 | 3300005547 | Bacteria | 33408 |
| 169 | Ga0070693_100151858 | 3300005547 | Bacteria | 1468 |
| 170 | Ga0070665_100032403 | 3300005548 | Bacteria | 5259 |
| 171 | Ga0070665_100144488 | 3300005548 | Bacteria | 2382 |
| 172 | Ga0070665_100352336 | 3300005548 | Bacteria | 1478 |
| 173 | Ga0070665_100469798 | 3300005548 | Bacteria | 1268 |
| 174 | Ga0070704_100000428 | 3300005549 | Bacteria | 19609 |
| 175 | Ga0070704_100027693 | 3300005549 | Unclassified | 3762 |
| 176 | Ga0068855_100007545 | 3300005563 | Bacteria | 13158 |
| 177 | Ga0068855_100031321 | 3300005563 | Bacteria | 6351 |
| 178 | Ga0068855_100127457 | 3300005563 | Bacteria | 2909 |
| 179 | Ga0068855_100203384 | 3300005563 | Bacteria | 2229 |
| 180 | Ga0068855_100634939 | 3300005563 | Bacteria | 1148 |
| 181 | Ga0070664_100002234 | 3300005564 | Bacteria | 15585 |
| 182 | Ga0070664_100045631 | 3300005564 | Bacteria | 3701 |
| 183 | Ga0070664_100097454 | 3300005564 | Bacteria | 2553 |
| 184 | Ga0070664_100121692 | 3300005564 | Unclassified | 2286 |
| 185 | Ga0068857_100002935 | 3300005577 | Bacteria | 14058 |
| 186 | Ga0068857_100708826 | 3300005577 | Bacteria | 957 |
| 187 | Ga0068854_100308029 | 3300005578 | Bacteria | 1284 |
| 188 | Ga0068856_100002000 | 3300005614 | Bacteria | 21261 |
| 189 | Ga0068856_100307550 | 3300005614 | Bacteria | 1603 |
| 190 | Ga0070702_100000638 | 3300005615 | Bacteria | 12987 |
| 191 | Ga0070702_100002467 | 3300005615 | Bacteria | 7998 |
| 192 | Ga0070702_100011329 | 3300005615 | Bacteria | 4432 |
| 193 | Ga0070702_100023246 | 3300005615 | Bacteria | 3291 |
| 194 | Ga0068852_100002115 | 3300005616 | Bacteria | 13595 |
| 195 | Ga0068852_100077859 | 3300005616 | Bacteria | 2932 |
| 196 | Ga0068859_100021325 | 3300005617 | Bacteria | 6500 |
| 197 | Ga0068859_100080532 | 3300005617 | Bacteria | 3297 |
| 198 | Ga0068859_100243543 | 3300005617 | Unclassified | 1888 |
| 199 | Ga0068864_100014592 | 3300005618 | Bacteria | 6526 |
| 200 | Ga0068866_10000301 | 3300005718 | Bacteria | 23583 |
| 201 | Ga0068866_10002757 | 3300005718 | Bacteria | 7244 |
| 202 | Ga0068866_10124413 | 3300005718 | Bacteria | 1458 |
| 203 | Ga0068861_100016840 | 3300005719 | Bacteria | 5179 |
| 204 | Ga0068861_100018418 | 3300005719 | Bacteria | 4975 |
| 205 | Ga0068851_10058471 | 3300005834 | Bacteria | 1970 |
| 206 | Ga0068870_10000354 | 3300005840 | Bacteria | 17200 |
| 207 | Ga0068870_10001545 | 3300005840 | Bacteria | 9356 |
| 208 | Ga0068863_100000340 | 3300005841 | Bacteria | 47641 |
| 209 | Ga0068863_100018623 | 3300005841 | Bacteria | 6643 |
| 210 | Ga0068863_100272427 | 3300005841 | Bacteria | 1639 |
| 211 | Ga0068858_100000295 | 3300005842 | Bacteria | 53892 |
| 212 | Ga0068858_100011371 | 3300005842 | Bacteria | 8405 |
| 213 | Ga0068858_100025797 | 3300005842 | Bacteria | 5467 |
| 214 | Ga0068858_100128333 | 3300005842 | Bacteria | 2376 |
| 215 | Ga0068858_100160619 | 3300005842 | Bacteria | 2116 |
| 216 | Ga0068860_100001285 | 3300005843 | Bacteria | 27247 |
| 217 | Ga0068860_100084443 | 3300005843 | Bacteria | 3021 |
| 218 | Ga0068862_100003236 | 3300005844 | Bacteria | 14093 |
| 219 | Ga0068862_100012543 | 3300005844 | Bacteria | 7016 |
| 220 | Ga0081455_10000007 | 3300005937 | Bacteria | 269394 |
| 221 | Ga0081455_10001479 | 3300005937 | Bacteria | 29079 |
| 222 | Ga0081455_10009018 | 3300005937 | Bacteria | 10296 |
| 223 | Ga0081455_10017104 | 3300005937 | Bacteria | 6968 |
| 224 | Ga0081455_10033388 | 3300005937 | Bacteria | 4625 |
| 225 | Ga0081455_10143080 | 3300005937 | Bacteria | 1854 |
| 226 | Ga0081538_10022998 | 3300005981 | Bacteria | 4493 |
| 227 | Ga0070717_10007640 | 3300006028 | Bacteria | 8037 |
| 228 | Ga0075365_10022333 | 3300006038 | Bacteria | 3964 |
| 229 | Ga0075432_10000272 | 3300006058 | Bacteria | 14285 |
| 230 | Ga0075432_10094683 | 3300006058 | Bacteria | 1097 |
| 231 | Ga0070715_10005495 | 3300006163 | Bacteria | 4230 |
| 232 | Ga0070716_100148747 | 3300006173 | Bacteria | 1503 |
| 233 | Ga0070716_100251765 | 3300006173 | Bacteria | 1204 |
| 234 | Ga0070712_100028432 | 3300006175 | Bacteria | 3740 |
| 235 | Ga0070712_100061683 | 3300006175 | Unclassified | 2649 |
| 236 | Ga0070712_100204349 | 3300006175 | Bacteria | 1554 |
| 237 | Ga0075367_10049729 | 3300006178 | Bacteria | 2472 |
| 238 | Ga0075366_10028947 | 3300006195 | Bacteria | 3252 |
| 239 | Ga0097621_100000040 | 3300006237 | Bacteria | 66339 |
| 240 | Ga0097621_100022646 | 3300006237 | Bacteria | 4879 |
| 241 | Ga0097621_100053322 | 3300006237 | Bacteria | 3296 |
| 242 | Ga0075370_10040679 | 3300006353 | Bacteria | 2622 |
| 243 | Ga0068871_100000301 | 3300006358 | Bacteria | 34368 |
| 244 | Ga0075428_100003180 | 3300006844 | Bacteria | 17952 |
| 245 | Ga0075428_100015358 | 3300006844 | Bacteria | 8491 |
| 246 | Ga0075428_100045005 | 3300006844 | Bacteria | 4850 |
| 247 | Ga0075428_100100352 | 3300006844 | Bacteria | 3156 |
| 248 | Ga0075428_100416948 | 3300006844 | Bacteria | 1439 |
| 249 | Ga0075430_100000201 | 3300006846 | Bacteria | 40551 |
| 250 | Ga0075431_100000260 | 3300006847 | Bacteria | 40551 |
| 251 | Ga0075431_100329512 | 3300006847 | Bacteria | 1538 |
| 252 | Ga0075431_100509470 | 3300006847 | Bacteria | 1194 |
| 253 | Ga0075433_10000007 | 3300006852 | Bacteria | 75995 |
| 254 | Ga0075433_10006753 | 3300006852 | Bacteria | 9093 |
| 255 | Ga0075433_10009620 | 3300006852 | Bacteria | 7735 |
| 256 | Ga0075433_10492088 | 3300006852 | Bacteria | 1080 |
| 257 | Ga0075434_100000091 | 3300006871 | Bacteria | 49489 |
| 258 | Ga0075434_100019587 | 3300006871 | Bacteria | 6551 |
| 259 | Ga0075434_100067068 | 3300006871 | Bacteria | 3575 |
| 260 | Ga0075434_100094300 | 3300006871 | Bacteria | 2998 |
| 261 | Ga0075434_100183234 | 3300006871 | Bacteria | 2115 |
| 262 | Ga0075429_100001824 | 3300006880 | Bacteria | 17627 |
| 263 | Ga0068865_100000275 | 3300006881 | Bacteria | 28270 |
| 264 | Ga0068865_100024369 | 3300006881 | Bacteria | 3969 |
| 265 | Ga0068865_100050689 | 3300006881 | Unclassified | 2869 |
| 266 | Ga0068865_100100150 | 3300006881 | Bacteria | 2120 |
| 267 | Ga0075436_100039496 | 3300006914 | Bacteria | 3257 |
| 268 | Ga0075436_100107605 | 3300006914 | Bacteria | 1945 |
| 269 | Ga0097620_100021325 | 3300006931 | Bacteria | 6500 |
| 270 | Ga0097620_100080540 | 3300006931 | Bacteria | 3297 |
| 271 | Ga0097620_100243538 | 3300006931 | Unclassified | 1888 |
| 272 | Ga0075435_100017727 | 3300007076 | Bacteria | 5396 |
| 273 | Ga0075435_100040818 | 3300007076 | Bacteria | 3707 |
| 274 | Ga0075435_100286057 | 3300007076 | Bacteria | 1408 |
| 275 | Ga0099794_10046157 | 3300007265 | Bacteria | 2086 |
| 276 | Ga0105251_10020085 | 3300009011 | Bacteria | 3515 |
| 277 | Ga0105244_10133680 | 3300009036 | Bacteria | 1196 |
| 278 | Ga0105250_10018576 | 3300009092 | Bacteria | 2815 |
| 279 | Ga0105240_10646330 | 3300009093 | Bacteria | 1160 |
| 280 | Ga0105240_10743379 | 3300009093 | Bacteria | 1067 |
| 281 | Ga0111539_10000394 | 3300009094 | Bacteria | 54170 |
| 282 | Ga0111539_10001672 | 3300009094 | Bacteria | 29559 |
| 283 | Ga0111539_10017527 | 3300009094 | Bacteria | 8865 |
| 284 | Ga0111539_10040786 | 3300009094 | Bacteria | 5586 |
| 285 | Ga0111539_10109172 | 3300009094 | Bacteria | 3247 |
| 286 | Ga0111539_10187414 | 3300009094 | Bacteria | 2416 |
| 287 | Ga0111539_10409500 | 3300009094 | Bacteria | 1579 |
| 288 | Ga0111539_10828611 | 3300009094 | Unclassified | 1076 |
| 289 | Ga0105245_10000462 | 3300009098 | Bacteria | 37242 |
| 290 | Ga0105245_10020090 | 3300009098 | Bacteria | 5855 |
| 291 | Ga0105245_10350384 | 3300009098 | Bacteria | 1463 |
| 292 | Ga0105247_10001920 | 3300009101 | Bacteria | 14500 |
| 293 | Ga0105247_10022379 | 3300009101 | Bacteria | 3807 |
| 294 | Ga0105247_10309243 | 3300009101 | Bacteria | 1099 |
| 295 | Ga0114129_10001111 | 3300009147 | Bacteria | 35464 |
| 296 | Ga0114129_10003047 | 3300009147 | Bacteria | 23477 |
| 297 | Ga0114129_10007767 | 3300009147 | Bacteria | 15259 |
| 298 | Ga0114129_10069532 | 3300009147 | Bacteria | 4908 |
| 299 | Ga0114129_10991037 | 3300009147 | Bacteria | 1059 |
| 300 | Ga0105243_10000282 | 3300009148 | Bacteria | 56666 |
| 301 | Ga0105243_10030614 | 3300009148 | Bacteria | 4145 |
| 302 | Ga0105243_10033566 | 3300009148 | Bacteria | 3969 |
| 303 | Ga0105243_10123865 | 3300009148 | Bacteria | 2184 |
| 304 | Ga0105241_10000652 | 3300009174 | Bacteria | 26004 |
| 305 | Ga0105242_10011119 | 3300009176 | Bacteria | 6917 |
| 306 | Ga0105242_10298969 | 3300009176 | Bacteria | 1468 |
| 307 | Ga0105248_10011410 | 3300009177 | Bacteria | 9793 |
| 308 | Ga0105248_10027731 | 3300009177 | Bacteria | 6306 |
| 309 | Ga0105248_10093852 | 3300009177 | Bacteria | 3380 |
| 310 | Ga0105248_10262268 | 3300009177 | Bacteria | 1945 |
| 311 | Ga0105237_10043527 | 3300009545 | Bacteria | 4522 |
| 312 | Ga0105237_10237597 | 3300009545 | Bacteria | 1823 |
| 313 | Ga0105238_10713221 | 3300009551 | Bacteria | 1015 |
| 314 | Ga0105249_10001210 | 3300009553 | Bacteria | 22796 |
| 315 | Ga0105249_10071575 | 3300009553 | Bacteria | 3204 |
| 316 | Ga0105249_10153953 | 3300009553 | Bacteria | 2216 |
| 317 | Ga0105249_10173060 | 3300009553 | Bacteria | 2095 |
| 318 | Ga0105249_10332376 | 3300009553 | Bacteria | 1534 |
| 319 | Ga0105239_10028214 | 3300010375 | Bacteria | 6174 |
| 320 | Ga0105239_10067368 | 3300010375 | Bacteria | 3933 |
| 321 | Ga0105239_10154111 | 3300010375 | Bacteria | 2565 |
| 322 | Ga0105239_10486636 | 3300010375 | Unclassified | 1402 |
| 323 | Ga0105246_10009002 | 3300011119 | Bacteria | 6147 |
| 324 | Ga0105246_10026829 | 3300011119 | Bacteria | 3769 |
| 325 | Ga0105246_10122864 | 3300011119 | Bacteria | 1926 |
| 326 | Ga0157346_1000445 | 3300012480 | Bacteria | 1749 |
| 327 | Ga0157373_10010359 | 3300013100 | Bacteria | 6863 |
| 328 | Ga0157371_10019421 | 3300013102 | Bacteria | 5014 |
| 329 | Ga0157370_10164555 | 3300013104 | Bacteria | 2063 |
| 330 | Ga0157374_10006038 | 3300013296 | Bacteria | 10248 |
| 331 | Ga0157374_10120686 | 3300013296 | Bacteria | 2530 |
| 332 | Ga0157374_10148398 | 3300013296 | Unclassified | 2279 |
| 333 | Ga0157374_10195927 | 3300013296 | Bacteria | 1977 |
| 334 | Ga0157378_10000270 | 3300013297 | Bacteria | 50517 |
| 335 | Ga0157378_10494906 | 3300013297 | Bacteria | 1220 |
| 336 | Ga0163162_10000145 | 3300013306 | Bacteria | 65191 |
| 337 | Ga0163162_10143726 | 3300013306 | Bacteria | 2500 |
| 338 | Ga0157372_10012191 | 3300013307 | Bacteria | 9156 |
| 339 | Ga0157372_10254765 | 3300013307 | Bacteria | 2038 |
| 340 | Ga0157375_10000332 | 3300013308 | Bacteria | 42513 |
| 341 | Ga0157375_10009000 | 3300013308 | Bacteria | 8739 |
| 342 | Ga0157375_10049349 | 3300013308 | Bacteria | 4123 |
| 343 | Ga0157375_10748389 | 3300013308 | Bacteria | 1129 |
| 344 | Ga0163163_10000865 | 3300014325 | Bacteria | 25811 |
| 345 | Ga0163163_10005560 | 3300014325 | Bacteria | 10916 |
| 346 | Ga0163163_10069639 | 3300014325 | Bacteria | 3502 |
| 347 | Ga0163163_10768790 | 3300014325 | Bacteria | 1027 |
| 348 | Ga0157380_10000891 | 3300014326 | Bacteria | 18753 |
| 349 | Ga0157380_10059658 | 3300014326 | Bacteria | 3045 |
| 350 | Ga0157380_10473230 | 3300014326 | Bacteria | 1209 |
| 351 | Ga0157377_10000137 | 3300014745 | Bacteria | 46698 |
| 352 | Ga0157377_10039626 | 3300014745 | Bacteria | 2607 |
| 353 | Ga0157377_10128440 | 3300014745 | Bacteria | 1545 |
| 354 | Ga0157379_10001761 | 3300014968 | Bacteria | 17895 |
| 355 | Ga0157379_10012181 | 3300014968 | Bacteria | 7512 |
| 356 | Ga0157379_10032861 | 3300014968 | Unclassified | 4626 |
| 357 | Ga0157379_10071950 | 3300014968 | Bacteria | 3093 |
| 358 | Ga0157376_10000088 | 3300014969 | Bacteria | 70084 |
| 359 | Ga0157376_10083873 | 3300014969 | Bacteria | 2742 |
| 360 | Ga0157376_10270273 | 3300014969 | Bacteria | 1597 |
| 361 | Ga0157376_10422725 | 3300014969 | Bacteria | 1294 |
| 362 | Ga0163161_10000144 | 3300017792 | Bacteria | 64771 |
| 363 | Ga0163161_10049602 | 3300017792 | Bacteria | 3034 |
| 364 | Ga0213876_10026729 | 3300021384 | Bacteria | 3044 |
| 365 | Ga0228598_1007345 | 3300024227 | Bacteria | 2246 |
| 366 | Ga0207666_1000048 | 3300025271 | Bacteria | 23535 |
| 367 | Ga0207666_1000627 | 3300025271 | Bacteria | 4229 |
| 368 | Ga0207697_10003423 | 3300025315 | Bacteria | 7856 |
| 369 | Ga0207697_10014016 | 3300025315 | Bacteria | 3337 |
| 370 | Ga0207713_1061801 | 3300025735 | Unclassified | 1423 |
| 371 | Ga0207653_10015888 | 3300025885 | Bacteria | 2362 |
| 372 | Ga0207653_10034319 | 3300025885 | Bacteria | 1648 |
| 373 | Ga0207682_10000509 | 3300025893 | Bacteria | 17874 |
| 374 | Ga0207692_10007140 | 3300025898 | Bacteria | 4565 |
| 375 | Ga0207692_10052953 | 3300025898 | Bacteria | 2065 |
| 376 | Ga0207692_10058464 | 3300025898 | Bacteria | 1986 |
| 377 | Ga0207642_10000762 | 3300025899 | Bacteria | 9965 |
| 378 | Ga0207642_10006361 | 3300025899 | Bacteria | 3921 |
| 379 | Ga0207710_10003986 | 3300025900 | Bacteria | 6510 |
| 380 | Ga0207688_10000033 | 3300025901 | Bacteria | 46898 |
| 381 | Ga0207688_10004167 | 3300025901 | Bacteria | 7880 |
| 382 | Ga0207680_10030693 | 3300025903 | Bacteria | 3035 |
| 383 | Ga0207680_10035788 | 3300025903 | Bacteria | 2854 |
| 384 | Ga0207680_10262312 | 3300025903 | Bacteria | 1196 |
| 385 | Ga0207647_10020884 | 3300025904 | Bacteria | 4383 |
| 386 | Ga0207699_10008794 | 3300025906 | Bacteria | 5000 |
| 387 | Ga0207699_10186194 | 3300025906 | Bacteria | 1398 |
| 388 | Ga0207645_10000100 | 3300025907 | Bacteria | 64057 |
| 389 | Ga0207645_10087683 | 3300025907 | Bacteria | 2000 |
| 390 | Ga0207643_10000007 | 3300025908 | Bacteria | 171706 |
| 391 | Ga0207643_10000671 | 3300025908 | Bacteria | 21326 |
| 392 | Ga0207705_10061675 | 3300025909 | Bacteria | 2708 |
| 393 | Ga0207684_10023683 | 3300025910 | Bacteria | 5241 |
| 394 | Ga0207654_10000314 | 3300025911 | Bacteria | 29106 |
| 395 | Ga0207654_10152486 | 3300025911 | Bacteria | 1485 |
| 396 | Ga0207707_10037222 | 3300025912 | Bacteria | 4251 |
| 397 | Ga0207707_10079630 | 3300025912 | Bacteria | 2861 |
| 398 | Ga0207707_10121335 | 3300025912 | Bacteria | 2285 |
| 399 | Ga0207707_10216102 | 3300025912 | Bacteria | 1669 |
| 400 | Ga0207707_10323939 | 3300025912 | Bacteria | 1330 |
| 401 | Ga0207695_10146209 | 3300025913 | Bacteria | 2308 |
| 402 | Ga0207671_10025600 | 3300025914 | Bacteria | 4431 |
| 403 | Ga0207671_10095297 | 3300025914 | Bacteria | 2247 |
| 404 | Ga0207693_10007799 | 3300025915 | Bacteria | 8785 |
| 405 | Ga0207693_10026013 | 3300025915 | Bacteria | 4634 |
| 406 | Ga0207693_10037280 | 3300025915 | Bacteria | 3832 |
| 407 | Ga0207693_10042697 | 3300025915 | Unclassified | 3569 |
| 408 | Ga0207663_10033165 | 3300025916 | Bacteria | 3073 |
| 409 | Ga0207663_10122808 | 3300025916 | Unclassified | 1781 |
| 410 | Ga0207663_10148936 | 3300025916 | Bacteria | 1639 |
| 411 | Ga0207660_10000041 | 3300025917 | Bacteria | 63485 |
| 412 | Ga0207660_10015546 | 3300025917 | Bacteria | 5024 |
| 413 | Ga0207660_10032163 | 3300025917 | Bacteria | 3619 |
| 414 | Ga0207660_10130351 | 3300025917 | Bacteria | 1913 |
| 415 | Ga0207660_10165018 | 3300025917 | Bacteria | 1711 |
| 416 | Ga0207660_10443574 | 3300025917 | Bacteria | 1049 |
| 417 | Ga0207662_10000282 | 3300025918 | Bacteria | 23540 |
| 418 | Ga0207662_10004598 | 3300025918 | Bacteria | 7276 |
| 419 | Ga0207662_10018861 | 3300025918 | Bacteria | 3918 |
| 420 | Ga0207662_10053389 | 3300025918 | Bacteria | 2408 |
| 421 | Ga0207657_10009921 | 3300025919 | Bacteria | 9530 |
| 422 | Ga0207657_10013952 | 3300025919 | Bacteria | 7861 |
| 423 | Ga0207657_10022759 | 3300025919 | Bacteria | 5853 |
| 424 | Ga0207657_10030177 | 3300025919 | Bacteria | 4925 |
| 425 | Ga0207657_10046445 | 3300025919 | Bacteria | 3803 |
| 426 | Ga0207657_10076831 | 3300025919 | Bacteria | 2816 |
| 427 | Ga0207649_10001482 | 3300025920 | Bacteria | 13783 |
| 428 | Ga0207649_10077097 | 3300025920 | Bacteria | 2147 |
| 429 | Ga0207649_10097948 | 3300025920 | Bacteria | 1935 |
| 430 | Ga0207649_10501719 | 3300025920 | Bacteria | 923 |
| 431 | Ga0207652_10002995 | 3300025921 | Bacteria | 14105 |
| 432 | Ga0207652_10049186 | 3300025921 | Bacteria | 3608 |
| 433 | Ga0207652_10077001 | 3300025921 | Bacteria | 2909 |
| 434 | Ga0207652_10229057 | 3300025921 | Unclassified | 1675 |
| 435 | Ga0207652_10229888 | 3300025921 | Bacteria | 1671 |
| 436 | Ga0207652_10426192 | 3300025921 | Bacteria | 1196 |
| 437 | Ga0207652_10428879 | 3300025921 | Bacteria | 1192 |
| 438 | Ga0207681_10001546 | 3300025923 | Bacteria | 14821 |
| 439 | Ga0207681_10412728 | 3300025923 | Bacteria | 1092 |
| 440 | Ga0207694_10273369 | 3300025924 | Bacteria | 1386 |
| 441 | Ga0207694_10344105 | 3300025924 | Unclassified | 1233 |
| 442 | Ga0207650_10001317 | 3300025925 | Bacteria | 17984 |
| 443 | Ga0207650_10015921 | 3300025925 | Bacteria | 5246 |
| 444 | Ga0207659_10005767 | 3300025926 | Bacteria | 7546 |
| 445 | Ga0207659_10019879 | 3300025926 | Bacteria | 4429 |
| 446 | Ga0207659_10045708 | 3300025926 | Bacteria | 3089 |
| 447 | Ga0207687_10000072 | 3300025927 | Bacteria | 76222 |
| 448 | Ga0207687_10029549 | 3300025927 | Bacteria | 3688 |
| 449 | Ga0207687_10105562 | 3300025927 | Bacteria | 2082 |
| 450 | Ga0207687_10447810 | 3300025927 | Bacteria | 1070 |
| 451 | Ga0207700_10001532 | 3300025928 | Bacteria | 13089 |
| 452 | Ga0207700_10014414 | 3300025928 | Bacteria | 5179 |
| 453 | Ga0207700_10062990 | 3300025928 | Bacteria | 2819 |
| 454 | Ga0207664_10016973 | 3300025929 | Bacteria | 5325 |
| 455 | Ga0207664_10092306 | 3300025929 | Bacteria | 2485 |
| 456 | Ga0207664_10139891 | 3300025929 | Unclassified | 2046 |
| 457 | Ga0207664_10326158 | 3300025929 | Bacteria | 1355 |
| 458 | Ga0207644_10001292 | 3300025931 | Bacteria | 16118 |
| 459 | Ga0207644_10221613 | 3300025931 | Bacteria | 1499 |
| 460 | Ga0207690_10000140 | 3300025932 | Bacteria | 58923 |
| 461 | Ga0207690_10070065 | 3300025932 | Bacteria | 2414 |
| 462 | Ga0207690_10383322 | 3300025932 | Bacteria | 1118 |
| 463 | Ga0207706_10002144 | 3300025933 | Bacteria | 19302 |
| 464 | Ga0207706_10012048 | 3300025933 | Bacteria | 7880 |
| 465 | Ga0207706_10042505 | 3300025933 | Unclassified | 4028 |
| 466 | Ga0207706_10109084 | 3300025933 | Bacteria | 2436 |
| 467 | Ga0207686_10001034 | 3300025934 | Bacteria | 16473 |
| 468 | Ga0207686_10120810 | 3300025934 | Bacteria | 1783 |
| 469 | Ga0207709_10001423 | 3300025935 | Bacteria | 16760 |
| 470 | Ga0207709_10015190 | 3300025935 | Bacteria | 4268 |
| 471 | Ga0207670_10005263 | 3300025936 | Bacteria | 7084 |
| 472 | Ga0207670_10015623 | 3300025936 | Bacteria | 4541 |
| 473 | Ga0207670_10066092 | 3300025936 | Bacteria | 2483 |
| 474 | Ga0207669_10000176 | 3300025937 | Bacteria | 29979 |
| 475 | Ga0207704_10000086 | 3300025938 | Bacteria | 54866 |
| 476 | Ga0207704_10009100 | 3300025938 | Bacteria | 4776 |
| 477 | Ga0207665_10000872 | 3300025939 | Bacteria | 20402 |
| 478 | Ga0207665_10135014 | 3300025939 | Bacteria | 1755 |
| 479 | Ga0207665_10159348 | 3300025939 | Bacteria | 1622 |
| 480 | Ga0207665_10207106 | 3300025939 | Bacteria | 1431 |
| 481 | Ga0207691_10000214 | 3300025940 | Bacteria | 56205 |
| 482 | Ga0207691_10003307 | 3300025940 | Bacteria | 15702 |
| 483 | Ga0207711_10001106 | 3300025941 | Bacteria | 25759 |
| 484 | Ga0207711_10006359 | 3300025941 | Bacteria | 9959 |
| 485 | Ga0207711_10036936 | 3300025941 | Bacteria | 4146 |
| 486 | Ga0207689_10000366 | 3300025942 | Bacteria | 42711 |
| 487 | Ga0207689_10114162 | 3300025942 | Bacteria | 2220 |
| 488 | Ga0207689_10505602 | 3300025942 | Bacteria | 1013 |
| 489 | Ga0207661_10000087 | 3300025944 | Bacteria | 63263 |
| 490 | Ga0207661_10470341 | 3300025944 | Bacteria | 1147 |
| 491 | Ga0207679_10000029 | 3300025945 | Bacteria | 183002 |
| 492 | Ga0207679_10061554 | 3300025945 | Bacteria | 2794 |
| 493 | Ga0207679_10090278 | 3300025945 | Unclassified | 2368 |
| 494 | Ga0207667_10009257 | 3300025949 | Bacteria | 11628 |
| 495 | Ga0207667_10255367 | 3300025949 | Bacteria | 1793 |
| 496 | Ga0207667_10345730 | 3300025949 | Bacteria | 1517 |
| 497 | Ga0207651_10000264 | 3300025960 | Bacteria | 22299 |
| 498 | Ga0207651_10355951 | 3300025960 | Bacteria | 1234 |
| 499 | Ga0207651_10411686 | 3300025960 | Unclassified | 1152 |
| 500 | Ga0207712_10001547 | 3300025961 | Bacteria | 15511 |
| 501 | Ga0207712_10013434 | 3300025961 | Bacteria | 5249 |
| 502 | Ga0207712_10584713 | 3300025961 | Unclassified | 964 |
| 503 | Ga0207668_10005954 | 3300025972 | Bacteria | 7187 |
| 504 | Ga0207640_10001474 | 3300025981 | Bacteria | 12692 |
| 505 | Ga0207640_10046782 | 3300025981 | Bacteria | 2787 |
| 506 | Ga0207658_10034469 | 3300025986 | Bacteria | 3618 |
| 507 | Ga0207658_10274950 | 3300025986 | Bacteria | 1441 |
| 508 | Ga0207658_10754531 | 3300025986 | Bacteria | 881 |
| 509 | Ga0207677_10001187 | 3300026023 | Bacteria | 14156 |
| 510 | Ga0207677_10403070 | 3300026023 | Bacteria | 1160 |
| 511 | Ga0207703_10003109 | 3300026035 | Bacteria | 14015 |
| 512 | Ga0207703_10030388 | 3300026035 | Bacteria | 4269 |
| 513 | Ga0207703_10262331 | 3300026035 | Bacteria | 1562 |
| 514 | Ga0207639_10012878 | 3300026041 | Bacteria | 5836 |
| 515 | Ga0207639_10096051 | 3300026041 | Unclassified | 2383 |
| 516 | Ga0207639_10204912 | 3300026041 | Bacteria | 1694 |
| 517 | Ga0207678_10011175 | 3300026067 | Bacteria | 7885 |
| 518 | Ga0207678_10012004 | 3300026067 | Bacteria | 7608 |
| 519 | Ga0207678_10038765 | 3300026067 | Bacteria | 4138 |
| 520 | Ga0207678_10051057 | 3300026067 | Bacteria | 3571 |
| 521 | Ga0207708_10000124 | 3300026075 | Bacteria | 59953 |
| 522 | Ga0207708_10007956 | 3300026075 | Bacteria | 7856 |
| 523 | Ga0207708_10025817 | 3300026075 | Bacteria | 4445 |
| 524 | Ga0207641_10000476 | 3300026088 | Bacteria | 45413 |
| 525 | Ga0207641_10183043 | 3300026088 | Bacteria | 1920 |
| 526 | Ga0207648_10000072 | 3300026089 | Bacteria | 94957 |
| 527 | Ga0207676_10000512 | 3300026095 | Bacteria | 32630 |
| 528 | Ga0207674_10000697 | 3300026116 | Bacteria | 43729 |
| 529 | Ga0207674_10228157 | 3300026116 | Bacteria | 1810 |
| 530 | Ga0207674_10570773 | 3300026116 | Bacteria | 1093 |
| 531 | Ga0207675_100005225 | 3300026118 | Bacteria | 12497 |
| 532 | Ga0207675_100030237 | 3300026118 | Bacteria | 5044 |
| 533 | Ga0207675_100171642 | 3300026118 | Bacteria | 2073 |
| 534 | Ga0207683_10000029 | 3300026121 | Bacteria | 109665 |
| 535 | Ga0207683_10010209 | 3300026121 | Bacteria | 8009 |
| 536 | Ga0207683_10049139 | 3300026121 | Bacteria | 3692 |
| 537 | Ga0207683_10058105 | 3300026121 | Bacteria | 3396 |
| 538 | Ga0207698_10000523 | 3300026142 | Bacteria | 22323 |
| 539 | Ga0207698_10006814 | 3300026142 | Bacteria | 7145 |
| 540 | Ga0207698_10105850 | 3300026142 | Bacteria | 2345 |
| 541 | Ga0209973_1002360 | 3300027252 | Unclassified | 1760 |
| 542 | Ga0210002_1000355 | 3300027617 | Bacteria | 6256 |
| 543 | Ga0209966_1012566 | 3300027695 | Bacteria | 1557 |
| 544 | Ga0209998_10002116 | 3300027717 | Bacteria | 4622 |
| 545 | Ga0209974_10002631 | 3300027876 | Bacteria | 6512 |
| 546 | Ga0209974_10037946 | 3300027876 | Bacteria | 1600 |
| 547 | Ga0207428_10000100 | 3300027907 | Bacteria | 119495 |
| 548 | Ga0207428_10000115 | 3300027907 | Bacteria | 109072 |
| 549 | Ga0207428_10000228 | 3300027907 | Bacteria | 77812 |
| 550 | Ga0207428_10237846 | 3300027907 | Bacteria | 1361 |
| 551 | Ga0268266_10127554 | 3300028379 | Bacteria | 2272 |
| 552 | Ga0268266_10466338 | 3300028379 | Bacteria | 1202 |
| 553 | Ga0268265_10001240 | 3300028380 | Bacteria | 22083 |
| 554 | Ga0268265_10011857 | 3300028380 | Bacteria | 5892 |
| 555 | Ga0268264_10002968 | 3300028381 | Bacteria | 14738 |
| 556 | Ga0268264_10098649 | 3300028381 | Bacteria | 2534 |
| 557 | Ga0265325_10000533 | 3300031241 | Bacteria | 27589 |
| 558 | Ga0265340_10008415 | 3300031247 | Bacteria | 5574 |
| 559 | Ga0265313_10010623 | 3300031595 | Bacteria | 5799 |
| 560 | Ga0316579_10140845 | 3300031691 | Bacteria | 1162 |
| 561 | Ga0265342_10000896 | 3300031712 | Bacteria | 29642 |
| 562 | Ga0265342_10127184 | 3300031712 | Bacteria | 1430 |
| 563 | Ga0373930_0000262 | 3300034816 | Bacteria | 6703 |
| 564 | Ga0373930_0016837 | 3300034816 | Bacteria | 1387 |
| 565 | Ga0373948_0003895 | 3300034817 | Bacteria | 2329 |
| 566 | Ga0373948_0010128 | 3300034817 | Bacteria | 1640 |
| 567 | Ga0373948_0024216 | 3300034817 | Bacteria | 1183 |
| 568 | Ga0373950_0005031 | 3300034818 | Bacteria | 1959 |
| 569 | Ga0373958_0001890 | 3300034819 | Bacteria | 2876 |
| 570 | Ga0373958_0006596 | 3300034819 | Bacteria | 1814 |
| 571 | Ga0373959_0003651 | 3300034820 | Bacteria | 2462 |
| 572 | Ga0373959_0019894 | 3300034820 | Bacteria | 1276 |
| 573 | Ga0373938_0000290 | 3300034957 | Bacteria | 8088 |
| 574 | Ga0373938_0000662 | 3300034957 | Bacteria | 5520 |
| 575 | Ga0373926_0090927 | 3300035083 | Bacteria | 1135 |
| 576 | Ga0373928_0000789 | 3300035084 | Bacteria | 6152 |
| 577 | Ga0373928_0006995 | 3300035084 | Unclassified | 2175 |
| 578 | Ga0373928_0009522 | 3300035084 | Bacteria | 1897 |
| 579 | Ga0373929_0002403 | 3300035085 | Bacteria | 3439 |
| 580 | Ga0373929_0006971 | 3300035085 | Bacteria | 2054 |
| 581 | Ga0373934_0046329 | 3300035086 | Unclassified | 1720 |
| 582 | Ga0373940_0050600 | 3300035088 | Bacteria | 1166 |
| 583 | Ga0373940_0071890 | 3300035088 | Bacteria | 1009 |
| 584 | Ga0373949_0000938 | 3300035090 | Bacteria | 9087 |
| 585 | Ga0373949_0001649 | 3300035090 | Bacteria | 6227 |
| 586 | Ga0373951_0000715 | 3300035091 | Bacteria | 9107 |
| 587 | Ga0373951_0005147 | 3300035091 | Bacteria | 3054 |
| 588 | Ga0373951_0035857 | 3300035091 | Bacteria | 1182 |
| 589 | Ga0373952_0000298 | 3300035092 | Bacteria | 8236 |
| 590 | Ga0373952_0002466 | 3300035092 | Bacteria | 3339 |
| 591 | Ga0373923_0054370 | 3300035111 | Bacteria | 1685 |
| 592 | Ga0373932_0000172 | 3300035112 | Bacteria | 18943 |
| 593 | Ga0373932_0008064 | 3300035112 | Bacteria | 2514 |
| 594 | Ga0373936_0004177 | 3300035113 | Bacteria | 5443 |
| 595 | Ga0373936_0059349 | 3300035113 | Bacteria | 1559 |
| 596 | Ga0373936_0096497 | 3300035113 | Bacteria | 1244 |
| 597 | Ga0373939_0000500 | 3300035114 | Bacteria | 9849 |
| 598 | Ga0373939_0007393 | 3300035114 | Bacteria | 2668 |
| 599 | Ga0373941_0001751 | 3300035115 | Bacteria | 4665 |
| 600 | Ga0373941_0013482 | 3300035115 | Bacteria | 2162 |
| 601 | Ga0373945_0002996 | 3300035116 | Bacteria | 5310 |
| 602 | Ga0373945_0010893 | 3300035116 | Bacteria | 2999 |
| 603 | Ga0373945_0076277 | 3300035116 | Unclassified | 1277 |
| 604 | Ga0373953_0001475 | 3300035117 | Bacteria | 6830 |
| 605 | Ga0373954_0050033 | 3300035118 | Bacteria | 1960 |
| 606 | Ga0373956_0142721 | 3300035119 | Bacteria | 1125 |
| 607 | Ga0373956_0181184 | 3300035119 | Unclassified | 996 |
| 608 | Ga0373957_0028243 | 3300035120 | Unclassified | 2043 |
| 609 | Ga0373960_0001140 | 3300035121 | Bacteria | 5759 |
| 610 | Ga0373960_0001458 | 3300035121 | Bacteria | 5233 |
| 611 | Ga0373943_0015808 | 3300035170 | Bacteria | 3432 |
| 612 | Ga0373943_0017540 | 3300035170 | Bacteria | 3275 |
| 613 | Ga0373946_0021621 | 3300035171 | Unclassified | 2496 |
| 614 | Ga0373955_0011599 | 3300035172 | Bacteria | 4207 |
| 615 | Ga0373955_0023581 | 3300035172 | Bacteria | 3136 |
| 616 | Ga0373955_0027187 | 3300035172 | Unclassified | 2955 |
| 617 | Ga0373955_0107444 | 3300035172 | Unclassified | 1610 |
| 618 | Ga0373955_0129822 | 3300035172 | Unclassified | 1470 |
| 619 | Ga0373942_0001552 | 3300035207 | Bacteria | 5891 |
| 620 | Ga0373961_0000196 | 3300035241 | Bacteria | 28662 |
| 621 | Ga0373961_0001345 | 3300035241 | Bacteria | 7386 |
| 622 | Ga0373961_0003263 | 3300035241 | Bacteria | 4041 |
| 623 | Ga0373962_0000310 | 3300035242 | Bacteria | 10526 |
| 624 | Ga0373962_0001593 | 3300035242 | Bacteria | 5381 |
| 625 | Ga0373962_0071476 | 3300035242 | Bacteria | 1038 |
| 626 | Ga0373924_0027636 | 3300035410 | Bacteria | 2257 |
| 627 | Ga0373924_0071717 | 3300035410 | Unclassified | 1462 |
| 628 | Ga0373931_0004010 | 3300035691 | Bacteria | 6667 |
| 629 | Ga0373931_0008212 | 3300035691 | Bacteria | 4946 |
| 630 | Ga0373931_0031253 | 3300035691 | Bacteria | 2747 |
| 631 | Ga0373931_0032881 | 3300035691 | Bacteria | 2686 |
| 632 | Ga0373931_0088107 | 3300035691 | Unclassified | 1724 |
| 633 | Ga0373931_0164382 | 3300035691 | Bacteria | 1303 |
| 634 | Ga0373935_0012655 | 3300035692 | Bacteria | 5077 |
| 635 | Ga0373935_0020024 | 3300035692 | Bacteria | 4084 |
| 636 | Ga0373927_0042280 | 3300035695 | Bacteria | 2952 |
| 637 | Ga0373927_0095358 | 3300035695 | Bacteria | 1933 |
| 638 | Ga0373927_0444526 | 3300035695 | Bacteria | 856 |
| 639 | Ga0373933_0001949 | 3300035724 | Bacteria | 11918 |
| 640 | Ga0373933_0006597 | 3300035724 | Bacteria | 6325 |
| 641 | Ga0373933_0008978 | 3300035724 | Bacteria | 5454 |
| 642 | Ga0373933_0032120 | 3300035724 | Unclassified | 3050 |
| 643 | Ga0373933_0162105 | 3300035724 | Bacteria | 1420 |
| 644 | Ga0373947_0000288 | 3300035725 | Bacteria | 28482 |
| 645 | Ga0373947_0008353 | 3300035725 | Bacteria | 5962 |
| 646 | Ga0373947_0103872 | 3300035725 | Bacteria | 1788 |
| 647 | Ga0373937_0005192 | 3300036401 | Bacteria | 11115 |
| 648 | Ga0373937_0014259 | 3300036401 | Bacteria | 7014 |
| 649 | Ga0373937_0025577 | 3300036401 | Bacteria | 5330 |
| 650 | Ga0373937_0266689 | 3300036401 | Bacteria | 1615 |
| 651 | Ga0373937_0286285 | 3300036401 | Unclassified | 1557 |
| 652 | Ga0373925_0001787 | 3300037068 | Bacteria | 17936 |
| 653 | Ga0373925_0007364 | 3300037068 | Bacteria | 8030 |
| 654 | Ga0373925_0043674 | 3300037068 | Unclassified | 3327 |
| 655 | Ga0373925_0173237 | 3300037068 | Unclassified | 1704 |
| 656 | Ga0373925_0211362 | 3300037068 | Bacteria | 1545 |
| 657 | Ga0395899_0223910 | 3300037312 | Bacteria | 1302 |
| 658 | Ga0395898_0112889 | 3300037466 | Bacteria | 2604 |
| 659 | Ga0395901_0057774 | 3300038443 | Bacteria | 4035 |
| 660 | Ga0436365_1087995 | 3300039437 | Bacteria | 4307 |
| 661 | Ga0439460_0007277 | 3300042461 | Bacteria | 2762 |
| 662 | Ga0451577_0010248 | 3300042876 | Bacteria | 8976 |
| 663 | Ga0495592_0009025 | 3300046454 | Bacteria | 7493 |
| 664 | Ga0495592_0049987 | 3300046454 | Bacteria | 3107 |
| 665 | Ga0495592_0262206 | 3300046454 | Unclassified | 1138 |
| 666 | Ga0495603_0047130 | 3300046455 | Bacteria | 2567 |
| 667 | Ga0495629_0000183 | 3300046459 | Bacteria | 56534 |
| 668 | Ga0495629_0020325 | 3300046459 | Unclassified | 4742 |
| 669 | Ga0495641_0016655 | 3300046461 | Bacteria | 3863 |
| 670 | Ga0495641_0019503 | 3300046461 | Unclassified | 3467 |
| 671 | Ga0495641_0052430 | 3300046461 | Unclassified | 1860 |
| 672 | Ga0495651_0001256 | 3300046462 | Bacteria | 19642 |
| 673 | Ga0495651_0004540 | 3300046462 | Bacteria | 10616 |
| 674 | Ga0495651_0023671 | 3300046462 | Bacteria | 4776 |
| 675 | Ga0495651_0064250 | 3300046462 | Bacteria | 2805 |
| 676 | Ga0495653_0046543 | 3300046463 | Unclassified | 3359 |
| 677 | Ga0495653_0057318 | 3300046463 | Bacteria | 2965 |
| 678 | Ga0495653_0117328 | 3300046463 | Bacteria | 1902 |
| 679 | Ga0495580_0080566 | 3300046472 | Bacteria | 2269 |
| 680 | Ga0495580_0120946 | 3300046472 | Bacteria | 1818 |
| 681 | Ga0495580_0123433 | 3300046472 | Bacteria | 1797 |
| 682 | Ga0495582_0001748 | 3300046473 | Bacteria | 12256 |
| 683 | Ga0495582_0002465 | 3300046473 | Bacteria | 10315 |
| 684 | Ga0495582_0097571 | 3300046473 | Unclassified | 1643 |
| 685 | Ga0495639_0015609 | 3300046475 | Bacteria | 3294 |
| 686 | Ga0495662_0019936 | 3300046476 | Unclassified | 3244 |
| 687 | Ga0495662_0052366 | 3300046476 | Bacteria | 1971 |
| 688 | Ga0495664_0007322 | 3300046477 | Bacteria | 6125 |
| 689 | Ga0495664_0007547 | 3300046477 | Bacteria | 6046 |
| 690 | Ga0495664_0026199 | 3300046477 | Bacteria | 3396 |
| 691 | Ga0495664_0071039 | 3300046477 | Unclassified | 2079 |
| 692 | Ga0495584_0023574 | 3300046491 | Bacteria | 3120 |
| 693 | Ga0495584_0065458 | 3300046491 | Bacteria | 1828 |
| 694 | Ga0495585_0017046 | 3300046492 | Bacteria | 4203 |
| 695 | Ga0495594_0068785 | 3300046499 | Bacteria | 1967 |
| 696 | Ga0495594_0081400 | 3300046499 | Bacteria | 1808 |
| 697 | Ga0495594_0087707 | 3300046499 | Bacteria | 1741 |
| 698 | Ga0495607_0019505 | 3300046501 | Bacteria | 4306 |
| 699 | Ga0495608_0000646 | 3300046511 | Bacteria | 24033 |
| 700 | Ga0495608_0019174 | 3300046511 | Bacteria | 4711 |
| 701 | Ga0495608_0073236 | 3300046511 | Unclassified | 2234 |
| 702 | Ga0495618_0025077 | 3300046514 | Bacteria | 3699 |
| 703 | Ga0495628_0001902 | 3300046516 | Bacteria | 18942 |
| 704 | Ga0495628_0105447 | 3300046516 | Bacteria | 2171 |
| 705 | Ga0495628_0246548 | 3300046516 | Unclassified | 1335 |
| 706 | Ga0495630_0086143 | 3300046517 | Bacteria | 2372 |
| 707 | Ga0495630_0137814 | 3300046517 | Unclassified | 1855 |
| 708 | Ga0495637_0049397 | 3300046520 | Unclassified | 1768 |
| 709 | Ga0495643_0132716 | 3300046522 | Bacteria | 1249 |
| 710 | Ga0495644_0000234 | 3300046523 | Bacteria | 26118 |
| 711 | Ga0495666_0019944 | 3300046526 | Bacteria | 3326 |
| 712 | Ga0495652_0012330 | 3300046529 | Bacteria | 7715 |
| 713 | Ga0495652_0039217 | 3300046529 | Bacteria | 4096 |
| 714 | Ga0495652_0055115 | 3300046529 | Bacteria | 3382 |
| 715 | Ga0495665_0039729 | 3300046531 | Bacteria | 2505 |
| 716 | Ga0495640_0018843 | 3300046533 | Bacteria | 5107 |
| 717 | Ga0495586_0102700 | 3300046535 | Bacteria | 1587 |
| 718 | Ga0495587_0000770 | 3300046536 | Bacteria | 21359 |
| 719 | Ga0495621_0082200 | 3300046539 | Bacteria | 1203 |
| 720 | Ga0495645_0010241 | 3300046543 | Bacteria | 6569 |
| 721 | Ga0495645_0067555 | 3300046543 | Bacteria | 2581 |
| 722 | Ga0495645_0074432 | 3300046543 | Bacteria | 2445 |
| 723 | Ga0495622_0026407 | 3300046557 | Bacteria | 2712 |
| 724 | Ga0495622_0036966 | 3300046557 | Bacteria | 2275 |
| 725 | Ga0495622_0115235 | 3300046557 | Bacteria | 1229 |
| 726 | Ga0495633_0055300 | 3300046558 | Bacteria | 1866 |
| 727 | Ga0495633_0132744 | 3300046558 | Unclassified | 1152 |
| 728 | Ga0495667_0012785 | 3300046559 | Bacteria | 5687 |
| 729 | Ga0495667_0013632 | 3300046559 | Bacteria | 5496 |
| 730 | Ga0495667_0021370 | 3300046559 | Bacteria | 4367 |
| 731 | Ga0495667_0231034 | 3300046559 | Unclassified | 1179 |
| 732 | Ga0495656_0000502 | 3300046615 | Bacteria | 12828 |
| 733 | Ga0495634_0005519 | 3300046642 | Bacteria | 9712 |
| 734 | Ga0495634_0029394 | 3300046642 | Bacteria | 3805 |
| 735 | Ga0495635_0000812 | 3300046663 | Bacteria | 20468 |
| 736 | Ga0495635_0068842 | 3300046663 | Unclassified | 2427 |
| 737 | Ga0495635_0078343 | 3300046663 | Bacteria | 2262 |
| 738 | Ga0495635_0090134 | 3300046663 | Bacteria | 2098 |
| 739 | Ga0495659_0019422 | 3300046664 | Unclassified | 2274 |
| 740 | Ga0495661_0133436 | 3300046665 | Bacteria | 1358 |
| 741 | Ga0495588_0018849 | 3300046674 | Unclassified | 3372 |
| 742 | Ga0495588_0049139 | 3300046674 | Unclassified | 2168 |
| 743 | Ga0495657_0005959 | 3300046675 | Bacteria | 9575 |
| 744 | Ga0495657_0073198 | 3300046675 | Bacteria | 2232 |
| 745 | Ga0495599_0003370 | 3300046678 | Bacteria | 9341 |
| 746 | Ga0495623_0001381 | 3300046679 | Bacteria | 16475 |
| 747 | Ga0495623_0007001 | 3300046679 | Bacteria | 7328 |
| 748 | Ga0495646_0006169 | 3300046680 | Bacteria | 7601 |
| 749 | Ga0495646_0101675 | 3300046680 | Bacteria | 1647 |
| 750 | Ga0495646_0225582 | 3300046680 | Unclassified | 1011 |
| 751 | Ga0495647_0010732 | 3300046681 | Bacteria | 3125 |
| 752 | Ga0495658_0026339 | 3300046683 | Unclassified | 3115 |
| 753 | Ga0495658_0033999 | 3300046683 | Bacteria | 2795 |
| 754 | Ga0495658_0100438 | 3300046683 | Bacteria | 1726 |
| 755 | Ga0495669_0025004 | 3300046684 | Unclassified | 2603 |
| 756 | Ga0495613_0103367 | 3300046689 | Bacteria | 2057 |
| 757 | Ga0495613_0174224 | 3300046689 | Bacteria | 1525 |
| 758 | Ga0495624_0022854 | 3300046690 | Bacteria | 4128 |
| 759 | Ga0495624_0040556 | 3300046690 | Unclassified | 2981 |
| 760 | Ga0495624_0043892 | 3300046690 | Unclassified | 2850 |
| 761 | Ga0495670_0001992 | 3300046691 | Bacteria | 10026 |
| 762 | Ga0495600_0001477 | 3300046809 | Bacteria | 13024 |
| 763 | Ga0495600_0071321 | 3300046809 | Bacteria | 2269 |
| 764 | Ga0495600_0122193 | 3300046809 | Unclassified | 1693 |
| 765 | Ga0495581_0129470 | 3300047315 | Bacteria | 1470 |
| 766 | Ga0495604_0079050 | 3300047317 | Bacteria | 2467 |
| 767 | Ga0495604_0093021 | 3300047317 | Bacteria | 2232 |
| 768 | Ga0495674_0058715 | 3300047319 | Bacteria | 3362 |
| 769 | Ga0495674_0147612 | 3300047319 | Bacteria | 1973 |
| 770 | Ga0495674_0254663 | 3300047319 | Bacteria | 1444 |
| 771 | Ga0495676_0031961 | 3300047321 | Bacteria | 4447 |
| 772 | Ga0495676_0047264 | 3300047321 | Bacteria | 3482 |
| 773 | Ga0495680_0006835 | 3300047322 | Bacteria | 10539 |
| 774 | Ga0495680_0025234 | 3300047322 | Bacteria | 4922 |
| 775 | Ga0495680_0045027 | 3300047322 | Bacteria | 3486 |
| 776 | Ga0495680_0047807 | 3300047322 | Bacteria | 3363 |
| 777 | Ga0495680_0150937 | 3300047322 | Unclassified | 1694 |
| 778 | Ga0495675_0007988 | 3300047444 | Bacteria | 6544 |
| 779 | Ga0495679_018405 | 3300047446 | Unclassified | 2480 |
| 780 | Ga0495684_0008581 | 3300047471 | Bacteria | 7911 |
| 781 | Ga0495684_0019509 | 3300047471 | Bacteria | 5223 |
| 782 | Ga0495684_0140377 | 3300047471 | Unclassified | 1811 |
| 783 | Ga0495684_0152115 | 3300047471 | Unclassified | 1729 |
| 784 | Ga0495684_0248375 | 3300047471 | Bacteria | 1295 |
| 785 | Ga0495684_0262639 | 3300047471 | Bacteria | 1252 |
| 786 | Ga0495593_0011432 | 3300047673 | Bacteria | 5100 |
| 787 | Ga0495602_0020689 | 3300048088 | Bacteria | 6498 |
| 788 | Ga0495602_0195930 | 3300048088 | Bacteria | 1545 |
| 789 | Ga0495614_0024203 | 3300048089 | Unclassified | 2622 |
| 790 | Ga0495614_0052376 | 3300048089 | Bacteria | 1749 |
| 791 | Ga0496100_0000530 | 3300048903 | Bacteria | 18154 |
| 792 | Ga0496100_0011766 | 3300048903 | Bacteria | 4992 |
| 793 | Ga0496100_0042055 | 3300048903 | Unclassified | 2916 |
| 794 | Ga0496100_0055648 | 3300048903 | Bacteria | 2585 |
| 795 | Ga0496100_0261903 | 3300048903 | Unclassified | 1283 |
| 796 | Ga0496101_0000189 | 3300048904 | Bacteria | 48416 |
| 797 | Ga0496101_0003519 | 3300048904 | Bacteria | 9766 |
| 798 | Ga0496101_0024583 | 3300048904 | Bacteria | 4170 |
| 799 | Ga0496101_0070644 | 3300048904 | Unclassified | 2557 |
| 800 | Ga0496101_0338230 | 3300048904 | Unclassified | 1182 |
| 801 | Ga0496101_0460570 | 3300048904 | Bacteria | 1003 |
| 802 | Ga0496102_0006150 | 3300048905 | Bacteria | 10232 |
| 803 | Ga0496102_0011115 | 3300048905 | Bacteria | 7754 |
| 804 | Ga0496102_0022131 | 3300048905 | Bacteria | 5632 |
| 805 | Ga0496102_0043206 | 3300048905 | Bacteria | 4086 |
| 806 | Ga0496102_0052973 | 3300048905 | Bacteria | 3698 |
| 807 | Ga0496102_0123061 | 3300048905 | Bacteria | 2423 |
| 808 | Ga0496102_0664937 | 3300048905 | Bacteria | 965 |
| 809 | Ga0496103_0001693 | 3300048906 | Bacteria | 14412 |
| 810 | Ga0496103_0006234 | 3300048906 | Bacteria | 7127 |
| 811 | Ga0496103_0056304 | 3300048906 | Bacteria | 2440 |
| 812 | Ga0496103_0124913 | 3300048906 | Unclassified | 1640 |
| 813 | Ga0496104_0001051 | 3300048907 | Bacteria | 23567 |
| 814 | Ga0496104_0001268 | 3300048907 | Bacteria | 21768 |
| 815 | Ga0496104_0011783 | 3300048907 | Bacteria | 7845 |
| 816 | Ga0496104_0032205 | 3300048907 | Bacteria | 4878 |
| 817 | Ga0496104_0032453 | 3300048907 | Bacteria | 4860 |
| 818 | Ga0496104_0077033 | 3300048907 | Bacteria | 3177 |
| 819 | Ga0496104_0086587 | 3300048907 | Bacteria | 2991 |
| 820 | Ga0496104_0110711 | 3300048907 | Bacteria | 2632 |
| 821 | Ga0496104_0175946 | 3300048907 | Bacteria | 2050 |
| 822 | Ga0496105_0010093 | 3300048908 | Bacteria | 7415 |
| 823 | Ga0496105_0017656 | 3300048908 | Bacteria | 5723 |
| 824 | Ga0496105_0030416 | 3300048908 | Bacteria | 4424 |
| 825 | Ga0496105_0039608 | 3300048908 | Bacteria | 3884 |
| 826 | Ga0496105_0045225 | 3300048908 | Bacteria | 3632 |
| 827 | Ga0496105_0051601 | 3300048908 | Bacteria | 3398 |
| 828 | Ga0496105_0147278 | 3300048908 | Bacteria | 1936 |
| 829 | Ga0496105_0243614 | 3300048908 | Bacteria | 1458 |
| 830 | Ga0496106_0002185 | 3300048909 | Bacteria | 14611 |
| 831 | Ga0496106_0002661 | 3300048909 | Bacteria | 13293 |
| 832 | Ga0496106_0039568 | 3300048909 | Bacteria | 3531 |
| 833 | Ga0496106_0059857 | 3300048909 | Bacteria | 2886 |
| 834 | Ga0496106_0060539 | 3300048909 | Bacteria | 2870 |
| 835 | Ga0496106_0062439 | 3300048909 | Bacteria | 2828 |
| 836 | Ga0496106_0119200 | 3300048909 | Bacteria | 2061 |
| 837 | Ga0496106_0151220 | 3300048909 | Unclassified | 1831 |
| 838 | Ga0496106_0171433 | 3300048909 | Bacteria | 1720 |
| 839 | Ga0496107_0005021 | 3300048910 | Bacteria | 9014 |
| 840 | Ga0496107_0007982 | 3300048910 | Bacteria | 7305 |
| 841 | Ga0496107_0042731 | 3300048910 | Bacteria | 3255 |
| 842 | Ga0496107_0059642 | 3300048910 | Bacteria | 2761 |
| 843 | Ga0496107_0063686 | 3300048910 | Bacteria | 2672 |
| 844 | Ga0496107_0082326 | 3300048910 | Bacteria | 2347 |
| 845 | Ga0496107_0123007 | 3300048910 | Bacteria | 1912 |
| 846 | Ga0496107_0224208 | 3300048910 | Bacteria | 1398 |
| 847 | Ga0496107_0266786 | 3300048910 | Unclassified | 1274 |
| 848 | Ga0496108_0004716 | 3300048911 | Bacteria | 10994 |
| 849 | Ga0496108_0007288 | 3300048911 | Bacteria | 8967 |
| 850 | Ga0496108_0020178 | 3300048911 | Bacteria | 5476 |
| 851 | Ga0496108_0022285 | 3300048911 | Bacteria | 5208 |
| 852 | Ga0496108_0048722 | 3300048911 | Bacteria | 3543 |
| 853 | Ga0496108_0052007 | 3300048911 | Unclassified | 3432 |
| 854 | Ga0496108_0079257 | 3300048911 | Bacteria | 2780 |
| 855 | Ga0496108_0155726 | 3300048911 | Bacteria | 1973 |
| 856 | Ga0496109_0000488 | 3300048912 | Bacteria | 33914 |
| 857 | Ga0496109_0000937 | 3300048912 | Bacteria | 24155 |
| 858 | Ga0496109_0006180 | 3300048912 | Bacteria | 10066 |
| 859 | Ga0496109_0006447 | 3300048912 | Bacteria | 9883 |
| 860 | Ga0496109_0076359 | 3300048912 | Unclassified | 3081 |
| 861 | Ga0496109_0131284 | 3300048912 | Bacteria | 2338 |
| 862 | Ga0496109_0134090 | 3300048912 | Bacteria | 2313 |
| 863 | Ga0496109_0161236 | 3300048912 | Bacteria | 2101 |
| 864 | Ga0496110_0010267 | 3300048913 | Bacteria | 7609 |
| 865 | Ga0496110_0011374 | 3300048913 | Bacteria | 7281 |
| 866 | Ga0496110_0060950 | 3300048913 | Bacteria | 3328 |
| 867 | Ga0496110_0087623 | 3300048913 | Bacteria | 2780 |
| 868 | Ga0496110_0176013 | 3300048913 | Bacteria | 1942 |
| 869 | Ga0496110_0186075 | 3300048913 | Bacteria | 1886 |
| 870 | Ga0496111_0043412 | 3300048914 | Bacteria | 3231 |
| 871 | Ga0496111_0054114 | 3300048914 | Unclassified | 2900 |
| 872 | Ga0496111_0073899 | 3300048914 | Bacteria | 2482 |
| 873 | Ga0496111_0186421 | 3300048914 | Bacteria | 1542 |
| 874 | Ga0496111_0290393 | 3300048914 | Bacteria | 1213 |
| 875 | Ga0496112_0002119 | 3300048915 | Bacteria | 15754 |
| 876 | Ga0496112_0030238 | 3300048915 | Bacteria | 5240 |
| 877 | Ga0496112_0042689 | 3300048915 | Plasmid | 4437 |
| 878 | Ga0496112_0072283 | 3300048915 | Bacteria | 3409 |
| 879 | Ga0496112_0150683 | 3300048915 | Bacteria | 2293 |
| 880 | Ga0496112_0382388 | 3300048915 | Unclassified | 1348 |
| 881 | Ga0496112_0650680 | 3300048915 | Bacteria | 983 |
| 882 | Ga0496113_0007034 | 3300048916 | Bacteria | 7196 |
| 883 | Ga0496113_0008963 | 3300048916 | Bacteria | 6550 |
| 884 | Ga0496113_0036654 | 3300048916 | Bacteria | 3594 |
| 885 | Ga0496113_0094768 | 3300048916 | Unclassified | 2306 |
| 886 | Ga0496114_0001444 | 3300048917 | Bacteria | 18027 |
| 887 | Ga0496114_0056180 | 3300048917 | Bacteria | 3284 |
| 888 | Ga0496114_0067813 | 3300048917 | Unclassified | 2993 |
| 889 | Ga0496114_0108540 | 3300048917 | Bacteria | 2376 |
| 890 | Ga0496114_0147267 | 3300048917 | Unclassified | 2042 |
| 891 | Ga0496114_0243562 | 3300048917 | Bacteria | 1582 |
| 892 | Ga0496114_0256679 | 3300048917 | Bacteria | 1538 |
| 893 | Ga0496115_0010890 | 3300048918 | Bacteria | 6809 |
| 894 | Ga0496115_0011115 | 3300048918 | Bacteria | 6746 |
| 895 | Ga0496115_0023856 | 3300048918 | Bacteria | 4750 |
| 896 | Ga0496115_0024977 | 3300048918 | Bacteria | 4649 |
| 897 | Ga0496115_0052993 | 3300048918 | Bacteria | 3255 |
| 898 | Ga0496115_0061694 | 3300048918 | Bacteria | 3023 |
| 899 | Ga0496115_0062463 | 3300048918 | Unclassified | 3004 |
| 900 | Ga0496115_0116398 | 3300048918 | Bacteria | 2198 |
| 901 | Ga0496115_0309304 | 3300048918 | Bacteria | 1294 |
| 902 | Ga0501032_0032146 | 3300049569 | Bacteria | 3595 |
| 903 | Ga0501032_0127112 | 3300049569 | Bacteria | 1683 |
| 904 | Ga0501032_0161794 | 3300049569 | Bacteria | 1470 |
| 905 | Ga0501033_0022284 | 3300049570 | Bacteria | 4778 |
| 906 | Ga0501034_0041862 | 3300049571 | Bacteria | 4635 |
| 907 | Ga0501034_0062271 | 3300049571 | Bacteria | 3746 |
| 908 | Ga0501034_0075137 | 3300049571 | Bacteria | 3387 |
| 909 | Ga0501034_0079867 | 3300049571 | Bacteria | 3275 |
| 910 | Ga0501034_0496032 | 3300049571 | Bacteria | 1135 |
| 911 | Ga0501036_0075408 | 3300049572 | Bacteria | 2852 |
| 912 | Ga0501036_0133421 | 3300049572 | Bacteria | 2096 |
| 913 | Ga0501037_0008863 | 3300049573 | Bacteria | 7366 |
| 914 | Ga0501037_0153724 | 3300049573 | Bacteria | 1643 |
| 915 | Ga0501038_0091952 | 3300049574 | Bacteria | 2541 |
| 916 | Ga0501038_0365413 | 3300049574 | Unclassified | 1122 |
| 917 | Ga0501039_0066340 | 3300049575 | Bacteria | 2801 |
| 918 | Ga0501039_0072285 | 3300049575 | Bacteria | 2680 |
| 919 | Ga0501042_0018045 | 3300049578 | Bacteria | 4881 |
| 920 | Ga0501043_0058825 | 3300049579 | Bacteria | 3016 |
| 921 | Ga0501046_0008348 | 3300049580 | Bacteria | 9033 |
| 922 | Ga0501047_0005574 | 3300049581 | Bacteria | 11854 |
| 923 | Ga0501047_0020602 | 3300049581 | Bacteria | 6332 |
| 924 | Ga0501048_0011858 | 3300049582 | Bacteria | 6497 |
| 925 | Ga0501067_0019941 | 3300049583 | Bacteria | 3709 |
| 926 | Ga0501067_0029331 | 3300049583 | Bacteria | 3049 |
| 927 | Ga0501067_0083058 | 3300049583 | Bacteria | 1777 |
| 928 | Ga0501068_0021379 | 3300049584 | Bacteria | 3777 |
| 929 | Ga0501068_0084807 | 3300049584 | Bacteria | 1949 |
| 930 | Ga0501069_0008627 | 3300049585 | Bacteria | 5365 |
| 931 | Ga0501069_0050869 | 3300049585 | Unclassified | 2305 |
| 932 | Ga0501070_0037325 | 3300049586 | Bacteria | 4056 |
| 933 | Ga0501070_0039332 | 3300049586 | Bacteria | 3945 |
| 934 | Ga0501070_0042299 | 3300049586 | Bacteria | 3794 |
| 935 | Ga0501070_0335857 | 3300049586 | Bacteria | 1228 |
| 936 | Ga0501071_0045909 | 3300049587 | Bacteria | 3137 |
| 937 | Ga0501071_0150128 | 3300049587 | Bacteria | 1738 |
| 938 | Ga0501072_0025367 | 3300049588 | Bacteria | 4618 |
| 939 | Ga0501073_0052097 | 3300049589 | Bacteria | 2866 |
| 940 | Ga0501074_0060323 | 3300049590 | Bacteria | 2732 |
| 941 | Ga0501074_0066377 | 3300049590 | Bacteria | 2595 |
| 942 | Ga0501076_0019979 | 3300049592 | Bacteria | 5125 |
| 943 | Ga0501076_0106849 | 3300049592 | Bacteria | 2260 |
| 944 | Ga0501077_0044390 | 3300049593 | Bacteria | 2824 |
| 945 | Ga0501077_0053596 | 3300049593 | Unclassified | 2561 |
| 946 | Ga0501077_0059008 | 3300049593 | Bacteria | 2436 |
| 947 | Ga0501077_0104465 | 3300049593 | Bacteria | 1795 |
| 948 | Ga0501079_0029585 | 3300049741 | Bacteria | 4206 |
| 949 | Ga0501079_0104827 | 3300049741 | Bacteria | 2194 |
| 950 | Ga0501079_0181819 | 3300049741 | Bacteria | 1641 |
| 951 | Ga0501080_0137924 | 3300049742 | Bacteria | 2256 |
| 952 | Ga0501081_0077791 | 3300049743 | Bacteria | 2319 |
| 953 | Ga0501083_0142979 | 3300049744 | Bacteria | 1566 |
| 954 | Ga0501083_0147279 | 3300049744 | Bacteria | 1542 |
| 955 | Ga0501035_0096281 | 3300049822 | Bacteria | 2601 |
| 956 | Ga0501035_0161843 | 3300049822 | Bacteria | 1937 |
| 957 | Ga0501035_0255216 | 3300049822 | Unclassified | 1488 |
| 958 | Ga0501035_0277780 | 3300049822 | Bacteria | 1416 |
| 959 | Ga0501044_0000212 | 3300049823 | Bacteria | 73807 |
| 960 | Ga0501044_0075245 | 3300049823 | Bacteria | 3428 |
| 961 | Ga0501044_0115183 | 3300049823 | Bacteria | 2693 |
| 962 | Ga0501044_0586978 | 3300049823 | Unclassified | 1008 |
| 963 | nmdc:mga00v17_25398_c1 | 3300050491 | Bacteria | 3443 |
| 964 | nmdc:mga0yw44_13330_c1 | 3300050492 | Bacteria | 4325 |
| 965 | nmdc:mga0yw44_23092_c1 | 3300050492 | Bacteria | 3500 |
| 966 | nmdc:mga0yw44_72764_c1 | 3300050492 | Bacteria | 2137 |
| 967 | nmdc:mga06z11_129052_c1 | 3300050494 | Bacteria | 1418 |
| 968 | nmdc:mga07m45_64769_c1 | 3300050496 | Bacteria | 2074 |
| 969 | nmdc:mga05p37_22407_c1 | 3300050507 | Bacteria | 7662 |
| 970 | nmdc:mga05p37_249482_c1 | 3300050507 | Bacteria | 2130 |
| 971 | nmdc:mga05p37_40101_c1 | 3300050507 | Bacteria | 5750 |
| 972 | nmdc:mga05p37_436714_c1 | 3300050507 | Bacteria | 1183 |
| 973 | nmdc:mga05p37_505_c1 | 3300050507 | Bacteria | 42970 |
| 974 | nmdc:mga05p37_9120_c1 | 3300050507 | Bacteria | 11724 |
| 975 | nmdc:mga09592_772_c1 | 3300050508 | Bacteria | 24711 |
| 976 | nmdc:mga0qj67_165_c1 | 3300050509 | Bacteria | 44307 |
| 977 | nmdc:mga0qj67_64449_c1 | 3300050509 | Bacteria | 2914 |
| 978 | nmdc:mga06r32_212095_c1 | 3300050510 | Bacteria | 1924 |
| 979 | nmdc:mga06r32_272949_c1 | 3300050510 | Bacteria | 1678 |
| 980 | nmdc:mga06r32_363440_c1 | 3300050510 | Bacteria | 1431 |
| 981 | nmdc:mga06r32_6147_c1 | 3300050510 | Bacteria | 10781 |
| 982 | nmdc:mga06r32_660729_c1 | 3300050510 | Bacteria | 1013 |
| 983 | nmdc:mga06r32_78142_c1 | 3300050510 | Bacteria | 3216 |
| 984 | nmdc:mga08y16_1045_c1 | 3300050511 | Bacteria | 27157 |
| 985 | nmdc:mga08y16_12959_c1 | 3300050511 | Bacteria | 8773 |
| 986 | nmdc:mga08y16_19941_c1 | 3300050511 | Bacteria | 7074 |
| 987 | nmdc:mga08y16_264944_c1 | 3300050511 | Bacteria | 1774 |
| 988 | nmdc:mga08y16_2844_c1 | 3300050511 | Bacteria | 17794 |
| 989 | nmdc:mga08y16_333700_c1 | 3300050511 | Bacteria | 1559 |
| 990 | nmdc:mga08y16_497493_c1 | 3300050511 | Bacteria | 1239 |
| 991 | nmdc:mga0n895_122515_c1 | 3300050512 | Bacteria | 2622 |
| 992 | nmdc:mga0n895_189060_c1 | 3300050512 | Bacteria | 2090 |
| 993 | nmdc:mga0n895_24562_c1 | 3300050512 | Bacteria | 5681 |
| 994 | nmdc:mga0n895_2649_c1 | 3300050512 | Bacteria | 14116 |
| 995 | nmdc:mga0n895_45935_c1 | 3300050512 | Bacteria | 4265 |
| 996 | nmdc:mga0n895_597460_c1 | 3300050512 | Bacteria | 1106 |
| 997 | nmdc:mga0n895_613787_c1 | 3300050512 | Bacteria | 1089 |
| 998 | nmdc:mga0n895_76480_c1 | 3300050512 | Bacteria | 3329 |
| 999 | nmdc:mga0rr50_124153_c1 | 3300050513 | Bacteria | 2059 |
| 1000 | nmdc:mga0rr50_1278_c1 | 3300050513 | Bacteria | 13714 |
| 1001 | nmdc:mga0rr50_16037_c1 | 3300050513 | Bacteria | 4108 |
| 1002 | nmdc:mga0rr50_192693_c1 | 3300050513 | Unclassified | 1671 |
| 1003 | nmdc:mga08x19_211521_c1 | 3300050514 | Bacteria | 1331 |
| 1004 | nmdc:mga08x19_23872_c1 | 3300050514 | Bacteria | 3795 |
| 1005 | nmdc:mga08x19_95929_c1 | 3300050514 | Bacteria | 1962 |
| 1006 | nmdc:mga0a205_15415_c1 | 3300050515 | Bacteria | 7143 |
| 1007 | nmdc:mga0a205_1632_c1 | 3300050515 | Bacteria | 19295 |
| 1008 | nmdc:mga0a205_20147_c1 | 3300050515 | Bacteria | 6292 |
| 1009 | nmdc:mga0a205_237148_c1 | 3300050515 | Bacteria | 1706 |
| 1010 | nmdc:mga0a205_565274_c1 | 3300050515 | Bacteria | 992 |
| 1011 | nmdc:mga0a205_81954_c1 | 3300050515 | Bacteria | 3116 |
| 1012 | Ga0495601_0000075 | 3300053077 | Bacteria | 54434 |
| 1013 | Ga0495601_0000961 | 3300053077 | Bacteria | 15756 |
| 1014 | Ga0495601_0001420 | 3300053077 | Bacteria | 13193 |
| 1015 | Ga0495601_0018671 | 3300053077 | Bacteria | 4221 |
| 1016 | Ga0495601_0048186 | 3300053077 | Bacteria | 2684 |
| 1017 | Ga0495612_0001336 | 3300053078 | Bacteria | 10158 |
| 1018 | Ga0495612_0002112 | 3300053078 | Bacteria | 8162 |
| 1019 | Ga0495612_0006592 | 3300053078 | Bacteria | 4764 |
| 1020 | Ga0495612_0008176 | 3300053078 | Bacteria | 4251 |
| 1021 | Ga0495612_0009466 | 3300053078 | Unclassified | 3950 |
| 1022 | Ga0495655_0005569 | 3300053083 | Bacteria | 2234 |
| 1023 | Ga0495595_0004598 | 3300053084 | Bacteria | 5550 |
| 1024 | Ga0495595_0005026 | 3300053084 | Bacteria | 5341 |
| 1025 | Ga0495595_0005375 | 3300053084 | Bacteria | 5187 |
| 1026 | Ga0495595_0023737 | 3300053084 | Bacteria | 2703 |
| 1027 | Ga0495595_0034986 | 3300053084 | Unclassified | 2274 |
| 1028 | Ga0495619_0000211 | 3300053085 | Bacteria | 42390 |
| 1029 | Ga0495619_0000315 | 3300053085 | Bacteria | 33904 |
| 1030 | Ga0495619_0000907 | 3300053085 | Bacteria | 19405 |
| 1031 | Ga0495619_0005328 | 3300053085 | Bacteria | 8144 |
| 1032 | Ga0495619_0033900 | 3300053085 | Bacteria | 3317 |
| 1033 | Ga0495619_0060054 | 3300053085 | Bacteria | 2526 |
| 1034 | Ga0495619_0185501 | 3300053085 | Unclassified | 1439 |
| 1035 | Ga0500616_0000028 | 3300053153 | Bacteria | 435722 |
| 1036 | Ga0501084_0033284 | 3300054114 | Bacteria | 4312 |
| 1037 | Ga0501084_0116228 | 3300054114 | Bacteria | 2249 |
| 1038 | Ga0501082_0010759 | 3300060353 | Bacteria | 7877 |
| 1039 | Ga0501082_0390742 | 3300060353 | Unclassified | 1214 |
| 1040 | Ga0530510_0323109 | 3300061734 | Unclassified | 1157 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049590 | Ga0501074_0060323 | Ga0501074_0060323_2007_2717 | 234 |
| 2 | 3300060353 | Ga0501082_0390742 | Ga0501082_0390742_162_1007 | 264 |
| 3 | 3300049569 | Ga0501032_0127112 | Ga0501032_0127112_778_1623 | 268 |
| 4 | 3300025916 | Ga0207663_10122808 | Ga0207663_101228081 | 270 |
| 5 | 3300047471 | Ga0495684_0140377 | Ga0495684_0140377_425_1237 | 270 |
| 6 | 3300035695 | Ga0373927_0444526 | Ga0373927_0444526_24_842 | 272 |
| 7 | 3300049592 | Ga0501076_0106849 | Ga0501076_0106849_1371_2216 | 273 |
| 8 | 3300054114 | Ga0501084_0116228 | Ga0501084_0116228_1050_1895 | 273 |
| 9 | 3300049583 | Ga0501067_0019941 | Ga0501067_0019941_2378_3223 | 274 |
| 10 | 3300049584 | Ga0501068_0084807 | Ga0501068_0084807_407_1252 | 274 |
| 11 | 3300049586 | Ga0501070_0039332 | Ga0501070_0039332_1535_2380 | 274 |
| 12 | 3300049587 | Ga0501071_0150128 | Ga0501071_0150128_205_1050 | 274 |
| 13 | 3300049588 | Ga0501072_0025367 | Ga0501072_0025367_3575_4420 | 274 |
| 14 | 3300049589 | Ga0501073_0052097 | Ga0501073_0052097_1438_2283 | 274 |
| 15 | 3300049590 | Ga0501074_0066377 | Ga0501074_0066377_973_1818 | 274 |
| 16 | 3300049741 | Ga0501079_0181819 | Ga0501079_0181819_149_994 | 274 |
| 17 | 3300049742 | Ga0501080_0137924 | Ga0501080_0137924_867_1712 | 274 |
| 18 | 3300049822 | Ga0501035_0255216 | Ga0501035_0255216_305_1150 | 274 |
| 19 | 3300049823 | Ga0501044_0075245 | Ga0501044_0075245_198_1043 | 274 |
| 20 | 3300005548 | Ga0070665_100469798 | Ga0070665_1004697982 | 279 |
| 21 | 3300028379 | Ga0268266_10466338 | Ga0268266_104663382 | 279 |
| 22 | 3300053153 | Ga0500616_0000028 | Ga0500616_0000028_131405_132244 | 279 |
| 23 | 3300005435 | Ga0070714_100045879 | Ga0070714_1000458791 | 280 |
| 24 | 3300006163 | Ga0070715_10005495 | Ga0070715_100054952 | 280 |
| 25 | 3300006173 | Ga0070716_100251765 | Ga0070716_1002517651 | 280 |
| 26 | 3300025898 | Ga0207692_10058464 | Ga0207692_100584642 | 280 |
| 27 | 3300025929 | Ga0207664_10092306 | Ga0207664_100923062 | 280 |
| 28 | 3300031691 | Ga0316579_10140845 | Ga0316579_101408451 | 280 |
| 29 | 3300048917 | Ga0496114_0108540 | Ga0496114_0108540_34_876 | 280 |
| 30 | 3300049569 | Ga0501032_0161794 | Ga0501032_0161794_578_1420 | 280 |
| 31 | 3300049571 | Ga0501034_0041862 | Ga0501034_0041862_203_1069 | 280 |
| 32 | 2209111006 | 2214745210 | 2213754776 | 281 |
| 33 | 3300000041 | ARcpr5oldR_c000144 | ARcpr5oldR_00014413 | 281 |
| 34 | 3300000042 | ARSoilYngRDRAFT_c00009 | ARSoilYngRDRAFT_000095 | 281 |
| 35 | 3300000043 | ARcpr5yngRDRAFT_c000006 | ARcpr5yngRDRAFT_0000065 | 281 |
| 36 | 3300000044 | ARSoilOldRDRAFT_c000102 | ARSoilOldRDRAFT_0001025 | 281 |
| 37 | 3300000045 | ARCol0oldRDRAFT_c00372 | ARCol0oldRDRAFT_003723 | 281 |
| 38 | 3300000652 | ARCol0yngRDRAFT_1000031 | ARCol0yngRDRAFT_100003125 | 281 |
| 39 | 3300001430 | JGI24032J14994_100083 | JGI24032J14994_1000833 | 281 |
| 40 | 3300001976 | JGI24752J21851_1003042 | JGI24752J21851_10030422 | 281 |
| 41 | 3300001977 | JGI24746J21847_1002186 | JGI24746J21847_10021864 | 281 |
| 42 | 3300001978 | JGI24747J21853_1006367 | JGI24747J21853_10063672 | 281 |
| 43 | 3300001989 | JGI24739J22299_10001142 | JGI24739J22299_100011427 | 281 |
| 44 | 3300001989 | JGI24739J22299_10001990 | JGI24739J22299_100019907 | 281 |
| 45 | 3300001990 | JGI24737J22298_10001546 | JGI24737J22298_100015467 | 281 |
| 46 | 3300001990 | JGI24737J22298_10010151 | JGI24737J22298_100101511 | 281 |
| 47 | 3300001991 | JGI24743J22301_10026307 | JGI24743J22301_100263071 | 281 |
| 48 | 3300002070 | JGI24750J21931_1000491 | JGI24750J21931_10004914 | 281 |
| 49 | 3300002075 | JGI24738J21930_10000010 | JGI24738J21930_100000102 | 281 |
| 50 | 3300002076 | JGI24749J21850_1000579 | JGI24749J21850_10005797 | 281 |
| 51 | 3300002077 | JGI24744J21845_10006762 | JGI24744J21845_100067622 | 281 |
| 52 | 3300002126 | JGI24035J26624_1000653 | JGI24035J26624_10006532 | 281 |
| 53 | 3300002155 | JGI24033J26618_1000465 | JGI24033J26618_10004652 | 281 |
| 54 | 3300002239 | JGI24034J26672_10000494 | JGI24034J26672_100004944 | 281 |
| 55 | 3300002244 | JGI24742J22300_10000278 | JGI24742J22300_100002787 | 281 |
| 56 | 3300005276 | Ga0065717_1001969 | Ga0065717_10019694 | 281 |
| 57 | 3300005289 | Ga0065704_10076177 | Ga0065704_100761775 | 281 |
| 58 | 3300005290 | Ga0065712_10010165 | Ga0065712_100101652 | 281 |
| 59 | 3300005290 | Ga0065712_10082229 | Ga0065712_100822293 | 281 |
| 60 | 3300005290 | Ga0065712_10170888 | Ga0065712_101708882 | 281 |
| 61 | 3300005293 | Ga0065715_10089173 | Ga0065715_100891732 | 281 |
| 62 | 3300005293 | Ga0065715_10120090 | Ga0065715_101200902 | 281 |
| 63 | 3300005327 | Ga0070658_10026708 | Ga0070658_100267085 | 281 |
| 64 | 3300005328 | Ga0070676_10000978 | Ga0070676_100009782 | 281 |
| 65 | 3300005328 | Ga0070676_10090580 | Ga0070676_100905802 | 281 |
| 66 | 3300005329 | Ga0070683_100001166 | Ga0070683_10000116615 | 281 |
| 67 | 3300005329 | Ga0070683_100215473 | Ga0070683_1002154731 | 281 |
| 68 | 3300005330 | Ga0070690_100001038 | Ga0070690_1000010384 | 281 |
| 69 | 3300005330 | Ga0070690_100015198 | Ga0070690_1000151984 | 281 |
| 70 | 3300005330 | Ga0070690_100029526 | Ga0070690_1000295263 | 281 |
| 71 | 3300005330 | Ga0070690_100042920 | Ga0070690_1000429201 | 281 |
| 72 | 3300005331 | Ga0070670_100003635 | Ga0070670_1000036357 | 281 |
| 73 | 3300005331 | Ga0070670_100012172 | Ga0070670_1000121728 | 281 |
| 74 | 3300005331 | Ga0070670_100294418 | Ga0070670_1002944182 | 281 |
| 75 | 3300005333 | Ga0070677_10000126 | Ga0070677_1000012613 | 281 |
| 76 | 3300005334 | Ga0068869_100002872 | Ga0068869_1000028729 | 281 |
| 77 | 3300005334 | Ga0068869_100122501 | Ga0068869_1001225013 | 281 |
| 78 | 3300005334 | Ga0068869_100555603 | Ga0068869_1005556031 | 281 |
| 79 | 3300005335 | Ga0070666_10007115 | Ga0070666_100071157 | 281 |
| 80 | 3300005335 | Ga0070666_10042300 | Ga0070666_100423001 | 281 |
| 81 | 3300005336 | Ga0070680_100003349 | Ga0070680_10000334914 | 281 |
| 82 | 3300005336 | Ga0070680_100008343 | Ga0070680_1000083437 | 281 |
| 83 | 3300005336 | Ga0070680_100041804 | Ga0070680_1000418043 | 281 |
| 84 | 3300005336 | Ga0070680_100069911 | Ga0070680_1000699113 | 281 |
| 85 | 3300005337 | Ga0070682_100000641 | Ga0070682_10000064123 | 281 |
| 86 | 3300005338 | Ga0068868_100003027 | Ga0068868_10000302710 | 281 |
| 87 | 3300005339 | Ga0070660_100002411 | Ga0070660_10000241114 | 281 |
| 88 | 3300005339 | Ga0070660_100034540 | Ga0070660_1000345402 | 281 |
| 89 | 3300005339 | Ga0070660_100049153 | Ga0070660_1000491533 | 281 |
| 90 | 3300005339 | Ga0070660_100204578 | Ga0070660_1002045781 | 281 |
| 91 | 3300005340 | Ga0070689_100004089 | Ga0070689_1000040899 | 281 |
| 92 | 3300005340 | Ga0070689_100004527 | Ga0070689_1000045277 | 281 |
| 93 | 3300005340 | Ga0070689_100040803 | Ga0070689_1000408032 | 281 |
| 94 | 3300005341 | Ga0070691_10049070 | Ga0070691_100490702 | 281 |
| 95 | 3300005343 | Ga0070687_100000085 | Ga0070687_10000008510 | 281 |
| 96 | 3300005343 | Ga0070687_100028353 | Ga0070687_1000283531 | 281 |
| 97 | 3300005344 | Ga0070661_100000307 | Ga0070661_10000030738 | 281 |
| 98 | 3300005344 | Ga0070661_100025875 | Ga0070661_1000258753 | 281 |
| 99 | 3300005344 | Ga0070661_100105180 | Ga0070661_1001051802 | 281 |
| 100 | 3300005344 | Ga0070661_100405484 | Ga0070661_1004054841 | 281 |
| 101 | 3300005345 | Ga0070692_10003918 | Ga0070692_100039182 | 281 |
| 102 | 3300005345 | Ga0070692_10035591 | Ga0070692_100355913 | 281 |
| 103 | 3300005347 | Ga0070668_100001248 | Ga0070668_1000012487 | 281 |
| 104 | 3300005347 | Ga0070668_100054836 | Ga0070668_1000548361 | 281 |
| 105 | 3300005353 | Ga0070669_100000571 | Ga0070669_1000005712 | 281 |
| 106 | 3300005354 | Ga0070675_100008609 | Ga0070675_1000086092 | 281 |
| 107 | 3300005354 | Ga0070675_100020365 | Ga0070675_1000203652 | 281 |
| 108 | 3300005354 | Ga0070675_100063073 | Ga0070675_1000630732 | 281 |
| 109 | 3300005354 | Ga0070675_100246924 | Ga0070675_1002469242 | 281 |
| 110 | 3300005355 | Ga0070671_100000104 | Ga0070671_10000010460 | 281 |
| 111 | 3300005355 | Ga0070671_100072021 | Ga0070671_1000720212 | 281 |
| 112 | 3300005356 | Ga0070674_100000238 | Ga0070674_1000002382 | 281 |
| 113 | 3300005356 | Ga0070674_100035821 | Ga0070674_1000358214 | 281 |
| 114 | 3300005356 | Ga0070674_100066460 | Ga0070674_1000664602 | 281 |
| 115 | 3300005364 | Ga0070673_100000152 | Ga0070673_10000015212 | 281 |
| 116 | 3300005364 | Ga0070673_100118963 | Ga0070673_1001189631 | 281 |
| 117 | 3300005364 | Ga0070673_100136582 | Ga0070673_1001365822 | 281 |
| 118 | 3300005365 | Ga0070688_100005902 | Ga0070688_1000059027 | 281 |
| 119 | 3300005365 | Ga0070688_100008100 | Ga0070688_1000081002 | 281 |
| 120 | 3300005365 | Ga0070688_100039619 | Ga0070688_1000396193 | 281 |
| 121 | 3300005366 | Ga0070659_100000551 | Ga0070659_1000005512 | 281 |
| 122 | 3300005366 | Ga0070659_100053119 | Ga0070659_1000531191 | 281 |
| 123 | 3300005367 | Ga0070667_100009897 | Ga0070667_1000098977 | 281 |
| 124 | 3300005367 | Ga0070667_100031049 | Ga0070667_1000310495 | 281 |
| 125 | 3300005367 | Ga0070667_100054697 | Ga0070667_1000546972 | 281 |
| 126 | 3300005367 | Ga0070667_100326336 | Ga0070667_1003263362 | 281 |
| 127 | 3300005406 | Ga0070703_10004978 | Ga0070703_100049784 | 281 |
| 128 | 3300005434 | Ga0070709_10062929 | Ga0070709_100629292 | 281 |
| 129 | 3300005435 | Ga0070714_100045087 | Ga0070714_1000450875 | 281 |
| 130 | 3300005435 | Ga0070714_100151122 | Ga0070714_1001511222 | 281 |
| 131 | 3300005435 | Ga0070714_100164539 | Ga0070714_1001645392 | 281 |
| 132 | 3300005436 | Ga0070713_100007389 | Ga0070713_1000073899 | 281 |
| 133 | 3300005436 | Ga0070713_100099207 | Ga0070713_1000992071 | 281 |
| 134 | 3300005436 | Ga0070713_100135912 | Ga0070713_1001359122 | 281 |
| 135 | 3300005436 | Ga0070713_100456005 | Ga0070713_1004560051 | 281 |
| 136 | 3300005437 | Ga0070710_10041960 | Ga0070710_100419603 | 281 |
| 137 | 3300005437 | Ga0070710_10070468 | Ga0070710_100704682 | 281 |
| 138 | 3300005437 | Ga0070710_10103898 | Ga0070710_101038982 | 281 |
| 139 | 3300005438 | Ga0070701_10087275 | Ga0070701_100872752 | 281 |
| 140 | 3300005438 | Ga0070701_10190757 | Ga0070701_101907571 | 281 |
| 141 | 3300005439 | Ga0070711_100158736 | Ga0070711_1001587362 | 281 |
| 142 | 3300005439 | Ga0070711_100165148 | Ga0070711_1001651482 | 281 |
| 143 | 3300005439 | Ga0070711_100300453 | Ga0070711_1003004532 | 281 |
| 144 | 3300005440 | Ga0070705_100000148 | Ga0070705_1000001481 | 281 |
| 145 | 3300005440 | Ga0070705_100066789 | Ga0070705_1000667892 | 281 |
| 146 | 3300005440 | Ga0070705_100286652 | Ga0070705_1002866521 | 281 |
| 147 | 3300005440 | Ga0070705_100349918 | Ga0070705_1003499181 | 281 |
| 148 | 3300005441 | Ga0070700_100000277 | Ga0070700_10000027731 | 281 |
| 149 | 3300005441 | Ga0070700_100031131 | Ga0070700_1000311312 | 281 |
| 150 | 3300005444 | Ga0070694_100001507 | Ga0070694_1000015077 | 281 |
| 151 | 3300005444 | Ga0070694_100016824 | Ga0070694_1000168245 | 281 |
| 152 | 3300005444 | Ga0070694_100021063 | Ga0070694_1000210634 | 281 |
| 153 | 3300005444 | Ga0070694_100073471 | Ga0070694_1000734713 | 281 |
| 154 | 3300005445 | Ga0070708_100027462 | Ga0070708_1000274625 | 281 |
| 155 | 3300005455 | Ga0070663_100000522 | Ga0070663_10000052214 | 281 |
| 156 | 3300005455 | Ga0070663_100017769 | Ga0070663_1000177696 | 281 |
| 157 | 3300005455 | Ga0070663_100028232 | Ga0070663_1000282324 | 281 |
| 158 | 3300005455 | Ga0070663_100494731 | Ga0070663_1004947311 | 281 |
| 159 | 3300005456 | Ga0070678_100000718 | Ga0070678_1000007185 | 281 |
| 160 | 3300005456 | Ga0070678_100011460 | Ga0070678_1000114605 | 281 |
| 161 | 3300005456 | Ga0070678_100042025 | Ga0070678_1000420253 | 281 |
| 162 | 3300005457 | Ga0070662_100001666 | Ga0070662_1000016667 | 281 |
| 163 | 3300005457 | Ga0070662_100015894 | Ga0070662_1000158943 | 281 |
| 164 | 3300005457 | Ga0070662_100060423 | Ga0070662_1000604233 | 281 |
| 165 | 3300005458 | Ga0070681_10014569 | Ga0070681_100145692 | 281 |
| 166 | 3300005458 | Ga0070681_10052540 | Ga0070681_100525404 | 281 |
| 167 | 3300005458 | Ga0070681_10306708 | Ga0070681_103067082 | 281 |
| 168 | 3300005458 | Ga0070681_10320548 | Ga0070681_103205482 | 281 |
| 169 | 3300005459 | Ga0068867_100006623 | Ga0068867_1000066232 | 281 |
| 170 | 3300005459 | Ga0068867_100012024 | Ga0068867_1000120244 | 281 |
| 171 | 3300005466 | Ga0070685_10002221 | Ga0070685_100022215 | 281 |
| 172 | 3300005466 | Ga0070685_10004005 | Ga0070685_100040057 | 281 |
| 173 | 3300005466 | Ga0070685_10024466 | Ga0070685_100244663 | 281 |
| 174 | 3300005467 | Ga0070706_100147399 | Ga0070706_1001473993 | 281 |
| 175 | 3300005518 | Ga0070699_100011505 | Ga0070699_1000115057 | 281 |
| 176 | 3300005518 | Ga0070699_100320219 | Ga0070699_1003202192 | 281 |
| 177 | 3300005530 | Ga0070679_100014561 | Ga0070679_1000145618 | 281 |
| 178 | 3300005530 | Ga0070679_100082633 | Ga0070679_1000826333 | 281 |
| 179 | 3300005530 | Ga0070679_100397378 | Ga0070679_1003973782 | 281 |
| 180 | 3300005535 | Ga0070684_100000894 | Ga0070684_10000089414 | 281 |
| 181 | 3300005535 | Ga0070684_100127730 | Ga0070684_1001277302 | 281 |
| 182 | 3300005535 | Ga0070684_100224857 | Ga0070684_1002248572 | 281 |
| 183 | 3300005535 | Ga0070684_100750412 | Ga0070684_1007504121 | 281 |
| 184 | 3300005536 | Ga0070697_100023189 | Ga0070697_1000231894 | 281 |
| 185 | 3300005536 | Ga0070697_100174431 | Ga0070697_1001744312 | 281 |
| 186 | 3300005539 | Ga0068853_100020627 | Ga0068853_1000206275 | 281 |
| 187 | 3300005539 | Ga0068853_100191830 | Ga0068853_1001918301 | 281 |
| 188 | 3300005539 | Ga0068853_100209643 | Ga0068853_1002096432 | 281 |
| 189 | 3300005543 | Ga0070672_100000088 | Ga0070672_10000008852 | 281 |
| 190 | 3300005543 | Ga0070672_100172591 | Ga0070672_1001725912 | 281 |
| 191 | 3300005544 | Ga0070686_100000719 | Ga0070686_10000071919 | 281 |
| 192 | 3300005544 | Ga0070686_100028453 | Ga0070686_1000284533 | 281 |
| 193 | 3300005544 | Ga0070686_100029585 | Ga0070686_1000295852 | 281 |
| 194 | 3300005544 | Ga0070686_100040116 | Ga0070686_1000401162 | 281 |
| 195 | 3300005546 | Ga0070696_100020775 | Ga0070696_1000207754 | 281 |
| 196 | 3300005546 | Ga0070696_100068057 | Ga0070696_1000680571 | 281 |
| 197 | 3300005546 | Ga0070696_100227825 | Ga0070696_1002278251 | 281 |
| 198 | 3300005547 | Ga0070693_100000134 | Ga0070693_1000001349 | 281 |
| 199 | 3300005547 | Ga0070693_100151858 | Ga0070693_1001518582 | 281 |
| 200 | 3300005548 | Ga0070665_100032403 | Ga0070665_1000324033 | 281 |
| 201 | 3300005548 | Ga0070665_100144488 | Ga0070665_1001444881 | 281 |
| 202 | 3300005548 | Ga0070665_100352336 | Ga0070665_1003523362 | 281 |
| 203 | 3300005549 | Ga0070704_100000428 | Ga0070704_1000004287 | 281 |
| 204 | 3300005549 | Ga0070704_100027693 | Ga0070704_1000276935 | 281 |
| 205 | 3300005563 | Ga0068855_100007545 | Ga0068855_1000075456 | 281 |
| 206 | 3300005563 | Ga0068855_100031321 | Ga0068855_1000313213 | 281 |
| 207 | 3300005563 | Ga0068855_100127457 | Ga0068855_1001274572 | 281 |
| 208 | 3300005563 | Ga0068855_100203384 | Ga0068855_1002033843 | 281 |
| 209 | 3300005563 | Ga0068855_100634939 | Ga0068855_1006349392 | 281 |
| 210 | 3300005564 | Ga0070664_100002234 | Ga0070664_10000223414 | 281 |
| 211 | 3300005564 | Ga0070664_100045631 | Ga0070664_1000456313 | 281 |
| 212 | 3300005564 | Ga0070664_100097454 | Ga0070664_1000974541 | 281 |
| 213 | 3300005564 | Ga0070664_100121692 | Ga0070664_1001216921 | 281 |
| 214 | 3300005577 | Ga0068857_100002935 | Ga0068857_10000293514 | 281 |
| 215 | 3300005577 | Ga0068857_100708826 | Ga0068857_1007088261 | 281 |
| 216 | 3300005578 | Ga0068854_100308029 | Ga0068854_1003080291 | 281 |
| 217 | 3300005614 | Ga0068856_100002000 | Ga0068856_10000200021 | 281 |
| 218 | 3300005614 | Ga0068856_100307550 | Ga0068856_1003075502 | 281 |
| 219 | 3300005615 | Ga0070702_100000638 | Ga0070702_1000006389 | 281 |
| 220 | 3300005615 | Ga0070702_100002467 | Ga0070702_1000024674 | 281 |
| 221 | 3300005615 | Ga0070702_100011329 | Ga0070702_1000113294 | 281 |
| 222 | 3300005615 | Ga0070702_100023246 | Ga0070702_1000232463 | 281 |
| 223 | 3300005616 | Ga0068852_100002115 | Ga0068852_1000021157 | 281 |
| 224 | 3300005616 | Ga0068852_100077859 | Ga0068852_1000778592 | 281 |
| 225 | 3300005617 | Ga0068859_100021325 | Ga0068859_1000213257 | 281 |
| 226 | 3300005617 | Ga0068859_100080532 | Ga0068859_1000805322 | 281 |
| 227 | 3300005617 | Ga0068859_100243543 | Ga0068859_1002435432 | 281 |
| 228 | 3300005618 | Ga0068864_100014592 | Ga0068864_1000145922 | 281 |
| 229 | 3300005718 | Ga0068866_10000301 | Ga0068866_1000030124 | 281 |
| 230 | 3300005718 | Ga0068866_10002757 | Ga0068866_100027573 | 281 |
| 231 | 3300005718 | Ga0068866_10124413 | Ga0068866_101244132 | 281 |
| 232 | 3300005719 | Ga0068861_100016840 | Ga0068861_1000168407 | 281 |
| 233 | 3300005719 | Ga0068861_100018418 | Ga0068861_1000184183 | 281 |
| 234 | 3300005834 | Ga0068851_10058471 | Ga0068851_100584712 | 281 |
| 235 | 3300005840 | Ga0068870_10000354 | Ga0068870_100003548 | 281 |
| 236 | 3300005840 | Ga0068870_10001545 | Ga0068870_100015453 | 281 |
| 237 | 3300005841 | Ga0068863_100000340 | Ga0068863_10000034019 | 281 |
| 238 | 3300005841 | Ga0068863_100018623 | Ga0068863_1000186235 | 281 |
| 239 | 3300005841 | Ga0068863_100272427 | Ga0068863_1002724272 | 281 |
| 240 | 3300005842 | Ga0068858_100000295 | Ga0068858_10000029562 | 281 |
| 241 | 3300005842 | Ga0068858_100011371 | Ga0068858_1000113713 | 281 |
| 242 | 3300005842 | Ga0068858_100025797 | Ga0068858_1000257972 | 281 |
| 243 | 3300005842 | Ga0068858_100128333 | Ga0068858_1001283332 | 281 |
| 244 | 3300005842 | Ga0068858_100160619 | Ga0068858_1001606192 | 281 |
| 245 | 3300005843 | Ga0068860_100001285 | Ga0068860_10000128530 | 281 |
| 246 | 3300005843 | Ga0068860_100084443 | Ga0068860_1000844433 | 281 |
| 247 | 3300005844 | Ga0068862_100003236 | Ga0068862_10000323614 | 281 |
| 248 | 3300005844 | Ga0068862_100012543 | Ga0068862_1000125432 | 281 |
| 249 | 3300005937 | Ga0081455_10000007 | Ga0081455_10000007214 | 281 |
| 250 | 3300005937 | Ga0081455_10001479 | Ga0081455_100014795 | 281 |
| 251 | 3300005937 | Ga0081455_10009018 | Ga0081455_100090182 | 281 |
| 252 | 3300005937 | Ga0081455_10017104 | Ga0081455_100171046 | 281 |
| 253 | 3300005937 | Ga0081455_10033388 | Ga0081455_100333884 | 281 |
| 254 | 3300005937 | Ga0081455_10143080 | Ga0081455_101430802 | 281 |
| 255 | 3300005981 | Ga0081538_10022998 | Ga0081538_100229986 | 281 |
| 256 | 3300006028 | Ga0070717_10007640 | Ga0070717_100076405 | 281 |
| 257 | 3300006038 | Ga0075365_10022333 | Ga0075365_100223335 | 281 |
| 258 | 3300006058 | Ga0075432_10000272 | Ga0075432_100002723 | 281 |
| 259 | 3300006058 | Ga0075432_10094683 | Ga0075432_100946831 | 281 |
| 260 | 3300006173 | Ga0070716_100148747 | Ga0070716_1001487471 | 281 |
| 261 | 3300006175 | Ga0070712_100028432 | Ga0070712_1000284324 | 281 |
| 262 | 3300006175 | Ga0070712_100061683 | Ga0070712_1000616833 | 281 |
| 263 | 3300006175 | Ga0070712_100204349 | Ga0070712_1002043492 | 281 |
| 264 | 3300006178 | Ga0075367_10049729 | Ga0075367_100497292 | 281 |
| 265 | 3300006195 | Ga0075366_10028947 | Ga0075366_100289472 | 281 |
| 266 | 3300006237 | Ga0097621_100000040 | Ga0097621_10000004067 | 281 |
| 267 | 3300006237 | Ga0097621_100022646 | Ga0097621_1000226463 | 281 |
| 268 | 3300006237 | Ga0097621_100053322 | Ga0097621_1000533222 | 281 |
| 269 | 3300006353 | Ga0075370_10040679 | Ga0075370_100406792 | 281 |
| 270 | 3300006358 | Ga0068871_100000301 | Ga0068871_10000030114 | 281 |
| 271 | 3300006844 | Ga0075428_100003180 | Ga0075428_10000318015 | 281 |
| 272 | 3300006844 | Ga0075428_100015358 | Ga0075428_1000153581 | 281 |
| 273 | 3300006844 | Ga0075428_100045005 | Ga0075428_1000450052 | 281 |
| 274 | 3300006844 | Ga0075428_100100352 | Ga0075428_1001003523 | 281 |
| 275 | 3300006844 | Ga0075428_100416948 | Ga0075428_1004169482 | 281 |
| 276 | 3300006846 | Ga0075430_100000201 | Ga0075430_10000020140 | 281 |
| 277 | 3300006847 | Ga0075431_100000260 | Ga0075431_10000026040 | 281 |
| 278 | 3300006847 | Ga0075431_100329512 | Ga0075431_1003295122 | 281 |
| 279 | 3300006847 | Ga0075431_100509470 | Ga0075431_1005094702 | 281 |
| 280 | 3300006852 | Ga0075433_10000007 | Ga0075433_1000000738 | 281 |
| 281 | 3300006852 | Ga0075433_10006753 | Ga0075433_100067537 | 281 |
| 282 | 3300006852 | Ga0075433_10009620 | Ga0075433_100096203 | 281 |
| 283 | 3300006852 | Ga0075433_10492088 | Ga0075433_104920881 | 281 |
| 284 | 3300006871 | Ga0075434_100000091 | Ga0075434_1000000916 | 281 |
| 285 | 3300006871 | Ga0075434_100019587 | Ga0075434_1000195876 | 281 |
| 286 | 3300006871 | Ga0075434_100067068 | Ga0075434_1000670685 | 281 |
| 287 | 3300006871 | Ga0075434_100094300 | Ga0075434_1000943002 | 281 |
| 288 | 3300006871 | Ga0075434_100183234 | Ga0075434_1001832342 | 281 |
| 289 | 3300006880 | Ga0075429_100001824 | Ga0075429_10000182415 | 281 |
| 290 | 3300006881 | Ga0068865_100000275 | Ga0068865_1000002759 | 281 |
| 291 | 3300006881 | Ga0068865_100024369 | Ga0068865_1000243695 | 281 |
| 292 | 3300006881 | Ga0068865_100050689 | Ga0068865_1000506892 | 281 |
| 293 | 3300006881 | Ga0068865_100100150 | Ga0068865_1001001501 | 281 |
| 294 | 3300006914 | Ga0075436_100039496 | Ga0075436_1000394963 | 281 |
| 295 | 3300006914 | Ga0075436_100107605 | Ga0075436_1001076051 | 281 |
| 296 | 3300006931 | Ga0097620_100021325 | Ga0097620_1000213257 | 281 |
| 297 | 3300006931 | Ga0097620_100080540 | Ga0097620_1000805402 | 281 |
| 298 | 3300006931 | Ga0097620_100243538 | Ga0097620_1002435382 | 281 |
| 299 | 3300007076 | Ga0075435_100017727 | Ga0075435_1000177272 | 281 |
| 300 | 3300007076 | Ga0075435_100040818 | Ga0075435_1000408185 | 281 |
| 301 | 3300007076 | Ga0075435_100286057 | Ga0075435_1002860572 | 281 |
| 302 | 3300007265 | Ga0099794_10046157 | Ga0099794_100461573 | 281 |
| 303 | 3300009011 | Ga0105251_10020085 | Ga0105251_100200853 | 281 |
| 304 | 3300009036 | Ga0105244_10133680 | Ga0105244_101336801 | 281 |
| 305 | 3300009092 | Ga0105250_10018576 | Ga0105250_100185762 | 281 |
| 306 | 3300009093 | Ga0105240_10646330 | Ga0105240_106463301 | 281 |
| 307 | 3300009093 | Ga0105240_10743379 | Ga0105240_107433791 | 281 |
| 308 | 3300009094 | Ga0111539_10000394 | Ga0111539_1000039457 | 281 |
| 309 | 3300009094 | Ga0111539_10001672 | Ga0111539_1000167220 | 281 |
| 310 | 3300009094 | Ga0111539_10017527 | Ga0111539_100175277 | 281 |
| 311 | 3300009094 | Ga0111539_10040786 | Ga0111539_100407862 | 281 |
| 312 | 3300009094 | Ga0111539_10109172 | Ga0111539_101091723 | 281 |
| 313 | 3300009094 | Ga0111539_10187414 | Ga0111539_101874142 | 281 |
| 314 | 3300009094 | Ga0111539_10409500 | Ga0111539_104095001 | 281 |
| 315 | 3300009094 | Ga0111539_10828611 | Ga0111539_108286111 | 281 |
| 316 | 3300009098 | Ga0105245_10000462 | Ga0105245_100004626 | 281 |
| 317 | 3300009098 | Ga0105245_10020090 | Ga0105245_100200904 | 281 |
| 318 | 3300009098 | Ga0105245_10350384 | Ga0105245_103503842 | 281 |
| 319 | 3300009101 | Ga0105247_10001920 | Ga0105247_100019207 | 281 |
| 320 | 3300009101 | Ga0105247_10022379 | Ga0105247_100223792 | 281 |
| 321 | 3300009101 | Ga0105247_10309243 | Ga0105247_103092432 | 281 |
| 322 | 3300009147 | Ga0114129_10001111 | Ga0114129_1000111142 | 281 |
| 323 | 3300009147 | Ga0114129_10003047 | Ga0114129_1000304717 | 281 |
| 324 | 3300009147 | Ga0114129_10007767 | Ga0114129_100077677 | 281 |
| 325 | 3300009147 | Ga0114129_10069532 | Ga0114129_100695322 | 281 |
| 326 | 3300009147 | Ga0114129_10991037 | Ga0114129_109910371 | 281 |
| 327 | 3300009148 | Ga0105243_10000282 | Ga0105243_1000028261 | 281 |
| 328 | 3300009148 | Ga0105243_10030614 | Ga0105243_100306142 | 281 |
| 329 | 3300009148 | Ga0105243_10033566 | Ga0105243_100335662 | 281 |
| 330 | 3300009148 | Ga0105243_10123865 | Ga0105243_101238652 | 281 |
| 331 | 3300009174 | Ga0105241_10000652 | Ga0105241_100006525 | 281 |
| 332 | 3300009176 | Ga0105242_10011119 | Ga0105242_100111195 | 281 |
| 333 | 3300009176 | Ga0105242_10298969 | Ga0105242_102989692 | 281 |
| 334 | 3300009177 | Ga0105248_10011410 | Ga0105248_100114103 | 281 |
| 335 | 3300009177 | Ga0105248_10027731 | Ga0105248_100277312 | 281 |
| 336 | 3300009177 | Ga0105248_10093852 | Ga0105248_100938523 | 281 |
| 337 | 3300009177 | Ga0105248_10262268 | Ga0105248_102622682 | 281 |
| 338 | 3300009545 | Ga0105237_10043527 | Ga0105237_100435273 | 281 |
| 339 | 3300009545 | Ga0105237_10237597 | Ga0105237_102375971 | 281 |
| 340 | 3300009551 | Ga0105238_10713221 | Ga0105238_107132211 | 281 |
| 341 | 3300009553 | Ga0105249_10001210 | Ga0105249_1000121024 | 281 |
| 342 | 3300009553 | Ga0105249_10071575 | Ga0105249_100715752 | 281 |
| 343 | 3300009553 | Ga0105249_10153953 | Ga0105249_101539531 | 281 |
| 344 | 3300009553 | Ga0105249_10173060 | Ga0105249_101730602 | 281 |
| 345 | 3300009553 | Ga0105249_10332376 | Ga0105249_103323762 | 281 |
| 346 | 3300010375 | Ga0105239_10028214 | Ga0105239_100282147 | 281 |
| 347 | 3300010375 | Ga0105239_10067368 | Ga0105239_100673683 | 281 |
| 348 | 3300010375 | Ga0105239_10154111 | Ga0105239_101541113 | 281 |
| 349 | 3300010375 | Ga0105239_10486636 | Ga0105239_104866361 | 281 |
| 350 | 3300011119 | Ga0105246_10009002 | Ga0105246_100090021 | 281 |
| 351 | 3300011119 | Ga0105246_10026829 | Ga0105246_100268292 | 281 |
| 352 | 3300011119 | Ga0105246_10122864 | Ga0105246_101228642 | 281 |
| 353 | 3300012480 | Ga0157346_1000445 | Ga0157346_10004451 | 281 |
| 354 | 3300013100 | Ga0157373_10010359 | Ga0157373_100103595 | 281 |
| 355 | 3300013102 | Ga0157371_10019421 | Ga0157371_100194212 | 281 |
| 356 | 3300013104 | Ga0157370_10164555 | Ga0157370_101645553 | 281 |
| 357 | 3300013296 | Ga0157374_10006038 | Ga0157374_100060389 | 281 |
| 358 | 3300013296 | Ga0157374_10120686 | Ga0157374_101206861 | 281 |
| 359 | 3300013296 | Ga0157374_10148398 | Ga0157374_101483981 | 281 |
| 360 | 3300013296 | Ga0157374_10195927 | Ga0157374_101959273 | 281 |
| 361 | 3300013297 | Ga0157378_10000270 | Ga0157378_100002702 | 281 |
| 362 | 3300013297 | Ga0157378_10494906 | Ga0157378_104949062 | 281 |
| 363 | 3300013306 | Ga0163162_10000145 | Ga0163162_100001454 | 281 |
| 364 | 3300013306 | Ga0163162_10143726 | Ga0163162_101437262 | 281 |
| 365 | 3300013307 | Ga0157372_10012191 | Ga0157372_100121917 | 281 |
| 366 | 3300013307 | Ga0157372_10254765 | Ga0157372_102547652 | 281 |
| 367 | 3300013308 | Ga0157375_10000332 | Ga0157375_100003321 | 281 |
| 368 | 3300013308 | Ga0157375_10009000 | Ga0157375_100090006 | 281 |
| 369 | 3300013308 | Ga0157375_10049349 | Ga0157375_100493495 | 281 |
| 370 | 3300013308 | Ga0157375_10748389 | Ga0157375_107483891 | 281 |
| 371 | 3300014325 | Ga0163163_10000865 | Ga0163163_100008655 | 281 |
| 372 | 3300014325 | Ga0163163_10005560 | Ga0163163_100055606 | 281 |
| 373 | 3300014325 | Ga0163163_10069639 | Ga0163163_100696393 | 281 |
| 374 | 3300014325 | Ga0163163_10768790 | Ga0163163_107687901 | 281 |
| 375 | 3300014326 | Ga0157380_10000891 | Ga0157380_100008917 | 281 |
| 376 | 3300014326 | Ga0157380_10059658 | Ga0157380_100596582 | 281 |
| 377 | 3300014326 | Ga0157380_10473230 | Ga0157380_104732301 | 281 |
| 378 | 3300014745 | Ga0157377_10000137 | Ga0157377_100001375 | 281 |
| 379 | 3300014745 | Ga0157377_10039626 | Ga0157377_100396262 | 281 |
| 380 | 3300014745 | Ga0157377_10128440 | Ga0157377_101284402 | 281 |
| 381 | 3300014968 | Ga0157379_10001761 | Ga0157379_1000176119 | 281 |
| 382 | 3300014968 | Ga0157379_10012181 | Ga0157379_100121815 | 281 |
| 383 | 3300014968 | Ga0157379_10032861 | Ga0157379_100328612 | 281 |
| 384 | 3300014968 | Ga0157379_10071950 | Ga0157379_100719503 | 281 |
| 385 | 3300014969 | Ga0157376_10000088 | Ga0157376_1000008861 | 281 |
| 386 | 3300014969 | Ga0157376_10083873 | Ga0157376_100838734 | 281 |
| 387 | 3300014969 | Ga0157376_10270273 | Ga0157376_102702732 | 281 |
| 388 | 3300014969 | Ga0157376_10422725 | Ga0157376_104227252 | 281 |
| 389 | 3300017792 | Ga0163161_10000144 | Ga0163161_1000014410 | 281 |
| 390 | 3300017792 | Ga0163161_10049602 | Ga0163161_100496022 | 281 |
| 391 | 3300021384 | Ga0213876_10026729 | Ga0213876_100267293 | 281 |
| 392 | 3300024227 | Ga0228598_1007345 | Ga0228598_10073452 | 281 |
| 393 | 3300025271 | Ga0207666_1000048 | Ga0207666_100004826 | 281 |
| 394 | 3300025271 | Ga0207666_1000627 | Ga0207666_10006272 | 281 |
| 395 | 3300025315 | Ga0207697_10003423 | Ga0207697_100034232 | 281 |
| 396 | 3300025315 | Ga0207697_10014016 | Ga0207697_100140164 | 281 |
| 397 | 3300025735 | Ga0207713_1061801 | Ga0207713_10618012 | 281 |
| 398 | 3300025885 | Ga0207653_10015888 | Ga0207653_100158883 | 281 |
| 399 | 3300025885 | Ga0207653_10034319 | Ga0207653_100343191 | 281 |
| 400 | 3300025893 | Ga0207682_10000509 | Ga0207682_1000050912 | 281 |
| 401 | 3300025898 | Ga0207692_10007140 | Ga0207692_100071403 | 281 |
| 402 | 3300025898 | Ga0207692_10052953 | Ga0207692_100529532 | 281 |
| 403 | 3300025899 | Ga0207642_10000762 | Ga0207642_100007627 | 281 |
| 404 | 3300025899 | Ga0207642_10006361 | Ga0207642_100063613 | 281 |
| 405 | 3300025900 | Ga0207710_10003986 | Ga0207710_100039863 | 281 |
| 406 | 3300025901 | Ga0207688_10000033 | Ga0207688_1000003316 | 281 |
| 407 | 3300025901 | Ga0207688_10004167 | Ga0207688_100041677 | 281 |
| 408 | 3300025903 | Ga0207680_10030693 | Ga0207680_100306934 | 281 |
| 409 | 3300025903 | Ga0207680_10035788 | Ga0207680_100357881 | 281 |
| 410 | 3300025903 | Ga0207680_10262312 | Ga0207680_102623121 | 281 |
| 411 | 3300025904 | Ga0207647_10020884 | Ga0207647_100208842 | 281 |
| 412 | 3300025906 | Ga0207699_10008794 | Ga0207699_100087942 | 281 |
| 413 | 3300025906 | Ga0207699_10186194 | Ga0207699_101861942 | 281 |
| 414 | 3300025907 | Ga0207645_10000100 | Ga0207645_1000010061 | 281 |
| 415 | 3300025907 | Ga0207645_10087683 | Ga0207645_100876832 | 281 |
| 416 | 3300025908 | Ga0207643_10000007 | Ga0207643_10000007172 | 281 |
| 417 | 3300025908 | Ga0207643_10000671 | Ga0207643_1000067113 | 281 |
| 418 | 3300025909 | Ga0207705_10061675 | Ga0207705_100616754 | 281 |
| 419 | 3300025910 | Ga0207684_10023683 | Ga0207684_100236836 | 281 |
| 420 | 3300025911 | Ga0207654_10000314 | Ga0207654_100003148 | 281 |
| 421 | 3300025911 | Ga0207654_10152486 | Ga0207654_101524862 | 281 |
| 422 | 3300025912 | Ga0207707_10037222 | Ga0207707_100372222 | 281 |
| 423 | 3300025912 | Ga0207707_10079630 | Ga0207707_100796304 | 281 |
| 424 | 3300025912 | Ga0207707_10121335 | Ga0207707_101213354 | 281 |
| 425 | 3300025912 | Ga0207707_10216102 | Ga0207707_102161022 | 281 |
| 426 | 3300025912 | Ga0207707_10323939 | Ga0207707_103239391 | 281 |
| 427 | 3300025913 | Ga0207695_10146209 | Ga0207695_101462093 | 281 |
| 428 | 3300025914 | Ga0207671_10025600 | Ga0207671_100256003 | 281 |
| 429 | 3300025914 | Ga0207671_10095297 | Ga0207671_100952972 | 281 |
| 430 | 3300025915 | Ga0207693_10007799 | Ga0207693_100077996 | 281 |
| 431 | 3300025915 | Ga0207693_10026013 | Ga0207693_100260133 | 281 |
| 432 | 3300025915 | Ga0207693_10037280 | Ga0207693_100372802 | 281 |
| 433 | 3300025915 | Ga0207693_10042697 | Ga0207693_100426973 | 281 |
| 434 | 3300025916 | Ga0207663_10033165 | Ga0207663_100331652 | 281 |
| 435 | 3300025916 | Ga0207663_10148936 | Ga0207663_101489362 | 281 |
| 436 | 3300025917 | Ga0207660_10000041 | Ga0207660_1000004111 | 281 |
| 437 | 3300025917 | Ga0207660_10015546 | Ga0207660_100155465 | 281 |
| 438 | 3300025917 | Ga0207660_10032163 | Ga0207660_100321632 | 281 |
| 439 | 3300025917 | Ga0207660_10130351 | Ga0207660_101303512 | 281 |
| 440 | 3300025917 | Ga0207660_10165018 | Ga0207660_101650182 | 281 |
| 441 | 3300025917 | Ga0207660_10443574 | Ga0207660_104435741 | 281 |
| 442 | 3300025918 | Ga0207662_10000282 | Ga0207662_1000028226 | 281 |
| 443 | 3300025918 | Ga0207662_10004598 | Ga0207662_100045983 | 281 |
| 444 | 3300025918 | Ga0207662_10018861 | Ga0207662_100188616 | 281 |
| 445 | 3300025918 | Ga0207662_10053389 | Ga0207662_100533892 | 281 |
| 446 | 3300025919 | Ga0207657_10009921 | Ga0207657_100099215 | 281 |
| 447 | 3300025919 | Ga0207657_10013952 | Ga0207657_100139522 | 281 |
| 448 | 3300025919 | Ga0207657_10022759 | Ga0207657_100227592 | 281 |
| 449 | 3300025919 | Ga0207657_10030177 | Ga0207657_100301774 | 281 |
| 450 | 3300025919 | Ga0207657_10046445 | Ga0207657_100464452 | 281 |
| 451 | 3300025919 | Ga0207657_10076831 | Ga0207657_100768313 | 281 |
| 452 | 3300025920 | Ga0207649_10001482 | Ga0207649_1000148210 | 281 |
| 453 | 3300025920 | Ga0207649_10077097 | Ga0207649_100770972 | 281 |
| 454 | 3300025920 | Ga0207649_10097948 | Ga0207649_100979482 | 281 |
| 455 | 3300025920 | Ga0207649_10501719 | Ga0207649_105017191 | 281 |
| 456 | 3300025921 | Ga0207652_10002995 | Ga0207652_1000299510 | 281 |
| 457 | 3300025921 | Ga0207652_10049186 | Ga0207652_100491861 | 281 |
| 458 | 3300025921 | Ga0207652_10077001 | Ga0207652_100770011 | 281 |
| 459 | 3300025921 | Ga0207652_10229057 | Ga0207652_102290572 | 281 |
| 460 | 3300025921 | Ga0207652_10229888 | Ga0207652_102298882 | 281 |
| 461 | 3300025921 | Ga0207652_10426192 | Ga0207652_104261921 | 281 |
| 462 | 3300025921 | Ga0207652_10428879 | Ga0207652_104288792 | 281 |
| 463 | 3300025923 | Ga0207681_10001546 | Ga0207681_100015467 | 281 |
| 464 | 3300025923 | Ga0207681_10412728 | Ga0207681_104127282 | 281 |
| 465 | 3300025924 | Ga0207694_10273369 | Ga0207694_102733692 | 281 |
| 466 | 3300025924 | Ga0207694_10344105 | Ga0207694_103441052 | 281 |
| 467 | 3300025925 | Ga0207650_10001317 | Ga0207650_1000131713 | 281 |
| 468 | 3300025925 | Ga0207650_10015921 | Ga0207650_100159213 | 281 |
| 469 | 3300025926 | Ga0207659_10005767 | Ga0207659_100057673 | 281 |
| 470 | 3300025926 | Ga0207659_10019879 | Ga0207659_100198793 | 281 |
| 471 | 3300025926 | Ga0207659_10045708 | Ga0207659_100457083 | 281 |
| 472 | 3300025927 | Ga0207687_10000072 | Ga0207687_1000007263 | 281 |
| 473 | 3300025927 | Ga0207687_10029549 | Ga0207687_100295493 | 281 |
| 474 | 3300025927 | Ga0207687_10105562 | Ga0207687_101055622 | 281 |
| 475 | 3300025927 | Ga0207687_10447810 | Ga0207687_104478101 | 281 |
| 476 | 3300025928 | Ga0207700_10001532 | Ga0207700_1000153210 | 281 |
| 477 | 3300025928 | Ga0207700_10014414 | Ga0207700_100144142 | 281 |
| 478 | 3300025928 | Ga0207700_10062990 | Ga0207700_100629902 | 281 |
| 479 | 3300025929 | Ga0207664_10016973 | Ga0207664_100169734 | 281 |
| 480 | 3300025929 | Ga0207664_10139891 | Ga0207664_101398912 | 281 |
| 481 | 3300025929 | Ga0207664_10326158 | Ga0207664_103261581 | 281 |
| 482 | 3300025931 | Ga0207644_10001292 | Ga0207644_100012927 | 281 |
| 483 | 3300025931 | Ga0207644_10221613 | Ga0207644_102216132 | 281 |
| 484 | 3300025932 | Ga0207690_10000140 | Ga0207690_1000014066 | 281 |
| 485 | 3300025932 | Ga0207690_10070065 | Ga0207690_100700652 | 281 |
| 486 | 3300025932 | Ga0207690_10383322 | Ga0207690_103833221 | 281 |
| 487 | 3300025933 | Ga0207706_10002144 | Ga0207706_1000214412 | 281 |
| 488 | 3300025933 | Ga0207706_10012048 | Ga0207706_100120482 | 281 |
| 489 | 3300025933 | Ga0207706_10042505 | Ga0207706_100425055 | 281 |
| 490 | 3300025933 | Ga0207706_10109084 | Ga0207706_101090842 | 281 |
| 491 | 3300025934 | Ga0207686_10001034 | Ga0207686_100010344 | 281 |
| 492 | 3300025934 | Ga0207686_10120810 | Ga0207686_101208102 | 281 |
| 493 | 3300025935 | Ga0207709_10001423 | Ga0207709_100014237 | 281 |
| 494 | 3300025935 | Ga0207709_10015190 | Ga0207709_100151903 | 281 |
| 495 | 3300025936 | Ga0207670_10005263 | Ga0207670_100052634 | 281 |
| 496 | 3300025936 | Ga0207670_10015623 | Ga0207670_100156233 | 281 |
| 497 | 3300025936 | Ga0207670_10066092 | Ga0207670_100660922 | 281 |
| 498 | 3300025937 | Ga0207669_10000176 | Ga0207669_1000017621 | 281 |
| 499 | 3300025938 | Ga0207704_10000086 | Ga0207704_100000862 | 281 |
| 500 | 3300025938 | Ga0207704_10009100 | Ga0207704_100091006 | 281 |
| 501 | 3300025939 | Ga0207665_10000872 | Ga0207665_100008727 | 281 |
| 502 | 3300025939 | Ga0207665_10135014 | Ga0207665_101350142 | 281 |
| 503 | 3300025939 | Ga0207665_10159348 | Ga0207665_101593482 | 281 |
| 504 | 3300025939 | Ga0207665_10207106 | Ga0207665_102071062 | 281 |
| 505 | 3300025940 | Ga0207691_10000214 | Ga0207691_1000021461 | 281 |
| 506 | 3300025940 | Ga0207691_10003307 | Ga0207691_1000330712 | 281 |
| 507 | 3300025941 | Ga0207711_10001106 | Ga0207711_100011067 | 281 |
| 508 | 3300025941 | Ga0207711_10006359 | Ga0207711_100063593 | 281 |
| 509 | 3300025941 | Ga0207711_10036936 | Ga0207711_100369363 | 281 |
| 510 | 3300025942 | Ga0207689_10000366 | Ga0207689_1000036625 | 281 |
| 511 | 3300025942 | Ga0207689_10114162 | Ga0207689_101141623 | 281 |
| 512 | 3300025942 | Ga0207689_10505602 | Ga0207689_105056021 | 281 |
| 513 | 3300025944 | Ga0207661_10000087 | Ga0207661_1000008710 | 281 |
| 514 | 3300025944 | Ga0207661_10470341 | Ga0207661_104703411 | 281 |
| 515 | 3300025945 | Ga0207679_10000029 | Ga0207679_1000002925 | 281 |
| 516 | 3300025945 | Ga0207679_10061554 | Ga0207679_100615541 | 281 |
| 517 | 3300025945 | Ga0207679_10090278 | Ga0207679_100902783 | 281 |
| 518 | 3300025949 | Ga0207667_10009257 | Ga0207667_100092579 | 281 |
| 519 | 3300025949 | Ga0207667_10255367 | Ga0207667_102553672 | 281 |
| 520 | 3300025949 | Ga0207667_10345730 | Ga0207667_103457302 | 281 |
| 521 | 3300025960 | Ga0207651_10000264 | Ga0207651_1000026424 | 281 |
| 522 | 3300025960 | Ga0207651_10355951 | Ga0207651_103559511 | 281 |
| 523 | 3300025960 | Ga0207651_10411686 | Ga0207651_104116862 | 281 |
| 524 | 3300025961 | Ga0207712_10001547 | Ga0207712_100015477 | 281 |
| 525 | 3300025961 | Ga0207712_10013434 | Ga0207712_100134342 | 281 |
| 526 | 3300025961 | Ga0207712_10584713 | Ga0207712_105847131 | 281 |
| 527 | 3300025972 | Ga0207668_10005954 | Ga0207668_100059547 | 281 |
| 528 | 3300025981 | Ga0207640_10001474 | Ga0207640_1000147410 | 281 |
| 529 | 3300025981 | Ga0207640_10046782 | Ga0207640_100467823 | 281 |
| 530 | 3300025986 | Ga0207658_10034469 | Ga0207658_100344692 | 281 |
| 531 | 3300025986 | Ga0207658_10274950 | Ga0207658_102749501 | 281 |
| 532 | 3300025986 | Ga0207658_10754531 | Ga0207658_107545311 | 281 |
| 533 | 3300026023 | Ga0207677_10001187 | Ga0207677_100011878 | 281 |
| 534 | 3300026023 | Ga0207677_10403070 | Ga0207677_104030702 | 281 |
| 535 | 3300026035 | Ga0207703_10003109 | Ga0207703_100031099 | 281 |
| 536 | 3300026035 | Ga0207703_10030388 | Ga0207703_100303883 | 281 |
| 537 | 3300026035 | Ga0207703_10262331 | Ga0207703_102623312 | 281 |
| 538 | 3300026041 | Ga0207639_10012878 | Ga0207639_100128786 | 281 |
| 539 | 3300026041 | Ga0207639_10096051 | Ga0207639_100960512 | 281 |
| 540 | 3300026041 | Ga0207639_10204912 | Ga0207639_102049122 | 281 |
| 541 | 3300026067 | Ga0207678_10011175 | Ga0207678_100111752 | 281 |
| 542 | 3300026067 | Ga0207678_10012004 | Ga0207678_100120048 | 281 |
| 543 | 3300026067 | Ga0207678_10038765 | Ga0207678_100387652 | 281 |
| 544 | 3300026067 | Ga0207678_10051057 | Ga0207678_100510572 | 281 |
| 545 | 3300026075 | Ga0207708_10000124 | Ga0207708_1000012435 | 281 |
| 546 | 3300026075 | Ga0207708_10007956 | Ga0207708_100079567 | 281 |
| 547 | 3300026075 | Ga0207708_10025817 | Ga0207708_100258172 | 281 |
| 548 | 3300026088 | Ga0207641_10000476 | Ga0207641_100004762 | 281 |
| 549 | 3300026088 | Ga0207641_10183043 | Ga0207641_101830431 | 281 |
| 550 | 3300026089 | Ga0207648_10000072 | Ga0207648_100000722 | 281 |
| 551 | 3300026095 | Ga0207676_10000512 | Ga0207676_1000051237 | 281 |
| 552 | 3300026116 | Ga0207674_10000697 | Ga0207674_1000069741 | 281 |
| 553 | 3300026116 | Ga0207674_10228157 | Ga0207674_102281572 | 281 |
| 554 | 3300026116 | Ga0207674_10570773 | Ga0207674_105707731 | 281 |
| 555 | 3300026118 | Ga0207675_100005225 | Ga0207675_10000522510 | 281 |
| 556 | 3300026118 | Ga0207675_100030237 | Ga0207675_1000302372 | 281 |
| 557 | 3300026118 | Ga0207675_100171642 | Ga0207675_1001716422 | 281 |
| 558 | 3300026121 | Ga0207683_10000029 | Ga0207683_1000002912 | 281 |
| 559 | 3300026121 | Ga0207683_10010209 | Ga0207683_100102098 | 281 |
| 560 | 3300026121 | Ga0207683_10049139 | Ga0207683_100491393 | 281 |
| 561 | 3300026121 | Ga0207683_10058105 | Ga0207683_100581053 | 281 |
| 562 | 3300026142 | Ga0207698_10000523 | Ga0207698_100005235 | 281 |
| 563 | 3300026142 | Ga0207698_10006814 | Ga0207698_100068148 | 281 |
| 564 | 3300026142 | Ga0207698_10105850 | Ga0207698_101058502 | 281 |
| 565 | 3300027252 | Ga0209973_1002360 | Ga0209973_10023601 | 281 |
| 566 | 3300027617 | Ga0210002_1000355 | Ga0210002_10003553 | 281 |
| 567 | 3300027695 | Ga0209966_1012566 | Ga0209966_10125661 | 281 |
| 568 | 3300027717 | Ga0209998_10002116 | Ga0209998_100021162 | 281 |
| 569 | 3300027876 | Ga0209974_10002631 | Ga0209974_100026312 | 281 |
| 570 | 3300027876 | Ga0209974_10037946 | Ga0209974_100379462 | 281 |
| 571 | 3300027907 | Ga0207428_10000100 | Ga0207428_10000100124 | 281 |
| 572 | 3300027907 | Ga0207428_10000115 | Ga0207428_1000011544 | 281 |
| 573 | 3300027907 | Ga0207428_10000228 | Ga0207428_1000022824 | 281 |
| 574 | 3300027907 | Ga0207428_10237846 | Ga0207428_102378462 | 281 |
| 575 | 3300028379 | Ga0268266_10127554 | Ga0268266_101275542 | 281 |
| 576 | 3300028380 | Ga0268265_10001240 | Ga0268265_1000124019 | 281 |
| 577 | 3300028380 | Ga0268265_10011857 | Ga0268265_100118572 | 281 |
| 578 | 3300028381 | Ga0268264_10002968 | Ga0268264_100029687 | 281 |
| 579 | 3300028381 | Ga0268264_10098649 | Ga0268264_100986492 | 281 |
| 580 | 3300031241 | Ga0265325_10000533 | Ga0265325_100005339 | 281 |
| 581 | 3300031247 | Ga0265340_10008415 | Ga0265340_100084156 | 281 |
| 582 | 3300031595 | Ga0265313_10010623 | Ga0265313_100106233 | 281 |
| 583 | 3300031712 | Ga0265342_10000896 | Ga0265342_1000089628 | 281 |
| 584 | 3300031712 | Ga0265342_10127184 | Ga0265342_101271841 | 281 |
| 585 | 3300034816 | Ga0373930_0000262 | Ga0373930_0000262_5026_5871 | 281 |
| 586 | 3300034816 | Ga0373930_0016837 | Ga0373930_0016837_104_949 | 281 |
| 587 | 3300034817 | Ga0373948_0003895 | Ga0373948_0003895_83_928 | 281 |
| 588 | 3300034817 | Ga0373948_0010128 | Ga0373948_0010128_245_1090 | 281 |
| 589 | 3300034817 | Ga0373948_0024216 | Ga0373948_0024216_274_1125 | 281 |
| 590 | 3300034818 | Ga0373950_0005031 | Ga0373950_0005031_561_1406 | 281 |
| 591 | 3300034819 | Ga0373958_0001890 | Ga0373958_0001890_269_1120 | 281 |
| 592 | 3300034819 | Ga0373958_0006596 | Ga0373958_0006596_760_1605 | 281 |
| 593 | 3300034820 | Ga0373959_0003651 | Ga0373959_0003651_499_1344 | 281 |
| 594 | 3300034820 | Ga0373959_0019894 | Ga0373959_0019894_181_1032 | 281 |
| 595 | 3300034957 | Ga0373938_0000290 | Ga0373938_0000290_2918_3763 | 281 |
| 596 | 3300034957 | Ga0373938_0000662 | Ga0373938_0000662_163_1008 | 281 |
| 597 | 3300035083 | Ga0373926_0090927 | Ga0373926_0090927_278_1123 | 281 |
| 598 | 3300035084 | Ga0373928_0000789 | Ga0373928_0000789_3798_4643 | 281 |
| 599 | 3300035084 | Ga0373928_0006995 | Ga0373928_0006995_1257_2108 | 281 |
| 600 | 3300035084 | Ga0373928_0009522 | Ga0373928_0009522_591_1436 | 281 |
| 601 | 3300035085 | Ga0373929_0002403 | Ga0373929_0002403_1873_2724 | 281 |
| 602 | 3300035085 | Ga0373929_0006971 | Ga0373929_0006971_48_893 | 281 |
| 603 | 3300035086 | Ga0373934_0046329 | Ga0373934_0046329_483_1487 | 281 |
| 604 | 3300035088 | Ga0373940_0050600 | Ga0373940_0050600_245_1090 | 281 |
| 605 | 3300035088 | Ga0373940_0071890 | Ga0373940_0071890_11_856 | 281 |
| 606 | 3300035090 | Ga0373949_0000938 | Ga0373949_0000938_5026_5871 | 281 |
| 607 | 3300035090 | Ga0373949_0001649 | Ga0373949_0001649_2916_3761 | 281 |
| 608 | 3300035091 | Ga0373951_0000715 | Ga0373951_0000715_5245_6090 | 281 |
| 609 | 3300035091 | Ga0373951_0005147 | Ga0373951_0005147_1438_2283 | 281 |
| 610 | 3300035091 | Ga0373951_0035857 | Ga0373951_0035857_101_946 | 281 |
| 611 | 3300035092 | Ga0373952_0000298 | Ga0373952_0000298_4243_5088 | 281 |
| 612 | 3300035092 | Ga0373952_0002466 | Ga0373952_0002466_264_1109 | 281 |
| 613 | 3300035111 | Ga0373923_0054370 | Ga0373923_0054370_628_1491 | 281 |
| 614 | 3300035112 | Ga0373932_0000172 | Ga0373932_0000172_1730_2575 | 281 |
| 615 | 3300035112 | Ga0373932_0008064 | Ga0373932_0008064_1466_2317 | 281 |
| 616 | 3300035113 | Ga0373936_0004177 | Ga0373936_0004177_3038_3883 | 281 |
| 617 | 3300035113 | Ga0373936_0059349 | Ga0373936_0059349_561_1424 | 281 |
| 618 | 3300035113 | Ga0373936_0096497 | Ga0373936_0096497_339_1184 | 281 |
| 619 | 3300035114 | Ga0373939_0000500 | Ga0373939_0000500_1182_2027 | 281 |
| 620 | 3300035114 | Ga0373939_0007393 | Ga0373939_0007393_1505_2350 | 281 |
| 621 | 3300035115 | Ga0373941_0001751 | Ga0373941_0001751_3804_4649 | 281 |
| 622 | 3300035115 | Ga0373941_0013482 | Ga0373941_0013482_1135_1986 | 281 |
| 623 | 3300035116 | Ga0373945_0002996 | Ga0373945_0002996_1409_2254 | 281 |
| 624 | 3300035116 | Ga0373945_0010893 | Ga0373945_0010893_163_1008 | 281 |
| 625 | 3300035116 | Ga0373945_0076277 | Ga0373945_0076277_280_1143 | 281 |
| 626 | 3300035117 | Ga0373953_0001475 | Ga0373953_0001475_5362_6207 | 281 |
| 627 | 3300035118 | Ga0373954_0050033 | Ga0373954_0050033_593_1438 | 281 |
| 628 | 3300035119 | Ga0373956_0142721 | Ga0373956_0142721_245_1090 | 281 |
| 629 | 3300035119 | Ga0373956_0181184 | Ga0373956_0181184_77_922 | 281 |
| 630 | 3300035120 | Ga0373957_0028243 | Ga0373957_0028243_362_1366 | 281 |
| 631 | 3300035121 | Ga0373960_0001140 | Ga0373960_0001140_3737_4582 | 281 |
| 632 | 3300035121 | Ga0373960_0001458 | Ga0373960_0001458_2321_3166 | 281 |
| 633 | 3300035170 | Ga0373943_0015808 | Ga0373943_0015808_1848_2699 | 281 |
| 634 | 3300035170 | Ga0373943_0017540 | Ga0373943_0017540_1251_2096 | 281 |
| 635 | 3300035171 | Ga0373946_0021621 | Ga0373946_0021621_1144_2007 | 281 |
| 636 | 3300035172 | Ga0373955_0011599 | Ga0373955_0011599_2881_3885 | 281 |
| 637 | 3300035172 | Ga0373955_0023581 | Ga0373955_0023581_1357_2202 | 281 |
| 638 | 3300035172 | Ga0373955_0027187 | Ga0373955_0027187_1806_2651 | 281 |
| 639 | 3300035172 | Ga0373955_0107444 | Ga0373955_0107444_673_1518 | 281 |
| 640 | 3300035172 | Ga0373955_0129822 | Ga0373955_0129822_395_1240 | 281 |
| 641 | 3300035207 | Ga0373942_0001552 | Ga0373942_0001552_5006_5851 | 281 |
| 642 | 3300035241 | Ga0373961_0000196 | Ga0373961_0000196_11409_12254 | 281 |
| 643 | 3300035241 | Ga0373961_0001345 | Ga0373961_0001345_4443_5288 | 281 |
| 644 | 3300035241 | Ga0373961_0003263 | Ga0373961_0003263_1287_2138 | 281 |
| 645 | 3300035242 | Ga0373962_0000310 | Ga0373962_0000310_4544_5389 | 281 |
| 646 | 3300035242 | Ga0373962_0001593 | Ga0373962_0001593_1603_2448 | 281 |
| 647 | 3300035242 | Ga0373962_0071476 | Ga0373962_0071476_28_873 | 281 |
| 648 | 3300035410 | Ga0373924_0027636 | Ga0373924_0027636_24_869 | 281 |
| 649 | 3300035410 | Ga0373924_0071717 | Ga0373924_0071717_395_1240 | 281 |
| 650 | 3300035691 | Ga0373931_0004010 | Ga0373931_0004010_1507_2352 | 281 |
| 651 | 3300035691 | Ga0373931_0008212 | Ga0373931_0008212_3553_4398 | 281 |
| 652 | 3300035691 | Ga0373931_0031253 | Ga0373931_0031253_225_1076 | 281 |
| 653 | 3300035691 | Ga0373931_0032881 | Ga0373931_0032881_1810_2667 | 281 |
| 654 | 3300035691 | Ga0373931_0088107 | Ga0373931_0088107_832_1677 | 281 |
| 655 | 3300035691 | Ga0373931_0164382 | Ga0373931_0164382_154_999 | 281 |
| 656 | 3300035692 | Ga0373935_0012655 | Ga0373935_0012655_1012_1863 | 281 |
| 657 | 3300035692 | Ga0373935_0020024 | Ga0373935_0020024_2958_3803 | 281 |
| 658 | 3300035695 | Ga0373927_0042280 | Ga0373927_0042280_674_1519 | 281 |
| 659 | 3300035695 | Ga0373927_0095358 | Ga0373927_0095358_971_1816 | 281 |
| 660 | 3300035724 | Ga0373933_0001949 | Ga0373933_0001949_10600_11445 | 281 |
| 661 | 3300035724 | Ga0373933_0006597 | Ga0373933_0006597_3957_4961 | 281 |
| 662 | 3300035724 | Ga0373933_0008978 | Ga0373933_0008978_4114_4959 | 281 |
| 663 | 3300035724 | Ga0373933_0032120 | Ga0373933_0032120_1120_1965 | 281 |
| 664 | 3300035724 | Ga0373933_0162105 | Ga0373933_0162105_18_863 | 281 |
| 665 | 3300035725 | Ga0373947_0000288 | Ga0373947_0000288_2589_3440 | 281 |
| 666 | 3300035725 | Ga0373947_0008353 | Ga0373947_0008353_1822_2667 | 281 |
| 667 | 3300035725 | Ga0373947_0103872 | Ga0373947_0103872_356_1201 | 281 |
| 668 | 3300036401 | Ga0373937_0005192 | Ga0373937_0005192_9199_10044 | 281 |
| 669 | 3300036401 | Ga0373937_0014259 | Ga0373937_0014259_593_1438 | 281 |
| 670 | 3300036401 | Ga0373937_0025577 | Ga0373937_0025577_109_1113 | 281 |
| 671 | 3300036401 | Ga0373937_0266689 | Ga0373937_0266689_496_1341 | 281 |
| 672 | 3300036401 | Ga0373937_0286285 | Ga0373937_0286285_644_1489 | 281 |
| 673 | 3300037068 | Ga0373925_0001787 | Ga0373925_0001787_3349_4200 | 281 |
| 674 | 3300037068 | Ga0373925_0007364 | Ga0373925_0007364_3751_4596 | 281 |
| 675 | 3300037068 | Ga0373925_0043674 | Ga0373925_0043674_495_1358 | 281 |
| 676 | 3300037068 | Ga0373925_0173237 | Ga0373925_0173237_685_1689 | 281 |
| 677 | 3300037068 | Ga0373925_0211362 | Ga0373925_0211362_359_1204 | 281 |
| 678 | 3300037312 | Ga0395899_0223910 | Ga0395899_0223910_160_1005 | 281 |
| 679 | 3300037466 | Ga0395898_0112889 | Ga0395898_0112889_535_1380 | 281 |
| 680 | 3300038443 | Ga0395901_0057774 | Ga0395901_0057774_331_1176 | 281 |
| 681 | 3300039437 | Ga0436365_1087995 | Ga0436365_1087995_476_1321 | 281 |
| 682 | 3300042461 | Ga0439460_0007277 | Ga0439460_0007277_1808_2653 | 281 |
| 683 | 3300042876 | Ga0451577_0010248 | Ga0451577_0010248_2650_3495 | 281 |
| 684 | 3300046454 | Ga0495592_0009025 | Ga0495592_0009025_4631_5476 | 281 |
| 685 | 3300046454 | Ga0495592_0049987 | Ga0495592_0049987_636_1640 | 281 |
| 686 | 3300046454 | Ga0495592_0262206 | Ga0495592_0262206_223_1068 | 281 |
| 687 | 3300046455 | Ga0495603_0047130 | Ga0495603_0047130_307_1170 | 281 |
| 688 | 3300046459 | Ga0495629_0000183 | Ga0495629_0000183_48959_49810 | 281 |
| 689 | 3300046459 | Ga0495629_0020325 | Ga0495629_0020325_2041_2904 | 281 |
| 690 | 3300046461 | Ga0495641_0016655 | Ga0495641_0016655_496_1347 | 281 |
| 691 | 3300046461 | Ga0495641_0019503 | Ga0495641_0019503_1935_2780 | 281 |
| 692 | 3300046461 | Ga0495641_0052430 | Ga0495641_0052430_987_1832 | 281 |
| 693 | 3300046462 | Ga0495651_0001256 | Ga0495651_0001256_15379_16224 | 281 |
| 694 | 3300046462 | Ga0495651_0004540 | Ga0495651_0004540_2980_3984 | 281 |
| 695 | 3300046462 | Ga0495651_0023671 | Ga0495651_0023671_183_1028 | 281 |
| 696 | 3300046462 | Ga0495651_0064250 | Ga0495651_0064250_1583_2428 | 281 |
| 697 | 3300046463 | Ga0495653_0046543 | Ga0495653_0046543_1078_1923 | 281 |
| 698 | 3300046463 | Ga0495653_0057318 | Ga0495653_0057318_1797_2660 | 281 |
| 699 | 3300046463 | Ga0495653_0117328 | Ga0495653_0117328_128_979 | 281 |
| 700 | 3300046472 | Ga0495580_0080566 | Ga0495580_0080566_364_1227 | 281 |
| 701 | 3300046472 | Ga0495580_0120946 | Ga0495580_0120946_941_1786 | 281 |
| 702 | 3300046472 | Ga0495580_0123433 | Ga0495580_0123433_438_1289 | 281 |
| 703 | 3300046473 | Ga0495582_0001748 | Ga0495582_0001748_4471_5322 | 281 |
| 704 | 3300046473 | Ga0495582_0002465 | Ga0495582_0002465_8745_9590 | 281 |
| 705 | 3300046473 | Ga0495582_0097571 | Ga0495582_0097571_629_1474 | 281 |
| 706 | 3300046475 | Ga0495639_0015609 | Ga0495639_0015609_2064_2909 | 281 |
| 707 | 3300046476 | Ga0495662_0019936 | Ga0495662_0019936_1576_2421 | 281 |
| 708 | 3300046476 | Ga0495662_0052366 | Ga0495662_0052366_832_1677 | 281 |
| 709 | 3300046477 | Ga0495664_0007322 | Ga0495664_0007322_4458_5303 | 281 |
| 710 | 3300046477 | Ga0495664_0007547 | Ga0495664_0007547_236_1081 | 281 |
| 711 | 3300046477 | Ga0495664_0026199 | Ga0495664_0026199_2284_3147 | 281 |
| 712 | 3300046477 | Ga0495664_0071039 | Ga0495664_0071039_563_1408 | 281 |
| 713 | 3300046491 | Ga0495584_0023574 | Ga0495584_0023574_125_988 | 281 |
| 714 | 3300046491 | Ga0495584_0065458 | Ga0495584_0065458_647_1492 | 281 |
| 715 | 3300046492 | Ga0495585_0017046 | Ga0495585_0017046_3182_4045 | 281 |
| 716 | 3300046499 | Ga0495594_0068785 | Ga0495594_0068785_85_936 | 281 |
| 717 | 3300046499 | Ga0495594_0081400 | Ga0495594_0081400_331_1176 | 281 |
| 718 | 3300046499 | Ga0495594_0087707 | Ga0495594_0087707_403_1266 | 281 |
| 719 | 3300046501 | Ga0495607_0019505 | Ga0495607_0019505_1393_2256 | 281 |
| 720 | 3300046511 | Ga0495608_0000646 | Ga0495608_0000646_9017_9862 | 281 |
| 721 | 3300046511 | Ga0495608_0019174 | Ga0495608_0019174_673_1677 | 281 |
| 722 | 3300046511 | Ga0495608_0073236 | Ga0495608_0073236_890_1753 | 281 |
| 723 | 3300046514 | Ga0495618_0025077 | Ga0495618_0025077_519_1364 | 281 |
| 724 | 3300046516 | Ga0495628_0001902 | Ga0495628_0001902_7432_8436 | 281 |
| 725 | 3300046516 | Ga0495628_0105447 | Ga0495628_0105447_521_1366 | 281 |
| 726 | 3300046516 | Ga0495628_0246548 | Ga0495628_0246548_422_1267 | 281 |
| 727 | 3300046517 | Ga0495630_0086143 | Ga0495630_0086143_484_1329 | 281 |
| 728 | 3300046517 | Ga0495630_0137814 | Ga0495630_0137814_936_1781 | 281 |
| 729 | 3300046520 | Ga0495637_0049397 | Ga0495637_0049397_170_1033 | 281 |
| 730 | 3300046522 | Ga0495643_0132716 | Ga0495643_0132716_266_1111 | 281 |
| 731 | 3300046523 | Ga0495644_0000234 | Ga0495644_0000234_25002_25865 | 281 |
| 732 | 3300046526 | Ga0495666_0019944 | Ga0495666_0019944_367_1212 | 281 |
| 733 | 3300046529 | Ga0495652_0012330 | Ga0495652_0012330_5577_6422 | 281 |
| 734 | 3300046529 | Ga0495652_0039217 | Ga0495652_0039217_2085_3089 | 281 |
| 735 | 3300046529 | Ga0495652_0055115 | Ga0495652_0055115_2432_3277 | 281 |
| 736 | 3300046531 | Ga0495665_0039729 | Ga0495665_0039729_1270_2115 | 281 |
| 737 | 3300046533 | Ga0495640_0018843 | Ga0495640_0018843_2808_3671 | 281 |
| 738 | 3300046535 | Ga0495586_0102700 | Ga0495586_0102700_384_1229 | 281 |
| 739 | 3300046536 | Ga0495587_0000770 | Ga0495587_0000770_20042_20887 | 281 |
| 740 | 3300046539 | Ga0495621_0082200 | Ga0495621_0082200_85_948 | 281 |
| 741 | 3300046543 | Ga0495645_0010241 | Ga0495645_0010241_3509_4354 | 281 |
| 742 | 3300046543 | Ga0495645_0067555 | Ga0495645_0067555_1570_2415 | 281 |
| 743 | 3300046543 | Ga0495645_0074432 | Ga0495645_0074432_49_996 | 281 |
| 744 | 3300046557 | Ga0495622_0026407 | Ga0495622_0026407_108_953 | 281 |
| 745 | 3300046557 | Ga0495622_0036966 | Ga0495622_0036966_358_1221 | 281 |
| 746 | 3300046557 | Ga0495622_0115235 | Ga0495622_0115235_224_1075 | 281 |
| 747 | 3300046558 | Ga0495633_0055300 | Ga0495633_0055300_936_1793 | 281 |
| 748 | 3300046558 | Ga0495633_0132744 | Ga0495633_0132744_84_947 | 281 |
| 749 | 3300046559 | Ga0495667_0012785 | Ga0495667_0012785_4535_5398 | 281 |
| 750 | 3300046559 | Ga0495667_0013632 | Ga0495667_0013632_197_1042 | 281 |
| 751 | 3300046559 | Ga0495667_0021370 | Ga0495667_0021370_1766_2611 | 281 |
| 752 | 3300046559 | Ga0495667_0231034 | Ga0495667_0231034_85_1089 | 281 |
| 753 | 3300046615 | Ga0495656_0000502 | Ga0495656_0000502_537_1400 | 281 |
| 754 | 3300046642 | Ga0495634_0005519 | Ga0495634_0005519_236_1081 | 281 |
| 755 | 3300046642 | Ga0495634_0029394 | Ga0495634_0029394_2736_3581 | 281 |
| 756 | 3300046663 | Ga0495635_0000812 | Ga0495635_0000812_9649_10494 | 281 |
| 757 | 3300046663 | Ga0495635_0068842 | Ga0495635_0068842_622_1467 | 281 |
| 758 | 3300046663 | Ga0495635_0078343 | Ga0495635_0078343_1032_1895 | 281 |
| 759 | 3300046663 | Ga0495635_0090134 | Ga0495635_0090134_708_1559 | 281 |
| 760 | 3300046664 | Ga0495659_0019422 | Ga0495659_0019422_142_1005 | 281 |
| 761 | 3300046665 | Ga0495661_0133436 | Ga0495661_0133436_301_1164 | 281 |
| 762 | 3300046674 | Ga0495588_0018849 | Ga0495588_0018849_1221_2066 | 281 |
| 763 | 3300046674 | Ga0495588_0049139 | Ga0495588_0049139_825_1688 | 281 |
| 764 | 3300046675 | Ga0495657_0005959 | Ga0495657_0005959_7976_8821 | 281 |
| 765 | 3300046675 | Ga0495657_0073198 | Ga0495657_0073198_1069_1914 | 281 |
| 766 | 3300046678 | Ga0495599_0003370 | Ga0495599_0003370_6677_7681 | 281 |
| 767 | 3300046679 | Ga0495623_0001381 | Ga0495623_0001381_6127_6972 | 281 |
| 768 | 3300046679 | Ga0495623_0007001 | Ga0495623_0007001_2895_3899 | 281 |
| 769 | 3300046680 | Ga0495646_0006169 | Ga0495646_0006169_2351_3196 | 281 |
| 770 | 3300046680 | Ga0495646_0101675 | Ga0495646_0101675_712_1557 | 281 |
| 771 | 3300046680 | Ga0495646_0225582 | Ga0495646_0225582_42_989 | 281 |
| 772 | 3300046681 | Ga0495647_0010732 | Ga0495647_0010732_636_1487 | 281 |
| 773 | 3300046683 | Ga0495658_0026339 | Ga0495658_0026339_280_1143 | 281 |
| 774 | 3300046683 | Ga0495658_0033999 | Ga0495658_0033999_1347_2192 | 281 |
| 775 | 3300046683 | Ga0495658_0100438 | Ga0495658_0100438_780_1631 | 281 |
| 776 | 3300046684 | Ga0495669_0025004 | Ga0495669_0025004_737_1600 | 281 |
| 777 | 3300046689 | Ga0495613_0103367 | Ga0495613_0103367_757_1602 | 281 |
| 778 | 3300046689 | Ga0495613_0174224 | Ga0495613_0174224_376_1221 | 281 |
| 779 | 3300046690 | Ga0495624_0022854 | Ga0495624_0022854_1861_2706 | 281 |
| 780 | 3300046690 | Ga0495624_0040556 | Ga0495624_0040556_663_1508 | 281 |
| 781 | 3300046690 | Ga0495624_0043892 | Ga0495624_0043892_425_1288 | 281 |
| 782 | 3300046691 | Ga0495670_0001992 | Ga0495670_0001992_1265_2128 | 281 |
| 783 | 3300046809 | Ga0495600_0001477 | Ga0495600_0001477_9417_10421 | 281 |
| 784 | 3300046809 | Ga0495600_0071321 | Ga0495600_0071321_255_1118 | 281 |
| 785 | 3300046809 | Ga0495600_0122193 | Ga0495600_0122193_775_1620 | 281 |
| 786 | 3300047315 | Ga0495581_0129470 | Ga0495581_0129470_268_1113 | 281 |
| 787 | 3300047317 | Ga0495604_0079050 | Ga0495604_0079050_354_1217 | 281 |
| 788 | 3300047317 | Ga0495604_0093021 | Ga0495604_0093021_1356_2201 | 281 |
| 789 | 3300047319 | Ga0495674_0058715 | Ga0495674_0058715_200_1045 | 281 |
| 790 | 3300047319 | Ga0495674_0147612 | Ga0495674_0147612_628_1473 | 281 |
| 791 | 3300047319 | Ga0495674_0254663 | Ga0495674_0254663_281_1126 | 281 |
| 792 | 3300047321 | Ga0495676_0031961 | Ga0495676_0031961_840_1691 | 281 |
| 793 | 3300047321 | Ga0495676_0047264 | Ga0495676_0047264_717_1562 | 281 |
| 794 | 3300047322 | Ga0495680_0006835 | Ga0495680_0006835_649_1494 | 281 |
| 795 | 3300047322 | Ga0495680_0025234 | Ga0495680_0025234_219_1064 | 281 |
| 796 | 3300047322 | Ga0495680_0045027 | Ga0495680_0045027_1527_2378 | 281 |
| 797 | 3300047322 | Ga0495680_0047807 | Ga0495680_0047807_61_906 | 281 |
| 798 | 3300047322 | Ga0495680_0150937 | Ga0495680_0150937_794_1639 | 281 |
| 799 | 3300047444 | Ga0495675_0007988 | Ga0495675_0007988_4406_5251 | 281 |
| 800 | 3300047446 | Ga0495679_018405 | Ga0495679_018405_377_1240 | 281 |
| 801 | 3300047471 | Ga0495684_0008581 | Ga0495684_0008581_4563_5426 | 281 |
| 802 | 3300047471 | Ga0495684_0019509 | Ga0495684_0019509_2127_2972 | 281 |
| 803 | 3300047471 | Ga0495684_0152115 | Ga0495684_0152115_41_1045 | 281 |
| 804 | 3300047471 | Ga0495684_0248375 | Ga0495684_0248375_357_1202 | 281 |
| 805 | 3300047471 | Ga0495684_0262639 | Ga0495684_0262639_383_1228 | 281 |
| 806 | 3300047673 | Ga0495593_0011432 | Ga0495593_0011432_1573_2424 | 281 |
| 807 | 3300048088 | Ga0495602_0020689 | Ga0495602_0020689_88_1092 | 281 |
| 808 | 3300048088 | Ga0495602_0195930 | Ga0495602_0195930_431_1276 | 281 |
| 809 | 3300048089 | Ga0495614_0024203 | Ga0495614_0024203_182_1045 | 281 |
| 810 | 3300048089 | Ga0495614_0052376 | Ga0495614_0052376_361_1212 | 281 |
| 811 | 3300048903 | Ga0496100_0000530 | Ga0496100_0000530_19_864 | 281 |
| 812 | 3300048903 | Ga0496100_0011766 | Ga0496100_0011766_3660_4505 | 281 |
| 813 | 3300048903 | Ga0496100_0042055 | Ga0496100_0042055_1982_2833 | 281 |
| 814 | 3300048903 | Ga0496100_0055648 | Ga0496100_0055648_1726_2571 | 281 |
| 815 | 3300048903 | Ga0496100_0261903 | Ga0496100_0261903_28_873 | 281 |
| 816 | 3300048904 | Ga0496101_0000189 | Ga0496101_0000189_43148_43993 | 281 |
| 817 | 3300048904 | Ga0496101_0003519 | Ga0496101_0003519_4274_5119 | 281 |
| 818 | 3300048904 | Ga0496101_0024583 | Ga0496101_0024583_1399_2244 | 281 |
| 819 | 3300048904 | Ga0496101_0070644 | Ga0496101_0070644_1471_2322 | 281 |
| 820 | 3300048904 | Ga0496101_0338230 | Ga0496101_0338230_158_1003 | 281 |
| 821 | 3300048904 | Ga0496101_0460570 | Ga0496101_0460570_60_905 | 281 |
| 822 | 3300048905 | Ga0496102_0006150 | Ga0496102_0006150_5092_5937 | 281 |
| 823 | 3300048905 | Ga0496102_0011115 | Ga0496102_0011115_5875_6720 | 281 |
| 824 | 3300048905 | Ga0496102_0022131 | Ga0496102_0022131_2684_3529 | 281 |
| 825 | 3300048905 | Ga0496102_0043206 | Ga0496102_0043206_2364_3209 | 281 |
| 826 | 3300048905 | Ga0496102_0052973 | Ga0496102_0052973_1931_2782 | 281 |
| 827 | 3300048905 | Ga0496102_0123061 | Ga0496102_0123061_459_1304 | 281 |
| 828 | 3300048905 | Ga0496102_0664937 | Ga0496102_0664937_38_883 | 281 |
| 829 | 3300048906 | Ga0496103_0001693 | Ga0496103_0001693_4261_5106 | 281 |
| 830 | 3300048906 | Ga0496103_0006234 | Ga0496103_0006234_4780_5625 | 281 |
| 831 | 3300048906 | Ga0496103_0056304 | Ga0496103_0056304_1120_1965 | 281 |
| 832 | 3300048906 | Ga0496103_0124913 | Ga0496103_0124913_56_907 | 281 |
| 833 | 3300048907 | Ga0496104_0001051 | Ga0496104_0001051_7837_8682 | 281 |
| 834 | 3300048907 | Ga0496104_0001268 | Ga0496104_0001268_10195_11163 | 281 |
| 835 | 3300048907 | Ga0496104_0011783 | Ga0496104_0011783_3205_4050 | 281 |
| 836 | 3300048907 | Ga0496104_0032205 | Ga0496104_0032205_2944_3789 | 281 |
| 837 | 3300048907 | Ga0496104_0032453 | Ga0496104_0032453_1955_2800 | 281 |
| 838 | 3300048907 | Ga0496104_0077033 | Ga0496104_0077033_1692_2537 | 281 |
| 839 | 3300048907 | Ga0496104_0086587 | Ga0496104_0086587_373_1218 | 281 |
| 840 | 3300048907 | Ga0496104_0110711 | Ga0496104_0110711_917_1768 | 281 |
| 841 | 3300048907 | Ga0496104_0175946 | Ga0496104_0175946_335_1186 | 281 |
| 842 | 3300048908 | Ga0496105_0010093 | Ga0496105_0010093_5546_6391 | 281 |
| 843 | 3300048908 | Ga0496105_0017656 | Ga0496105_0017656_4793_5644 | 281 |
| 844 | 3300048908 | Ga0496105_0030416 | Ga0496105_0030416_184_1029 | 281 |
| 845 | 3300048908 | Ga0496105_0039608 | Ga0496105_0039608_2798_3649 | 281 |
| 846 | 3300048908 | Ga0496105_0045225 | Ga0496105_0045225_1826_2671 | 281 |
| 847 | 3300048908 | Ga0496105_0051601 | Ga0496105_0051601_1607_2575 | 281 |
| 848 | 3300048908 | Ga0496105_0147278 | Ga0496105_0147278_996_1841 | 281 |
| 849 | 3300048908 | Ga0496105_0243614 | Ga0496105_0243614_557_1402 | 281 |
| 850 | 3300048909 | Ga0496106_0002185 | Ga0496106_0002185_9343_10188 | 281 |
| 851 | 3300048909 | Ga0496106_0002661 | Ga0496106_0002661_10381_11226 | 281 |
| 852 | 3300048909 | Ga0496106_0039568 | Ga0496106_0039568_2163_3008 | 281 |
| 853 | 3300048909 | Ga0496106_0059857 | Ga0496106_0059857_1074_1919 | 281 |
| 854 | 3300048909 | Ga0496106_0060539 | Ga0496106_0060539_1964_2815 | 281 |
| 855 | 3300048909 | Ga0496106_0062439 | Ga0496106_0062439_681_1526 | 281 |
| 856 | 3300048909 | Ga0496106_0119200 | Ga0496106_0119200_909_1754 | 281 |
| 857 | 3300048909 | Ga0496106_0151220 | Ga0496106_0151220_828_1673 | 281 |
| 858 | 3300048909 | Ga0496106_0171433 | Ga0496106_0171433_591_1436 | 281 |
| 859 | 3300048910 | Ga0496107_0005021 | Ga0496107_0005021_2038_2883 | 281 |
| 860 | 3300048910 | Ga0496107_0007982 | Ga0496107_0007982_4424_5269 | 281 |
| 861 | 3300048910 | Ga0496107_0042731 | Ga0496107_0042731_2149_2994 | 281 |
| 862 | 3300048910 | Ga0496107_0059642 | Ga0496107_0059642_909_1760 | 281 |
| 863 | 3300048910 | Ga0496107_0063686 | Ga0496107_0063686_1629_2474 | 281 |
| 864 | 3300048910 | Ga0496107_0082326 | Ga0496107_0082326_884_1729 | 281 |
| 865 | 3300048910 | Ga0496107_0123007 | Ga0496107_0123007_618_1463 | 281 |
| 866 | 3300048910 | Ga0496107_0224208 | Ga0496107_0224208_541_1386 | 281 |
| 867 | 3300048910 | Ga0496107_0266786 | Ga0496107_0266786_97_942 | 281 |
| 868 | 3300048911 | Ga0496108_0004716 | Ga0496108_0004716_5050_5895 | 281 |
| 869 | 3300048911 | Ga0496108_0007288 | Ga0496108_0007288_6281_7126 | 281 |
| 870 | 3300048911 | Ga0496108_0020178 | Ga0496108_0020178_3729_4574 | 281 |
| 871 | 3300048911 | Ga0496108_0022285 | Ga0496108_0022285_4021_4872 | 281 |
| 872 | 3300048911 | Ga0496108_0048722 | Ga0496108_0048722_2035_2880 | 281 |
| 873 | 3300048911 | Ga0496108_0052007 | Ga0496108_0052007_1025_1870 | 281 |
| 874 | 3300048911 | Ga0496108_0079257 | Ga0496108_0079257_83_934 | 281 |
| 875 | 3300048911 | Ga0496108_0155726 | Ga0496108_0155726_494_1339 | 281 |
| 876 | 3300048912 | Ga0496109_0000488 | Ga0496109_0000488_24539_25384 | 281 |
| 877 | 3300048912 | Ga0496109_0000937 | Ga0496109_0000937_22888_23733 | 281 |
| 878 | 3300048912 | Ga0496109_0006180 | Ga0496109_0006180_2819_3664 | 281 |
| 879 | 3300048912 | Ga0496109_0006447 | Ga0496109_0006447_5464_6309 | 281 |
| 880 | 3300048912 | Ga0496109_0076359 | Ga0496109_0076359_732_1583 | 281 |
| 881 | 3300048912 | Ga0496109_0131284 | Ga0496109_0131284_754_1599 | 281 |
| 882 | 3300048912 | Ga0496109_0134090 | Ga0496109_0134090_1211_2056 | 281 |
| 883 | 3300048912 | Ga0496109_0161236 | Ga0496109_0161236_1070_1915 | 281 |
| 884 | 3300048913 | Ga0496110_0010267 | Ga0496110_0010267_6032_6877 | 281 |
| 885 | 3300048913 | Ga0496110_0011374 | Ga0496110_0011374_5543_6388 | 281 |
| 886 | 3300048913 | Ga0496110_0060950 | Ga0496110_0060950_71_922 | 281 |
| 887 | 3300048913 | Ga0496110_0087623 | Ga0496110_0087623_1851_2702 | 281 |
| 888 | 3300048913 | Ga0496110_0176013 | Ga0496110_0176013_745_1590 | 281 |
| 889 | 3300048913 | Ga0496110_0186075 | Ga0496110_0186075_831_1676 | 281 |
| 890 | 3300048914 | Ga0496111_0043412 | Ga0496111_0043412_1809_2654 | 281 |
| 891 | 3300048914 | Ga0496111_0054114 | Ga0496111_0054114_1234_2079 | 281 |
| 892 | 3300048914 | Ga0496111_0073899 | Ga0496111_0073899_1499_2350 | 281 |
| 893 | 3300048914 | Ga0496111_0186421 | Ga0496111_0186421_566_1411 | 281 |
| 894 | 3300048914 | Ga0496111_0290393 | Ga0496111_0290393_339_1184 | 281 |
| 895 | 3300048915 | Ga0496112_0002119 | Ga0496112_0002119_8497_9342 | 281 |
| 896 | 3300048915 | Ga0496112_0030238 | Ga0496112_0030238_1177_2022 | 281 |
| 897 | 3300048915 | Ga0496112_0042689 | Ga0496112_0042689_1499_2350 | 281 |
| 898 | 3300048915 | Ga0496112_0072283 | Ga0496112_0072283_2271_3116 | 281 |
| 899 | 3300048915 | Ga0496112_0150683 | Ga0496112_0150683_710_1558 | 281 |
| 900 | 3300048915 | Ga0496112_0382388 | Ga0496112_0382388_365_1216 | 281 |
| 901 | 3300048915 | Ga0496112_0650680 | Ga0496112_0650680_49_900 | 281 |
| 902 | 3300048916 | Ga0496113_0007034 | Ga0496113_0007034_2857_3702 | 281 |
| 903 | 3300048916 | Ga0496113_0008963 | Ga0496113_0008963_4970_5815 | 281 |
| 904 | 3300048916 | Ga0496113_0036654 | Ga0496113_0036654_917_1768 | 281 |
| 905 | 3300048916 | Ga0496113_0094768 | Ga0496113_0094768_56_907 | 281 |
| 906 | 3300048917 | Ga0496114_0001444 | Ga0496114_0001444_6176_7021 | 281 |
| 907 | 3300048917 | Ga0496114_0056180 | Ga0496114_0056180_680_1525 | 281 |
| 908 | 3300048917 | Ga0496114_0067813 | Ga0496114_0067813_648_1499 | 281 |
| 909 | 3300048917 | Ga0496114_0147267 | Ga0496114_0147267_85_930 | 281 |
| 910 | 3300048917 | Ga0496114_0243562 | Ga0496114_0243562_48_893 | 281 |
| 911 | 3300048917 | Ga0496114_0256679 | Ga0496114_0256679_646_1491 | 281 |
| 912 | 3300048918 | Ga0496115_0010890 | Ga0496115_0010890_4569_5414 | 281 |
| 913 | 3300048918 | Ga0496115_0011115 | Ga0496115_0011115_1601_2446 | 281 |
| 914 | 3300048918 | Ga0496115_0023856 | Ga0496115_0023856_2034_2879 | 281 |
| 915 | 3300048918 | Ga0496115_0024977 | Ga0496115_0024977_1709_2554 | 281 |
| 916 | 3300048918 | Ga0496115_0052993 | Ga0496115_0052993_433_1284 | 281 |
| 917 | 3300048918 | Ga0496115_0061694 | Ga0496115_0061694_562_1407 | 281 |
| 918 | 3300048918 | Ga0496115_0062463 | Ga0496115_0062463_1465_2316 | 281 |
| 919 | 3300048918 | Ga0496115_0116398 | Ga0496115_0116398_22_867 | 281 |
| 920 | 3300048918 | Ga0496115_0309304 | Ga0496115_0309304_418_1263 | 281 |
| 921 | 3300049569 | Ga0501032_0032146 | Ga0501032_0032146_2152_3003 | 281 |
| 922 | 3300049570 | Ga0501033_0022284 | Ga0501033_0022284_3446_4291 | 281 |
| 923 | 3300049571 | Ga0501034_0062271 | Ga0501034_0062271_1501_2352 | 281 |
| 924 | 3300049571 | Ga0501034_0075137 | Ga0501034_0075137_858_1709 | 281 |
| 925 | 3300049571 | Ga0501034_0079867 | Ga0501034_0079867_1962_2807 | 281 |
| 926 | 3300049571 | Ga0501034_0496032 | Ga0501034_0496032_11_856 | 281 |
| 927 | 3300049572 | Ga0501036_0075408 | Ga0501036_0075408_1899_2744 | 281 |
| 928 | 3300049572 | Ga0501036_0133421 | Ga0501036_0133421_1191_2036 | 281 |
| 929 | 3300049573 | Ga0501037_0008863 | Ga0501037_0008863_1395_2246 | 281 |
| 930 | 3300049573 | Ga0501037_0153724 | Ga0501037_0153724_778_1623 | 281 |
| 931 | 3300049574 | Ga0501038_0091952 | Ga0501038_0091952_1573_2424 | 281 |
| 932 | 3300049574 | Ga0501038_0365413 | Ga0501038_0365413_229_1074 | 281 |
| 933 | 3300049575 | Ga0501039_0066340 | Ga0501039_0066340_1907_2758 | 281 |
| 934 | 3300049575 | Ga0501039_0072285 | Ga0501039_0072285_1768_2613 | 281 |
| 935 | 3300049578 | Ga0501042_0018045 | Ga0501042_0018045_1655_2506 | 281 |
| 936 | 3300049579 | Ga0501043_0058825 | Ga0501043_0058825_771_1622 | 281 |
| 937 | 3300049580 | Ga0501046_0008348 | Ga0501046_0008348_2313_3164 | 281 |
| 938 | 3300049581 | Ga0501047_0005574 | Ga0501047_0005574_750_1595 | 281 |
| 939 | 3300049581 | Ga0501047_0020602 | Ga0501047_0020602_1960_2805 | 281 |
| 940 | 3300049582 | Ga0501048_0011858 | Ga0501048_0011858_2812_3663 | 281 |
| 941 | 3300049583 | Ga0501067_0029331 | Ga0501067_0029331_2155_3006 | 281 |
| 942 | 3300049583 | Ga0501067_0083058 | Ga0501067_0083058_349_1194 | 281 |
| 943 | 3300049584 | Ga0501068_0021379 | Ga0501068_0021379_2182_3033 | 281 |
| 944 | 3300049585 | Ga0501069_0008627 | Ga0501069_0008627_1706_2557 | 281 |
| 945 | 3300049585 | Ga0501069_0050869 | Ga0501069_0050869_794_1639 | 281 |
| 946 | 3300049586 | Ga0501070_0037325 | Ga0501070_0037325_2107_2952 | 281 |
| 947 | 3300049586 | Ga0501070_0042299 | Ga0501070_0042299_2149_3000 | 281 |
| 948 | 3300049586 | Ga0501070_0335857 | Ga0501070_0335857_34_879 | 281 |
| 949 | 3300049587 | Ga0501071_0045909 | Ga0501071_0045909_1596_2447 | 281 |
| 950 | 3300049592 | Ga0501076_0019979 | Ga0501076_0019979_4188_5033 | 281 |
| 951 | 3300049593 | Ga0501077_0044390 | Ga0501077_0044390_1940_2785 | 281 |
| 952 | 3300049593 | Ga0501077_0053596 | Ga0501077_0053596_1638_2483 | 281 |
| 953 | 3300049593 | Ga0501077_0059008 | Ga0501077_0059008_433_1278 | 281 |
| 954 | 3300049593 | Ga0501077_0104465 | Ga0501077_0104465_883_1728 | 281 |
| 955 | 3300049741 | Ga0501079_0029585 | Ga0501079_0029585_798_1649 | 281 |
| 956 | 3300049741 | Ga0501079_0104827 | Ga0501079_0104827_491_1336 | 281 |
| 957 | 3300049743 | Ga0501081_0077791 | Ga0501081_0077791_147_992 | 281 |
| 958 | 3300049744 | Ga0501083_0142979 | Ga0501083_0142979_494_1345 | 281 |
| 959 | 3300049744 | Ga0501083_0147279 | Ga0501083_0147279_494_1339 | 281 |
| 960 | 3300049822 | Ga0501035_0096281 | Ga0501035_0096281_383_1228 | 281 |
| 961 | 3300049822 | Ga0501035_0161843 | Ga0501035_0161843_317_1162 | 281 |
| 962 | 3300049822 | Ga0501035_0277780 | Ga0501035_0277780_417_1262 | 281 |
| 963 | 3300049823 | Ga0501044_0000212 | Ga0501044_0000212_33036_33887 | 281 |
| 964 | 3300049823 | Ga0501044_0115183 | Ga0501044_0115183_939_1784 | 281 |
| 965 | 3300049823 | Ga0501044_0586978 | Ga0501044_0586978_113_958 | 281 |
| 966 | 3300050491 | nmdc:mga00v17_25398_c1 | nmdc:mga00v17_25398_c1_1367_2212 | 281 |
| 967 | 3300050492 | nmdc:mga0yw44_13330_c1 | nmdc:mga0yw44_13330_c1_2623_3471 | 281 |
| 968 | 3300050492 | nmdc:mga0yw44_23092_c1 | nmdc:mga0yw44_23092_c1_2369_3214 | 281 |
| 969 | 3300050492 | nmdc:mga0yw44_72764_c1 | nmdc:mga0yw44_72764_c1_648_1493 | 281 |
| 970 | 3300050494 | nmdc:mga06z11_129052_c1 | nmdc:mga06z11_129052_c1_520_1368 | 281 |
| 971 | 3300050496 | nmdc:mga07m45_64769_c1 | nmdc:mga07m45_64769_c1_608_1453 | 281 |
| 972 | 3300050507 | nmdc:mga05p37_22407_c1 | nmdc:mga05p37_22407_c1_6448_7293 | 281 |
| 973 | 3300050507 | nmdc:mga05p37_249482_c1 | nmdc:mga05p37_249482_c1_1047_1892 | 281 |
| 974 | 3300050507 | nmdc:mga05p37_40101_c1 | nmdc:mga05p37_40101_c1_778_1623 | 281 |
| 975 | 3300050507 | nmdc:mga05p37_436714_c1 | nmdc:mga05p37_436714_c1_280_1125 | 281 |
| 976 | 3300050507 | nmdc:mga05p37_505_c1 | nmdc:mga05p37_505_c1_32033_32878 | 281 |
| 977 | 3300050507 | nmdc:mga05p37_9120_c1 | nmdc:mga05p37_9120_c1_9650_10495 | 281 |
| 978 | 3300050508 | nmdc:mga09592_772_c1 | nmdc:mga09592_772_c1_8136_8981 | 281 |
| 979 | 3300050509 | nmdc:mga0qj67_165_c1 | nmdc:mga0qj67_165_c1_36610_37455 | 281 |
| 980 | 3300050509 | nmdc:mga0qj67_64449_c1 | nmdc:mga0qj67_64449_c1_1963_2808 | 281 |
| 981 | 3300050510 | nmdc:mga06r32_212095_c1 | nmdc:mga06r32_212095_c1_219_1064 | 281 |
| 982 | 3300050510 | nmdc:mga06r32_272949_c1 | nmdc:mga06r32_272949_c1_615_1460 | 281 |
| 983 | 3300050510 | nmdc:mga06r32_363440_c1 | nmdc:mga06r32_363440_c1_465_1310 | 281 |
| 984 | 3300050510 | nmdc:mga06r32_6147_c1 | nmdc:mga06r32_6147_c1_3336_4181 | 281 |
| 985 | 3300050510 | nmdc:mga06r32_660729_c1 | nmdc:mga06r32_660729_c1_104_949 | 281 |
| 986 | 3300050510 | nmdc:mga06r32_78142_c1 | nmdc:mga06r32_78142_c1_431_1276 | 281 |
| 987 | 3300050511 | nmdc:mga08y16_1045_c1 | nmdc:mga08y16_1045_c1_13936_14781 | 281 |
| 988 | 3300050511 | nmdc:mga08y16_12959_c1 | nmdc:mga08y16_12959_c1_6016_6861 | 281 |
| 989 | 3300050511 | nmdc:mga08y16_19941_c1 | nmdc:mga08y16_19941_c1_1806_2651 | 281 |
| 990 | 3300050511 | nmdc:mga08y16_264944_c1 | nmdc:mga08y16_264944_c1_702_1547 | 281 |
| 991 | 3300050511 | nmdc:mga08y16_2844_c1 | nmdc:mga08y16_2844_c1_10221_11066 | 281 |
| 992 | 3300050511 | nmdc:mga08y16_333700_c1 | nmdc:mga08y16_333700_c1_18_863 | 281 |
| 993 | 3300050511 | nmdc:mga08y16_497493_c1 | nmdc:mga08y16_497493_c1_232_1077 | 281 |
| 994 | 3300050512 | nmdc:mga0n895_122515_c1 | nmdc:mga0n895_122515_c1_211_1056 | 281 |
| 995 | 3300050512 | nmdc:mga0n895_189060_c1 | nmdc:mga0n895_189060_c1_547_1392 | 281 |
| 996 | 3300050512 | nmdc:mga0n895_24562_c1 | nmdc:mga0n895_24562_c1_675_1520 | 281 |
| 997 | 3300050512 | nmdc:mga0n895_2649_c1 | nmdc:mga0n895_2649_c1_983_1828 | 281 |
| 998 | 3300050512 | nmdc:mga0n895_45935_c1 | nmdc:mga0n895_45935_c1_1384_2229 | 281 |
| 999 | 3300050512 | nmdc:mga0n895_597460_c1 | nmdc:mga0n895_597460_c1_237_1082 | 281 |
| 1000 | 3300050512 | nmdc:mga0n895_613787_c1 | nmdc:mga0n895_613787_c1_104_949 | 281 |
| 1001 | 3300050512 | nmdc:mga0n895_76480_c1 | nmdc:mga0n895_76480_c1_1546_2391 | 281 |
| 1002 | 3300050513 | nmdc:mga0rr50_124153_c1 | nmdc:mga0rr50_124153_c1_485_1336 | 281 |
| 1003 | 3300050513 | nmdc:mga0rr50_1278_c1 | nmdc:mga0rr50_1278_c1_176_1021 | 281 |
| 1004 | 3300050513 | nmdc:mga0rr50_16037_c1 | nmdc:mga0rr50_16037_c1_895_1740 | 281 |
| 1005 | 3300050513 | nmdc:mga0rr50_192693_c1 | nmdc:mga0rr50_192693_c1_16_861 | 281 |
| 1006 | 3300050514 | nmdc:mga08x19_211521_c1 | nmdc:mga08x19_211521_c1_372_1217 | 281 |
| 1007 | 3300050514 | nmdc:mga08x19_23872_c1 | nmdc:mga08x19_23872_c1_2891_3736 | 281 |
| 1008 | 3300050514 | nmdc:mga08x19_95929_c1 | nmdc:mga08x19_95929_c1_1098_1943 | 281 |
| 1009 | 3300050515 | nmdc:mga0a205_15415_c1 | nmdc:mga0a205_15415_c1_5573_6418 | 281 |
| 1010 | 3300050515 | nmdc:mga0a205_1632_c1 | nmdc:mga0a205_1632_c1_1236_2081 | 281 |
| 1011 | 3300050515 | nmdc:mga0a205_20147_c1 | nmdc:mga0a205_20147_c1_1839_2684 | 281 |
| 1012 | 3300050515 | nmdc:mga0a205_237148_c1 | nmdc:mga0a205_237148_c1_82_927 | 281 |
| 1013 | 3300050515 | nmdc:mga0a205_565274_c1 | nmdc:mga0a205_565274_c1_17_862 | 281 |
| 1014 | 3300050515 | nmdc:mga0a205_81954_c1 | nmdc:mga0a205_81954_c1_411_1262 | 281 |
| 1015 | 3300053077 | Ga0495601_0000075 | Ga0495601_0000075_47226_48230 | 281 |
| 1016 | 3300053077 | Ga0495601_0000961 | Ga0495601_0000961_6336_7181 | 281 |
| 1017 | 3300053077 | Ga0495601_0001420 | Ga0495601_0001420_6570_7415 | 281 |
| 1018 | 3300053077 | Ga0495601_0018671 | Ga0495601_0018671_898_1761 | 281 |
| 1019 | 3300053077 | Ga0495601_0048186 | Ga0495601_0048186_1627_2472 | 281 |
| 1020 | 3300053078 | Ga0495612_0001336 | Ga0495612_0001336_1704_2651 | 281 |
| 1021 | 3300053078 | Ga0495612_0002112 | Ga0495612_0002112_2718_3563 | 281 |
| 1022 | 3300053078 | Ga0495612_0006592 | Ga0495612_0006592_3399_4244 | 281 |
| 1023 | 3300053078 | Ga0495612_0008176 | Ga0495612_0008176_1048_1893 | 281 |
| 1024 | 3300053078 | Ga0495612_0009466 | Ga0495612_0009466_1928_2773 | 281 |
| 1025 | 3300053083 | Ga0495655_0005569 | Ga0495655_0005569_45_902 | 281 |
| 1026 | 3300053084 | Ga0495595_0004598 | Ga0495595_0004598_300_1145 | 281 |
| 1027 | 3300053084 | Ga0495595_0005026 | Ga0495595_0005026_1300_2163 | 281 |
| 1028 | 3300053084 | Ga0495595_0005375 | Ga0495595_0005375_2604_3608 | 281 |
| 1029 | 3300053084 | Ga0495595_0023737 | Ga0495595_0023737_825_1670 | 281 |
| 1030 | 3300053084 | Ga0495595_0034986 | Ga0495595_0034986_1307_2152 | 281 |
| 1031 | 3300053085 | Ga0495619_0000211 | Ga0495619_0000211_35474_36325 | 281 |
| 1032 | 3300053085 | Ga0495619_0000315 | Ga0495619_0000315_3688_4533 | 281 |
| 1033 | 3300053085 | Ga0495619_0000907 | Ga0495619_0000907_12113_13117 | 281 |
| 1034 | 3300053085 | Ga0495619_0005328 | Ga0495619_0005328_5791_6636 | 281 |
| 1035 | 3300053085 | Ga0495619_0033900 | Ga0495619_0033900_2117_2962 | 281 |
| 1036 | 3300053085 | Ga0495619_0060054 | Ga0495619_0060054_1433_2380 | 281 |
| 1037 | 3300053085 | Ga0495619_0185501 | Ga0495619_0185501_281_1126 | 281 |
| 1038 | 3300054114 | Ga0501084_0033284 | Ga0501084_0033284_1096_1947 | 281 |
| 1039 | 3300060353 | Ga0501082_0010759 | Ga0501082_0010759_6922_7773 | 281 |
| 1040 | 3300061734 | Ga0530510_0323109 | Ga0530510_0323109_109_954 | 281 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5oge-assembly4.cif.gz_D | crystal structure of a nucleotide sugar transporter | 0.8272 | 2 | 280 |
| 5oge-assembly2.cif.gz_B | crystal structure of a nucleotide sugar transporter | 0.8195 | 2 | 280 |
| 5oge-assembly4.cif.gz_D | crystal structure of a nucleotide sugar transporter | 0.8194 | 2 | 280 |
| 7paf-assembly1.cif.gz_D | streptococcus pneumoniae choline importer licb in lipid nanodiscs | 0.8189 | 5 | 278 |
| 5oge-assembly3.cif.gz_H-2 | crystal structure of a nucleotide sugar transporter | 0.8182 | 2 | 280 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1MX93_4_118_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.8039 | 198 | 281 | 1.10.3730.20 |
| af_A0A0R0GBE4_5_124_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.8008 | 197 | 281 | 1.10.3730.20 |
| af_Q8RWH8_5_118_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.7979 | 198 | 281 | 1.10.3730.20 |
| af_Q20583_6_327_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.731 | 5 | 280 | 1.20.1740.10 |
| af_Q20583_6_327_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.7176 | 5 | 280 | 1.20.1740.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-V7H9D7-F1-model_v4 | EamA domain-containing protein | 0.9785 | 1 | 281 |
GO:0016020
|
| AF-A0A090DDL3-F1-model_v4 | EamA domain-containing protein | 0.9781 | 1 | 281 |
GO:0016020
|
| AF-A0A1I5ETQ7-F1-model_v4 | EamA-like transporter family protein | 0.9775 | 1 | 281 |
GO:0016020
|
| AF-A0A3Q8YGF5-F1-model_v4 | EamA family transporter | 0.9768 | 1 | 281 |
GO:0016020
|
| AF-A0A4U6C9U7-F1-model_v4 | EamA family transporter | 0.9762 | 1 | 281 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar