F488809

General Info

Members Datasets Scaffolds Average Seq Length
1040 408 1040 283

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100165148|Ga0070711_1001651482
Length 334
Sequence MVGQTPSIRILKSLNPLIKMLCSIADSRAARFRRGDNGQKLRAGGPSDRYALVMENFVFLAVLFAAACHAGWNALIKVGLDPLSTTTLISIGSGAVALVFTPLVGAPAGAAWPWLVASVAIHLVYFASLIETYRTGDLGQVYPIARGAAPLMTATVTTFFIGEKLSVVGWVGIFALIAGVLLLSARGGRELARIDRRAIGFAFFTALTVCAYSVVDGVGARLSANPNAYSVWLFIGIAVVMLPYALFRDGREVIPAMQRFWQRGLAGGALQFLSYGIAIWAMTAAPIAVVATLRETSVLFGAVIAVVVLKEPLRAVRIIAACLIVFGLILIRLQ

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
9 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
10 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
11 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
15 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
20 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
21 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
22 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
23 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
54 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
60 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
63 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
69 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
70 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
79 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
94 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
99 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
100 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
101 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
102 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
103 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
111 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
112 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
113 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
114 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
115 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
116 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
117 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
122 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
123 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
124 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
125 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
134 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
135 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
136 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
137 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
141 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
142 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
143 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
144 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
145 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
146 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
147 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
148 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
149 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
150 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
151 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
152 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
153 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
154 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
155 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
156 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
157 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
229 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
233 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
234 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
235 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
236 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
237 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
238 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
239 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
240 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
241 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
242 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
243 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
244 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
245 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
246 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
247 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
248 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
249 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
250 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
251 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
253 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
255 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
256 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
257 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
258 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
259 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
260 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
261 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
262 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
263 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
264 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
265 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
266 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
267 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
268 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
269 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
270 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
271 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
272 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
273 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
274 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
275 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
276 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
277 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
278 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
279 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
280 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
281 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
282 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
283 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
284 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
285 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
286 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
287 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
288 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
289 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
290 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
291 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
292 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
293 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
294 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
295 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
296 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
297 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
298 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
299 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
300 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
301 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
302 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
303 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
304 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
305 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
306 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
307 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
308 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
309 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
310 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
311 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
312 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
313 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
314 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
315 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
316 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
317 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
318 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
319 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
320 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
321 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
322 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
323 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
324 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
325 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
326 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
327 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
328 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
329 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
330 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
331 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
332 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
333 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
334 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
335 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
336 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
337 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
338 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
339 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
340 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
341 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
342 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
343 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
344 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
345 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
346 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
347 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
348 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
349 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
350 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
351 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
352 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
353 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
354 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
355 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
356 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
357 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
358 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
359 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
372 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
373 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
374 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
375 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
376 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
377 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
378 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
379 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
380 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
381 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
382 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
383 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
384 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
385 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
387 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
388 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
389 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
390 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
391 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
392 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
393 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
394 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
395 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
396 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
397 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
398 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
399 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
400 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
401 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
402 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
403 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
404 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
405 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
406 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
407 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
408 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 0
Rhizoplane 10.67
Rhizosphere 88.08
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214745210 2209111006 Bacteria 15141
2 ARcpr5oldR_c000144 3300000041 Bacteria 12262
3 ARSoilYngRDRAFT_c00009 3300000042 Bacteria 30468
4 ARcpr5yngRDRAFT_c000006 3300000043 Bacteria 44193
5 ARSoilOldRDRAFT_c000102 3300000044 Bacteria 16000
6 ARCol0oldRDRAFT_c00372 3300000045 Bacteria 4333
7 ARCol0yngRDRAFT_1000031 3300000652 Bacteria 25026
8 JGI24032J14994_100083 3300001430 Bacteria 4098
9 JGI24752J21851_1003042 3300001976 Bacteria 2222
10 JGI24746J21847_1002186 3300001977 Bacteria 3125
11 JGI24747J21853_1006367 3300001978 Bacteria 1115
12 JGI24739J22299_10001142 3300001989 Bacteria 9904
13 JGI24739J22299_10001990 3300001989 Bacteria 7825
14 JGI24737J22298_10001546 3300001990 Bacteria 8175
15 JGI24737J22298_10010151 3300001990 Unclassified 3117
16 JGI24743J22301_10026307 3300001991 Bacteria 1132
17 JGI24750J21931_1000491 3300002070 Bacteria 6207
18 JGI24738J21930_10000010 3300002075 Bacteria 37976
19 JGI24749J21850_1000579 3300002076 Bacteria 5347
20 JGI24744J21845_10006762 3300002077 Bacteria 2373
21 JGI24035J26624_1000653 3300002126 Bacteria 3209
22 JGI24033J26618_1000465 3300002155 Bacteria 3989
23 JGI24034J26672_10000494 3300002239 Bacteria 5114
24 JGI24742J22300_10000278 3300002244 Bacteria 7696
25 Ga0065717_1001969 3300005276 Bacteria 4623
26 Ga0065704_10076177 3300005289 Bacteria 5232
27 Ga0065712_10010165 3300005290 Unclassified 3514
28 Ga0065712_10082229 3300005290 Bacteria 2930
29 Ga0065712_10170888 3300005290 Bacteria 1244
30 Ga0065715_10089173 3300005293 Bacteria 13131
31 Ga0065715_10120090 3300005293 Bacteria 2267
32 Ga0070658_10026708 3300005327 Bacteria 4634
33 Ga0070676_10000978 3300005328 Bacteria 14208
34 Ga0070676_10090580 3300005328 Bacteria 1873
35 Ga0070683_100001166 3300005329 Bacteria 19905
36 Ga0070683_100215473 3300005329 Unclassified 1824
37 Ga0070690_100001038 3300005330 Bacteria 14220
38 Ga0070690_100015198 3300005330 Bacteria 4586
39 Ga0070690_100029526 3300005330 Bacteria 3402
40 Ga0070690_100042920 3300005330 Bacteria 2865
41 Ga0070670_100003635 3300005331 Bacteria 12843
42 Ga0070670_100012172 3300005331 Bacteria 7359
43 Ga0070670_100294418 3300005331 Unclassified 1419
44 Ga0070677_10000126 3300005333 Bacteria 25482
45 Ga0068869_100002872 3300005334 Bacteria 10456
46 Ga0068869_100122501 3300005334 Bacteria 1990
47 Ga0068869_100555603 3300005334 Bacteria 965
48 Ga0070666_10007115 3300005335 Bacteria 6901
49 Ga0070666_10042300 3300005335 Bacteria 3048
50 Ga0070680_100003349 3300005336 Bacteria 11958
51 Ga0070680_100008343 3300005336 Bacteria 7929
52 Ga0070680_100041804 3300005336 Bacteria 3717
53 Ga0070680_100069911 3300005336 Bacteria 2883
54 Ga0070682_100000641 3300005337 Bacteria 21233
55 Ga0068868_100003027 3300005338 Bacteria 11693
56 Ga0070660_100002411 3300005339 Bacteria 12843
57 Ga0070660_100034540 3300005339 Bacteria 3822
58 Ga0070660_100049153 3300005339 Bacteria 3241
59 Ga0070660_100204578 3300005339 Bacteria 1602
60 Ga0070689_100004089 3300005340 Bacteria 9825
61 Ga0070689_100004527 3300005340 Bacteria 9413
62 Ga0070689_100040803 3300005340 Bacteria 3559
63 Ga0070691_10049070 3300005341 Bacteria 2010
64 Ga0070687_100000085 3300005343 Bacteria 30647
65 Ga0070687_100028353 3300005343 Bacteria 2715
66 Ga0070661_100000307 3300005344 Bacteria 39479
67 Ga0070661_100025875 3300005344 Bacteria 4217
68 Ga0070661_100105180 3300005344 Unclassified 2103
69 Ga0070661_100405484 3300005344 Bacteria 1078
70 Ga0070692_10003918 3300005345 Bacteria 6137
71 Ga0070692_10035591 3300005345 Bacteria 2522
72 Ga0070668_100001248 3300005347 Bacteria 18134
73 Ga0070668_100054836 3300005347 Bacteria 3076
74 Ga0070669_100000571 3300005353 Bacteria 27367
75 Ga0070675_100008609 3300005354 Bacteria 7923
76 Ga0070675_100020365 3300005354 Bacteria 5295
77 Ga0070675_100063073 3300005354 Bacteria 3063
78 Ga0070675_100246924 3300005354 Unclassified 1561
79 Ga0070671_100000104 3300005355 Bacteria 53922
80 Ga0070671_100072021 3300005355 Unclassified 2885
81 Ga0070674_100000238 3300005356 Bacteria 27260
82 Ga0070674_100035821 3300005356 Bacteria 3326
83 Ga0070674_100066460 3300005356 Bacteria 2534
84 Ga0070673_100000152 3300005364 Bacteria 33183
85 Ga0070673_100118963 3300005364 Bacteria 2200
86 Ga0070673_100136582 3300005364 Bacteria 2064
87 Ga0070688_100005902 3300005365 Bacteria 6485
88 Ga0070688_100008100 3300005365 Bacteria 5693
89 Ga0070688_100039619 3300005365 Bacteria 2884
90 Ga0070659_100000551 3300005366 Bacteria 27372
91 Ga0070659_100053119 3300005366 Unclassified 3189
92 Ga0070667_100009897 3300005367 Bacteria 7904
93 Ga0070667_100031049 3300005367 Bacteria 4454
94 Ga0070667_100054697 3300005367 Unclassified 3370
95 Ga0070667_100326336 3300005367 Bacteria 1386
96 Ga0070703_10004978 3300005406 Bacteria 3708
97 Ga0070709_10062929 3300005434 Bacteria 2367
98 Ga0070714_100045087 3300005435 Bacteria 3735
99 Ga0070714_100045879 3300005435 Bacteria 3705
100 Ga0070714_100151122 3300005435 Bacteria 2093
101 Ga0070714_100164539 3300005435 Unclassified 2009
102 Ga0070713_100007389 3300005436 Bacteria 7708
103 Ga0070713_100099207 3300005436 Bacteria 2519
104 Ga0070713_100135912 3300005436 Unclassified 2172
105 Ga0070713_100456005 3300005436 Unclassified 1201
106 Ga0070710_10041960 3300005437 Bacteria 2528
107 Ga0070710_10070468 3300005437 Bacteria 2014
108 Ga0070710_10103898 3300005437 Bacteria 1696
109 Ga0070701_10087275 3300005438 Bacteria 1702
110 Ga0070701_10190757 3300005438 Bacteria 1206
111 Ga0070711_100158736 3300005439 Unclassified 1712
112 Ga0070711_100165148 3300005439 Unclassified 1682
113 Ga0070711_100300453 3300005439 Unclassified 1276
114 Ga0070705_100000148 3300005440 Bacteria 41687
115 Ga0070705_100066789 3300005440 Bacteria 2158
116 Ga0070705_100286652 3300005440 Bacteria 1173
117 Ga0070705_100349918 3300005440 Bacteria 1077
118 Ga0070700_100000277 3300005441 Bacteria 27391
119 Ga0070700_100031131 3300005441 Bacteria 3194
120 Ga0070694_100001507 3300005444 Bacteria 13661
121 Ga0070694_100016824 3300005444 Bacteria 4610
122 Ga0070694_100021063 3300005444 Bacteria 4161
123 Ga0070694_100073471 3300005444 Unclassified 2362
124 Ga0070708_100027462 3300005445 Bacteria 4884
125 Ga0070663_100000522 3300005455 Bacteria 20244
126 Ga0070663_100017769 3300005455 Bacteria 4649
127 Ga0070663_100028232 3300005455 Unclassified 3818
128 Ga0070663_100494731 3300005455 Bacteria 1014
129 Ga0070678_100000718 3300005456 Bacteria 16435
130 Ga0070678_100011460 3300005456 Bacteria 5470
131 Ga0070678_100042025 3300005456 Bacteria 3246
132 Ga0070662_100001666 3300005457 Bacteria 13661
133 Ga0070662_100015894 3300005457 Bacteria 5047
134 Ga0070662_100060423 3300005457 Bacteria 2764
135 Ga0070681_10014569 3300005458 Bacteria 7825
136 Ga0070681_10052540 3300005458 Bacteria 4064
137 Ga0070681_10306708 3300005458 Bacteria 1497
138 Ga0070681_10320548 3300005458 Bacteria 1459
139 Ga0068867_100006623 3300005459 Bacteria 8186
140 Ga0068867_100012024 3300005459 Bacteria 6112
141 Ga0070685_10002221 3300005466 Bacteria 10015
142 Ga0070685_10004005 3300005466 Bacteria 7442
143 Ga0070685_10024466 3300005466 Bacteria 3317
144 Ga0070706_100147399 3300005467 Bacteria 2198
145 Ga0070699_100011505 3300005518 Bacteria 7639
146 Ga0070699_100320219 3300005518 Bacteria 1394
147 Ga0070679_100014561 3300005530 Bacteria 7557
148 Ga0070679_100082633 3300005530 Bacteria 3202
149 Ga0070679_100397378 3300005530 Bacteria 1324
150 Ga0070684_100000894 3300005535 Bacteria 21105
151 Ga0070684_100127730 3300005535 Bacteria 2291
152 Ga0070684_100224857 3300005535 Bacteria 1713
153 Ga0070684_100750412 3300005535 Bacteria 911
154 Ga0070697_100023189 3300005536 Bacteria 4935
155 Ga0070697_100174431 3300005536 Bacteria 1821
156 Ga0068853_100020627 3300005539 Bacteria 5480
157 Ga0068853_100191830 3300005539 Bacteria 1857
158 Ga0068853_100209643 3300005539 Bacteria 1776
159 Ga0070672_100000088 3300005543 Bacteria 44394
160 Ga0070672_100172591 3300005543 Bacteria 1799
161 Ga0070686_100000719 3300005544 Bacteria 19252
162 Ga0070686_100028453 3300005544 Bacteria 3390
163 Ga0070686_100029585 3300005544 Bacteria 3333
164 Ga0070686_100040116 3300005544 Bacteria 2920
165 Ga0070696_100020775 3300005546 Bacteria 4448
166 Ga0070696_100068057 3300005546 Bacteria 2499
167 Ga0070696_100227825 3300005546 Bacteria 1401
168 Ga0070693_100000134 3300005547 Bacteria 33408
169 Ga0070693_100151858 3300005547 Bacteria 1468
170 Ga0070665_100032403 3300005548 Bacteria 5259
171 Ga0070665_100144488 3300005548 Bacteria 2382
172 Ga0070665_100352336 3300005548 Bacteria 1478
173 Ga0070665_100469798 3300005548 Bacteria 1268
174 Ga0070704_100000428 3300005549 Bacteria 19609
175 Ga0070704_100027693 3300005549 Unclassified 3762
176 Ga0068855_100007545 3300005563 Bacteria 13158
177 Ga0068855_100031321 3300005563 Bacteria 6351
178 Ga0068855_100127457 3300005563 Bacteria 2909
179 Ga0068855_100203384 3300005563 Bacteria 2229
180 Ga0068855_100634939 3300005563 Bacteria 1148
181 Ga0070664_100002234 3300005564 Bacteria 15585
182 Ga0070664_100045631 3300005564 Bacteria 3701
183 Ga0070664_100097454 3300005564 Bacteria 2553
184 Ga0070664_100121692 3300005564 Unclassified 2286
185 Ga0068857_100002935 3300005577 Bacteria 14058
186 Ga0068857_100708826 3300005577 Bacteria 957
187 Ga0068854_100308029 3300005578 Bacteria 1284
188 Ga0068856_100002000 3300005614 Bacteria 21261
189 Ga0068856_100307550 3300005614 Bacteria 1603
190 Ga0070702_100000638 3300005615 Bacteria 12987
191 Ga0070702_100002467 3300005615 Bacteria 7998
192 Ga0070702_100011329 3300005615 Bacteria 4432
193 Ga0070702_100023246 3300005615 Bacteria 3291
194 Ga0068852_100002115 3300005616 Bacteria 13595
195 Ga0068852_100077859 3300005616 Bacteria 2932
196 Ga0068859_100021325 3300005617 Bacteria 6500
197 Ga0068859_100080532 3300005617 Bacteria 3297
198 Ga0068859_100243543 3300005617 Unclassified 1888
199 Ga0068864_100014592 3300005618 Bacteria 6526
200 Ga0068866_10000301 3300005718 Bacteria 23583
201 Ga0068866_10002757 3300005718 Bacteria 7244
202 Ga0068866_10124413 3300005718 Bacteria 1458
203 Ga0068861_100016840 3300005719 Bacteria 5179
204 Ga0068861_100018418 3300005719 Bacteria 4975
205 Ga0068851_10058471 3300005834 Bacteria 1970
206 Ga0068870_10000354 3300005840 Bacteria 17200
207 Ga0068870_10001545 3300005840 Bacteria 9356
208 Ga0068863_100000340 3300005841 Bacteria 47641
209 Ga0068863_100018623 3300005841 Bacteria 6643
210 Ga0068863_100272427 3300005841 Bacteria 1639
211 Ga0068858_100000295 3300005842 Bacteria 53892
212 Ga0068858_100011371 3300005842 Bacteria 8405
213 Ga0068858_100025797 3300005842 Bacteria 5467
214 Ga0068858_100128333 3300005842 Bacteria 2376
215 Ga0068858_100160619 3300005842 Bacteria 2116
216 Ga0068860_100001285 3300005843 Bacteria 27247
217 Ga0068860_100084443 3300005843 Bacteria 3021
218 Ga0068862_100003236 3300005844 Bacteria 14093
219 Ga0068862_100012543 3300005844 Bacteria 7016
220 Ga0081455_10000007 3300005937 Bacteria 269394
221 Ga0081455_10001479 3300005937 Bacteria 29079
222 Ga0081455_10009018 3300005937 Bacteria 10296
223 Ga0081455_10017104 3300005937 Bacteria 6968
224 Ga0081455_10033388 3300005937 Bacteria 4625
225 Ga0081455_10143080 3300005937 Bacteria 1854
226 Ga0081538_10022998 3300005981 Bacteria 4493
227 Ga0070717_10007640 3300006028 Bacteria 8037
228 Ga0075365_10022333 3300006038 Bacteria 3964
229 Ga0075432_10000272 3300006058 Bacteria 14285
230 Ga0075432_10094683 3300006058 Bacteria 1097
231 Ga0070715_10005495 3300006163 Bacteria 4230
232 Ga0070716_100148747 3300006173 Bacteria 1503
233 Ga0070716_100251765 3300006173 Bacteria 1204
234 Ga0070712_100028432 3300006175 Bacteria 3740
235 Ga0070712_100061683 3300006175 Unclassified 2649
236 Ga0070712_100204349 3300006175 Bacteria 1554
237 Ga0075367_10049729 3300006178 Bacteria 2472
238 Ga0075366_10028947 3300006195 Bacteria 3252
239 Ga0097621_100000040 3300006237 Bacteria 66339
240 Ga0097621_100022646 3300006237 Bacteria 4879
241 Ga0097621_100053322 3300006237 Bacteria 3296
242 Ga0075370_10040679 3300006353 Bacteria 2622
243 Ga0068871_100000301 3300006358 Bacteria 34368
244 Ga0075428_100003180 3300006844 Bacteria 17952
245 Ga0075428_100015358 3300006844 Bacteria 8491
246 Ga0075428_100045005 3300006844 Bacteria 4850
247 Ga0075428_100100352 3300006844 Bacteria 3156
248 Ga0075428_100416948 3300006844 Bacteria 1439
249 Ga0075430_100000201 3300006846 Bacteria 40551
250 Ga0075431_100000260 3300006847 Bacteria 40551
251 Ga0075431_100329512 3300006847 Bacteria 1538
252 Ga0075431_100509470 3300006847 Bacteria 1194
253 Ga0075433_10000007 3300006852 Bacteria 75995
254 Ga0075433_10006753 3300006852 Bacteria 9093
255 Ga0075433_10009620 3300006852 Bacteria 7735
256 Ga0075433_10492088 3300006852 Bacteria 1080
257 Ga0075434_100000091 3300006871 Bacteria 49489
258 Ga0075434_100019587 3300006871 Bacteria 6551
259 Ga0075434_100067068 3300006871 Bacteria 3575
260 Ga0075434_100094300 3300006871 Bacteria 2998
261 Ga0075434_100183234 3300006871 Bacteria 2115
262 Ga0075429_100001824 3300006880 Bacteria 17627
263 Ga0068865_100000275 3300006881 Bacteria 28270
264 Ga0068865_100024369 3300006881 Bacteria 3969
265 Ga0068865_100050689 3300006881 Unclassified 2869
266 Ga0068865_100100150 3300006881 Bacteria 2120
267 Ga0075436_100039496 3300006914 Bacteria 3257
268 Ga0075436_100107605 3300006914 Bacteria 1945
269 Ga0097620_100021325 3300006931 Bacteria 6500
270 Ga0097620_100080540 3300006931 Bacteria 3297
271 Ga0097620_100243538 3300006931 Unclassified 1888
272 Ga0075435_100017727 3300007076 Bacteria 5396
273 Ga0075435_100040818 3300007076 Bacteria 3707
274 Ga0075435_100286057 3300007076 Bacteria 1408
275 Ga0099794_10046157 3300007265 Bacteria 2086
276 Ga0105251_10020085 3300009011 Bacteria 3515
277 Ga0105244_10133680 3300009036 Bacteria 1196
278 Ga0105250_10018576 3300009092 Bacteria 2815
279 Ga0105240_10646330 3300009093 Bacteria 1160
280 Ga0105240_10743379 3300009093 Bacteria 1067
281 Ga0111539_10000394 3300009094 Bacteria 54170
282 Ga0111539_10001672 3300009094 Bacteria 29559
283 Ga0111539_10017527 3300009094 Bacteria 8865
284 Ga0111539_10040786 3300009094 Bacteria 5586
285 Ga0111539_10109172 3300009094 Bacteria 3247
286 Ga0111539_10187414 3300009094 Bacteria 2416
287 Ga0111539_10409500 3300009094 Bacteria 1579
288 Ga0111539_10828611 3300009094 Unclassified 1076
289 Ga0105245_10000462 3300009098 Bacteria 37242
290 Ga0105245_10020090 3300009098 Bacteria 5855
291 Ga0105245_10350384 3300009098 Bacteria 1463
292 Ga0105247_10001920 3300009101 Bacteria 14500
293 Ga0105247_10022379 3300009101 Bacteria 3807
294 Ga0105247_10309243 3300009101 Bacteria 1099
295 Ga0114129_10001111 3300009147 Bacteria 35464
296 Ga0114129_10003047 3300009147 Bacteria 23477
297 Ga0114129_10007767 3300009147 Bacteria 15259
298 Ga0114129_10069532 3300009147 Bacteria 4908
299 Ga0114129_10991037 3300009147 Bacteria 1059
300 Ga0105243_10000282 3300009148 Bacteria 56666
301 Ga0105243_10030614 3300009148 Bacteria 4145
302 Ga0105243_10033566 3300009148 Bacteria 3969
303 Ga0105243_10123865 3300009148 Bacteria 2184
304 Ga0105241_10000652 3300009174 Bacteria 26004
305 Ga0105242_10011119 3300009176 Bacteria 6917
306 Ga0105242_10298969 3300009176 Bacteria 1468
307 Ga0105248_10011410 3300009177 Bacteria 9793
308 Ga0105248_10027731 3300009177 Bacteria 6306
309 Ga0105248_10093852 3300009177 Bacteria 3380
310 Ga0105248_10262268 3300009177 Bacteria 1945
311 Ga0105237_10043527 3300009545 Bacteria 4522
312 Ga0105237_10237597 3300009545 Bacteria 1823
313 Ga0105238_10713221 3300009551 Bacteria 1015
314 Ga0105249_10001210 3300009553 Bacteria 22796
315 Ga0105249_10071575 3300009553 Bacteria 3204
316 Ga0105249_10153953 3300009553 Bacteria 2216
317 Ga0105249_10173060 3300009553 Bacteria 2095
318 Ga0105249_10332376 3300009553 Bacteria 1534
319 Ga0105239_10028214 3300010375 Bacteria 6174
320 Ga0105239_10067368 3300010375 Bacteria 3933
321 Ga0105239_10154111 3300010375 Bacteria 2565
322 Ga0105239_10486636 3300010375 Unclassified 1402
323 Ga0105246_10009002 3300011119 Bacteria 6147
324 Ga0105246_10026829 3300011119 Bacteria 3769
325 Ga0105246_10122864 3300011119 Bacteria 1926
326 Ga0157346_1000445 3300012480 Bacteria 1749
327 Ga0157373_10010359 3300013100 Bacteria 6863
328 Ga0157371_10019421 3300013102 Bacteria 5014
329 Ga0157370_10164555 3300013104 Bacteria 2063
330 Ga0157374_10006038 3300013296 Bacteria 10248
331 Ga0157374_10120686 3300013296 Bacteria 2530
332 Ga0157374_10148398 3300013296 Unclassified 2279
333 Ga0157374_10195927 3300013296 Bacteria 1977
334 Ga0157378_10000270 3300013297 Bacteria 50517
335 Ga0157378_10494906 3300013297 Bacteria 1220
336 Ga0163162_10000145 3300013306 Bacteria 65191
337 Ga0163162_10143726 3300013306 Bacteria 2500
338 Ga0157372_10012191 3300013307 Bacteria 9156
339 Ga0157372_10254765 3300013307 Bacteria 2038
340 Ga0157375_10000332 3300013308 Bacteria 42513
341 Ga0157375_10009000 3300013308 Bacteria 8739
342 Ga0157375_10049349 3300013308 Bacteria 4123
343 Ga0157375_10748389 3300013308 Bacteria 1129
344 Ga0163163_10000865 3300014325 Bacteria 25811
345 Ga0163163_10005560 3300014325 Bacteria 10916
346 Ga0163163_10069639 3300014325 Bacteria 3502
347 Ga0163163_10768790 3300014325 Bacteria 1027
348 Ga0157380_10000891 3300014326 Bacteria 18753
349 Ga0157380_10059658 3300014326 Bacteria 3045
350 Ga0157380_10473230 3300014326 Bacteria 1209
351 Ga0157377_10000137 3300014745 Bacteria 46698
352 Ga0157377_10039626 3300014745 Bacteria 2607
353 Ga0157377_10128440 3300014745 Bacteria 1545
354 Ga0157379_10001761 3300014968 Bacteria 17895
355 Ga0157379_10012181 3300014968 Bacteria 7512
356 Ga0157379_10032861 3300014968 Unclassified 4626
357 Ga0157379_10071950 3300014968 Bacteria 3093
358 Ga0157376_10000088 3300014969 Bacteria 70084
359 Ga0157376_10083873 3300014969 Bacteria 2742
360 Ga0157376_10270273 3300014969 Bacteria 1597
361 Ga0157376_10422725 3300014969 Bacteria 1294
362 Ga0163161_10000144 3300017792 Bacteria 64771
363 Ga0163161_10049602 3300017792 Bacteria 3034
364 Ga0213876_10026729 3300021384 Bacteria 3044
365 Ga0228598_1007345 3300024227 Bacteria 2246
366 Ga0207666_1000048 3300025271 Bacteria 23535
367 Ga0207666_1000627 3300025271 Bacteria 4229
368 Ga0207697_10003423 3300025315 Bacteria 7856
369 Ga0207697_10014016 3300025315 Bacteria 3337
370 Ga0207713_1061801 3300025735 Unclassified 1423
371 Ga0207653_10015888 3300025885 Bacteria 2362
372 Ga0207653_10034319 3300025885 Bacteria 1648
373 Ga0207682_10000509 3300025893 Bacteria 17874
374 Ga0207692_10007140 3300025898 Bacteria 4565
375 Ga0207692_10052953 3300025898 Bacteria 2065
376 Ga0207692_10058464 3300025898 Bacteria 1986
377 Ga0207642_10000762 3300025899 Bacteria 9965
378 Ga0207642_10006361 3300025899 Bacteria 3921
379 Ga0207710_10003986 3300025900 Bacteria 6510
380 Ga0207688_10000033 3300025901 Bacteria 46898
381 Ga0207688_10004167 3300025901 Bacteria 7880
382 Ga0207680_10030693 3300025903 Bacteria 3035
383 Ga0207680_10035788 3300025903 Bacteria 2854
384 Ga0207680_10262312 3300025903 Bacteria 1196
385 Ga0207647_10020884 3300025904 Bacteria 4383
386 Ga0207699_10008794 3300025906 Bacteria 5000
387 Ga0207699_10186194 3300025906 Bacteria 1398
388 Ga0207645_10000100 3300025907 Bacteria 64057
389 Ga0207645_10087683 3300025907 Bacteria 2000
390 Ga0207643_10000007 3300025908 Bacteria 171706
391 Ga0207643_10000671 3300025908 Bacteria 21326
392 Ga0207705_10061675 3300025909 Bacteria 2708
393 Ga0207684_10023683 3300025910 Bacteria 5241
394 Ga0207654_10000314 3300025911 Bacteria 29106
395 Ga0207654_10152486 3300025911 Bacteria 1485
396 Ga0207707_10037222 3300025912 Bacteria 4251
397 Ga0207707_10079630 3300025912 Bacteria 2861
398 Ga0207707_10121335 3300025912 Bacteria 2285
399 Ga0207707_10216102 3300025912 Bacteria 1669
400 Ga0207707_10323939 3300025912 Bacteria 1330
401 Ga0207695_10146209 3300025913 Bacteria 2308
402 Ga0207671_10025600 3300025914 Bacteria 4431
403 Ga0207671_10095297 3300025914 Bacteria 2247
404 Ga0207693_10007799 3300025915 Bacteria 8785
405 Ga0207693_10026013 3300025915 Bacteria 4634
406 Ga0207693_10037280 3300025915 Bacteria 3832
407 Ga0207693_10042697 3300025915 Unclassified 3569
408 Ga0207663_10033165 3300025916 Bacteria 3073
409 Ga0207663_10122808 3300025916 Unclassified 1781
410 Ga0207663_10148936 3300025916 Bacteria 1639
411 Ga0207660_10000041 3300025917 Bacteria 63485
412 Ga0207660_10015546 3300025917 Bacteria 5024
413 Ga0207660_10032163 3300025917 Bacteria 3619
414 Ga0207660_10130351 3300025917 Bacteria 1913
415 Ga0207660_10165018 3300025917 Bacteria 1711
416 Ga0207660_10443574 3300025917 Bacteria 1049
417 Ga0207662_10000282 3300025918 Bacteria 23540
418 Ga0207662_10004598 3300025918 Bacteria 7276
419 Ga0207662_10018861 3300025918 Bacteria 3918
420 Ga0207662_10053389 3300025918 Bacteria 2408
421 Ga0207657_10009921 3300025919 Bacteria 9530
422 Ga0207657_10013952 3300025919 Bacteria 7861
423 Ga0207657_10022759 3300025919 Bacteria 5853
424 Ga0207657_10030177 3300025919 Bacteria 4925
425 Ga0207657_10046445 3300025919 Bacteria 3803
426 Ga0207657_10076831 3300025919 Bacteria 2816
427 Ga0207649_10001482 3300025920 Bacteria 13783
428 Ga0207649_10077097 3300025920 Bacteria 2147
429 Ga0207649_10097948 3300025920 Bacteria 1935
430 Ga0207649_10501719 3300025920 Bacteria 923
431 Ga0207652_10002995 3300025921 Bacteria 14105
432 Ga0207652_10049186 3300025921 Bacteria 3608
433 Ga0207652_10077001 3300025921 Bacteria 2909
434 Ga0207652_10229057 3300025921 Unclassified 1675
435 Ga0207652_10229888 3300025921 Bacteria 1671
436 Ga0207652_10426192 3300025921 Bacteria 1196
437 Ga0207652_10428879 3300025921 Bacteria 1192
438 Ga0207681_10001546 3300025923 Bacteria 14821
439 Ga0207681_10412728 3300025923 Bacteria 1092
440 Ga0207694_10273369 3300025924 Bacteria 1386
441 Ga0207694_10344105 3300025924 Unclassified 1233
442 Ga0207650_10001317 3300025925 Bacteria 17984
443 Ga0207650_10015921 3300025925 Bacteria 5246
444 Ga0207659_10005767 3300025926 Bacteria 7546
445 Ga0207659_10019879 3300025926 Bacteria 4429
446 Ga0207659_10045708 3300025926 Bacteria 3089
447 Ga0207687_10000072 3300025927 Bacteria 76222
448 Ga0207687_10029549 3300025927 Bacteria 3688
449 Ga0207687_10105562 3300025927 Bacteria 2082
450 Ga0207687_10447810 3300025927 Bacteria 1070
451 Ga0207700_10001532 3300025928 Bacteria 13089
452 Ga0207700_10014414 3300025928 Bacteria 5179
453 Ga0207700_10062990 3300025928 Bacteria 2819
454 Ga0207664_10016973 3300025929 Bacteria 5325
455 Ga0207664_10092306 3300025929 Bacteria 2485
456 Ga0207664_10139891 3300025929 Unclassified 2046
457 Ga0207664_10326158 3300025929 Bacteria 1355
458 Ga0207644_10001292 3300025931 Bacteria 16118
459 Ga0207644_10221613 3300025931 Bacteria 1499
460 Ga0207690_10000140 3300025932 Bacteria 58923
461 Ga0207690_10070065 3300025932 Bacteria 2414
462 Ga0207690_10383322 3300025932 Bacteria 1118
463 Ga0207706_10002144 3300025933 Bacteria 19302
464 Ga0207706_10012048 3300025933 Bacteria 7880
465 Ga0207706_10042505 3300025933 Unclassified 4028
466 Ga0207706_10109084 3300025933 Bacteria 2436
467 Ga0207686_10001034 3300025934 Bacteria 16473
468 Ga0207686_10120810 3300025934 Bacteria 1783
469 Ga0207709_10001423 3300025935 Bacteria 16760
470 Ga0207709_10015190 3300025935 Bacteria 4268
471 Ga0207670_10005263 3300025936 Bacteria 7084
472 Ga0207670_10015623 3300025936 Bacteria 4541
473 Ga0207670_10066092 3300025936 Bacteria 2483
474 Ga0207669_10000176 3300025937 Bacteria 29979
475 Ga0207704_10000086 3300025938 Bacteria 54866
476 Ga0207704_10009100 3300025938 Bacteria 4776
477 Ga0207665_10000872 3300025939 Bacteria 20402
478 Ga0207665_10135014 3300025939 Bacteria 1755
479 Ga0207665_10159348 3300025939 Bacteria 1622
480 Ga0207665_10207106 3300025939 Bacteria 1431
481 Ga0207691_10000214 3300025940 Bacteria 56205
482 Ga0207691_10003307 3300025940 Bacteria 15702
483 Ga0207711_10001106 3300025941 Bacteria 25759
484 Ga0207711_10006359 3300025941 Bacteria 9959
485 Ga0207711_10036936 3300025941 Bacteria 4146
486 Ga0207689_10000366 3300025942 Bacteria 42711
487 Ga0207689_10114162 3300025942 Bacteria 2220
488 Ga0207689_10505602 3300025942 Bacteria 1013
489 Ga0207661_10000087 3300025944 Bacteria 63263
490 Ga0207661_10470341 3300025944 Bacteria 1147
491 Ga0207679_10000029 3300025945 Bacteria 183002
492 Ga0207679_10061554 3300025945 Bacteria 2794
493 Ga0207679_10090278 3300025945 Unclassified 2368
494 Ga0207667_10009257 3300025949 Bacteria 11628
495 Ga0207667_10255367 3300025949 Bacteria 1793
496 Ga0207667_10345730 3300025949 Bacteria 1517
497 Ga0207651_10000264 3300025960 Bacteria 22299
498 Ga0207651_10355951 3300025960 Bacteria 1234
499 Ga0207651_10411686 3300025960 Unclassified 1152
500 Ga0207712_10001547 3300025961 Bacteria 15511
501 Ga0207712_10013434 3300025961 Bacteria 5249
502 Ga0207712_10584713 3300025961 Unclassified 964
503 Ga0207668_10005954 3300025972 Bacteria 7187
504 Ga0207640_10001474 3300025981 Bacteria 12692
505 Ga0207640_10046782 3300025981 Bacteria 2787
506 Ga0207658_10034469 3300025986 Bacteria 3618
507 Ga0207658_10274950 3300025986 Bacteria 1441
508 Ga0207658_10754531 3300025986 Bacteria 881
509 Ga0207677_10001187 3300026023 Bacteria 14156
510 Ga0207677_10403070 3300026023 Bacteria 1160
511 Ga0207703_10003109 3300026035 Bacteria 14015
512 Ga0207703_10030388 3300026035 Bacteria 4269
513 Ga0207703_10262331 3300026035 Bacteria 1562
514 Ga0207639_10012878 3300026041 Bacteria 5836
515 Ga0207639_10096051 3300026041 Unclassified 2383
516 Ga0207639_10204912 3300026041 Bacteria 1694
517 Ga0207678_10011175 3300026067 Bacteria 7885
518 Ga0207678_10012004 3300026067 Bacteria 7608
519 Ga0207678_10038765 3300026067 Bacteria 4138
520 Ga0207678_10051057 3300026067 Bacteria 3571
521 Ga0207708_10000124 3300026075 Bacteria 59953
522 Ga0207708_10007956 3300026075 Bacteria 7856
523 Ga0207708_10025817 3300026075 Bacteria 4445
524 Ga0207641_10000476 3300026088 Bacteria 45413
525 Ga0207641_10183043 3300026088 Bacteria 1920
526 Ga0207648_10000072 3300026089 Bacteria 94957
527 Ga0207676_10000512 3300026095 Bacteria 32630
528 Ga0207674_10000697 3300026116 Bacteria 43729
529 Ga0207674_10228157 3300026116 Bacteria 1810
530 Ga0207674_10570773 3300026116 Bacteria 1093
531 Ga0207675_100005225 3300026118 Bacteria 12497
532 Ga0207675_100030237 3300026118 Bacteria 5044
533 Ga0207675_100171642 3300026118 Bacteria 2073
534 Ga0207683_10000029 3300026121 Bacteria 109665
535 Ga0207683_10010209 3300026121 Bacteria 8009
536 Ga0207683_10049139 3300026121 Bacteria 3692
537 Ga0207683_10058105 3300026121 Bacteria 3396
538 Ga0207698_10000523 3300026142 Bacteria 22323
539 Ga0207698_10006814 3300026142 Bacteria 7145
540 Ga0207698_10105850 3300026142 Bacteria 2345
541 Ga0209973_1002360 3300027252 Unclassified 1760
542 Ga0210002_1000355 3300027617 Bacteria 6256
543 Ga0209966_1012566 3300027695 Bacteria 1557
544 Ga0209998_10002116 3300027717 Bacteria 4622
545 Ga0209974_10002631 3300027876 Bacteria 6512
546 Ga0209974_10037946 3300027876 Bacteria 1600
547 Ga0207428_10000100 3300027907 Bacteria 119495
548 Ga0207428_10000115 3300027907 Bacteria 109072
549 Ga0207428_10000228 3300027907 Bacteria 77812
550 Ga0207428_10237846 3300027907 Bacteria 1361
551 Ga0268266_10127554 3300028379 Bacteria 2272
552 Ga0268266_10466338 3300028379 Bacteria 1202
553 Ga0268265_10001240 3300028380 Bacteria 22083
554 Ga0268265_10011857 3300028380 Bacteria 5892
555 Ga0268264_10002968 3300028381 Bacteria 14738
556 Ga0268264_10098649 3300028381 Bacteria 2534
557 Ga0265325_10000533 3300031241 Bacteria 27589
558 Ga0265340_10008415 3300031247 Bacteria 5574
559 Ga0265313_10010623 3300031595 Bacteria 5799
560 Ga0316579_10140845 3300031691 Bacteria 1162
561 Ga0265342_10000896 3300031712 Bacteria 29642
562 Ga0265342_10127184 3300031712 Bacteria 1430
563 Ga0373930_0000262 3300034816 Bacteria 6703
564 Ga0373930_0016837 3300034816 Bacteria 1387
565 Ga0373948_0003895 3300034817 Bacteria 2329
566 Ga0373948_0010128 3300034817 Bacteria 1640
567 Ga0373948_0024216 3300034817 Bacteria 1183
568 Ga0373950_0005031 3300034818 Bacteria 1959
569 Ga0373958_0001890 3300034819 Bacteria 2876
570 Ga0373958_0006596 3300034819 Bacteria 1814
571 Ga0373959_0003651 3300034820 Bacteria 2462
572 Ga0373959_0019894 3300034820 Bacteria 1276
573 Ga0373938_0000290 3300034957 Bacteria 8088
574 Ga0373938_0000662 3300034957 Bacteria 5520
575 Ga0373926_0090927 3300035083 Bacteria 1135
576 Ga0373928_0000789 3300035084 Bacteria 6152
577 Ga0373928_0006995 3300035084 Unclassified 2175
578 Ga0373928_0009522 3300035084 Bacteria 1897
579 Ga0373929_0002403 3300035085 Bacteria 3439
580 Ga0373929_0006971 3300035085 Bacteria 2054
581 Ga0373934_0046329 3300035086 Unclassified 1720
582 Ga0373940_0050600 3300035088 Bacteria 1166
583 Ga0373940_0071890 3300035088 Bacteria 1009
584 Ga0373949_0000938 3300035090 Bacteria 9087
585 Ga0373949_0001649 3300035090 Bacteria 6227
586 Ga0373951_0000715 3300035091 Bacteria 9107
587 Ga0373951_0005147 3300035091 Bacteria 3054
588 Ga0373951_0035857 3300035091 Bacteria 1182
589 Ga0373952_0000298 3300035092 Bacteria 8236
590 Ga0373952_0002466 3300035092 Bacteria 3339
591 Ga0373923_0054370 3300035111 Bacteria 1685
592 Ga0373932_0000172 3300035112 Bacteria 18943
593 Ga0373932_0008064 3300035112 Bacteria 2514
594 Ga0373936_0004177 3300035113 Bacteria 5443
595 Ga0373936_0059349 3300035113 Bacteria 1559
596 Ga0373936_0096497 3300035113 Bacteria 1244
597 Ga0373939_0000500 3300035114 Bacteria 9849
598 Ga0373939_0007393 3300035114 Bacteria 2668
599 Ga0373941_0001751 3300035115 Bacteria 4665
600 Ga0373941_0013482 3300035115 Bacteria 2162
601 Ga0373945_0002996 3300035116 Bacteria 5310
602 Ga0373945_0010893 3300035116 Bacteria 2999
603 Ga0373945_0076277 3300035116 Unclassified 1277
604 Ga0373953_0001475 3300035117 Bacteria 6830
605 Ga0373954_0050033 3300035118 Bacteria 1960
606 Ga0373956_0142721 3300035119 Bacteria 1125
607 Ga0373956_0181184 3300035119 Unclassified 996
608 Ga0373957_0028243 3300035120 Unclassified 2043
609 Ga0373960_0001140 3300035121 Bacteria 5759
610 Ga0373960_0001458 3300035121 Bacteria 5233
611 Ga0373943_0015808 3300035170 Bacteria 3432
612 Ga0373943_0017540 3300035170 Bacteria 3275
613 Ga0373946_0021621 3300035171 Unclassified 2496
614 Ga0373955_0011599 3300035172 Bacteria 4207
615 Ga0373955_0023581 3300035172 Bacteria 3136
616 Ga0373955_0027187 3300035172 Unclassified 2955
617 Ga0373955_0107444 3300035172 Unclassified 1610
618 Ga0373955_0129822 3300035172 Unclassified 1470
619 Ga0373942_0001552 3300035207 Bacteria 5891
620 Ga0373961_0000196 3300035241 Bacteria 28662
621 Ga0373961_0001345 3300035241 Bacteria 7386
622 Ga0373961_0003263 3300035241 Bacteria 4041
623 Ga0373962_0000310 3300035242 Bacteria 10526
624 Ga0373962_0001593 3300035242 Bacteria 5381
625 Ga0373962_0071476 3300035242 Bacteria 1038
626 Ga0373924_0027636 3300035410 Bacteria 2257
627 Ga0373924_0071717 3300035410 Unclassified 1462
628 Ga0373931_0004010 3300035691 Bacteria 6667
629 Ga0373931_0008212 3300035691 Bacteria 4946
630 Ga0373931_0031253 3300035691 Bacteria 2747
631 Ga0373931_0032881 3300035691 Bacteria 2686
632 Ga0373931_0088107 3300035691 Unclassified 1724
633 Ga0373931_0164382 3300035691 Bacteria 1303
634 Ga0373935_0012655 3300035692 Bacteria 5077
635 Ga0373935_0020024 3300035692 Bacteria 4084
636 Ga0373927_0042280 3300035695 Bacteria 2952
637 Ga0373927_0095358 3300035695 Bacteria 1933
638 Ga0373927_0444526 3300035695 Bacteria 856
639 Ga0373933_0001949 3300035724 Bacteria 11918
640 Ga0373933_0006597 3300035724 Bacteria 6325
641 Ga0373933_0008978 3300035724 Bacteria 5454
642 Ga0373933_0032120 3300035724 Unclassified 3050
643 Ga0373933_0162105 3300035724 Bacteria 1420
644 Ga0373947_0000288 3300035725 Bacteria 28482
645 Ga0373947_0008353 3300035725 Bacteria 5962
646 Ga0373947_0103872 3300035725 Bacteria 1788
647 Ga0373937_0005192 3300036401 Bacteria 11115
648 Ga0373937_0014259 3300036401 Bacteria 7014
649 Ga0373937_0025577 3300036401 Bacteria 5330
650 Ga0373937_0266689 3300036401 Bacteria 1615
651 Ga0373937_0286285 3300036401 Unclassified 1557
652 Ga0373925_0001787 3300037068 Bacteria 17936
653 Ga0373925_0007364 3300037068 Bacteria 8030
654 Ga0373925_0043674 3300037068 Unclassified 3327
655 Ga0373925_0173237 3300037068 Unclassified 1704
656 Ga0373925_0211362 3300037068 Bacteria 1545
657 Ga0395899_0223910 3300037312 Bacteria 1302
658 Ga0395898_0112889 3300037466 Bacteria 2604
659 Ga0395901_0057774 3300038443 Bacteria 4035
660 Ga0436365_1087995 3300039437 Bacteria 4307
661 Ga0439460_0007277 3300042461 Bacteria 2762
662 Ga0451577_0010248 3300042876 Bacteria 8976
663 Ga0495592_0009025 3300046454 Bacteria 7493
664 Ga0495592_0049987 3300046454 Bacteria 3107
665 Ga0495592_0262206 3300046454 Unclassified 1138
666 Ga0495603_0047130 3300046455 Bacteria 2567
667 Ga0495629_0000183 3300046459 Bacteria 56534
668 Ga0495629_0020325 3300046459 Unclassified 4742
669 Ga0495641_0016655 3300046461 Bacteria 3863
670 Ga0495641_0019503 3300046461 Unclassified 3467
671 Ga0495641_0052430 3300046461 Unclassified 1860
672 Ga0495651_0001256 3300046462 Bacteria 19642
673 Ga0495651_0004540 3300046462 Bacteria 10616
674 Ga0495651_0023671 3300046462 Bacteria 4776
675 Ga0495651_0064250 3300046462 Bacteria 2805
676 Ga0495653_0046543 3300046463 Unclassified 3359
677 Ga0495653_0057318 3300046463 Bacteria 2965
678 Ga0495653_0117328 3300046463 Bacteria 1902
679 Ga0495580_0080566 3300046472 Bacteria 2269
680 Ga0495580_0120946 3300046472 Bacteria 1818
681 Ga0495580_0123433 3300046472 Bacteria 1797
682 Ga0495582_0001748 3300046473 Bacteria 12256
683 Ga0495582_0002465 3300046473 Bacteria 10315
684 Ga0495582_0097571 3300046473 Unclassified 1643
685 Ga0495639_0015609 3300046475 Bacteria 3294
686 Ga0495662_0019936 3300046476 Unclassified 3244
687 Ga0495662_0052366 3300046476 Bacteria 1971
688 Ga0495664_0007322 3300046477 Bacteria 6125
689 Ga0495664_0007547 3300046477 Bacteria 6046
690 Ga0495664_0026199 3300046477 Bacteria 3396
691 Ga0495664_0071039 3300046477 Unclassified 2079
692 Ga0495584_0023574 3300046491 Bacteria 3120
693 Ga0495584_0065458 3300046491 Bacteria 1828
694 Ga0495585_0017046 3300046492 Bacteria 4203
695 Ga0495594_0068785 3300046499 Bacteria 1967
696 Ga0495594_0081400 3300046499 Bacteria 1808
697 Ga0495594_0087707 3300046499 Bacteria 1741
698 Ga0495607_0019505 3300046501 Bacteria 4306
699 Ga0495608_0000646 3300046511 Bacteria 24033
700 Ga0495608_0019174 3300046511 Bacteria 4711
701 Ga0495608_0073236 3300046511 Unclassified 2234
702 Ga0495618_0025077 3300046514 Bacteria 3699
703 Ga0495628_0001902 3300046516 Bacteria 18942
704 Ga0495628_0105447 3300046516 Bacteria 2171
705 Ga0495628_0246548 3300046516 Unclassified 1335
706 Ga0495630_0086143 3300046517 Bacteria 2372
707 Ga0495630_0137814 3300046517 Unclassified 1855
708 Ga0495637_0049397 3300046520 Unclassified 1768
709 Ga0495643_0132716 3300046522 Bacteria 1249
710 Ga0495644_0000234 3300046523 Bacteria 26118
711 Ga0495666_0019944 3300046526 Bacteria 3326
712 Ga0495652_0012330 3300046529 Bacteria 7715
713 Ga0495652_0039217 3300046529 Bacteria 4096
714 Ga0495652_0055115 3300046529 Bacteria 3382
715 Ga0495665_0039729 3300046531 Bacteria 2505
716 Ga0495640_0018843 3300046533 Bacteria 5107
717 Ga0495586_0102700 3300046535 Bacteria 1587
718 Ga0495587_0000770 3300046536 Bacteria 21359
719 Ga0495621_0082200 3300046539 Bacteria 1203
720 Ga0495645_0010241 3300046543 Bacteria 6569
721 Ga0495645_0067555 3300046543 Bacteria 2581
722 Ga0495645_0074432 3300046543 Bacteria 2445
723 Ga0495622_0026407 3300046557 Bacteria 2712
724 Ga0495622_0036966 3300046557 Bacteria 2275
725 Ga0495622_0115235 3300046557 Bacteria 1229
726 Ga0495633_0055300 3300046558 Bacteria 1866
727 Ga0495633_0132744 3300046558 Unclassified 1152
728 Ga0495667_0012785 3300046559 Bacteria 5687
729 Ga0495667_0013632 3300046559 Bacteria 5496
730 Ga0495667_0021370 3300046559 Bacteria 4367
731 Ga0495667_0231034 3300046559 Unclassified 1179
732 Ga0495656_0000502 3300046615 Bacteria 12828
733 Ga0495634_0005519 3300046642 Bacteria 9712
734 Ga0495634_0029394 3300046642 Bacteria 3805
735 Ga0495635_0000812 3300046663 Bacteria 20468
736 Ga0495635_0068842 3300046663 Unclassified 2427
737 Ga0495635_0078343 3300046663 Bacteria 2262
738 Ga0495635_0090134 3300046663 Bacteria 2098
739 Ga0495659_0019422 3300046664 Unclassified 2274
740 Ga0495661_0133436 3300046665 Bacteria 1358
741 Ga0495588_0018849 3300046674 Unclassified 3372
742 Ga0495588_0049139 3300046674 Unclassified 2168
743 Ga0495657_0005959 3300046675 Bacteria 9575
744 Ga0495657_0073198 3300046675 Bacteria 2232
745 Ga0495599_0003370 3300046678 Bacteria 9341
746 Ga0495623_0001381 3300046679 Bacteria 16475
747 Ga0495623_0007001 3300046679 Bacteria 7328
748 Ga0495646_0006169 3300046680 Bacteria 7601
749 Ga0495646_0101675 3300046680 Bacteria 1647
750 Ga0495646_0225582 3300046680 Unclassified 1011
751 Ga0495647_0010732 3300046681 Bacteria 3125
752 Ga0495658_0026339 3300046683 Unclassified 3115
753 Ga0495658_0033999 3300046683 Bacteria 2795
754 Ga0495658_0100438 3300046683 Bacteria 1726
755 Ga0495669_0025004 3300046684 Unclassified 2603
756 Ga0495613_0103367 3300046689 Bacteria 2057
757 Ga0495613_0174224 3300046689 Bacteria 1525
758 Ga0495624_0022854 3300046690 Bacteria 4128
759 Ga0495624_0040556 3300046690 Unclassified 2981
760 Ga0495624_0043892 3300046690 Unclassified 2850
761 Ga0495670_0001992 3300046691 Bacteria 10026
762 Ga0495600_0001477 3300046809 Bacteria 13024
763 Ga0495600_0071321 3300046809 Bacteria 2269
764 Ga0495600_0122193 3300046809 Unclassified 1693
765 Ga0495581_0129470 3300047315 Bacteria 1470
766 Ga0495604_0079050 3300047317 Bacteria 2467
767 Ga0495604_0093021 3300047317 Bacteria 2232
768 Ga0495674_0058715 3300047319 Bacteria 3362
769 Ga0495674_0147612 3300047319 Bacteria 1973
770 Ga0495674_0254663 3300047319 Bacteria 1444
771 Ga0495676_0031961 3300047321 Bacteria 4447
772 Ga0495676_0047264 3300047321 Bacteria 3482
773 Ga0495680_0006835 3300047322 Bacteria 10539
774 Ga0495680_0025234 3300047322 Bacteria 4922
775 Ga0495680_0045027 3300047322 Bacteria 3486
776 Ga0495680_0047807 3300047322 Bacteria 3363
777 Ga0495680_0150937 3300047322 Unclassified 1694
778 Ga0495675_0007988 3300047444 Bacteria 6544
779 Ga0495679_018405 3300047446 Unclassified 2480
780 Ga0495684_0008581 3300047471 Bacteria 7911
781 Ga0495684_0019509 3300047471 Bacteria 5223
782 Ga0495684_0140377 3300047471 Unclassified 1811
783 Ga0495684_0152115 3300047471 Unclassified 1729
784 Ga0495684_0248375 3300047471 Bacteria 1295
785 Ga0495684_0262639 3300047471 Bacteria 1252
786 Ga0495593_0011432 3300047673 Bacteria 5100
787 Ga0495602_0020689 3300048088 Bacteria 6498
788 Ga0495602_0195930 3300048088 Bacteria 1545
789 Ga0495614_0024203 3300048089 Unclassified 2622
790 Ga0495614_0052376 3300048089 Bacteria 1749
791 Ga0496100_0000530 3300048903 Bacteria 18154
792 Ga0496100_0011766 3300048903 Bacteria 4992
793 Ga0496100_0042055 3300048903 Unclassified 2916
794 Ga0496100_0055648 3300048903 Bacteria 2585
795 Ga0496100_0261903 3300048903 Unclassified 1283
796 Ga0496101_0000189 3300048904 Bacteria 48416
797 Ga0496101_0003519 3300048904 Bacteria 9766
798 Ga0496101_0024583 3300048904 Bacteria 4170
799 Ga0496101_0070644 3300048904 Unclassified 2557
800 Ga0496101_0338230 3300048904 Unclassified 1182
801 Ga0496101_0460570 3300048904 Bacteria 1003
802 Ga0496102_0006150 3300048905 Bacteria 10232
803 Ga0496102_0011115 3300048905 Bacteria 7754
804 Ga0496102_0022131 3300048905 Bacteria 5632
805 Ga0496102_0043206 3300048905 Bacteria 4086
806 Ga0496102_0052973 3300048905 Bacteria 3698
807 Ga0496102_0123061 3300048905 Bacteria 2423
808 Ga0496102_0664937 3300048905 Bacteria 965
809 Ga0496103_0001693 3300048906 Bacteria 14412
810 Ga0496103_0006234 3300048906 Bacteria 7127
811 Ga0496103_0056304 3300048906 Bacteria 2440
812 Ga0496103_0124913 3300048906 Unclassified 1640
813 Ga0496104_0001051 3300048907 Bacteria 23567
814 Ga0496104_0001268 3300048907 Bacteria 21768
815 Ga0496104_0011783 3300048907 Bacteria 7845
816 Ga0496104_0032205 3300048907 Bacteria 4878
817 Ga0496104_0032453 3300048907 Bacteria 4860
818 Ga0496104_0077033 3300048907 Bacteria 3177
819 Ga0496104_0086587 3300048907 Bacteria 2991
820 Ga0496104_0110711 3300048907 Bacteria 2632
821 Ga0496104_0175946 3300048907 Bacteria 2050
822 Ga0496105_0010093 3300048908 Bacteria 7415
823 Ga0496105_0017656 3300048908 Bacteria 5723
824 Ga0496105_0030416 3300048908 Bacteria 4424
825 Ga0496105_0039608 3300048908 Bacteria 3884
826 Ga0496105_0045225 3300048908 Bacteria 3632
827 Ga0496105_0051601 3300048908 Bacteria 3398
828 Ga0496105_0147278 3300048908 Bacteria 1936
829 Ga0496105_0243614 3300048908 Bacteria 1458
830 Ga0496106_0002185 3300048909 Bacteria 14611
831 Ga0496106_0002661 3300048909 Bacteria 13293
832 Ga0496106_0039568 3300048909 Bacteria 3531
833 Ga0496106_0059857 3300048909 Bacteria 2886
834 Ga0496106_0060539 3300048909 Bacteria 2870
835 Ga0496106_0062439 3300048909 Bacteria 2828
836 Ga0496106_0119200 3300048909 Bacteria 2061
837 Ga0496106_0151220 3300048909 Unclassified 1831
838 Ga0496106_0171433 3300048909 Bacteria 1720
839 Ga0496107_0005021 3300048910 Bacteria 9014
840 Ga0496107_0007982 3300048910 Bacteria 7305
841 Ga0496107_0042731 3300048910 Bacteria 3255
842 Ga0496107_0059642 3300048910 Bacteria 2761
843 Ga0496107_0063686 3300048910 Bacteria 2672
844 Ga0496107_0082326 3300048910 Bacteria 2347
845 Ga0496107_0123007 3300048910 Bacteria 1912
846 Ga0496107_0224208 3300048910 Bacteria 1398
847 Ga0496107_0266786 3300048910 Unclassified 1274
848 Ga0496108_0004716 3300048911 Bacteria 10994
849 Ga0496108_0007288 3300048911 Bacteria 8967
850 Ga0496108_0020178 3300048911 Bacteria 5476
851 Ga0496108_0022285 3300048911 Bacteria 5208
852 Ga0496108_0048722 3300048911 Bacteria 3543
853 Ga0496108_0052007 3300048911 Unclassified 3432
854 Ga0496108_0079257 3300048911 Bacteria 2780
855 Ga0496108_0155726 3300048911 Bacteria 1973
856 Ga0496109_0000488 3300048912 Bacteria 33914
857 Ga0496109_0000937 3300048912 Bacteria 24155
858 Ga0496109_0006180 3300048912 Bacteria 10066
859 Ga0496109_0006447 3300048912 Bacteria 9883
860 Ga0496109_0076359 3300048912 Unclassified 3081
861 Ga0496109_0131284 3300048912 Bacteria 2338
862 Ga0496109_0134090 3300048912 Bacteria 2313
863 Ga0496109_0161236 3300048912 Bacteria 2101
864 Ga0496110_0010267 3300048913 Bacteria 7609
865 Ga0496110_0011374 3300048913 Bacteria 7281
866 Ga0496110_0060950 3300048913 Bacteria 3328
867 Ga0496110_0087623 3300048913 Bacteria 2780
868 Ga0496110_0176013 3300048913 Bacteria 1942
869 Ga0496110_0186075 3300048913 Bacteria 1886
870 Ga0496111_0043412 3300048914 Bacteria 3231
871 Ga0496111_0054114 3300048914 Unclassified 2900
872 Ga0496111_0073899 3300048914 Bacteria 2482
873 Ga0496111_0186421 3300048914 Bacteria 1542
874 Ga0496111_0290393 3300048914 Bacteria 1213
875 Ga0496112_0002119 3300048915 Bacteria 15754
876 Ga0496112_0030238 3300048915 Bacteria 5240
877 Ga0496112_0042689 3300048915 Plasmid 4437
878 Ga0496112_0072283 3300048915 Bacteria 3409
879 Ga0496112_0150683 3300048915 Bacteria 2293
880 Ga0496112_0382388 3300048915 Unclassified 1348
881 Ga0496112_0650680 3300048915 Bacteria 983
882 Ga0496113_0007034 3300048916 Bacteria 7196
883 Ga0496113_0008963 3300048916 Bacteria 6550
884 Ga0496113_0036654 3300048916 Bacteria 3594
885 Ga0496113_0094768 3300048916 Unclassified 2306
886 Ga0496114_0001444 3300048917 Bacteria 18027
887 Ga0496114_0056180 3300048917 Bacteria 3284
888 Ga0496114_0067813 3300048917 Unclassified 2993
889 Ga0496114_0108540 3300048917 Bacteria 2376
890 Ga0496114_0147267 3300048917 Unclassified 2042
891 Ga0496114_0243562 3300048917 Bacteria 1582
892 Ga0496114_0256679 3300048917 Bacteria 1538
893 Ga0496115_0010890 3300048918 Bacteria 6809
894 Ga0496115_0011115 3300048918 Bacteria 6746
895 Ga0496115_0023856 3300048918 Bacteria 4750
896 Ga0496115_0024977 3300048918 Bacteria 4649
897 Ga0496115_0052993 3300048918 Bacteria 3255
898 Ga0496115_0061694 3300048918 Bacteria 3023
899 Ga0496115_0062463 3300048918 Unclassified 3004
900 Ga0496115_0116398 3300048918 Bacteria 2198
901 Ga0496115_0309304 3300048918 Bacteria 1294
902 Ga0501032_0032146 3300049569 Bacteria 3595
903 Ga0501032_0127112 3300049569 Bacteria 1683
904 Ga0501032_0161794 3300049569 Bacteria 1470
905 Ga0501033_0022284 3300049570 Bacteria 4778
906 Ga0501034_0041862 3300049571 Bacteria 4635
907 Ga0501034_0062271 3300049571 Bacteria 3746
908 Ga0501034_0075137 3300049571 Bacteria 3387
909 Ga0501034_0079867 3300049571 Bacteria 3275
910 Ga0501034_0496032 3300049571 Bacteria 1135
911 Ga0501036_0075408 3300049572 Bacteria 2852
912 Ga0501036_0133421 3300049572 Bacteria 2096
913 Ga0501037_0008863 3300049573 Bacteria 7366
914 Ga0501037_0153724 3300049573 Bacteria 1643
915 Ga0501038_0091952 3300049574 Bacteria 2541
916 Ga0501038_0365413 3300049574 Unclassified 1122
917 Ga0501039_0066340 3300049575 Bacteria 2801
918 Ga0501039_0072285 3300049575 Bacteria 2680
919 Ga0501042_0018045 3300049578 Bacteria 4881
920 Ga0501043_0058825 3300049579 Bacteria 3016
921 Ga0501046_0008348 3300049580 Bacteria 9033
922 Ga0501047_0005574 3300049581 Bacteria 11854
923 Ga0501047_0020602 3300049581 Bacteria 6332
924 Ga0501048_0011858 3300049582 Bacteria 6497
925 Ga0501067_0019941 3300049583 Bacteria 3709
926 Ga0501067_0029331 3300049583 Bacteria 3049
927 Ga0501067_0083058 3300049583 Bacteria 1777
928 Ga0501068_0021379 3300049584 Bacteria 3777
929 Ga0501068_0084807 3300049584 Bacteria 1949
930 Ga0501069_0008627 3300049585 Bacteria 5365
931 Ga0501069_0050869 3300049585 Unclassified 2305
932 Ga0501070_0037325 3300049586 Bacteria 4056
933 Ga0501070_0039332 3300049586 Bacteria 3945
934 Ga0501070_0042299 3300049586 Bacteria 3794
935 Ga0501070_0335857 3300049586 Bacteria 1228
936 Ga0501071_0045909 3300049587 Bacteria 3137
937 Ga0501071_0150128 3300049587 Bacteria 1738
938 Ga0501072_0025367 3300049588 Bacteria 4618
939 Ga0501073_0052097 3300049589 Bacteria 2866
940 Ga0501074_0060323 3300049590 Bacteria 2732
941 Ga0501074_0066377 3300049590 Bacteria 2595
942 Ga0501076_0019979 3300049592 Bacteria 5125
943 Ga0501076_0106849 3300049592 Bacteria 2260
944 Ga0501077_0044390 3300049593 Bacteria 2824
945 Ga0501077_0053596 3300049593 Unclassified 2561
946 Ga0501077_0059008 3300049593 Bacteria 2436
947 Ga0501077_0104465 3300049593 Bacteria 1795
948 Ga0501079_0029585 3300049741 Bacteria 4206
949 Ga0501079_0104827 3300049741 Bacteria 2194
950 Ga0501079_0181819 3300049741 Bacteria 1641
951 Ga0501080_0137924 3300049742 Bacteria 2256
952 Ga0501081_0077791 3300049743 Bacteria 2319
953 Ga0501083_0142979 3300049744 Bacteria 1566
954 Ga0501083_0147279 3300049744 Bacteria 1542
955 Ga0501035_0096281 3300049822 Bacteria 2601
956 Ga0501035_0161843 3300049822 Bacteria 1937
957 Ga0501035_0255216 3300049822 Unclassified 1488
958 Ga0501035_0277780 3300049822 Bacteria 1416
959 Ga0501044_0000212 3300049823 Bacteria 73807
960 Ga0501044_0075245 3300049823 Bacteria 3428
961 Ga0501044_0115183 3300049823 Bacteria 2693
962 Ga0501044_0586978 3300049823 Unclassified 1008
963 nmdc:mga00v17_25398_c1 3300050491 Bacteria 3443
964 nmdc:mga0yw44_13330_c1 3300050492 Bacteria 4325
965 nmdc:mga0yw44_23092_c1 3300050492 Bacteria 3500
966 nmdc:mga0yw44_72764_c1 3300050492 Bacteria 2137
967 nmdc:mga06z11_129052_c1 3300050494 Bacteria 1418
968 nmdc:mga07m45_64769_c1 3300050496 Bacteria 2074
969 nmdc:mga05p37_22407_c1 3300050507 Bacteria 7662
970 nmdc:mga05p37_249482_c1 3300050507 Bacteria 2130
971 nmdc:mga05p37_40101_c1 3300050507 Bacteria 5750
972 nmdc:mga05p37_436714_c1 3300050507 Bacteria 1183
973 nmdc:mga05p37_505_c1 3300050507 Bacteria 42970
974 nmdc:mga05p37_9120_c1 3300050507 Bacteria 11724
975 nmdc:mga09592_772_c1 3300050508 Bacteria 24711
976 nmdc:mga0qj67_165_c1 3300050509 Bacteria 44307
977 nmdc:mga0qj67_64449_c1 3300050509 Bacteria 2914
978 nmdc:mga06r32_212095_c1 3300050510 Bacteria 1924
979 nmdc:mga06r32_272949_c1 3300050510 Bacteria 1678
980 nmdc:mga06r32_363440_c1 3300050510 Bacteria 1431
981 nmdc:mga06r32_6147_c1 3300050510 Bacteria 10781
982 nmdc:mga06r32_660729_c1 3300050510 Bacteria 1013
983 nmdc:mga06r32_78142_c1 3300050510 Bacteria 3216
984 nmdc:mga08y16_1045_c1 3300050511 Bacteria 27157
985 nmdc:mga08y16_12959_c1 3300050511 Bacteria 8773
986 nmdc:mga08y16_19941_c1 3300050511 Bacteria 7074
987 nmdc:mga08y16_264944_c1 3300050511 Bacteria 1774
988 nmdc:mga08y16_2844_c1 3300050511 Bacteria 17794
989 nmdc:mga08y16_333700_c1 3300050511 Bacteria 1559
990 nmdc:mga08y16_497493_c1 3300050511 Bacteria 1239
991 nmdc:mga0n895_122515_c1 3300050512 Bacteria 2622
992 nmdc:mga0n895_189060_c1 3300050512 Bacteria 2090
993 nmdc:mga0n895_24562_c1 3300050512 Bacteria 5681
994 nmdc:mga0n895_2649_c1 3300050512 Bacteria 14116
995 nmdc:mga0n895_45935_c1 3300050512 Bacteria 4265
996 nmdc:mga0n895_597460_c1 3300050512 Bacteria 1106
997 nmdc:mga0n895_613787_c1 3300050512 Bacteria 1089
998 nmdc:mga0n895_76480_c1 3300050512 Bacteria 3329
999 nmdc:mga0rr50_124153_c1 3300050513 Bacteria 2059
1000 nmdc:mga0rr50_1278_c1 3300050513 Bacteria 13714
1001 nmdc:mga0rr50_16037_c1 3300050513 Bacteria 4108
1002 nmdc:mga0rr50_192693_c1 3300050513 Unclassified 1671
1003 nmdc:mga08x19_211521_c1 3300050514 Bacteria 1331
1004 nmdc:mga08x19_23872_c1 3300050514 Bacteria 3795
1005 nmdc:mga08x19_95929_c1 3300050514 Bacteria 1962
1006 nmdc:mga0a205_15415_c1 3300050515 Bacteria 7143
1007 nmdc:mga0a205_1632_c1 3300050515 Bacteria 19295
1008 nmdc:mga0a205_20147_c1 3300050515 Bacteria 6292
1009 nmdc:mga0a205_237148_c1 3300050515 Bacteria 1706
1010 nmdc:mga0a205_565274_c1 3300050515 Bacteria 992
1011 nmdc:mga0a205_81954_c1 3300050515 Bacteria 3116
1012 Ga0495601_0000075 3300053077 Bacteria 54434
1013 Ga0495601_0000961 3300053077 Bacteria 15756
1014 Ga0495601_0001420 3300053077 Bacteria 13193
1015 Ga0495601_0018671 3300053077 Bacteria 4221
1016 Ga0495601_0048186 3300053077 Bacteria 2684
1017 Ga0495612_0001336 3300053078 Bacteria 10158
1018 Ga0495612_0002112 3300053078 Bacteria 8162
1019 Ga0495612_0006592 3300053078 Bacteria 4764
1020 Ga0495612_0008176 3300053078 Bacteria 4251
1021 Ga0495612_0009466 3300053078 Unclassified 3950
1022 Ga0495655_0005569 3300053083 Bacteria 2234
1023 Ga0495595_0004598 3300053084 Bacteria 5550
1024 Ga0495595_0005026 3300053084 Bacteria 5341
1025 Ga0495595_0005375 3300053084 Bacteria 5187
1026 Ga0495595_0023737 3300053084 Bacteria 2703
1027 Ga0495595_0034986 3300053084 Unclassified 2274
1028 Ga0495619_0000211 3300053085 Bacteria 42390
1029 Ga0495619_0000315 3300053085 Bacteria 33904
1030 Ga0495619_0000907 3300053085 Bacteria 19405
1031 Ga0495619_0005328 3300053085 Bacteria 8144
1032 Ga0495619_0033900 3300053085 Bacteria 3317
1033 Ga0495619_0060054 3300053085 Bacteria 2526
1034 Ga0495619_0185501 3300053085 Unclassified 1439
1035 Ga0500616_0000028 3300053153 Bacteria 435722
1036 Ga0501084_0033284 3300054114 Bacteria 4312
1037 Ga0501084_0116228 3300054114 Bacteria 2249
1038 Ga0501082_0010759 3300060353 Bacteria 7877
1039 Ga0501082_0390742 3300060353 Unclassified 1214
1040 Ga0530510_0323109 3300061734 Unclassified 1157

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049590 Ga0501074_0060323 Ga0501074_0060323_2007_2717 234
2 3300060353 Ga0501082_0390742 Ga0501082_0390742_162_1007 264
3 3300049569 Ga0501032_0127112 Ga0501032_0127112_778_1623 268
4 3300025916 Ga0207663_10122808 Ga0207663_101228081 270
5 3300047471 Ga0495684_0140377 Ga0495684_0140377_425_1237 270
6 3300035695 Ga0373927_0444526 Ga0373927_0444526_24_842 272
7 3300049592 Ga0501076_0106849 Ga0501076_0106849_1371_2216 273
8 3300054114 Ga0501084_0116228 Ga0501084_0116228_1050_1895 273
9 3300049583 Ga0501067_0019941 Ga0501067_0019941_2378_3223 274
10 3300049584 Ga0501068_0084807 Ga0501068_0084807_407_1252 274
11 3300049586 Ga0501070_0039332 Ga0501070_0039332_1535_2380 274
12 3300049587 Ga0501071_0150128 Ga0501071_0150128_205_1050 274
13 3300049588 Ga0501072_0025367 Ga0501072_0025367_3575_4420 274
14 3300049589 Ga0501073_0052097 Ga0501073_0052097_1438_2283 274
15 3300049590 Ga0501074_0066377 Ga0501074_0066377_973_1818 274
16 3300049741 Ga0501079_0181819 Ga0501079_0181819_149_994 274
17 3300049742 Ga0501080_0137924 Ga0501080_0137924_867_1712 274
18 3300049822 Ga0501035_0255216 Ga0501035_0255216_305_1150 274
19 3300049823 Ga0501044_0075245 Ga0501044_0075245_198_1043 274
20 3300005548 Ga0070665_100469798 Ga0070665_1004697982 279
21 3300028379 Ga0268266_10466338 Ga0268266_104663382 279
22 3300053153 Ga0500616_0000028 Ga0500616_0000028_131405_132244 279
23 3300005435 Ga0070714_100045879 Ga0070714_1000458791 280
24 3300006163 Ga0070715_10005495 Ga0070715_100054952 280
25 3300006173 Ga0070716_100251765 Ga0070716_1002517651 280
26 3300025898 Ga0207692_10058464 Ga0207692_100584642 280
27 3300025929 Ga0207664_10092306 Ga0207664_100923062 280
28 3300031691 Ga0316579_10140845 Ga0316579_101408451 280
29 3300048917 Ga0496114_0108540 Ga0496114_0108540_34_876 280
30 3300049569 Ga0501032_0161794 Ga0501032_0161794_578_1420 280
31 3300049571 Ga0501034_0041862 Ga0501034_0041862_203_1069 280
32 2209111006 2214745210 2213754776 281
33 3300000041 ARcpr5oldR_c000144 ARcpr5oldR_00014413 281
34 3300000042 ARSoilYngRDRAFT_c00009 ARSoilYngRDRAFT_000095 281
35 3300000043 ARcpr5yngRDRAFT_c000006 ARcpr5yngRDRAFT_0000065 281
36 3300000044 ARSoilOldRDRAFT_c000102 ARSoilOldRDRAFT_0001025 281
37 3300000045 ARCol0oldRDRAFT_c00372 ARCol0oldRDRAFT_003723 281
38 3300000652 ARCol0yngRDRAFT_1000031 ARCol0yngRDRAFT_100003125 281
39 3300001430 JGI24032J14994_100083 JGI24032J14994_1000833 281
40 3300001976 JGI24752J21851_1003042 JGI24752J21851_10030422 281
41 3300001977 JGI24746J21847_1002186 JGI24746J21847_10021864 281
42 3300001978 JGI24747J21853_1006367 JGI24747J21853_10063672 281
43 3300001989 JGI24739J22299_10001142 JGI24739J22299_100011427 281
44 3300001989 JGI24739J22299_10001990 JGI24739J22299_100019907 281
45 3300001990 JGI24737J22298_10001546 JGI24737J22298_100015467 281
46 3300001990 JGI24737J22298_10010151 JGI24737J22298_100101511 281
47 3300001991 JGI24743J22301_10026307 JGI24743J22301_100263071 281
48 3300002070 JGI24750J21931_1000491 JGI24750J21931_10004914 281
49 3300002075 JGI24738J21930_10000010 JGI24738J21930_100000102 281
50 3300002076 JGI24749J21850_1000579 JGI24749J21850_10005797 281
51 3300002077 JGI24744J21845_10006762 JGI24744J21845_100067622 281
52 3300002126 JGI24035J26624_1000653 JGI24035J26624_10006532 281
53 3300002155 JGI24033J26618_1000465 JGI24033J26618_10004652 281
54 3300002239 JGI24034J26672_10000494 JGI24034J26672_100004944 281
55 3300002244 JGI24742J22300_10000278 JGI24742J22300_100002787 281
56 3300005276 Ga0065717_1001969 Ga0065717_10019694 281
57 3300005289 Ga0065704_10076177 Ga0065704_100761775 281
58 3300005290 Ga0065712_10010165 Ga0065712_100101652 281
59 3300005290 Ga0065712_10082229 Ga0065712_100822293 281
60 3300005290 Ga0065712_10170888 Ga0065712_101708882 281
61 3300005293 Ga0065715_10089173 Ga0065715_100891732 281
62 3300005293 Ga0065715_10120090 Ga0065715_101200902 281
63 3300005327 Ga0070658_10026708 Ga0070658_100267085 281
64 3300005328 Ga0070676_10000978 Ga0070676_100009782 281
65 3300005328 Ga0070676_10090580 Ga0070676_100905802 281
66 3300005329 Ga0070683_100001166 Ga0070683_10000116615 281
67 3300005329 Ga0070683_100215473 Ga0070683_1002154731 281
68 3300005330 Ga0070690_100001038 Ga0070690_1000010384 281
69 3300005330 Ga0070690_100015198 Ga0070690_1000151984 281
70 3300005330 Ga0070690_100029526 Ga0070690_1000295263 281
71 3300005330 Ga0070690_100042920 Ga0070690_1000429201 281
72 3300005331 Ga0070670_100003635 Ga0070670_1000036357 281
73 3300005331 Ga0070670_100012172 Ga0070670_1000121728 281
74 3300005331 Ga0070670_100294418 Ga0070670_1002944182 281
75 3300005333 Ga0070677_10000126 Ga0070677_1000012613 281
76 3300005334 Ga0068869_100002872 Ga0068869_1000028729 281
77 3300005334 Ga0068869_100122501 Ga0068869_1001225013 281
78 3300005334 Ga0068869_100555603 Ga0068869_1005556031 281
79 3300005335 Ga0070666_10007115 Ga0070666_100071157 281
80 3300005335 Ga0070666_10042300 Ga0070666_100423001 281
81 3300005336 Ga0070680_100003349 Ga0070680_10000334914 281
82 3300005336 Ga0070680_100008343 Ga0070680_1000083437 281
83 3300005336 Ga0070680_100041804 Ga0070680_1000418043 281
84 3300005336 Ga0070680_100069911 Ga0070680_1000699113 281
85 3300005337 Ga0070682_100000641 Ga0070682_10000064123 281
86 3300005338 Ga0068868_100003027 Ga0068868_10000302710 281
87 3300005339 Ga0070660_100002411 Ga0070660_10000241114 281
88 3300005339 Ga0070660_100034540 Ga0070660_1000345402 281
89 3300005339 Ga0070660_100049153 Ga0070660_1000491533 281
90 3300005339 Ga0070660_100204578 Ga0070660_1002045781 281
91 3300005340 Ga0070689_100004089 Ga0070689_1000040899 281
92 3300005340 Ga0070689_100004527 Ga0070689_1000045277 281
93 3300005340 Ga0070689_100040803 Ga0070689_1000408032 281
94 3300005341 Ga0070691_10049070 Ga0070691_100490702 281
95 3300005343 Ga0070687_100000085 Ga0070687_10000008510 281
96 3300005343 Ga0070687_100028353 Ga0070687_1000283531 281
97 3300005344 Ga0070661_100000307 Ga0070661_10000030738 281
98 3300005344 Ga0070661_100025875 Ga0070661_1000258753 281
99 3300005344 Ga0070661_100105180 Ga0070661_1001051802 281
100 3300005344 Ga0070661_100405484 Ga0070661_1004054841 281
101 3300005345 Ga0070692_10003918 Ga0070692_100039182 281
102 3300005345 Ga0070692_10035591 Ga0070692_100355913 281
103 3300005347 Ga0070668_100001248 Ga0070668_1000012487 281
104 3300005347 Ga0070668_100054836 Ga0070668_1000548361 281
105 3300005353 Ga0070669_100000571 Ga0070669_1000005712 281
106 3300005354 Ga0070675_100008609 Ga0070675_1000086092 281
107 3300005354 Ga0070675_100020365 Ga0070675_1000203652 281
108 3300005354 Ga0070675_100063073 Ga0070675_1000630732 281
109 3300005354 Ga0070675_100246924 Ga0070675_1002469242 281
110 3300005355 Ga0070671_100000104 Ga0070671_10000010460 281
111 3300005355 Ga0070671_100072021 Ga0070671_1000720212 281
112 3300005356 Ga0070674_100000238 Ga0070674_1000002382 281
113 3300005356 Ga0070674_100035821 Ga0070674_1000358214 281
114 3300005356 Ga0070674_100066460 Ga0070674_1000664602 281
115 3300005364 Ga0070673_100000152 Ga0070673_10000015212 281
116 3300005364 Ga0070673_100118963 Ga0070673_1001189631 281
117 3300005364 Ga0070673_100136582 Ga0070673_1001365822 281
118 3300005365 Ga0070688_100005902 Ga0070688_1000059027 281
119 3300005365 Ga0070688_100008100 Ga0070688_1000081002 281
120 3300005365 Ga0070688_100039619 Ga0070688_1000396193 281
121 3300005366 Ga0070659_100000551 Ga0070659_1000005512 281
122 3300005366 Ga0070659_100053119 Ga0070659_1000531191 281
123 3300005367 Ga0070667_100009897 Ga0070667_1000098977 281
124 3300005367 Ga0070667_100031049 Ga0070667_1000310495 281
125 3300005367 Ga0070667_100054697 Ga0070667_1000546972 281
126 3300005367 Ga0070667_100326336 Ga0070667_1003263362 281
127 3300005406 Ga0070703_10004978 Ga0070703_100049784 281
128 3300005434 Ga0070709_10062929 Ga0070709_100629292 281
129 3300005435 Ga0070714_100045087 Ga0070714_1000450875 281
130 3300005435 Ga0070714_100151122 Ga0070714_1001511222 281
131 3300005435 Ga0070714_100164539 Ga0070714_1001645392 281
132 3300005436 Ga0070713_100007389 Ga0070713_1000073899 281
133 3300005436 Ga0070713_100099207 Ga0070713_1000992071 281
134 3300005436 Ga0070713_100135912 Ga0070713_1001359122 281
135 3300005436 Ga0070713_100456005 Ga0070713_1004560051 281
136 3300005437 Ga0070710_10041960 Ga0070710_100419603 281
137 3300005437 Ga0070710_10070468 Ga0070710_100704682 281
138 3300005437 Ga0070710_10103898 Ga0070710_101038982 281
139 3300005438 Ga0070701_10087275 Ga0070701_100872752 281
140 3300005438 Ga0070701_10190757 Ga0070701_101907571 281
141 3300005439 Ga0070711_100158736 Ga0070711_1001587362 281
142 3300005439 Ga0070711_100165148 Ga0070711_1001651482 281
143 3300005439 Ga0070711_100300453 Ga0070711_1003004532 281
144 3300005440 Ga0070705_100000148 Ga0070705_1000001481 281
145 3300005440 Ga0070705_100066789 Ga0070705_1000667892 281
146 3300005440 Ga0070705_100286652 Ga0070705_1002866521 281
147 3300005440 Ga0070705_100349918 Ga0070705_1003499181 281
148 3300005441 Ga0070700_100000277 Ga0070700_10000027731 281
149 3300005441 Ga0070700_100031131 Ga0070700_1000311312 281
150 3300005444 Ga0070694_100001507 Ga0070694_1000015077 281
151 3300005444 Ga0070694_100016824 Ga0070694_1000168245 281
152 3300005444 Ga0070694_100021063 Ga0070694_1000210634 281
153 3300005444 Ga0070694_100073471 Ga0070694_1000734713 281
154 3300005445 Ga0070708_100027462 Ga0070708_1000274625 281
155 3300005455 Ga0070663_100000522 Ga0070663_10000052214 281
156 3300005455 Ga0070663_100017769 Ga0070663_1000177696 281
157 3300005455 Ga0070663_100028232 Ga0070663_1000282324 281
158 3300005455 Ga0070663_100494731 Ga0070663_1004947311 281
159 3300005456 Ga0070678_100000718 Ga0070678_1000007185 281
160 3300005456 Ga0070678_100011460 Ga0070678_1000114605 281
161 3300005456 Ga0070678_100042025 Ga0070678_1000420253 281
162 3300005457 Ga0070662_100001666 Ga0070662_1000016667 281
163 3300005457 Ga0070662_100015894 Ga0070662_1000158943 281
164 3300005457 Ga0070662_100060423 Ga0070662_1000604233 281
165 3300005458 Ga0070681_10014569 Ga0070681_100145692 281
166 3300005458 Ga0070681_10052540 Ga0070681_100525404 281
167 3300005458 Ga0070681_10306708 Ga0070681_103067082 281
168 3300005458 Ga0070681_10320548 Ga0070681_103205482 281
169 3300005459 Ga0068867_100006623 Ga0068867_1000066232 281
170 3300005459 Ga0068867_100012024 Ga0068867_1000120244 281
171 3300005466 Ga0070685_10002221 Ga0070685_100022215 281
172 3300005466 Ga0070685_10004005 Ga0070685_100040057 281
173 3300005466 Ga0070685_10024466 Ga0070685_100244663 281
174 3300005467 Ga0070706_100147399 Ga0070706_1001473993 281
175 3300005518 Ga0070699_100011505 Ga0070699_1000115057 281
176 3300005518 Ga0070699_100320219 Ga0070699_1003202192 281
177 3300005530 Ga0070679_100014561 Ga0070679_1000145618 281
178 3300005530 Ga0070679_100082633 Ga0070679_1000826333 281
179 3300005530 Ga0070679_100397378 Ga0070679_1003973782 281
180 3300005535 Ga0070684_100000894 Ga0070684_10000089414 281
181 3300005535 Ga0070684_100127730 Ga0070684_1001277302 281
182 3300005535 Ga0070684_100224857 Ga0070684_1002248572 281
183 3300005535 Ga0070684_100750412 Ga0070684_1007504121 281
184 3300005536 Ga0070697_100023189 Ga0070697_1000231894 281
185 3300005536 Ga0070697_100174431 Ga0070697_1001744312 281
186 3300005539 Ga0068853_100020627 Ga0068853_1000206275 281
187 3300005539 Ga0068853_100191830 Ga0068853_1001918301 281
188 3300005539 Ga0068853_100209643 Ga0068853_1002096432 281
189 3300005543 Ga0070672_100000088 Ga0070672_10000008852 281
190 3300005543 Ga0070672_100172591 Ga0070672_1001725912 281
191 3300005544 Ga0070686_100000719 Ga0070686_10000071919 281
192 3300005544 Ga0070686_100028453 Ga0070686_1000284533 281
193 3300005544 Ga0070686_100029585 Ga0070686_1000295852 281
194 3300005544 Ga0070686_100040116 Ga0070686_1000401162 281
195 3300005546 Ga0070696_100020775 Ga0070696_1000207754 281
196 3300005546 Ga0070696_100068057 Ga0070696_1000680571 281
197 3300005546 Ga0070696_100227825 Ga0070696_1002278251 281
198 3300005547 Ga0070693_100000134 Ga0070693_1000001349 281
199 3300005547 Ga0070693_100151858 Ga0070693_1001518582 281
200 3300005548 Ga0070665_100032403 Ga0070665_1000324033 281
201 3300005548 Ga0070665_100144488 Ga0070665_1001444881 281
202 3300005548 Ga0070665_100352336 Ga0070665_1003523362 281
203 3300005549 Ga0070704_100000428 Ga0070704_1000004287 281
204 3300005549 Ga0070704_100027693 Ga0070704_1000276935 281
205 3300005563 Ga0068855_100007545 Ga0068855_1000075456 281
206 3300005563 Ga0068855_100031321 Ga0068855_1000313213 281
207 3300005563 Ga0068855_100127457 Ga0068855_1001274572 281
208 3300005563 Ga0068855_100203384 Ga0068855_1002033843 281
209 3300005563 Ga0068855_100634939 Ga0068855_1006349392 281
210 3300005564 Ga0070664_100002234 Ga0070664_10000223414 281
211 3300005564 Ga0070664_100045631 Ga0070664_1000456313 281
212 3300005564 Ga0070664_100097454 Ga0070664_1000974541 281
213 3300005564 Ga0070664_100121692 Ga0070664_1001216921 281
214 3300005577 Ga0068857_100002935 Ga0068857_10000293514 281
215 3300005577 Ga0068857_100708826 Ga0068857_1007088261 281
216 3300005578 Ga0068854_100308029 Ga0068854_1003080291 281
217 3300005614 Ga0068856_100002000 Ga0068856_10000200021 281
218 3300005614 Ga0068856_100307550 Ga0068856_1003075502 281
219 3300005615 Ga0070702_100000638 Ga0070702_1000006389 281
220 3300005615 Ga0070702_100002467 Ga0070702_1000024674 281
221 3300005615 Ga0070702_100011329 Ga0070702_1000113294 281
222 3300005615 Ga0070702_100023246 Ga0070702_1000232463 281
223 3300005616 Ga0068852_100002115 Ga0068852_1000021157 281
224 3300005616 Ga0068852_100077859 Ga0068852_1000778592 281
225 3300005617 Ga0068859_100021325 Ga0068859_1000213257 281
226 3300005617 Ga0068859_100080532 Ga0068859_1000805322 281
227 3300005617 Ga0068859_100243543 Ga0068859_1002435432 281
228 3300005618 Ga0068864_100014592 Ga0068864_1000145922 281
229 3300005718 Ga0068866_10000301 Ga0068866_1000030124 281
230 3300005718 Ga0068866_10002757 Ga0068866_100027573 281
231 3300005718 Ga0068866_10124413 Ga0068866_101244132 281
232 3300005719 Ga0068861_100016840 Ga0068861_1000168407 281
233 3300005719 Ga0068861_100018418 Ga0068861_1000184183 281
234 3300005834 Ga0068851_10058471 Ga0068851_100584712 281
235 3300005840 Ga0068870_10000354 Ga0068870_100003548 281
236 3300005840 Ga0068870_10001545 Ga0068870_100015453 281
237 3300005841 Ga0068863_100000340 Ga0068863_10000034019 281
238 3300005841 Ga0068863_100018623 Ga0068863_1000186235 281
239 3300005841 Ga0068863_100272427 Ga0068863_1002724272 281
240 3300005842 Ga0068858_100000295 Ga0068858_10000029562 281
241 3300005842 Ga0068858_100011371 Ga0068858_1000113713 281
242 3300005842 Ga0068858_100025797 Ga0068858_1000257972 281
243 3300005842 Ga0068858_100128333 Ga0068858_1001283332 281
244 3300005842 Ga0068858_100160619 Ga0068858_1001606192 281
245 3300005843 Ga0068860_100001285 Ga0068860_10000128530 281
246 3300005843 Ga0068860_100084443 Ga0068860_1000844433 281
247 3300005844 Ga0068862_100003236 Ga0068862_10000323614 281
248 3300005844 Ga0068862_100012543 Ga0068862_1000125432 281
249 3300005937 Ga0081455_10000007 Ga0081455_10000007214 281
250 3300005937 Ga0081455_10001479 Ga0081455_100014795 281
251 3300005937 Ga0081455_10009018 Ga0081455_100090182 281
252 3300005937 Ga0081455_10017104 Ga0081455_100171046 281
253 3300005937 Ga0081455_10033388 Ga0081455_100333884 281
254 3300005937 Ga0081455_10143080 Ga0081455_101430802 281
255 3300005981 Ga0081538_10022998 Ga0081538_100229986 281
256 3300006028 Ga0070717_10007640 Ga0070717_100076405 281
257 3300006038 Ga0075365_10022333 Ga0075365_100223335 281
258 3300006058 Ga0075432_10000272 Ga0075432_100002723 281
259 3300006058 Ga0075432_10094683 Ga0075432_100946831 281
260 3300006173 Ga0070716_100148747 Ga0070716_1001487471 281
261 3300006175 Ga0070712_100028432 Ga0070712_1000284324 281
262 3300006175 Ga0070712_100061683 Ga0070712_1000616833 281
263 3300006175 Ga0070712_100204349 Ga0070712_1002043492 281
264 3300006178 Ga0075367_10049729 Ga0075367_100497292 281
265 3300006195 Ga0075366_10028947 Ga0075366_100289472 281
266 3300006237 Ga0097621_100000040 Ga0097621_10000004067 281
267 3300006237 Ga0097621_100022646 Ga0097621_1000226463 281
268 3300006237 Ga0097621_100053322 Ga0097621_1000533222 281
269 3300006353 Ga0075370_10040679 Ga0075370_100406792 281
270 3300006358 Ga0068871_100000301 Ga0068871_10000030114 281
271 3300006844 Ga0075428_100003180 Ga0075428_10000318015 281
272 3300006844 Ga0075428_100015358 Ga0075428_1000153581 281
273 3300006844 Ga0075428_100045005 Ga0075428_1000450052 281
274 3300006844 Ga0075428_100100352 Ga0075428_1001003523 281
275 3300006844 Ga0075428_100416948 Ga0075428_1004169482 281
276 3300006846 Ga0075430_100000201 Ga0075430_10000020140 281
277 3300006847 Ga0075431_100000260 Ga0075431_10000026040 281
278 3300006847 Ga0075431_100329512 Ga0075431_1003295122 281
279 3300006847 Ga0075431_100509470 Ga0075431_1005094702 281
280 3300006852 Ga0075433_10000007 Ga0075433_1000000738 281
281 3300006852 Ga0075433_10006753 Ga0075433_100067537 281
282 3300006852 Ga0075433_10009620 Ga0075433_100096203 281
283 3300006852 Ga0075433_10492088 Ga0075433_104920881 281
284 3300006871 Ga0075434_100000091 Ga0075434_1000000916 281
285 3300006871 Ga0075434_100019587 Ga0075434_1000195876 281
286 3300006871 Ga0075434_100067068 Ga0075434_1000670685 281
287 3300006871 Ga0075434_100094300 Ga0075434_1000943002 281
288 3300006871 Ga0075434_100183234 Ga0075434_1001832342 281
289 3300006880 Ga0075429_100001824 Ga0075429_10000182415 281
290 3300006881 Ga0068865_100000275 Ga0068865_1000002759 281
291 3300006881 Ga0068865_100024369 Ga0068865_1000243695 281
292 3300006881 Ga0068865_100050689 Ga0068865_1000506892 281
293 3300006881 Ga0068865_100100150 Ga0068865_1001001501 281
294 3300006914 Ga0075436_100039496 Ga0075436_1000394963 281
295 3300006914 Ga0075436_100107605 Ga0075436_1001076051 281
296 3300006931 Ga0097620_100021325 Ga0097620_1000213257 281
297 3300006931 Ga0097620_100080540 Ga0097620_1000805402 281
298 3300006931 Ga0097620_100243538 Ga0097620_1002435382 281
299 3300007076 Ga0075435_100017727 Ga0075435_1000177272 281
300 3300007076 Ga0075435_100040818 Ga0075435_1000408185 281
301 3300007076 Ga0075435_100286057 Ga0075435_1002860572 281
302 3300007265 Ga0099794_10046157 Ga0099794_100461573 281
303 3300009011 Ga0105251_10020085 Ga0105251_100200853 281
304 3300009036 Ga0105244_10133680 Ga0105244_101336801 281
305 3300009092 Ga0105250_10018576 Ga0105250_100185762 281
306 3300009093 Ga0105240_10646330 Ga0105240_106463301 281
307 3300009093 Ga0105240_10743379 Ga0105240_107433791 281
308 3300009094 Ga0111539_10000394 Ga0111539_1000039457 281
309 3300009094 Ga0111539_10001672 Ga0111539_1000167220 281
310 3300009094 Ga0111539_10017527 Ga0111539_100175277 281
311 3300009094 Ga0111539_10040786 Ga0111539_100407862 281
312 3300009094 Ga0111539_10109172 Ga0111539_101091723 281
313 3300009094 Ga0111539_10187414 Ga0111539_101874142 281
314 3300009094 Ga0111539_10409500 Ga0111539_104095001 281
315 3300009094 Ga0111539_10828611 Ga0111539_108286111 281
316 3300009098 Ga0105245_10000462 Ga0105245_100004626 281
317 3300009098 Ga0105245_10020090 Ga0105245_100200904 281
318 3300009098 Ga0105245_10350384 Ga0105245_103503842 281
319 3300009101 Ga0105247_10001920 Ga0105247_100019207 281
320 3300009101 Ga0105247_10022379 Ga0105247_100223792 281
321 3300009101 Ga0105247_10309243 Ga0105247_103092432 281
322 3300009147 Ga0114129_10001111 Ga0114129_1000111142 281
323 3300009147 Ga0114129_10003047 Ga0114129_1000304717 281
324 3300009147 Ga0114129_10007767 Ga0114129_100077677 281
325 3300009147 Ga0114129_10069532 Ga0114129_100695322 281
326 3300009147 Ga0114129_10991037 Ga0114129_109910371 281
327 3300009148 Ga0105243_10000282 Ga0105243_1000028261 281
328 3300009148 Ga0105243_10030614 Ga0105243_100306142 281
329 3300009148 Ga0105243_10033566 Ga0105243_100335662 281
330 3300009148 Ga0105243_10123865 Ga0105243_101238652 281
331 3300009174 Ga0105241_10000652 Ga0105241_100006525 281
332 3300009176 Ga0105242_10011119 Ga0105242_100111195 281
333 3300009176 Ga0105242_10298969 Ga0105242_102989692 281
334 3300009177 Ga0105248_10011410 Ga0105248_100114103 281
335 3300009177 Ga0105248_10027731 Ga0105248_100277312 281
336 3300009177 Ga0105248_10093852 Ga0105248_100938523 281
337 3300009177 Ga0105248_10262268 Ga0105248_102622682 281
338 3300009545 Ga0105237_10043527 Ga0105237_100435273 281
339 3300009545 Ga0105237_10237597 Ga0105237_102375971 281
340 3300009551 Ga0105238_10713221 Ga0105238_107132211 281
341 3300009553 Ga0105249_10001210 Ga0105249_1000121024 281
342 3300009553 Ga0105249_10071575 Ga0105249_100715752 281
343 3300009553 Ga0105249_10153953 Ga0105249_101539531 281
344 3300009553 Ga0105249_10173060 Ga0105249_101730602 281
345 3300009553 Ga0105249_10332376 Ga0105249_103323762 281
346 3300010375 Ga0105239_10028214 Ga0105239_100282147 281
347 3300010375 Ga0105239_10067368 Ga0105239_100673683 281
348 3300010375 Ga0105239_10154111 Ga0105239_101541113 281
349 3300010375 Ga0105239_10486636 Ga0105239_104866361 281
350 3300011119 Ga0105246_10009002 Ga0105246_100090021 281
351 3300011119 Ga0105246_10026829 Ga0105246_100268292 281
352 3300011119 Ga0105246_10122864 Ga0105246_101228642 281
353 3300012480 Ga0157346_1000445 Ga0157346_10004451 281
354 3300013100 Ga0157373_10010359 Ga0157373_100103595 281
355 3300013102 Ga0157371_10019421 Ga0157371_100194212 281
356 3300013104 Ga0157370_10164555 Ga0157370_101645553 281
357 3300013296 Ga0157374_10006038 Ga0157374_100060389 281
358 3300013296 Ga0157374_10120686 Ga0157374_101206861 281
359 3300013296 Ga0157374_10148398 Ga0157374_101483981 281
360 3300013296 Ga0157374_10195927 Ga0157374_101959273 281
361 3300013297 Ga0157378_10000270 Ga0157378_100002702 281
362 3300013297 Ga0157378_10494906 Ga0157378_104949062 281
363 3300013306 Ga0163162_10000145 Ga0163162_100001454 281
364 3300013306 Ga0163162_10143726 Ga0163162_101437262 281
365 3300013307 Ga0157372_10012191 Ga0157372_100121917 281
366 3300013307 Ga0157372_10254765 Ga0157372_102547652 281
367 3300013308 Ga0157375_10000332 Ga0157375_100003321 281
368 3300013308 Ga0157375_10009000 Ga0157375_100090006 281
369 3300013308 Ga0157375_10049349 Ga0157375_100493495 281
370 3300013308 Ga0157375_10748389 Ga0157375_107483891 281
371 3300014325 Ga0163163_10000865 Ga0163163_100008655 281
372 3300014325 Ga0163163_10005560 Ga0163163_100055606 281
373 3300014325 Ga0163163_10069639 Ga0163163_100696393 281
374 3300014325 Ga0163163_10768790 Ga0163163_107687901 281
375 3300014326 Ga0157380_10000891 Ga0157380_100008917 281
376 3300014326 Ga0157380_10059658 Ga0157380_100596582 281
377 3300014326 Ga0157380_10473230 Ga0157380_104732301 281
378 3300014745 Ga0157377_10000137 Ga0157377_100001375 281
379 3300014745 Ga0157377_10039626 Ga0157377_100396262 281
380 3300014745 Ga0157377_10128440 Ga0157377_101284402 281
381 3300014968 Ga0157379_10001761 Ga0157379_1000176119 281
382 3300014968 Ga0157379_10012181 Ga0157379_100121815 281
383 3300014968 Ga0157379_10032861 Ga0157379_100328612 281
384 3300014968 Ga0157379_10071950 Ga0157379_100719503 281
385 3300014969 Ga0157376_10000088 Ga0157376_1000008861 281
386 3300014969 Ga0157376_10083873 Ga0157376_100838734 281
387 3300014969 Ga0157376_10270273 Ga0157376_102702732 281
388 3300014969 Ga0157376_10422725 Ga0157376_104227252 281
389 3300017792 Ga0163161_10000144 Ga0163161_1000014410 281
390 3300017792 Ga0163161_10049602 Ga0163161_100496022 281
391 3300021384 Ga0213876_10026729 Ga0213876_100267293 281
392 3300024227 Ga0228598_1007345 Ga0228598_10073452 281
393 3300025271 Ga0207666_1000048 Ga0207666_100004826 281
394 3300025271 Ga0207666_1000627 Ga0207666_10006272 281
395 3300025315 Ga0207697_10003423 Ga0207697_100034232 281
396 3300025315 Ga0207697_10014016 Ga0207697_100140164 281
397 3300025735 Ga0207713_1061801 Ga0207713_10618012 281
398 3300025885 Ga0207653_10015888 Ga0207653_100158883 281
399 3300025885 Ga0207653_10034319 Ga0207653_100343191 281
400 3300025893 Ga0207682_10000509 Ga0207682_1000050912 281
401 3300025898 Ga0207692_10007140 Ga0207692_100071403 281
402 3300025898 Ga0207692_10052953 Ga0207692_100529532 281
403 3300025899 Ga0207642_10000762 Ga0207642_100007627 281
404 3300025899 Ga0207642_10006361 Ga0207642_100063613 281
405 3300025900 Ga0207710_10003986 Ga0207710_100039863 281
406 3300025901 Ga0207688_10000033 Ga0207688_1000003316 281
407 3300025901 Ga0207688_10004167 Ga0207688_100041677 281
408 3300025903 Ga0207680_10030693 Ga0207680_100306934 281
409 3300025903 Ga0207680_10035788 Ga0207680_100357881 281
410 3300025903 Ga0207680_10262312 Ga0207680_102623121 281
411 3300025904 Ga0207647_10020884 Ga0207647_100208842 281
412 3300025906 Ga0207699_10008794 Ga0207699_100087942 281
413 3300025906 Ga0207699_10186194 Ga0207699_101861942 281
414 3300025907 Ga0207645_10000100 Ga0207645_1000010061 281
415 3300025907 Ga0207645_10087683 Ga0207645_100876832 281
416 3300025908 Ga0207643_10000007 Ga0207643_10000007172 281
417 3300025908 Ga0207643_10000671 Ga0207643_1000067113 281
418 3300025909 Ga0207705_10061675 Ga0207705_100616754 281
419 3300025910 Ga0207684_10023683 Ga0207684_100236836 281
420 3300025911 Ga0207654_10000314 Ga0207654_100003148 281
421 3300025911 Ga0207654_10152486 Ga0207654_101524862 281
422 3300025912 Ga0207707_10037222 Ga0207707_100372222 281
423 3300025912 Ga0207707_10079630 Ga0207707_100796304 281
424 3300025912 Ga0207707_10121335 Ga0207707_101213354 281
425 3300025912 Ga0207707_10216102 Ga0207707_102161022 281
426 3300025912 Ga0207707_10323939 Ga0207707_103239391 281
427 3300025913 Ga0207695_10146209 Ga0207695_101462093 281
428 3300025914 Ga0207671_10025600 Ga0207671_100256003 281
429 3300025914 Ga0207671_10095297 Ga0207671_100952972 281
430 3300025915 Ga0207693_10007799 Ga0207693_100077996 281
431 3300025915 Ga0207693_10026013 Ga0207693_100260133 281
432 3300025915 Ga0207693_10037280 Ga0207693_100372802 281
433 3300025915 Ga0207693_10042697 Ga0207693_100426973 281
434 3300025916 Ga0207663_10033165 Ga0207663_100331652 281
435 3300025916 Ga0207663_10148936 Ga0207663_101489362 281
436 3300025917 Ga0207660_10000041 Ga0207660_1000004111 281
437 3300025917 Ga0207660_10015546 Ga0207660_100155465 281
438 3300025917 Ga0207660_10032163 Ga0207660_100321632 281
439 3300025917 Ga0207660_10130351 Ga0207660_101303512 281
440 3300025917 Ga0207660_10165018 Ga0207660_101650182 281
441 3300025917 Ga0207660_10443574 Ga0207660_104435741 281
442 3300025918 Ga0207662_10000282 Ga0207662_1000028226 281
443 3300025918 Ga0207662_10004598 Ga0207662_100045983 281
444 3300025918 Ga0207662_10018861 Ga0207662_100188616 281
445 3300025918 Ga0207662_10053389 Ga0207662_100533892 281
446 3300025919 Ga0207657_10009921 Ga0207657_100099215 281
447 3300025919 Ga0207657_10013952 Ga0207657_100139522 281
448 3300025919 Ga0207657_10022759 Ga0207657_100227592 281
449 3300025919 Ga0207657_10030177 Ga0207657_100301774 281
450 3300025919 Ga0207657_10046445 Ga0207657_100464452 281
451 3300025919 Ga0207657_10076831 Ga0207657_100768313 281
452 3300025920 Ga0207649_10001482 Ga0207649_1000148210 281
453 3300025920 Ga0207649_10077097 Ga0207649_100770972 281
454 3300025920 Ga0207649_10097948 Ga0207649_100979482 281
455 3300025920 Ga0207649_10501719 Ga0207649_105017191 281
456 3300025921 Ga0207652_10002995 Ga0207652_1000299510 281
457 3300025921 Ga0207652_10049186 Ga0207652_100491861 281
458 3300025921 Ga0207652_10077001 Ga0207652_100770011 281
459 3300025921 Ga0207652_10229057 Ga0207652_102290572 281
460 3300025921 Ga0207652_10229888 Ga0207652_102298882 281
461 3300025921 Ga0207652_10426192 Ga0207652_104261921 281
462 3300025921 Ga0207652_10428879 Ga0207652_104288792 281
463 3300025923 Ga0207681_10001546 Ga0207681_100015467 281
464 3300025923 Ga0207681_10412728 Ga0207681_104127282 281
465 3300025924 Ga0207694_10273369 Ga0207694_102733692 281
466 3300025924 Ga0207694_10344105 Ga0207694_103441052 281
467 3300025925 Ga0207650_10001317 Ga0207650_1000131713 281
468 3300025925 Ga0207650_10015921 Ga0207650_100159213 281
469 3300025926 Ga0207659_10005767 Ga0207659_100057673 281
470 3300025926 Ga0207659_10019879 Ga0207659_100198793 281
471 3300025926 Ga0207659_10045708 Ga0207659_100457083 281
472 3300025927 Ga0207687_10000072 Ga0207687_1000007263 281
473 3300025927 Ga0207687_10029549 Ga0207687_100295493 281
474 3300025927 Ga0207687_10105562 Ga0207687_101055622 281
475 3300025927 Ga0207687_10447810 Ga0207687_104478101 281
476 3300025928 Ga0207700_10001532 Ga0207700_1000153210 281
477 3300025928 Ga0207700_10014414 Ga0207700_100144142 281
478 3300025928 Ga0207700_10062990 Ga0207700_100629902 281
479 3300025929 Ga0207664_10016973 Ga0207664_100169734 281
480 3300025929 Ga0207664_10139891 Ga0207664_101398912 281
481 3300025929 Ga0207664_10326158 Ga0207664_103261581 281
482 3300025931 Ga0207644_10001292 Ga0207644_100012927 281
483 3300025931 Ga0207644_10221613 Ga0207644_102216132 281
484 3300025932 Ga0207690_10000140 Ga0207690_1000014066 281
485 3300025932 Ga0207690_10070065 Ga0207690_100700652 281
486 3300025932 Ga0207690_10383322 Ga0207690_103833221 281
487 3300025933 Ga0207706_10002144 Ga0207706_1000214412 281
488 3300025933 Ga0207706_10012048 Ga0207706_100120482 281
489 3300025933 Ga0207706_10042505 Ga0207706_100425055 281
490 3300025933 Ga0207706_10109084 Ga0207706_101090842 281
491 3300025934 Ga0207686_10001034 Ga0207686_100010344 281
492 3300025934 Ga0207686_10120810 Ga0207686_101208102 281
493 3300025935 Ga0207709_10001423 Ga0207709_100014237 281
494 3300025935 Ga0207709_10015190 Ga0207709_100151903 281
495 3300025936 Ga0207670_10005263 Ga0207670_100052634 281
496 3300025936 Ga0207670_10015623 Ga0207670_100156233 281
497 3300025936 Ga0207670_10066092 Ga0207670_100660922 281
498 3300025937 Ga0207669_10000176 Ga0207669_1000017621 281
499 3300025938 Ga0207704_10000086 Ga0207704_100000862 281
500 3300025938 Ga0207704_10009100 Ga0207704_100091006 281
501 3300025939 Ga0207665_10000872 Ga0207665_100008727 281
502 3300025939 Ga0207665_10135014 Ga0207665_101350142 281
503 3300025939 Ga0207665_10159348 Ga0207665_101593482 281
504 3300025939 Ga0207665_10207106 Ga0207665_102071062 281
505 3300025940 Ga0207691_10000214 Ga0207691_1000021461 281
506 3300025940 Ga0207691_10003307 Ga0207691_1000330712 281
507 3300025941 Ga0207711_10001106 Ga0207711_100011067 281
508 3300025941 Ga0207711_10006359 Ga0207711_100063593 281
509 3300025941 Ga0207711_10036936 Ga0207711_100369363 281
510 3300025942 Ga0207689_10000366 Ga0207689_1000036625 281
511 3300025942 Ga0207689_10114162 Ga0207689_101141623 281
512 3300025942 Ga0207689_10505602 Ga0207689_105056021 281
513 3300025944 Ga0207661_10000087 Ga0207661_1000008710 281
514 3300025944 Ga0207661_10470341 Ga0207661_104703411 281
515 3300025945 Ga0207679_10000029 Ga0207679_1000002925 281
516 3300025945 Ga0207679_10061554 Ga0207679_100615541 281
517 3300025945 Ga0207679_10090278 Ga0207679_100902783 281
518 3300025949 Ga0207667_10009257 Ga0207667_100092579 281
519 3300025949 Ga0207667_10255367 Ga0207667_102553672 281
520 3300025949 Ga0207667_10345730 Ga0207667_103457302 281
521 3300025960 Ga0207651_10000264 Ga0207651_1000026424 281
522 3300025960 Ga0207651_10355951 Ga0207651_103559511 281
523 3300025960 Ga0207651_10411686 Ga0207651_104116862 281
524 3300025961 Ga0207712_10001547 Ga0207712_100015477 281
525 3300025961 Ga0207712_10013434 Ga0207712_100134342 281
526 3300025961 Ga0207712_10584713 Ga0207712_105847131 281
527 3300025972 Ga0207668_10005954 Ga0207668_100059547 281
528 3300025981 Ga0207640_10001474 Ga0207640_1000147410 281
529 3300025981 Ga0207640_10046782 Ga0207640_100467823 281
530 3300025986 Ga0207658_10034469 Ga0207658_100344692 281
531 3300025986 Ga0207658_10274950 Ga0207658_102749501 281
532 3300025986 Ga0207658_10754531 Ga0207658_107545311 281
533 3300026023 Ga0207677_10001187 Ga0207677_100011878 281
534 3300026023 Ga0207677_10403070 Ga0207677_104030702 281
535 3300026035 Ga0207703_10003109 Ga0207703_100031099 281
536 3300026035 Ga0207703_10030388 Ga0207703_100303883 281
537 3300026035 Ga0207703_10262331 Ga0207703_102623312 281
538 3300026041 Ga0207639_10012878 Ga0207639_100128786 281
539 3300026041 Ga0207639_10096051 Ga0207639_100960512 281
540 3300026041 Ga0207639_10204912 Ga0207639_102049122 281
541 3300026067 Ga0207678_10011175 Ga0207678_100111752 281
542 3300026067 Ga0207678_10012004 Ga0207678_100120048 281
543 3300026067 Ga0207678_10038765 Ga0207678_100387652 281
544 3300026067 Ga0207678_10051057 Ga0207678_100510572 281
545 3300026075 Ga0207708_10000124 Ga0207708_1000012435 281
546 3300026075 Ga0207708_10007956 Ga0207708_100079567 281
547 3300026075 Ga0207708_10025817 Ga0207708_100258172 281
548 3300026088 Ga0207641_10000476 Ga0207641_100004762 281
549 3300026088 Ga0207641_10183043 Ga0207641_101830431 281
550 3300026089 Ga0207648_10000072 Ga0207648_100000722 281
551 3300026095 Ga0207676_10000512 Ga0207676_1000051237 281
552 3300026116 Ga0207674_10000697 Ga0207674_1000069741 281
553 3300026116 Ga0207674_10228157 Ga0207674_102281572 281
554 3300026116 Ga0207674_10570773 Ga0207674_105707731 281
555 3300026118 Ga0207675_100005225 Ga0207675_10000522510 281
556 3300026118 Ga0207675_100030237 Ga0207675_1000302372 281
557 3300026118 Ga0207675_100171642 Ga0207675_1001716422 281
558 3300026121 Ga0207683_10000029 Ga0207683_1000002912 281
559 3300026121 Ga0207683_10010209 Ga0207683_100102098 281
560 3300026121 Ga0207683_10049139 Ga0207683_100491393 281
561 3300026121 Ga0207683_10058105 Ga0207683_100581053 281
562 3300026142 Ga0207698_10000523 Ga0207698_100005235 281
563 3300026142 Ga0207698_10006814 Ga0207698_100068148 281
564 3300026142 Ga0207698_10105850 Ga0207698_101058502 281
565 3300027252 Ga0209973_1002360 Ga0209973_10023601 281
566 3300027617 Ga0210002_1000355 Ga0210002_10003553 281
567 3300027695 Ga0209966_1012566 Ga0209966_10125661 281
568 3300027717 Ga0209998_10002116 Ga0209998_100021162 281
569 3300027876 Ga0209974_10002631 Ga0209974_100026312 281
570 3300027876 Ga0209974_10037946 Ga0209974_100379462 281
571 3300027907 Ga0207428_10000100 Ga0207428_10000100124 281
572 3300027907 Ga0207428_10000115 Ga0207428_1000011544 281
573 3300027907 Ga0207428_10000228 Ga0207428_1000022824 281
574 3300027907 Ga0207428_10237846 Ga0207428_102378462 281
575 3300028379 Ga0268266_10127554 Ga0268266_101275542 281
576 3300028380 Ga0268265_10001240 Ga0268265_1000124019 281
577 3300028380 Ga0268265_10011857 Ga0268265_100118572 281
578 3300028381 Ga0268264_10002968 Ga0268264_100029687 281
579 3300028381 Ga0268264_10098649 Ga0268264_100986492 281
580 3300031241 Ga0265325_10000533 Ga0265325_100005339 281
581 3300031247 Ga0265340_10008415 Ga0265340_100084156 281
582 3300031595 Ga0265313_10010623 Ga0265313_100106233 281
583 3300031712 Ga0265342_10000896 Ga0265342_1000089628 281
584 3300031712 Ga0265342_10127184 Ga0265342_101271841 281
585 3300034816 Ga0373930_0000262 Ga0373930_0000262_5026_5871 281
586 3300034816 Ga0373930_0016837 Ga0373930_0016837_104_949 281
587 3300034817 Ga0373948_0003895 Ga0373948_0003895_83_928 281
588 3300034817 Ga0373948_0010128 Ga0373948_0010128_245_1090 281
589 3300034817 Ga0373948_0024216 Ga0373948_0024216_274_1125 281
590 3300034818 Ga0373950_0005031 Ga0373950_0005031_561_1406 281
591 3300034819 Ga0373958_0001890 Ga0373958_0001890_269_1120 281
592 3300034819 Ga0373958_0006596 Ga0373958_0006596_760_1605 281
593 3300034820 Ga0373959_0003651 Ga0373959_0003651_499_1344 281
594 3300034820 Ga0373959_0019894 Ga0373959_0019894_181_1032 281
595 3300034957 Ga0373938_0000290 Ga0373938_0000290_2918_3763 281
596 3300034957 Ga0373938_0000662 Ga0373938_0000662_163_1008 281
597 3300035083 Ga0373926_0090927 Ga0373926_0090927_278_1123 281
598 3300035084 Ga0373928_0000789 Ga0373928_0000789_3798_4643 281
599 3300035084 Ga0373928_0006995 Ga0373928_0006995_1257_2108 281
600 3300035084 Ga0373928_0009522 Ga0373928_0009522_591_1436 281
601 3300035085 Ga0373929_0002403 Ga0373929_0002403_1873_2724 281
602 3300035085 Ga0373929_0006971 Ga0373929_0006971_48_893 281
603 3300035086 Ga0373934_0046329 Ga0373934_0046329_483_1487 281
604 3300035088 Ga0373940_0050600 Ga0373940_0050600_245_1090 281
605 3300035088 Ga0373940_0071890 Ga0373940_0071890_11_856 281
606 3300035090 Ga0373949_0000938 Ga0373949_0000938_5026_5871 281
607 3300035090 Ga0373949_0001649 Ga0373949_0001649_2916_3761 281
608 3300035091 Ga0373951_0000715 Ga0373951_0000715_5245_6090 281
609 3300035091 Ga0373951_0005147 Ga0373951_0005147_1438_2283 281
610 3300035091 Ga0373951_0035857 Ga0373951_0035857_101_946 281
611 3300035092 Ga0373952_0000298 Ga0373952_0000298_4243_5088 281
612 3300035092 Ga0373952_0002466 Ga0373952_0002466_264_1109 281
613 3300035111 Ga0373923_0054370 Ga0373923_0054370_628_1491 281
614 3300035112 Ga0373932_0000172 Ga0373932_0000172_1730_2575 281
615 3300035112 Ga0373932_0008064 Ga0373932_0008064_1466_2317 281
616 3300035113 Ga0373936_0004177 Ga0373936_0004177_3038_3883 281
617 3300035113 Ga0373936_0059349 Ga0373936_0059349_561_1424 281
618 3300035113 Ga0373936_0096497 Ga0373936_0096497_339_1184 281
619 3300035114 Ga0373939_0000500 Ga0373939_0000500_1182_2027 281
620 3300035114 Ga0373939_0007393 Ga0373939_0007393_1505_2350 281
621 3300035115 Ga0373941_0001751 Ga0373941_0001751_3804_4649 281
622 3300035115 Ga0373941_0013482 Ga0373941_0013482_1135_1986 281
623 3300035116 Ga0373945_0002996 Ga0373945_0002996_1409_2254 281
624 3300035116 Ga0373945_0010893 Ga0373945_0010893_163_1008 281
625 3300035116 Ga0373945_0076277 Ga0373945_0076277_280_1143 281
626 3300035117 Ga0373953_0001475 Ga0373953_0001475_5362_6207 281
627 3300035118 Ga0373954_0050033 Ga0373954_0050033_593_1438 281
628 3300035119 Ga0373956_0142721 Ga0373956_0142721_245_1090 281
629 3300035119 Ga0373956_0181184 Ga0373956_0181184_77_922 281
630 3300035120 Ga0373957_0028243 Ga0373957_0028243_362_1366 281
631 3300035121 Ga0373960_0001140 Ga0373960_0001140_3737_4582 281
632 3300035121 Ga0373960_0001458 Ga0373960_0001458_2321_3166 281
633 3300035170 Ga0373943_0015808 Ga0373943_0015808_1848_2699 281
634 3300035170 Ga0373943_0017540 Ga0373943_0017540_1251_2096 281
635 3300035171 Ga0373946_0021621 Ga0373946_0021621_1144_2007 281
636 3300035172 Ga0373955_0011599 Ga0373955_0011599_2881_3885 281
637 3300035172 Ga0373955_0023581 Ga0373955_0023581_1357_2202 281
638 3300035172 Ga0373955_0027187 Ga0373955_0027187_1806_2651 281
639 3300035172 Ga0373955_0107444 Ga0373955_0107444_673_1518 281
640 3300035172 Ga0373955_0129822 Ga0373955_0129822_395_1240 281
641 3300035207 Ga0373942_0001552 Ga0373942_0001552_5006_5851 281
642 3300035241 Ga0373961_0000196 Ga0373961_0000196_11409_12254 281
643 3300035241 Ga0373961_0001345 Ga0373961_0001345_4443_5288 281
644 3300035241 Ga0373961_0003263 Ga0373961_0003263_1287_2138 281
645 3300035242 Ga0373962_0000310 Ga0373962_0000310_4544_5389 281
646 3300035242 Ga0373962_0001593 Ga0373962_0001593_1603_2448 281
647 3300035242 Ga0373962_0071476 Ga0373962_0071476_28_873 281
648 3300035410 Ga0373924_0027636 Ga0373924_0027636_24_869 281
649 3300035410 Ga0373924_0071717 Ga0373924_0071717_395_1240 281
650 3300035691 Ga0373931_0004010 Ga0373931_0004010_1507_2352 281
651 3300035691 Ga0373931_0008212 Ga0373931_0008212_3553_4398 281
652 3300035691 Ga0373931_0031253 Ga0373931_0031253_225_1076 281
653 3300035691 Ga0373931_0032881 Ga0373931_0032881_1810_2667 281
654 3300035691 Ga0373931_0088107 Ga0373931_0088107_832_1677 281
655 3300035691 Ga0373931_0164382 Ga0373931_0164382_154_999 281
656 3300035692 Ga0373935_0012655 Ga0373935_0012655_1012_1863 281
657 3300035692 Ga0373935_0020024 Ga0373935_0020024_2958_3803 281
658 3300035695 Ga0373927_0042280 Ga0373927_0042280_674_1519 281
659 3300035695 Ga0373927_0095358 Ga0373927_0095358_971_1816 281
660 3300035724 Ga0373933_0001949 Ga0373933_0001949_10600_11445 281
661 3300035724 Ga0373933_0006597 Ga0373933_0006597_3957_4961 281
662 3300035724 Ga0373933_0008978 Ga0373933_0008978_4114_4959 281
663 3300035724 Ga0373933_0032120 Ga0373933_0032120_1120_1965 281
664 3300035724 Ga0373933_0162105 Ga0373933_0162105_18_863 281
665 3300035725 Ga0373947_0000288 Ga0373947_0000288_2589_3440 281
666 3300035725 Ga0373947_0008353 Ga0373947_0008353_1822_2667 281
667 3300035725 Ga0373947_0103872 Ga0373947_0103872_356_1201 281
668 3300036401 Ga0373937_0005192 Ga0373937_0005192_9199_10044 281
669 3300036401 Ga0373937_0014259 Ga0373937_0014259_593_1438 281
670 3300036401 Ga0373937_0025577 Ga0373937_0025577_109_1113 281
671 3300036401 Ga0373937_0266689 Ga0373937_0266689_496_1341 281
672 3300036401 Ga0373937_0286285 Ga0373937_0286285_644_1489 281
673 3300037068 Ga0373925_0001787 Ga0373925_0001787_3349_4200 281
674 3300037068 Ga0373925_0007364 Ga0373925_0007364_3751_4596 281
675 3300037068 Ga0373925_0043674 Ga0373925_0043674_495_1358 281
676 3300037068 Ga0373925_0173237 Ga0373925_0173237_685_1689 281
677 3300037068 Ga0373925_0211362 Ga0373925_0211362_359_1204 281
678 3300037312 Ga0395899_0223910 Ga0395899_0223910_160_1005 281
679 3300037466 Ga0395898_0112889 Ga0395898_0112889_535_1380 281
680 3300038443 Ga0395901_0057774 Ga0395901_0057774_331_1176 281
681 3300039437 Ga0436365_1087995 Ga0436365_1087995_476_1321 281
682 3300042461 Ga0439460_0007277 Ga0439460_0007277_1808_2653 281
683 3300042876 Ga0451577_0010248 Ga0451577_0010248_2650_3495 281
684 3300046454 Ga0495592_0009025 Ga0495592_0009025_4631_5476 281
685 3300046454 Ga0495592_0049987 Ga0495592_0049987_636_1640 281
686 3300046454 Ga0495592_0262206 Ga0495592_0262206_223_1068 281
687 3300046455 Ga0495603_0047130 Ga0495603_0047130_307_1170 281
688 3300046459 Ga0495629_0000183 Ga0495629_0000183_48959_49810 281
689 3300046459 Ga0495629_0020325 Ga0495629_0020325_2041_2904 281
690 3300046461 Ga0495641_0016655 Ga0495641_0016655_496_1347 281
691 3300046461 Ga0495641_0019503 Ga0495641_0019503_1935_2780 281
692 3300046461 Ga0495641_0052430 Ga0495641_0052430_987_1832 281
693 3300046462 Ga0495651_0001256 Ga0495651_0001256_15379_16224 281
694 3300046462 Ga0495651_0004540 Ga0495651_0004540_2980_3984 281
695 3300046462 Ga0495651_0023671 Ga0495651_0023671_183_1028 281
696 3300046462 Ga0495651_0064250 Ga0495651_0064250_1583_2428 281
697 3300046463 Ga0495653_0046543 Ga0495653_0046543_1078_1923 281
698 3300046463 Ga0495653_0057318 Ga0495653_0057318_1797_2660 281
699 3300046463 Ga0495653_0117328 Ga0495653_0117328_128_979 281
700 3300046472 Ga0495580_0080566 Ga0495580_0080566_364_1227 281
701 3300046472 Ga0495580_0120946 Ga0495580_0120946_941_1786 281
702 3300046472 Ga0495580_0123433 Ga0495580_0123433_438_1289 281
703 3300046473 Ga0495582_0001748 Ga0495582_0001748_4471_5322 281
704 3300046473 Ga0495582_0002465 Ga0495582_0002465_8745_9590 281
705 3300046473 Ga0495582_0097571 Ga0495582_0097571_629_1474 281
706 3300046475 Ga0495639_0015609 Ga0495639_0015609_2064_2909 281
707 3300046476 Ga0495662_0019936 Ga0495662_0019936_1576_2421 281
708 3300046476 Ga0495662_0052366 Ga0495662_0052366_832_1677 281
709 3300046477 Ga0495664_0007322 Ga0495664_0007322_4458_5303 281
710 3300046477 Ga0495664_0007547 Ga0495664_0007547_236_1081 281
711 3300046477 Ga0495664_0026199 Ga0495664_0026199_2284_3147 281
712 3300046477 Ga0495664_0071039 Ga0495664_0071039_563_1408 281
713 3300046491 Ga0495584_0023574 Ga0495584_0023574_125_988 281
714 3300046491 Ga0495584_0065458 Ga0495584_0065458_647_1492 281
715 3300046492 Ga0495585_0017046 Ga0495585_0017046_3182_4045 281
716 3300046499 Ga0495594_0068785 Ga0495594_0068785_85_936 281
717 3300046499 Ga0495594_0081400 Ga0495594_0081400_331_1176 281
718 3300046499 Ga0495594_0087707 Ga0495594_0087707_403_1266 281
719 3300046501 Ga0495607_0019505 Ga0495607_0019505_1393_2256 281
720 3300046511 Ga0495608_0000646 Ga0495608_0000646_9017_9862 281
721 3300046511 Ga0495608_0019174 Ga0495608_0019174_673_1677 281
722 3300046511 Ga0495608_0073236 Ga0495608_0073236_890_1753 281
723 3300046514 Ga0495618_0025077 Ga0495618_0025077_519_1364 281
724 3300046516 Ga0495628_0001902 Ga0495628_0001902_7432_8436 281
725 3300046516 Ga0495628_0105447 Ga0495628_0105447_521_1366 281
726 3300046516 Ga0495628_0246548 Ga0495628_0246548_422_1267 281
727 3300046517 Ga0495630_0086143 Ga0495630_0086143_484_1329 281
728 3300046517 Ga0495630_0137814 Ga0495630_0137814_936_1781 281
729 3300046520 Ga0495637_0049397 Ga0495637_0049397_170_1033 281
730 3300046522 Ga0495643_0132716 Ga0495643_0132716_266_1111 281
731 3300046523 Ga0495644_0000234 Ga0495644_0000234_25002_25865 281
732 3300046526 Ga0495666_0019944 Ga0495666_0019944_367_1212 281
733 3300046529 Ga0495652_0012330 Ga0495652_0012330_5577_6422 281
734 3300046529 Ga0495652_0039217 Ga0495652_0039217_2085_3089 281
735 3300046529 Ga0495652_0055115 Ga0495652_0055115_2432_3277 281
736 3300046531 Ga0495665_0039729 Ga0495665_0039729_1270_2115 281
737 3300046533 Ga0495640_0018843 Ga0495640_0018843_2808_3671 281
738 3300046535 Ga0495586_0102700 Ga0495586_0102700_384_1229 281
739 3300046536 Ga0495587_0000770 Ga0495587_0000770_20042_20887 281
740 3300046539 Ga0495621_0082200 Ga0495621_0082200_85_948 281
741 3300046543 Ga0495645_0010241 Ga0495645_0010241_3509_4354 281
742 3300046543 Ga0495645_0067555 Ga0495645_0067555_1570_2415 281
743 3300046543 Ga0495645_0074432 Ga0495645_0074432_49_996 281
744 3300046557 Ga0495622_0026407 Ga0495622_0026407_108_953 281
745 3300046557 Ga0495622_0036966 Ga0495622_0036966_358_1221 281
746 3300046557 Ga0495622_0115235 Ga0495622_0115235_224_1075 281
747 3300046558 Ga0495633_0055300 Ga0495633_0055300_936_1793 281
748 3300046558 Ga0495633_0132744 Ga0495633_0132744_84_947 281
749 3300046559 Ga0495667_0012785 Ga0495667_0012785_4535_5398 281
750 3300046559 Ga0495667_0013632 Ga0495667_0013632_197_1042 281
751 3300046559 Ga0495667_0021370 Ga0495667_0021370_1766_2611 281
752 3300046559 Ga0495667_0231034 Ga0495667_0231034_85_1089 281
753 3300046615 Ga0495656_0000502 Ga0495656_0000502_537_1400 281
754 3300046642 Ga0495634_0005519 Ga0495634_0005519_236_1081 281
755 3300046642 Ga0495634_0029394 Ga0495634_0029394_2736_3581 281
756 3300046663 Ga0495635_0000812 Ga0495635_0000812_9649_10494 281
757 3300046663 Ga0495635_0068842 Ga0495635_0068842_622_1467 281
758 3300046663 Ga0495635_0078343 Ga0495635_0078343_1032_1895 281
759 3300046663 Ga0495635_0090134 Ga0495635_0090134_708_1559 281
760 3300046664 Ga0495659_0019422 Ga0495659_0019422_142_1005 281
761 3300046665 Ga0495661_0133436 Ga0495661_0133436_301_1164 281
762 3300046674 Ga0495588_0018849 Ga0495588_0018849_1221_2066 281
763 3300046674 Ga0495588_0049139 Ga0495588_0049139_825_1688 281
764 3300046675 Ga0495657_0005959 Ga0495657_0005959_7976_8821 281
765 3300046675 Ga0495657_0073198 Ga0495657_0073198_1069_1914 281
766 3300046678 Ga0495599_0003370 Ga0495599_0003370_6677_7681 281
767 3300046679 Ga0495623_0001381 Ga0495623_0001381_6127_6972 281
768 3300046679 Ga0495623_0007001 Ga0495623_0007001_2895_3899 281
769 3300046680 Ga0495646_0006169 Ga0495646_0006169_2351_3196 281
770 3300046680 Ga0495646_0101675 Ga0495646_0101675_712_1557 281
771 3300046680 Ga0495646_0225582 Ga0495646_0225582_42_989 281
772 3300046681 Ga0495647_0010732 Ga0495647_0010732_636_1487 281
773 3300046683 Ga0495658_0026339 Ga0495658_0026339_280_1143 281
774 3300046683 Ga0495658_0033999 Ga0495658_0033999_1347_2192 281
775 3300046683 Ga0495658_0100438 Ga0495658_0100438_780_1631 281
776 3300046684 Ga0495669_0025004 Ga0495669_0025004_737_1600 281
777 3300046689 Ga0495613_0103367 Ga0495613_0103367_757_1602 281
778 3300046689 Ga0495613_0174224 Ga0495613_0174224_376_1221 281
779 3300046690 Ga0495624_0022854 Ga0495624_0022854_1861_2706 281
780 3300046690 Ga0495624_0040556 Ga0495624_0040556_663_1508 281
781 3300046690 Ga0495624_0043892 Ga0495624_0043892_425_1288 281
782 3300046691 Ga0495670_0001992 Ga0495670_0001992_1265_2128 281
783 3300046809 Ga0495600_0001477 Ga0495600_0001477_9417_10421 281
784 3300046809 Ga0495600_0071321 Ga0495600_0071321_255_1118 281
785 3300046809 Ga0495600_0122193 Ga0495600_0122193_775_1620 281
786 3300047315 Ga0495581_0129470 Ga0495581_0129470_268_1113 281
787 3300047317 Ga0495604_0079050 Ga0495604_0079050_354_1217 281
788 3300047317 Ga0495604_0093021 Ga0495604_0093021_1356_2201 281
789 3300047319 Ga0495674_0058715 Ga0495674_0058715_200_1045 281
790 3300047319 Ga0495674_0147612 Ga0495674_0147612_628_1473 281
791 3300047319 Ga0495674_0254663 Ga0495674_0254663_281_1126 281
792 3300047321 Ga0495676_0031961 Ga0495676_0031961_840_1691 281
793 3300047321 Ga0495676_0047264 Ga0495676_0047264_717_1562 281
794 3300047322 Ga0495680_0006835 Ga0495680_0006835_649_1494 281
795 3300047322 Ga0495680_0025234 Ga0495680_0025234_219_1064 281
796 3300047322 Ga0495680_0045027 Ga0495680_0045027_1527_2378 281
797 3300047322 Ga0495680_0047807 Ga0495680_0047807_61_906 281
798 3300047322 Ga0495680_0150937 Ga0495680_0150937_794_1639 281
799 3300047444 Ga0495675_0007988 Ga0495675_0007988_4406_5251 281
800 3300047446 Ga0495679_018405 Ga0495679_018405_377_1240 281
801 3300047471 Ga0495684_0008581 Ga0495684_0008581_4563_5426 281
802 3300047471 Ga0495684_0019509 Ga0495684_0019509_2127_2972 281
803 3300047471 Ga0495684_0152115 Ga0495684_0152115_41_1045 281
804 3300047471 Ga0495684_0248375 Ga0495684_0248375_357_1202 281
805 3300047471 Ga0495684_0262639 Ga0495684_0262639_383_1228 281
806 3300047673 Ga0495593_0011432 Ga0495593_0011432_1573_2424 281
807 3300048088 Ga0495602_0020689 Ga0495602_0020689_88_1092 281
808 3300048088 Ga0495602_0195930 Ga0495602_0195930_431_1276 281
809 3300048089 Ga0495614_0024203 Ga0495614_0024203_182_1045 281
810 3300048089 Ga0495614_0052376 Ga0495614_0052376_361_1212 281
811 3300048903 Ga0496100_0000530 Ga0496100_0000530_19_864 281
812 3300048903 Ga0496100_0011766 Ga0496100_0011766_3660_4505 281
813 3300048903 Ga0496100_0042055 Ga0496100_0042055_1982_2833 281
814 3300048903 Ga0496100_0055648 Ga0496100_0055648_1726_2571 281
815 3300048903 Ga0496100_0261903 Ga0496100_0261903_28_873 281
816 3300048904 Ga0496101_0000189 Ga0496101_0000189_43148_43993 281
817 3300048904 Ga0496101_0003519 Ga0496101_0003519_4274_5119 281
818 3300048904 Ga0496101_0024583 Ga0496101_0024583_1399_2244 281
819 3300048904 Ga0496101_0070644 Ga0496101_0070644_1471_2322 281
820 3300048904 Ga0496101_0338230 Ga0496101_0338230_158_1003 281
821 3300048904 Ga0496101_0460570 Ga0496101_0460570_60_905 281
822 3300048905 Ga0496102_0006150 Ga0496102_0006150_5092_5937 281
823 3300048905 Ga0496102_0011115 Ga0496102_0011115_5875_6720 281
824 3300048905 Ga0496102_0022131 Ga0496102_0022131_2684_3529 281
825 3300048905 Ga0496102_0043206 Ga0496102_0043206_2364_3209 281
826 3300048905 Ga0496102_0052973 Ga0496102_0052973_1931_2782 281
827 3300048905 Ga0496102_0123061 Ga0496102_0123061_459_1304 281
828 3300048905 Ga0496102_0664937 Ga0496102_0664937_38_883 281
829 3300048906 Ga0496103_0001693 Ga0496103_0001693_4261_5106 281
830 3300048906 Ga0496103_0006234 Ga0496103_0006234_4780_5625 281
831 3300048906 Ga0496103_0056304 Ga0496103_0056304_1120_1965 281
832 3300048906 Ga0496103_0124913 Ga0496103_0124913_56_907 281
833 3300048907 Ga0496104_0001051 Ga0496104_0001051_7837_8682 281
834 3300048907 Ga0496104_0001268 Ga0496104_0001268_10195_11163 281
835 3300048907 Ga0496104_0011783 Ga0496104_0011783_3205_4050 281
836 3300048907 Ga0496104_0032205 Ga0496104_0032205_2944_3789 281
837 3300048907 Ga0496104_0032453 Ga0496104_0032453_1955_2800 281
838 3300048907 Ga0496104_0077033 Ga0496104_0077033_1692_2537 281
839 3300048907 Ga0496104_0086587 Ga0496104_0086587_373_1218 281
840 3300048907 Ga0496104_0110711 Ga0496104_0110711_917_1768 281
841 3300048907 Ga0496104_0175946 Ga0496104_0175946_335_1186 281
842 3300048908 Ga0496105_0010093 Ga0496105_0010093_5546_6391 281
843 3300048908 Ga0496105_0017656 Ga0496105_0017656_4793_5644 281
844 3300048908 Ga0496105_0030416 Ga0496105_0030416_184_1029 281
845 3300048908 Ga0496105_0039608 Ga0496105_0039608_2798_3649 281
846 3300048908 Ga0496105_0045225 Ga0496105_0045225_1826_2671 281
847 3300048908 Ga0496105_0051601 Ga0496105_0051601_1607_2575 281
848 3300048908 Ga0496105_0147278 Ga0496105_0147278_996_1841 281
849 3300048908 Ga0496105_0243614 Ga0496105_0243614_557_1402 281
850 3300048909 Ga0496106_0002185 Ga0496106_0002185_9343_10188 281
851 3300048909 Ga0496106_0002661 Ga0496106_0002661_10381_11226 281
852 3300048909 Ga0496106_0039568 Ga0496106_0039568_2163_3008 281
853 3300048909 Ga0496106_0059857 Ga0496106_0059857_1074_1919 281
854 3300048909 Ga0496106_0060539 Ga0496106_0060539_1964_2815 281
855 3300048909 Ga0496106_0062439 Ga0496106_0062439_681_1526 281
856 3300048909 Ga0496106_0119200 Ga0496106_0119200_909_1754 281
857 3300048909 Ga0496106_0151220 Ga0496106_0151220_828_1673 281
858 3300048909 Ga0496106_0171433 Ga0496106_0171433_591_1436 281
859 3300048910 Ga0496107_0005021 Ga0496107_0005021_2038_2883 281
860 3300048910 Ga0496107_0007982 Ga0496107_0007982_4424_5269 281
861 3300048910 Ga0496107_0042731 Ga0496107_0042731_2149_2994 281
862 3300048910 Ga0496107_0059642 Ga0496107_0059642_909_1760 281
863 3300048910 Ga0496107_0063686 Ga0496107_0063686_1629_2474 281
864 3300048910 Ga0496107_0082326 Ga0496107_0082326_884_1729 281
865 3300048910 Ga0496107_0123007 Ga0496107_0123007_618_1463 281
866 3300048910 Ga0496107_0224208 Ga0496107_0224208_541_1386 281
867 3300048910 Ga0496107_0266786 Ga0496107_0266786_97_942 281
868 3300048911 Ga0496108_0004716 Ga0496108_0004716_5050_5895 281
869 3300048911 Ga0496108_0007288 Ga0496108_0007288_6281_7126 281
870 3300048911 Ga0496108_0020178 Ga0496108_0020178_3729_4574 281
871 3300048911 Ga0496108_0022285 Ga0496108_0022285_4021_4872 281
872 3300048911 Ga0496108_0048722 Ga0496108_0048722_2035_2880 281
873 3300048911 Ga0496108_0052007 Ga0496108_0052007_1025_1870 281
874 3300048911 Ga0496108_0079257 Ga0496108_0079257_83_934 281
875 3300048911 Ga0496108_0155726 Ga0496108_0155726_494_1339 281
876 3300048912 Ga0496109_0000488 Ga0496109_0000488_24539_25384 281
877 3300048912 Ga0496109_0000937 Ga0496109_0000937_22888_23733 281
878 3300048912 Ga0496109_0006180 Ga0496109_0006180_2819_3664 281
879 3300048912 Ga0496109_0006447 Ga0496109_0006447_5464_6309 281
880 3300048912 Ga0496109_0076359 Ga0496109_0076359_732_1583 281
881 3300048912 Ga0496109_0131284 Ga0496109_0131284_754_1599 281
882 3300048912 Ga0496109_0134090 Ga0496109_0134090_1211_2056 281
883 3300048912 Ga0496109_0161236 Ga0496109_0161236_1070_1915 281
884 3300048913 Ga0496110_0010267 Ga0496110_0010267_6032_6877 281
885 3300048913 Ga0496110_0011374 Ga0496110_0011374_5543_6388 281
886 3300048913 Ga0496110_0060950 Ga0496110_0060950_71_922 281
887 3300048913 Ga0496110_0087623 Ga0496110_0087623_1851_2702 281
888 3300048913 Ga0496110_0176013 Ga0496110_0176013_745_1590 281
889 3300048913 Ga0496110_0186075 Ga0496110_0186075_831_1676 281
890 3300048914 Ga0496111_0043412 Ga0496111_0043412_1809_2654 281
891 3300048914 Ga0496111_0054114 Ga0496111_0054114_1234_2079 281
892 3300048914 Ga0496111_0073899 Ga0496111_0073899_1499_2350 281
893 3300048914 Ga0496111_0186421 Ga0496111_0186421_566_1411 281
894 3300048914 Ga0496111_0290393 Ga0496111_0290393_339_1184 281
895 3300048915 Ga0496112_0002119 Ga0496112_0002119_8497_9342 281
896 3300048915 Ga0496112_0030238 Ga0496112_0030238_1177_2022 281
897 3300048915 Ga0496112_0042689 Ga0496112_0042689_1499_2350 281
898 3300048915 Ga0496112_0072283 Ga0496112_0072283_2271_3116 281
899 3300048915 Ga0496112_0150683 Ga0496112_0150683_710_1558 281
900 3300048915 Ga0496112_0382388 Ga0496112_0382388_365_1216 281
901 3300048915 Ga0496112_0650680 Ga0496112_0650680_49_900 281
902 3300048916 Ga0496113_0007034 Ga0496113_0007034_2857_3702 281
903 3300048916 Ga0496113_0008963 Ga0496113_0008963_4970_5815 281
904 3300048916 Ga0496113_0036654 Ga0496113_0036654_917_1768 281
905 3300048916 Ga0496113_0094768 Ga0496113_0094768_56_907 281
906 3300048917 Ga0496114_0001444 Ga0496114_0001444_6176_7021 281
907 3300048917 Ga0496114_0056180 Ga0496114_0056180_680_1525 281
908 3300048917 Ga0496114_0067813 Ga0496114_0067813_648_1499 281
909 3300048917 Ga0496114_0147267 Ga0496114_0147267_85_930 281
910 3300048917 Ga0496114_0243562 Ga0496114_0243562_48_893 281
911 3300048917 Ga0496114_0256679 Ga0496114_0256679_646_1491 281
912 3300048918 Ga0496115_0010890 Ga0496115_0010890_4569_5414 281
913 3300048918 Ga0496115_0011115 Ga0496115_0011115_1601_2446 281
914 3300048918 Ga0496115_0023856 Ga0496115_0023856_2034_2879 281
915 3300048918 Ga0496115_0024977 Ga0496115_0024977_1709_2554 281
916 3300048918 Ga0496115_0052993 Ga0496115_0052993_433_1284 281
917 3300048918 Ga0496115_0061694 Ga0496115_0061694_562_1407 281
918 3300048918 Ga0496115_0062463 Ga0496115_0062463_1465_2316 281
919 3300048918 Ga0496115_0116398 Ga0496115_0116398_22_867 281
920 3300048918 Ga0496115_0309304 Ga0496115_0309304_418_1263 281
921 3300049569 Ga0501032_0032146 Ga0501032_0032146_2152_3003 281
922 3300049570 Ga0501033_0022284 Ga0501033_0022284_3446_4291 281
923 3300049571 Ga0501034_0062271 Ga0501034_0062271_1501_2352 281
924 3300049571 Ga0501034_0075137 Ga0501034_0075137_858_1709 281
925 3300049571 Ga0501034_0079867 Ga0501034_0079867_1962_2807 281
926 3300049571 Ga0501034_0496032 Ga0501034_0496032_11_856 281
927 3300049572 Ga0501036_0075408 Ga0501036_0075408_1899_2744 281
928 3300049572 Ga0501036_0133421 Ga0501036_0133421_1191_2036 281
929 3300049573 Ga0501037_0008863 Ga0501037_0008863_1395_2246 281
930 3300049573 Ga0501037_0153724 Ga0501037_0153724_778_1623 281
931 3300049574 Ga0501038_0091952 Ga0501038_0091952_1573_2424 281
932 3300049574 Ga0501038_0365413 Ga0501038_0365413_229_1074 281
933 3300049575 Ga0501039_0066340 Ga0501039_0066340_1907_2758 281
934 3300049575 Ga0501039_0072285 Ga0501039_0072285_1768_2613 281
935 3300049578 Ga0501042_0018045 Ga0501042_0018045_1655_2506 281
936 3300049579 Ga0501043_0058825 Ga0501043_0058825_771_1622 281
937 3300049580 Ga0501046_0008348 Ga0501046_0008348_2313_3164 281
938 3300049581 Ga0501047_0005574 Ga0501047_0005574_750_1595 281
939 3300049581 Ga0501047_0020602 Ga0501047_0020602_1960_2805 281
940 3300049582 Ga0501048_0011858 Ga0501048_0011858_2812_3663 281
941 3300049583 Ga0501067_0029331 Ga0501067_0029331_2155_3006 281
942 3300049583 Ga0501067_0083058 Ga0501067_0083058_349_1194 281
943 3300049584 Ga0501068_0021379 Ga0501068_0021379_2182_3033 281
944 3300049585 Ga0501069_0008627 Ga0501069_0008627_1706_2557 281
945 3300049585 Ga0501069_0050869 Ga0501069_0050869_794_1639 281
946 3300049586 Ga0501070_0037325 Ga0501070_0037325_2107_2952 281
947 3300049586 Ga0501070_0042299 Ga0501070_0042299_2149_3000 281
948 3300049586 Ga0501070_0335857 Ga0501070_0335857_34_879 281
949 3300049587 Ga0501071_0045909 Ga0501071_0045909_1596_2447 281
950 3300049592 Ga0501076_0019979 Ga0501076_0019979_4188_5033 281
951 3300049593 Ga0501077_0044390 Ga0501077_0044390_1940_2785 281
952 3300049593 Ga0501077_0053596 Ga0501077_0053596_1638_2483 281
953 3300049593 Ga0501077_0059008 Ga0501077_0059008_433_1278 281
954 3300049593 Ga0501077_0104465 Ga0501077_0104465_883_1728 281
955 3300049741 Ga0501079_0029585 Ga0501079_0029585_798_1649 281
956 3300049741 Ga0501079_0104827 Ga0501079_0104827_491_1336 281
957 3300049743 Ga0501081_0077791 Ga0501081_0077791_147_992 281
958 3300049744 Ga0501083_0142979 Ga0501083_0142979_494_1345 281
959 3300049744 Ga0501083_0147279 Ga0501083_0147279_494_1339 281
960 3300049822 Ga0501035_0096281 Ga0501035_0096281_383_1228 281
961 3300049822 Ga0501035_0161843 Ga0501035_0161843_317_1162 281
962 3300049822 Ga0501035_0277780 Ga0501035_0277780_417_1262 281
963 3300049823 Ga0501044_0000212 Ga0501044_0000212_33036_33887 281
964 3300049823 Ga0501044_0115183 Ga0501044_0115183_939_1784 281
965 3300049823 Ga0501044_0586978 Ga0501044_0586978_113_958 281
966 3300050491 nmdc:mga00v17_25398_c1 nmdc:mga00v17_25398_c1_1367_2212 281
967 3300050492 nmdc:mga0yw44_13330_c1 nmdc:mga0yw44_13330_c1_2623_3471 281
968 3300050492 nmdc:mga0yw44_23092_c1 nmdc:mga0yw44_23092_c1_2369_3214 281
969 3300050492 nmdc:mga0yw44_72764_c1 nmdc:mga0yw44_72764_c1_648_1493 281
970 3300050494 nmdc:mga06z11_129052_c1 nmdc:mga06z11_129052_c1_520_1368 281
971 3300050496 nmdc:mga07m45_64769_c1 nmdc:mga07m45_64769_c1_608_1453 281
972 3300050507 nmdc:mga05p37_22407_c1 nmdc:mga05p37_22407_c1_6448_7293 281
973 3300050507 nmdc:mga05p37_249482_c1 nmdc:mga05p37_249482_c1_1047_1892 281
974 3300050507 nmdc:mga05p37_40101_c1 nmdc:mga05p37_40101_c1_778_1623 281
975 3300050507 nmdc:mga05p37_436714_c1 nmdc:mga05p37_436714_c1_280_1125 281
976 3300050507 nmdc:mga05p37_505_c1 nmdc:mga05p37_505_c1_32033_32878 281
977 3300050507 nmdc:mga05p37_9120_c1 nmdc:mga05p37_9120_c1_9650_10495 281
978 3300050508 nmdc:mga09592_772_c1 nmdc:mga09592_772_c1_8136_8981 281
979 3300050509 nmdc:mga0qj67_165_c1 nmdc:mga0qj67_165_c1_36610_37455 281
980 3300050509 nmdc:mga0qj67_64449_c1 nmdc:mga0qj67_64449_c1_1963_2808 281
981 3300050510 nmdc:mga06r32_212095_c1 nmdc:mga06r32_212095_c1_219_1064 281
982 3300050510 nmdc:mga06r32_272949_c1 nmdc:mga06r32_272949_c1_615_1460 281
983 3300050510 nmdc:mga06r32_363440_c1 nmdc:mga06r32_363440_c1_465_1310 281
984 3300050510 nmdc:mga06r32_6147_c1 nmdc:mga06r32_6147_c1_3336_4181 281
985 3300050510 nmdc:mga06r32_660729_c1 nmdc:mga06r32_660729_c1_104_949 281
986 3300050510 nmdc:mga06r32_78142_c1 nmdc:mga06r32_78142_c1_431_1276 281
987 3300050511 nmdc:mga08y16_1045_c1 nmdc:mga08y16_1045_c1_13936_14781 281
988 3300050511 nmdc:mga08y16_12959_c1 nmdc:mga08y16_12959_c1_6016_6861 281
989 3300050511 nmdc:mga08y16_19941_c1 nmdc:mga08y16_19941_c1_1806_2651 281
990 3300050511 nmdc:mga08y16_264944_c1 nmdc:mga08y16_264944_c1_702_1547 281
991 3300050511 nmdc:mga08y16_2844_c1 nmdc:mga08y16_2844_c1_10221_11066 281
992 3300050511 nmdc:mga08y16_333700_c1 nmdc:mga08y16_333700_c1_18_863 281
993 3300050511 nmdc:mga08y16_497493_c1 nmdc:mga08y16_497493_c1_232_1077 281
994 3300050512 nmdc:mga0n895_122515_c1 nmdc:mga0n895_122515_c1_211_1056 281
995 3300050512 nmdc:mga0n895_189060_c1 nmdc:mga0n895_189060_c1_547_1392 281
996 3300050512 nmdc:mga0n895_24562_c1 nmdc:mga0n895_24562_c1_675_1520 281
997 3300050512 nmdc:mga0n895_2649_c1 nmdc:mga0n895_2649_c1_983_1828 281
998 3300050512 nmdc:mga0n895_45935_c1 nmdc:mga0n895_45935_c1_1384_2229 281
999 3300050512 nmdc:mga0n895_597460_c1 nmdc:mga0n895_597460_c1_237_1082 281
1000 3300050512 nmdc:mga0n895_613787_c1 nmdc:mga0n895_613787_c1_104_949 281
1001 3300050512 nmdc:mga0n895_76480_c1 nmdc:mga0n895_76480_c1_1546_2391 281
1002 3300050513 nmdc:mga0rr50_124153_c1 nmdc:mga0rr50_124153_c1_485_1336 281
1003 3300050513 nmdc:mga0rr50_1278_c1 nmdc:mga0rr50_1278_c1_176_1021 281
1004 3300050513 nmdc:mga0rr50_16037_c1 nmdc:mga0rr50_16037_c1_895_1740 281
1005 3300050513 nmdc:mga0rr50_192693_c1 nmdc:mga0rr50_192693_c1_16_861 281
1006 3300050514 nmdc:mga08x19_211521_c1 nmdc:mga08x19_211521_c1_372_1217 281
1007 3300050514 nmdc:mga08x19_23872_c1 nmdc:mga08x19_23872_c1_2891_3736 281
1008 3300050514 nmdc:mga08x19_95929_c1 nmdc:mga08x19_95929_c1_1098_1943 281
1009 3300050515 nmdc:mga0a205_15415_c1 nmdc:mga0a205_15415_c1_5573_6418 281
1010 3300050515 nmdc:mga0a205_1632_c1 nmdc:mga0a205_1632_c1_1236_2081 281
1011 3300050515 nmdc:mga0a205_20147_c1 nmdc:mga0a205_20147_c1_1839_2684 281
1012 3300050515 nmdc:mga0a205_237148_c1 nmdc:mga0a205_237148_c1_82_927 281
1013 3300050515 nmdc:mga0a205_565274_c1 nmdc:mga0a205_565274_c1_17_862 281
1014 3300050515 nmdc:mga0a205_81954_c1 nmdc:mga0a205_81954_c1_411_1262 281
1015 3300053077 Ga0495601_0000075 Ga0495601_0000075_47226_48230 281
1016 3300053077 Ga0495601_0000961 Ga0495601_0000961_6336_7181 281
1017 3300053077 Ga0495601_0001420 Ga0495601_0001420_6570_7415 281
1018 3300053077 Ga0495601_0018671 Ga0495601_0018671_898_1761 281
1019 3300053077 Ga0495601_0048186 Ga0495601_0048186_1627_2472 281
1020 3300053078 Ga0495612_0001336 Ga0495612_0001336_1704_2651 281
1021 3300053078 Ga0495612_0002112 Ga0495612_0002112_2718_3563 281
1022 3300053078 Ga0495612_0006592 Ga0495612_0006592_3399_4244 281
1023 3300053078 Ga0495612_0008176 Ga0495612_0008176_1048_1893 281
1024 3300053078 Ga0495612_0009466 Ga0495612_0009466_1928_2773 281
1025 3300053083 Ga0495655_0005569 Ga0495655_0005569_45_902 281
1026 3300053084 Ga0495595_0004598 Ga0495595_0004598_300_1145 281
1027 3300053084 Ga0495595_0005026 Ga0495595_0005026_1300_2163 281
1028 3300053084 Ga0495595_0005375 Ga0495595_0005375_2604_3608 281
1029 3300053084 Ga0495595_0023737 Ga0495595_0023737_825_1670 281
1030 3300053084 Ga0495595_0034986 Ga0495595_0034986_1307_2152 281
1031 3300053085 Ga0495619_0000211 Ga0495619_0000211_35474_36325 281
1032 3300053085 Ga0495619_0000315 Ga0495619_0000315_3688_4533 281
1033 3300053085 Ga0495619_0000907 Ga0495619_0000907_12113_13117 281
1034 3300053085 Ga0495619_0005328 Ga0495619_0005328_5791_6636 281
1035 3300053085 Ga0495619_0033900 Ga0495619_0033900_2117_2962 281
1036 3300053085 Ga0495619_0060054 Ga0495619_0060054_1433_2380 281
1037 3300053085 Ga0495619_0185501 Ga0495619_0185501_281_1126 281
1038 3300054114 Ga0501084_0033284 Ga0501084_0033284_1096_1947 281
1039 3300060353 Ga0501082_0010759 Ga0501082_0010759_6922_7773 281
1040 3300061734 Ga0530510_0323109 Ga0530510_0323109_109_954 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

196

333

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oge-assembly4.cif.gz_D crystal structure of a nucleotide sugar transporter 0.8272 2 280
5oge-assembly2.cif.gz_B crystal structure of a nucleotide sugar transporter 0.8195 2 280
5oge-assembly4.cif.gz_D crystal structure of a nucleotide sugar transporter 0.8194 2 280
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.8189 5 278
5oge-assembly3.cif.gz_H-2 crystal structure of a nucleotide sugar transporter 0.8182 2 280
ID Description Score Start End Superfamily
af_I1MX93_4_118_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8039 198 281 1.10.3730.20
af_A0A0R0GBE4_5_124_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8008 197 281 1.10.3730.20
af_Q8RWH8_5_118_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7979 198 281 1.10.3730.20
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.731 5 280 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7176 5 280 1.20.1740.10
ID Description Score Start End GO Terms
AF-V7H9D7-F1-model_v4 EamA domain-containing protein 0.9785 1 281 GO:0016020
AF-A0A090DDL3-F1-model_v4 EamA domain-containing protein 0.9781 1 281 GO:0016020
AF-A0A1I5ETQ7-F1-model_v4 EamA-like transporter family protein 0.9775 1 281 GO:0016020
AF-A0A3Q8YGF5-F1-model_v4 EamA family transporter 0.9768 1 281 GO:0016020
AF-A0A4U6C9U7-F1-model_v4 EamA family transporter 0.9762 1 281 GO:0016020

Feature Viewer

pLDDT pTM Quality
89.96 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map