F488780
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1039 | 372 | 2078 | 304 |
Family's Representative Sequence
| Representative Sequence | 3300005518|Ga0070699_100053909|Ga0070699_1000539093 |
| Length | 361 |
| Sequence | MSERRQLINLAYRLLGSLAEAEDAVQETYARWYAMTRQQQEAIESPGAWLTTVASRLCLDLLGSARARRERYVGEWLPEPLPERAEWISGRPGAAAADPADRVTLDESVSMAFLVVLESMTPAERVALILHDVFRYSFAEVAEIAGRTPAACRQLASSARRRIRASQAPASPAARQAGIVRAFKAAWEAKDIDALIGLLDPDATATADGGGLATTFLRPIEGGEQIARAWVVIANRAPSNMTFLERTVNGQPGLVAQQDGVTATVFAFDVAGDRIKHIWAVRNPKKLRPWTTGWRAAASHRVRSEPTPPSLHALPGGLGPPRLRRGKGQPAAASYSDHWQERTSGHPQGPRPPATTSGNGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 65 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 66 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 67 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 107 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 108 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 109 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 171 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 172 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 174 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 175 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 176 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 177 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 178 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 179 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 180 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 181 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 182 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 183 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 184 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 188 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 189 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 190 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 191 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 192 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 196 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 200 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 201 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 206 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 214 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 215 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 216 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 219 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 222 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 223 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 224 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 225 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 226 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 290 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 291 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 292 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 293 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 294 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 295 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 298 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 299 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 300 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 301 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 302 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 303 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 304 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 305 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 317 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 324 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 329 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 330 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 331 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 332 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 333 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 334 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 335 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 336 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 337 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 338 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 339 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 340 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 341 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 342 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 343 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 344 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 345 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 346 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 347 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 348 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 349 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 350 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 351 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 352 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 353 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 354 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 355 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 356 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 357 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 358 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 359 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 360 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 361 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 362 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 363 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 364 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 365 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 366 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 367 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 368 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 369 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 370 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 371 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 372 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.09 |
| Metatranscriptomes | 0.67 |
| Isolates | 4.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.15 |
| Nodule | 0.19 |
| Rhizoplane | 5.87 |
| Rhizosphere | 87.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070699_100053909 | 3300005518 | Bacteria | 3481 |
| 2 | JGI25407J50210_10020823 | 3300003373 | Bacteria | 1705 |
| 3 | JGI25407J50210_10022959 | 3300003373 | Bacteria | 1620 |
| 4 | Ga0006562J51391_1067189 | 3300003578 | Bacteria | 2160 |
| 5 | Ga0070658_10011944 | 3300005327 | Bacteria | 6973 |
| 6 | Ga0070658_10029511 | 3300005327 | Bacteria | 4406 |
| 7 | Ga0070658_10189631 | 3300005327 | Bacteria | 1733 |
| 8 | Ga0070676_10045501 | 3300005328 | Bacteria | 2557 |
| 9 | Ga0070683_100011495 | 3300005329 | Bacteria | 7656 |
| 10 | Ga0070683_100014960 | 3300005329 | Bacteria | 6805 |
| 11 | Ga0070683_100059997 | 3300005329 | Bacteria | 3535 |
| 12 | Ga0070683_100114284 | 3300005329 | Bacteria | 2548 |
| 13 | Ga0070683_100228096 | 3300005329 | Bacteria | 1770 |
| 14 | Ga0070683_100374565 | 3300005329 | Bacteria | 1356 |
| 15 | Ga0070670_100037114 | 3300005331 | Bacteria | 4193 |
| 16 | Ga0070680_100124046 | 3300005336 | Bacteria | 2157 |
| 17 | Ga0070682_100005687 | 3300005337 | Bacteria | 6948 |
| 18 | Ga0070682_100151362 | 3300005337 | Bacteria | 1592 |
| 19 | Ga0068868_100054655 | 3300005338 | Bacteria | 3148 |
| 20 | Ga0068868_100116078 | 3300005338 | Bacteria | 2180 |
| 21 | Ga0068868_100178983 | 3300005338 | Bacteria | 1758 |
| 22 | Ga0068868_100188550 | 3300005338 | Bacteria | 1714 |
| 23 | Ga0068868_100552028 | 3300005338 | Bacteria | 1015 |
| 24 | Ga0070660_100026523 | 3300005339 | Bacteria | 4314 |
| 25 | Ga0070660_100048090 | 3300005339 | Bacteria | 3275 |
| 26 | Ga0070660_100085264 | 3300005339 | Bacteria | 2484 |
| 27 | Ga0070660_100149314 | 3300005339 | Bacteria | 1878 |
| 28 | Ga0070660_100149635 | 3300005339 | Bacteria | 1876 |
| 29 | Ga0070689_100119117 | 3300005340 | Bacteria | 2107 |
| 30 | Ga0070689_100153064 | 3300005340 | Bacteria | 1861 |
| 31 | Ga0070689_100295229 | 3300005340 | Bacteria | 1348 |
| 32 | Ga0070691_10036799 | 3300005341 | Bacteria | 2308 |
| 33 | Ga0070691_10083390 | 3300005341 | Bacteria | 1568 |
| 34 | Ga0070661_100006301 | 3300005344 | Bacteria | 8183 |
| 35 | Ga0070661_100038387 | 3300005344 | Bacteria | 3486 |
| 36 | Ga0070692_10055550 | 3300005345 | Bacteria | 2070 |
| 37 | Ga0070668_100000999 | 3300005347 | Bacteria | 19811 |
| 38 | Ga0070668_100093892 | 3300005347 | Bacteria | 2368 |
| 39 | Ga0070668_100188855 | 3300005347 | Bacteria | 1687 |
| 40 | Ga0070675_100002751 | 3300005354 | Bacteria | 13216 |
| 41 | Ga0070675_100444516 | 3300005354 | Bacteria | 1162 |
| 42 | Ga0070671_100014133 | 3300005355 | Bacteria | 6446 |
| 43 | Ga0070671_100142491 | 3300005355 | Bacteria | 2023 |
| 44 | Ga0070671_100172373 | 3300005355 | Bacteria | 1830 |
| 45 | Ga0070688_100353060 | 3300005365 | Bacteria | 1077 |
| 46 | Ga0070659_100027135 | 3300005366 | Bacteria | 4409 |
| 47 | Ga0070659_100065344 | 3300005366 | Bacteria | 2881 |
| 48 | Ga0070667_100116861 | 3300005367 | Bacteria | 2316 |
| 49 | Ga0070667_100427126 | 3300005367 | Bacteria | 1209 |
| 50 | Ga0070709_10000477 | 3300005434 | Bacteria | 23762 |
| 51 | Ga0070709_10000627 | 3300005434 | Bacteria | 20180 |
| 52 | Ga0070709_10020435 | 3300005434 | Bacteria | 3841 |
| 53 | Ga0070709_10030131 | 3300005434 | Bacteria | 3253 |
| 54 | Ga0070709_10059486 | 3300005434 | Bacteria | 2426 |
| 55 | Ga0070709_10128682 | 3300005434 | Bacteria | 1726 |
| 56 | Ga0070709_10161538 | 3300005434 | Bacteria | 1558 |
| 57 | Ga0070709_10413892 | 3300005434 | Bacteria | 1009 |
| 58 | Ga0070714_100004636 | 3300005435 | Bacteria | 10374 |
| 59 | Ga0070714_100013944 | 3300005435 | Bacteria | 6449 |
| 60 | Ga0070714_100025486 | 3300005435 | Bacteria | 4881 |
| 61 | Ga0070714_100025879 | 3300005435 | Bacteria | 4846 |
| 62 | Ga0070714_100026874 | 3300005435 | Bacteria | 4760 |
| 63 | Ga0070714_100072928 | 3300005435 | Bacteria | 2973 |
| 64 | Ga0070714_100088662 | 3300005435 | Bacteria | 2707 |
| 65 | Ga0070714_100097470 | 3300005435 | Bacteria | 2585 |
| 66 | Ga0070714_100117078 | 3300005435 | Bacteria | 2366 |
| 67 | Ga0070714_100331826 | 3300005435 | Bacteria | 1424 |
| 68 | Ga0070713_100002040 | 3300005436 | Bacteria | 13058 |
| 69 | Ga0070713_100003954 | 3300005436 | Bacteria | 9851 |
| 70 | Ga0070713_100024161 | 3300005436 | Bacteria | 4730 |
| 71 | Ga0070713_100075084 | 3300005436 | Bacteria | 2866 |
| 72 | Ga0070713_100149785 | 3300005436 | Bacteria | 2074 |
| 73 | Ga0070713_100184136 | 3300005436 | Bacteria | 1878 |
| 74 | Ga0070713_100248638 | 3300005436 | Bacteria | 1621 |
| 75 | Ga0070713_100265690 | 3300005436 | Bacteria | 1569 |
| 76 | Ga0070713_100330546 | 3300005436 | Bacteria | 1410 |
| 77 | Ga0070710_10000164 | 3300005437 | Bacteria | 30733 |
| 78 | Ga0070710_10001276 | 3300005437 | Bacteria | 11964 |
| 79 | Ga0070710_10065636 | 3300005437 | Bacteria | 2079 |
| 80 | Ga0070710_10070341 | 3300005437 | Bacteria | 2015 |
| 81 | Ga0070710_10110500 | 3300005437 | Bacteria | 1650 |
| 82 | Ga0070710_10227512 | 3300005437 | Bacteria | 1189 |
| 83 | Ga0070711_100001597 | 3300005439 | Bacteria | 12490 |
| 84 | Ga0070711_100002658 | 3300005439 | Bacteria | 10241 |
| 85 | Ga0070711_100035461 | 3300005439 | Bacteria | 3336 |
| 86 | Ga0070711_100059477 | 3300005439 | Bacteria | 2653 |
| 87 | Ga0070711_100084035 | 3300005439 | Bacteria | 2276 |
| 88 | Ga0070711_100115612 | 3300005439 | Bacteria | 1976 |
| 89 | Ga0070700_100040775 | 3300005441 | Bacteria | 2844 |
| 90 | Ga0070700_100052862 | 3300005441 | Bacteria | 2534 |
| 91 | Ga0070700_100081594 | 3300005441 | Bacteria | 2089 |
| 92 | Ga0070708_100007848 | 3300005445 | Bacteria | 8547 |
| 93 | Ga0070708_100475795 | 3300005445 | Bacteria | 1178 |
| 94 | Ga0070663_100016089 | 3300005455 | Bacteria | 4845 |
| 95 | Ga0070663_100022746 | 3300005455 | Bacteria | 4194 |
| 96 | Ga0070663_100026427 | 3300005455 | Bacteria | 3933 |
| 97 | Ga0070663_100091135 | 3300005455 | Bacteria | 2258 |
| 98 | Ga0070663_100312121 | 3300005455 | Bacteria | 1262 |
| 99 | Ga0070678_100003251 | 3300005456 | Bacteria | 9027 |
| 100 | Ga0070678_100095468 | 3300005456 | Bacteria | 2291 |
| 101 | Ga0070678_100116493 | 3300005456 | Bacteria | 2099 |
| 102 | Ga0070678_100243267 | 3300005456 | Bacteria | 1505 |
| 103 | Ga0070662_100210774 | 3300005457 | Bacteria | 1546 |
| 104 | Ga0070681_10009753 | 3300005458 | Bacteria | 9450 |
| 105 | Ga0070681_10043153 | 3300005458 | Bacteria | 4518 |
| 106 | Ga0070681_10232533 | 3300005458 | Bacteria | 1757 |
| 107 | Ga0068867_100149715 | 3300005459 | Bacteria | 1832 |
| 108 | Ga0070706_100018333 | 3300005467 | Bacteria | 6458 |
| 109 | Ga0070706_100230225 | 3300005467 | Bacteria | 1730 |
| 110 | Ga0070707_100024117 | 3300005468 | Bacteria | 5758 |
| 111 | Ga0070707_100036986 | 3300005468 | Bacteria | 4658 |
| 112 | Ga0070707_100198647 | 3300005468 | Bacteria | 1955 |
| 113 | Ga0070707_100255051 | 3300005468 | Bacteria | 1707 |
| 114 | Ga0070698_100002287 | 3300005471 | Bacteria | 21212 |
| 115 | Ga0070698_100031924 | 3300005471 | Bacteria | 5458 |
| 116 | Ga0070698_100038462 | 3300005471 | Bacteria | 4929 |
| 117 | Ga0070698_100084629 | 3300005471 | Bacteria | 3159 |
| 118 | Ga0070699_100000948 | 3300005518 | Bacteria | 27070 |
| 119 | Ga0070699_100065755 | 3300005518 | Bacteria | 3147 |
| 120 | Ga0070699_100077022 | 3300005518 | Bacteria | 2903 |
| 121 | Ga0070679_100003495 | 3300005530 | Bacteria | 14381 |
| 122 | Ga0070684_100023446 | 3300005535 | Bacteria | 5162 |
| 123 | Ga0070684_100040831 | 3300005535 | Bacteria | 3997 |
| 124 | Ga0070684_100181809 | 3300005535 | Bacteria | 1912 |
| 125 | Ga0070697_100008889 | 3300005536 | Bacteria | 7843 |
| 126 | Ga0070695_100022737 | 3300005545 | Bacteria | 3848 |
| 127 | Ga0070695_100092444 | 3300005545 | Bacteria | 2022 |
| 128 | Ga0070696_100154702 | 3300005546 | Bacteria | 1685 |
| 129 | Ga0070693_100005295 | 3300005547 | Bacteria | 6183 |
| 130 | Ga0070665_100005105 | 3300005548 | Bacteria | 13618 |
| 131 | Ga0070665_100203055 | 3300005548 | Bacteria | 1982 |
| 132 | Ga0070665_100289707 | 3300005548 | Bacteria | 1640 |
| 133 | Ga0070665_100323732 | 3300005548 | Bacteria | 1546 |
| 134 | Ga0070704_100021889 | 3300005549 | Bacteria | 4152 |
| 135 | Ga0070704_100261238 | 3300005549 | Bacteria | 1426 |
| 136 | Ga0068855_100241787 | 3300005563 | Bacteria | 2017 |
| 137 | Ga0068855_100345909 | 3300005563 | Bacteria | 1639 |
| 138 | Ga0068855_100396779 | 3300005563 | Bacteria | 1512 |
| 139 | Ga0070664_100001178 | 3300005564 | Bacteria | 20808 |
| 140 | Ga0070664_100125147 | 3300005564 | Bacteria | 2254 |
| 141 | Ga0070664_100332178 | 3300005564 | Bacteria | 1379 |
| 142 | Ga0068857_100035920 | 3300005577 | Bacteria | 4390 |
| 143 | Ga0068857_100101216 | 3300005577 | Bacteria | 2586 |
| 144 | Ga0068857_100160073 | 3300005577 | Bacteria | 2043 |
| 145 | Ga0068857_100206949 | 3300005577 | Bacteria | 1790 |
| 146 | Ga0068857_100321380 | 3300005577 | Bacteria | 1429 |
| 147 | Ga0068857_100437973 | 3300005577 | Bacteria | 1221 |
| 148 | Ga0068854_100084860 | 3300005578 | Bacteria | 2344 |
| 149 | Ga0068856_100101655 | 3300005614 | Bacteria | 2867 |
| 150 | Ga0068856_100145093 | 3300005614 | Bacteria | 2381 |
| 151 | Ga0068856_100243393 | 3300005614 | Bacteria | 1814 |
| 152 | Ga0068856_100278317 | 3300005614 | Bacteria | 1690 |
| 153 | Ga0070702_100282553 | 3300005615 | Bacteria | 1140 |
| 154 | Ga0068852_100003246 | 3300005616 | Bacteria | 11348 |
| 155 | Ga0068852_100045379 | 3300005616 | Bacteria | 3738 |
| 156 | Ga0068859_100119096 | 3300005617 | Bacteria | 2706 |
| 157 | Ga0068859_100152308 | 3300005617 | Bacteria | 2388 |
| 158 | Ga0068864_100013080 | 3300005618 | Bacteria | 6874 |
| 159 | Ga0068864_100051391 | 3300005618 | Bacteria | 3551 |
| 160 | Ga0068864_100053404 | 3300005618 | Bacteria | 3486 |
| 161 | Ga0068864_100101677 | 3300005618 | Bacteria | 2550 |
| 162 | Ga0068864_100256787 | 3300005618 | Bacteria | 1624 |
| 163 | Ga0068861_100013229 | 3300005719 | Bacteria | 5774 |
| 164 | Ga0068861_100323338 | 3300005719 | Bacteria | 1344 |
| 165 | Ga0068851_10064525 | 3300005834 | Bacteria | 1882 |
| 166 | Ga0068851_10102384 | 3300005834 | Bacteria | 1521 |
| 167 | Ga0068851_10210825 | 3300005834 | Bacteria | 1088 |
| 168 | Ga0068870_10003463 | 3300005840 | Bacteria | 6687 |
| 169 | Ga0068870_10095144 | 3300005840 | Bacteria | 1673 |
| 170 | Ga0068870_10192428 | 3300005840 | Bacteria | 1232 |
| 171 | Ga0068863_100012759 | 3300005841 | Bacteria | 8103 |
| 172 | Ga0068863_100175856 | 3300005841 | Bacteria | 2054 |
| 173 | Ga0068863_100305220 | 3300005841 | Bacteria | 1544 |
| 174 | Ga0068863_100318071 | 3300005841 | Bacteria | 1511 |
| 175 | Ga0068863_100422151 | 3300005841 | Bacteria | 1307 |
| 176 | Ga0068858_100171304 | 3300005842 | Bacteria | 2047 |
| 177 | Ga0068858_100190227 | 3300005842 | Bacteria | 1939 |
| 178 | Ga0068858_100472552 | 3300005842 | Bacteria | 1209 |
| 179 | Ga0068858_100525212 | 3300005842 | Bacteria | 1145 |
| 180 | Ga0068860_100362101 | 3300005843 | Bacteria | 1429 |
| 181 | Ga0068860_100405915 | 3300005843 | Bacteria | 1348 |
| 182 | Ga0068862_100064439 | 3300005844 | Bacteria | 3155 |
| 183 | Ga0081538_10000493 | 3300005981 | Bacteria | 44022 |
| 184 | Ga0081538_10003125 | 3300005981 | Bacteria | 15747 |
| 185 | Ga0081540_1000473 | 3300005983 | Bacteria | 39545 |
| 186 | Ga0081540_1002525 | 3300005983 | Bacteria | 14861 |
| 187 | Ga0081540_1004569 | 3300005983 | Bacteria | 10483 |
| 188 | Ga0081540_1007797 | 3300005983 | Bacteria | 7576 |
| 189 | Ga0081540_1027473 | 3300005983 | Bacteria | 3223 |
| 190 | Ga0070717_10003546 | 3300006028 | Bacteria | 11189 |
| 191 | Ga0070717_10007901 | 3300006028 | Bacteria | 7922 |
| 192 | Ga0070717_10019237 | 3300006028 | Bacteria | 5353 |
| 193 | Ga0070717_10053112 | 3300006028 | Bacteria | 3340 |
| 194 | Ga0070717_10073640 | 3300006028 | Bacteria | 2855 |
| 195 | Ga0070717_10128125 | 3300006028 | Bacteria | 2180 |
| 196 | Ga0070717_10130194 | 3300006028 | Bacteria | 2163 |
| 197 | Ga0070717_10154049 | 3300006028 | Bacteria | 1990 |
| 198 | Ga0070717_10204097 | 3300006028 | Bacteria | 1732 |
| 199 | Ga0075365_10014630 | 3300006038 | Bacteria | 4726 |
| 200 | Ga0075363_100000934 | 3300006048 | Bacteria | 10342 |
| 201 | Ga0075364_10120803 | 3300006051 | Bacteria | 1753 |
| 202 | Ga0070715_10000665 | 3300006163 | Bacteria | 9186 |
| 203 | Ga0070716_100000375 | 3300006173 | Bacteria | 18369 |
| 204 | Ga0070716_100005685 | 3300006173 | Bacteria | 6053 |
| 205 | Ga0070716_100014994 | 3300006173 | Bacteria | 3976 |
| 206 | Ga0070716_100025495 | 3300006173 | Bacteria | 3155 |
| 207 | Ga0070716_100026047 | 3300006173 | Bacteria | 3127 |
| 208 | Ga0070716_100050911 | 3300006173 | Bacteria | 2353 |
| 209 | Ga0070716_100071058 | 3300006173 | Bacteria | 2045 |
| 210 | Ga0070716_100092279 | 3300006173 | Bacteria | 1835 |
| 211 | Ga0070716_100181724 | 3300006173 | Bacteria | 1381 |
| 212 | Ga0070712_100001381 | 3300006175 | Bacteria | 14730 |
| 213 | Ga0070712_100002762 | 3300006175 | Bacteria | 10849 |
| 214 | Ga0070712_100056731 | 3300006175 | Bacteria | 2748 |
| 215 | Ga0070712_100072757 | 3300006175 | Bacteria | 2463 |
| 216 | Ga0070712_100089790 | 3300006175 | Bacteria | 2248 |
| 217 | Ga0097621_100016068 | 3300006237 | Bacteria | 5649 |
| 218 | Ga0097621_100097355 | 3300006237 | Bacteria | 2470 |
| 219 | Ga0097621_100135421 | 3300006237 | Bacteria | 2100 |
| 220 | Ga0097621_100183115 | 3300006237 | Bacteria | 1811 |
| 221 | Ga0068871_100094421 | 3300006358 | Bacteria | 2497 |
| 222 | Ga0068871_100158077 | 3300006358 | Bacteria | 1937 |
| 223 | Ga0075428_100000664 | 3300006844 | Bacteria | 35332 |
| 224 | Ga0075428_100078877 | 3300006844 | Bacteria | 3594 |
| 225 | Ga0075433_10004765 | 3300006852 | Bacteria | 10583 |
| 226 | Ga0075433_10032192 | 3300006852 | Bacteria | 4490 |
| 227 | Ga0075434_100011323 | 3300006871 | Bacteria | 8405 |
| 228 | Ga0075434_100061903 | 3300006871 | Bacteria | 3724 |
| 229 | Ga0075434_100090488 | 3300006871 | Bacteria | 3061 |
| 230 | Ga0075434_100162704 | 3300006871 | Bacteria | 2251 |
| 231 | Ga0075434_100200253 | 3300006871 | Bacteria | 2016 |
| 232 | Ga0075434_100208778 | 3300006871 | Bacteria | 1973 |
| 233 | Ga0075436_100001878 | 3300006914 | Bacteria | 14437 |
| 234 | Ga0075436_100014158 | 3300006914 | Bacteria | 5460 |
| 235 | Ga0075436_100095790 | 3300006914 | Bacteria | 2065 |
| 236 | Ga0075436_100143074 | 3300006914 | Bacteria | 1681 |
| 237 | Ga0075436_100216420 | 3300006914 | Bacteria | 1359 |
| 238 | Ga0075436_100225777 | 3300006914 | Bacteria | 1329 |
| 239 | Ga0097620_100119092 | 3300006931 | Bacteria | 2706 |
| 240 | Ga0097620_100152317 | 3300006931 | Bacteria | 2388 |
| 241 | Ga0075435_100002133 | 3300007076 | Bacteria | 13029 |
| 242 | Ga0075435_100451516 | 3300007076 | Bacteria | 1108 |
| 243 | Ga0105251_10075170 | 3300009011 | Bacteria | 1569 |
| 244 | Ga0105244_10131863 | 3300009036 | Bacteria | 1206 |
| 245 | Ga0105240_10077104 | 3300009093 | Bacteria | 4108 |
| 246 | Ga0105240_10609961 | 3300009093 | Bacteria | 1201 |
| 247 | Ga0111539_10080590 | 3300009094 | Bacteria | 3829 |
| 248 | Ga0111539_10288151 | 3300009094 | Bacteria | 1911 |
| 249 | Ga0111539_10332785 | 3300009094 | Bacteria | 1768 |
| 250 | Ga0105245_10005419 | 3300009098 | Bacteria | 11212 |
| 251 | Ga0105245_10025504 | 3300009098 | Bacteria | 5199 |
| 252 | Ga0105245_10065273 | 3300009098 | Bacteria | 3292 |
| 253 | Ga0105245_10152823 | 3300009098 | Bacteria | 2184 |
| 254 | Ga0105247_10032888 | 3300009101 | Bacteria | 3152 |
| 255 | Ga0105247_10145175 | 3300009101 | Bacteria | 1559 |
| 256 | Ga0105241_10004425 | 3300009174 | Bacteria | 10390 |
| 257 | Ga0105241_10056299 | 3300009174 | Bacteria | 3015 |
| 258 | Ga0105241_10210441 | 3300009174 | Bacteria | 1629 |
| 259 | Ga0105248_10246443 | 3300009177 | Bacteria | 2011 |
| 260 | Ga0105248_10430796 | 3300009177 | Bacteria | 1485 |
| 261 | Ga0105237_10145425 | 3300009545 | Bacteria | 2365 |
| 262 | Ga0105237_10202179 | 3300009545 | Bacteria | 1987 |
| 263 | Ga0105237_10274057 | 3300009545 | Bacteria | 1690 |
| 264 | Ga0099796_10082017 | 3300010159 | Bacteria | 1184 |
| 265 | Ga0105239_10143288 | 3300010375 | Bacteria | 2664 |
| 266 | Ga0105239_10179273 | 3300010375 | Bacteria | 2370 |
| 267 | Ga0105239_10193477 | 3300010375 | Bacteria | 2277 |
| 268 | Ga0105239_10333206 | 3300010375 | Bacteria | 1712 |
| 269 | Ga0105239_10488101 | 3300010375 | Bacteria | 1400 |
| 270 | Ga0105239_10637268 | 3300010375 | Bacteria | 1217 |
| 271 | Ga0105246_10000911 | 3300011119 | Bacteria | 16930 |
| 272 | Ga0105246_10032279 | 3300011119 | Bacteria | 3472 |
| 273 | Ga0105246_10313536 | 3300011119 | Bacteria | 1272 |
| 274 | Ga0157370_10156010 | 3300013104 | Bacteria | 2124 |
| 275 | Ga0157369_10029633 | 3300013105 | Bacteria | 6046 |
| 276 | Ga0157374_10174320 | 3300013296 | Bacteria | 2099 |
| 277 | Ga0157374_10213713 | 3300013296 | Bacteria | 1891 |
| 278 | Ga0157378_10170911 | 3300013297 | Bacteria | 2038 |
| 279 | Ga0163162_10209574 | 3300013306 | Bacteria | 2078 |
| 280 | Ga0163162_10241975 | 3300013306 | Bacteria | 1935 |
| 281 | Ga0157372_10164791 | 3300013307 | Bacteria | 2563 |
| 282 | Ga0157375_10243031 | 3300013308 | Bacteria | 1960 |
| 283 | Ga0157375_10363046 | 3300013308 | Bacteria | 1614 |
| 284 | Ga0157375_10608263 | 3300013308 | Bacteria | 1252 |
| 285 | Ga0163163_10059222 | 3300014325 | Bacteria | 3787 |
| 286 | Ga0163163_10111260 | 3300014325 | Bacteria | 2768 |
| 287 | Ga0163163_10351494 | 3300014325 | Bacteria | 1530 |
| 288 | Ga0163163_10508095 | 3300014325 | Bacteria | 1267 |
| 289 | Ga0157380_10261039 | 3300014326 | Bacteria | 1573 |
| 290 | Ga0182008_10056488 | 3300014497 | Bacteria | 1939 |
| 291 | Ga0157377_10006253 | 3300014745 | Bacteria | 5669 |
| 292 | Ga0157377_10010126 | 3300014745 | Bacteria | 4652 |
| 293 | Ga0157377_10208763 | 3300014745 | Bacteria | 1244 |
| 294 | Ga0157379_10007497 | 3300014968 | Bacteria | 9445 |
| 295 | Ga0157379_10026531 | 3300014968 | Bacteria | 5157 |
| 296 | Ga0157379_10414333 | 3300014968 | Bacteria | 1240 |
| 297 | Ga0157376_10017121 | 3300014969 | Bacteria | 5521 |
| 298 | Ga0157376_10105242 | 3300014969 | Bacteria | 2474 |
| 299 | Ga0157376_10120379 | 3300014969 | Bacteria | 2325 |
| 300 | Ga0197907_10187271 | 3300020069 | Bacteria | 1462 |
| 301 | Ga0206354_10057982 | 3300020081 | Bacteria | 1695 |
| 302 | Ga0206354_10343418 | 3300020081 | Bacteria | 1065 |
| 303 | Ga0206354_10978843 | 3300020081 | Bacteria | 1811 |
| 304 | Ga0206354_11413288 | 3300020081 | Bacteria | 2598 |
| 305 | Ga0206353_10026372 | 3300020082 | Bacteria | 6034 |
| 306 | Ga0213876_10051303 | 3300021384 | Bacteria | 2180 |
| 307 | Ga0213875_10000588 | 3300021388 | Bacteria | 29434 |
| 308 | Ga0213875_10001911 | 3300021388 | Bacteria | 12893 |
| 309 | Ga0213875_10066161 | 3300021388 | Bacteria | 1689 |
| 310 | Ga0224572_1000284 | 3300024225 | Bacteria | 5312 |
| 311 | Ga0224572_1001967 | 3300024225 | Bacteria | 3206 |
| 312 | Ga0207656_10027109 | 3300025321 | Bacteria | 2341 |
| 313 | Ga0207653_10007871 | 3300025885 | Bacteria | 3322 |
| 314 | Ga0207692_10004417 | 3300025898 | Bacteria | 5566 |
| 315 | Ga0207692_10008718 | 3300025898 | Bacteria | 4210 |
| 316 | Ga0207692_10011762 | 3300025898 | Bacteria | 3737 |
| 317 | Ga0207692_10013217 | 3300025898 | Bacteria | 3575 |
| 318 | Ga0207692_10014942 | 3300025898 | Bacteria | 3404 |
| 319 | Ga0207692_10070034 | 3300025898 | Bacteria | 1845 |
| 320 | Ga0207692_10112103 | 3300025898 | Bacteria | 1514 |
| 321 | Ga0207688_10001876 | 3300025901 | Bacteria | 11251 |
| 322 | Ga0207688_10002209 | 3300025901 | Bacteria | 10475 |
| 323 | Ga0207688_10002950 | 3300025901 | Bacteria | 9258 |
| 324 | Ga0207680_10082525 | 3300025903 | Bacteria | 2023 |
| 325 | Ga0207647_10170609 | 3300025904 | Bacteria | 1267 |
| 326 | Ga0207685_10002951 | 3300025905 | Bacteria | 4028 |
| 327 | Ga0207685_10044970 | 3300025905 | Bacteria | 1672 |
| 328 | Ga0207699_10001982 | 3300025906 | Bacteria | 9671 |
| 329 | Ga0207699_10002377 | 3300025906 | Bacteria | 8879 |
| 330 | Ga0207699_10009162 | 3300025906 | Bacteria | 4917 |
| 331 | Ga0207699_10044967 | 3300025906 | Bacteria | 2574 |
| 332 | Ga0207699_10055407 | 3300025906 | Bacteria | 2359 |
| 333 | Ga0207699_10093269 | 3300025906 | Bacteria | 1895 |
| 334 | Ga0207699_10114364 | 3300025906 | Bacteria | 1735 |
| 335 | Ga0207645_10017159 | 3300025907 | Bacteria | 4781 |
| 336 | Ga0207643_10001978 | 3300025908 | Bacteria | 11314 |
| 337 | Ga0207643_10044638 | 3300025908 | Bacteria | 2502 |
| 338 | Ga0207705_10035716 | 3300025909 | Bacteria | 3555 |
| 339 | Ga0207705_10092860 | 3300025909 | Bacteria | 2212 |
| 340 | Ga0207705_10131874 | 3300025909 | Bacteria | 1860 |
| 341 | Ga0207684_10004761 | 3300025910 | Bacteria | 12712 |
| 342 | Ga0207684_10209888 | 3300025910 | Bacteria | 1680 |
| 343 | Ga0207684_10247495 | 3300025910 | Bacteria | 1538 |
| 344 | Ga0207684_10257127 | 3300025910 | Bacteria | 1507 |
| 345 | Ga0207684_10277926 | 3300025910 | Bacteria | 1444 |
| 346 | Ga0207654_10048299 | 3300025911 | Bacteria | 2435 |
| 347 | Ga0207654_10099120 | 3300025911 | Bacteria | 1792 |
| 348 | Ga0207707_10010532 | 3300025912 | Bacteria | 8028 |
| 349 | Ga0207707_10011990 | 3300025912 | Bacteria | 7536 |
| 350 | Ga0207695_10334862 | 3300025913 | Bacteria | 1402 |
| 351 | Ga0207671_10113486 | 3300025914 | Bacteria | 2064 |
| 352 | Ga0207671_10311612 | 3300025914 | Bacteria | 1244 |
| 353 | Ga0207693_10001158 | 3300025915 | Bacteria | 23531 |
| 354 | Ga0207693_10002507 | 3300025915 | Bacteria | 15965 |
| 355 | Ga0207693_10003174 | 3300025915 | Bacteria | 14119 |
| 356 | Ga0207693_10050876 | 3300025915 | Bacteria | 3252 |
| 357 | Ga0207693_10074359 | 3300025915 | Bacteria | 2661 |
| 358 | Ga0207693_10129690 | 3300025915 | Bacteria | 1982 |
| 359 | Ga0207663_10033106 | 3300025916 | Bacteria | 3075 |
| 360 | Ga0207663_10046792 | 3300025916 | Bacteria | 2667 |
| 361 | Ga0207663_10085691 | 3300025916 | Bacteria | 2075 |
| 362 | Ga0207663_10137468 | 3300025916 | Bacteria | 1698 |
| 363 | Ga0207663_10160631 | 3300025916 | Bacteria | 1586 |
| 364 | Ga0207663_10194334 | 3300025916 | Bacteria | 1459 |
| 365 | Ga0207660_10038996 | 3300025917 | Bacteria | 3319 |
| 366 | Ga0207662_10041543 | 3300025918 | Bacteria | 2708 |
| 367 | Ga0207657_10003201 | 3300025919 | Bacteria | 17523 |
| 368 | Ga0207657_10011654 | 3300025919 | Bacteria | 8716 |
| 369 | Ga0207657_10016690 | 3300025919 | Bacteria | 7075 |
| 370 | Ga0207657_10135807 | 3300025919 | Bacteria | 2012 |
| 371 | Ga0207649_10018319 | 3300025920 | Bacteria | 3980 |
| 372 | Ga0207649_10219600 | 3300025920 | Bacteria | 1353 |
| 373 | Ga0207652_10003458 | 3300025921 | Bacteria | 13025 |
| 374 | Ga0207652_10004897 | 3300025921 | Bacteria | 10832 |
| 375 | Ga0207652_10171445 | 3300025921 | Bacteria | 1947 |
| 376 | Ga0207646_10030826 | 3300025922 | Bacteria | 4858 |
| 377 | Ga0207646_10039968 | 3300025922 | Bacteria | 4221 |
| 378 | Ga0207646_10054609 | 3300025922 | Bacteria | 3572 |
| 379 | Ga0207646_10071943 | 3300025922 | Bacteria | 3088 |
| 380 | Ga0207646_10114882 | 3300025922 | Bacteria | 2417 |
| 381 | Ga0207646_10131403 | 3300025922 | Bacteria | 2253 |
| 382 | Ga0207646_10183587 | 3300025922 | Bacteria | 1889 |
| 383 | Ga0207694_10181915 | 3300025924 | Bacteria | 1705 |
| 384 | Ga0207694_10429761 | 3300025924 | Bacteria | 1101 |
| 385 | Ga0207659_10006338 | 3300025926 | Bacteria | 7242 |
| 386 | Ga0207659_10372898 | 3300025926 | Bacteria | 1189 |
| 387 | Ga0207687_10125471 | 3300025927 | Bacteria | 1926 |
| 388 | Ga0207687_10147664 | 3300025927 | Bacteria | 1790 |
| 389 | Ga0207687_10274814 | 3300025927 | Bacteria | 1348 |
| 390 | Ga0207700_10000263 | 3300025928 | Bacteria | 31277 |
| 391 | Ga0207700_10000366 | 3300025928 | Bacteria | 26382 |
| 392 | Ga0207700_10001149 | 3300025928 | Bacteria | 15207 |
| 393 | Ga0207700_10005691 | 3300025928 | Bacteria | 7483 |
| 394 | Ga0207700_10021731 | 3300025928 | Bacteria | 4387 |
| 395 | Ga0207700_10051679 | 3300025928 | Bacteria | 3068 |
| 396 | Ga0207700_10114012 | 3300025928 | Bacteria | 2180 |
| 397 | Ga0207700_10147569 | 3300025928 | Bacteria | 1940 |
| 398 | Ga0207700_10184056 | 3300025928 | Bacteria | 1751 |
| 399 | Ga0207700_10254889 | 3300025928 | Bacteria | 1500 |
| 400 | Ga0207700_10335667 | 3300025928 | Bacteria | 1313 |
| 401 | Ga0207700_10371825 | 3300025928 | Bacteria | 1248 |
| 402 | Ga0207664_10000900 | 3300025929 | Bacteria | 20073 |
| 403 | Ga0207664_10001450 | 3300025929 | Bacteria | 15575 |
| 404 | Ga0207664_10003326 | 3300025929 | Bacteria | 10694 |
| 405 | Ga0207664_10014185 | 3300025929 | Bacteria | 5747 |
| 406 | Ga0207664_10019481 | 3300025929 | Bacteria | 5015 |
| 407 | Ga0207664_10025112 | 3300025929 | Bacteria | 4483 |
| 408 | Ga0207664_10057019 | 3300025929 | Bacteria | 3104 |
| 409 | Ga0207664_10069775 | 3300025929 | Bacteria | 2826 |
| 410 | Ga0207664_10083004 | 3300025929 | Bacteria | 2611 |
| 411 | Ga0207664_10145176 | 3300025929 | Bacteria | 2011 |
| 412 | Ga0207664_10154494 | 3300025929 | Bacteria | 1952 |
| 413 | Ga0207664_10177245 | 3300025929 | Bacteria | 1828 |
| 414 | Ga0207664_10199781 | 3300025929 | Bacteria | 1725 |
| 415 | Ga0207664_10243384 | 3300025929 | Bacteria | 1567 |
| 416 | Ga0207644_10006975 | 3300025931 | Bacteria | 7357 |
| 417 | Ga0207690_10009515 | 3300025932 | Bacteria | 5772 |
| 418 | Ga0207706_10036588 | 3300025933 | Bacteria | 4360 |
| 419 | Ga0207706_10210908 | 3300025933 | Bacteria | 1703 |
| 420 | Ga0207670_10045741 | 3300025936 | Bacteria | 2903 |
| 421 | Ga0207670_10155763 | 3300025936 | Bacteria | 1700 |
| 422 | Ga0207669_10065321 | 3300025937 | Bacteria | 2257 |
| 423 | Ga0207704_10077380 | 3300025938 | Bacteria | 2135 |
| 424 | Ga0207665_10002699 | 3300025939 | Bacteria | 11897 |
| 425 | Ga0207665_10004673 | 3300025939 | Bacteria | 9098 |
| 426 | Ga0207665_10009299 | 3300025939 | Bacteria | 6451 |
| 427 | Ga0207665_10027982 | 3300025939 | Bacteria | 3724 |
| 428 | Ga0207665_10029804 | 3300025939 | Bacteria | 3605 |
| 429 | Ga0207665_10058579 | 3300025939 | Bacteria | 2604 |
| 430 | Ga0207665_10110804 | 3300025939 | Bacteria | 1928 |
| 431 | Ga0207665_10150388 | 3300025939 | Bacteria | 1667 |
| 432 | Ga0207665_10265674 | 3300025939 | Bacteria | 1273 |
| 433 | Ga0207691_10040207 | 3300025940 | Bacteria | 4322 |
| 434 | Ga0207691_10096477 | 3300025940 | Bacteria | 2643 |
| 435 | Ga0207711_10298737 | 3300025941 | Bacteria | 1485 |
| 436 | Ga0207689_10002083 | 3300025942 | Bacteria | 18876 |
| 437 | Ga0207689_10010824 | 3300025942 | Bacteria | 7846 |
| 438 | Ga0207689_10052504 | 3300025942 | Bacteria | 3359 |
| 439 | Ga0207689_10053892 | 3300025942 | Bacteria | 3313 |
| 440 | Ga0207689_10100002 | 3300025942 | Bacteria | 2383 |
| 441 | Ga0207661_10009569 | 3300025944 | Bacteria | 6955 |
| 442 | Ga0207661_10034426 | 3300025944 | Bacteria | 3939 |
| 443 | Ga0207679_10000682 | 3300025945 | Bacteria | 22742 |
| 444 | Ga0207679_10347890 | 3300025945 | Bacteria | 1291 |
| 445 | Ga0207667_10112718 | 3300025949 | Bacteria | 2804 |
| 446 | Ga0207667_10564296 | 3300025949 | Bacteria | 1150 |
| 447 | Ga0207668_10087223 | 3300025972 | Bacteria | 2282 |
| 448 | Ga0207668_10274363 | 3300025972 | Bacteria | 1380 |
| 449 | Ga0207640_10102805 | 3300025981 | Bacteria | 2007 |
| 450 | Ga0207640_10533009 | 3300025981 | Bacteria | 983 |
| 451 | Ga0207677_10104941 | 3300026023 | Bacteria | 2090 |
| 452 | Ga0207677_10351622 | 3300026023 | Bacteria | 1235 |
| 453 | Ga0207703_10062086 | 3300026035 | Bacteria | 3060 |
| 454 | Ga0207703_10133257 | 3300026035 | Bacteria | 2148 |
| 455 | Ga0207639_10165093 | 3300026041 | Bacteria | 1870 |
| 456 | Ga0207678_10000539 | 3300026067 | Bacteria | 34560 |
| 457 | Ga0207678_10037818 | 3300026067 | Bacteria | 4197 |
| 458 | Ga0207678_10056165 | 3300026067 | Bacteria | 3390 |
| 459 | Ga0207678_10109763 | 3300026067 | Bacteria | 2353 |
| 460 | Ga0207678_10150666 | 3300026067 | Bacteria | 1986 |
| 461 | Ga0207708_10018103 | 3300026075 | Bacteria | 5302 |
| 462 | Ga0207708_10034183 | 3300026075 | Bacteria | 3866 |
| 463 | Ga0207708_10039594 | 3300026075 | Bacteria | 3592 |
| 464 | Ga0207708_10107881 | 3300026075 | Bacteria | 2159 |
| 465 | Ga0207702_10006037 | 3300026078 | Bacteria | 10513 |
| 466 | Ga0207702_10104537 | 3300026078 | Bacteria | 2506 |
| 467 | Ga0207702_10228954 | 3300026078 | Bacteria | 1736 |
| 468 | Ga0207641_10100640 | 3300026088 | Bacteria | 2546 |
| 469 | Ga0207648_10059647 | 3300026089 | Bacteria | 3328 |
| 470 | Ga0207648_10088399 | 3300026089 | Bacteria | 2705 |
| 471 | Ga0207648_10127939 | 3300026089 | Bacteria | 2235 |
| 472 | Ga0207676_10050059 | 3300026095 | Bacteria | 3255 |
| 473 | Ga0207676_10190443 | 3300026095 | Bacteria | 1804 |
| 474 | Ga0207676_10207549 | 3300026095 | Bacteria | 1735 |
| 475 | Ga0207674_10010256 | 3300026116 | Bacteria | 10635 |
| 476 | Ga0207674_10017051 | 3300026116 | Bacteria | 7928 |
| 477 | Ga0207674_10018405 | 3300026116 | Bacteria | 7594 |
| 478 | Ga0207674_10039117 | 3300026116 | Bacteria | 4918 |
| 479 | Ga0207674_10079326 | 3300026116 | Bacteria | 3287 |
| 480 | Ga0207674_10135329 | 3300026116 | Bacteria | 2426 |
| 481 | Ga0207674_10306562 | 3300026116 | Bacteria | 1537 |
| 482 | Ga0207675_100040011 | 3300026118 | Bacteria | 4375 |
| 483 | Ga0207675_100120200 | 3300026118 | Bacteria | 2485 |
| 484 | Ga0207675_100412970 | 3300026118 | Bacteria | 1332 |
| 485 | Ga0207683_10004433 | 3300026121 | Bacteria | 12130 |
| 486 | Ga0207683_10006189 | 3300026121 | Bacteria | 10253 |
| 487 | Ga0207698_10022386 | 3300026142 | Bacteria | 4390 |
| 488 | Ga0207698_10056701 | 3300026142 | Bacteria | 3026 |
| 489 | Ga0207698_10282871 | 3300026142 | Bacteria | 1535 |
| 490 | Ga0207428_10212858 | 3300027907 | Bacteria | 1451 |
| 491 | Ga0268266_10023738 | 3300028379 | Bacteria | 5219 |
| 492 | Ga0268266_10146044 | 3300028379 | Bacteria | 2127 |
| 493 | Ga0268265_10036886 | 3300028380 | Bacteria | 3584 |
| 494 | Ga0268265_10090899 | 3300028380 | Bacteria | 2440 |
| 495 | Ga0268264_10283291 | 3300028381 | Bacteria | 1553 |
| 496 | Ga0307517_10030403 | 3300028786 | Bacteria | 6332 |
| 497 | Ga0307515_10019119 | 3300028794 | Bacteria | 12352 |
| 498 | Ga0307515_10048095 | 3300028794 | Bacteria | 6459 |
| 499 | Ga0265338_10004490 | 3300028800 | Bacteria | 18814 |
| 500 | Ga0307512_10002799 | 3300030522 | Bacteria | 21251 |
| 501 | Ga0307512_10008268 | 3300030522 | Bacteria | 10171 |
| 502 | Ga0316177_1173943 | 3300030731 | Bacteria | 3739 |
| 503 | Ga0316176_1033292 | 3300030732 | Bacteria | 5298 |
| 504 | Ga0314311_1137046 | 3300030733 | Bacteria | 2064 |
| 505 | Ga0307513_10017242 | 3300031456 | Bacteria | 8664 |
| 506 | Ga0307513_10021598 | 3300031456 | Bacteria | 7595 |
| 507 | Ga0307513_10041651 | 3300031456 | Bacteria | 5066 |
| 508 | Ga0307508_10033376 | 3300031616 | Bacteria | 4645 |
| 509 | Ga0307508_10038806 | 3300031616 | Bacteria | 4279 |
| 510 | Ga0307516_10025692 | 3300031730 | Bacteria | 5993 |
| 511 | Ga0307516_10031906 | 3300031730 | Bacteria | 5309 |
| 512 | Ga0307518_10000232 | 3300031838 | Bacteria | 42086 |
| 513 | Ga0326468_10000194 | 3300031889 | Bacteria | 6226 |
| 514 | Ga0307407_10048845 | 3300031903 | Bacteria | 2411 |
| 515 | Ga0307409_100108688 | 3300031995 | Bacteria | 2320 |
| 516 | Ga0307409_100145861 | 3300031995 | Bacteria | 2047 |
| 517 | Ga0307409_100221793 | 3300031995 | Bacteria | 1707 |
| 518 | Ga0307416_100192736 | 3300032002 | Bacteria | 1924 |
| 519 | Ga0307416_100208676 | 3300032002 | Bacteria | 1861 |
| 520 | Ga0307416_100234286 | 3300032002 | Bacteria | 1773 |
| 521 | Ga0307416_100359168 | 3300032002 | Bacteria | 1478 |
| 522 | Ga0307411_10305563 | 3300032005 | Bacteria | 1278 |
| 523 | Ga0307415_100095063 | 3300032126 | Bacteria | 2169 |
| 524 | Ga0307507_10047237 | 3300033179 | Bacteria | 4208 |
| 525 | Ga0373938_0007695 | 3300034957 | Bacteria | 1903 |
| 526 | Ga0373926_0000209 | 3300035083 | Bacteria | 13645 |
| 527 | Ga0373926_0000481 | 3300035083 | Bacteria | 10558 |
| 528 | Ga0373928_0010206 | 3300035084 | Bacteria | 1842 |
| 529 | Ga0373929_0040540 | 3300035085 | Bacteria | 1032 |
| 530 | Ga0373934_0000464 | 3300035086 | Bacteria | 14174 |
| 531 | Ga0373934_0004916 | 3300035086 | Bacteria | 4947 |
| 532 | Ga0373940_0012633 | 3300035088 | Bacteria | 2026 |
| 533 | Ga0373940_0033813 | 3300035088 | Bacteria | 1377 |
| 534 | Ga0373940_0048069 | 3300035088 | Bacteria | 1191 |
| 535 | Ga0373944_0000324 | 3300035089 | Bacteria | 10702 |
| 536 | Ga0373944_0001985 | 3300035089 | Bacteria | 5181 |
| 537 | Ga0373949_0030098 | 3300035090 | Bacteria | 1289 |
| 538 | Ga0373949_0034803 | 3300035090 | Bacteria | 1216 |
| 539 | Ga0373951_0000035 | 3300035091 | Bacteria | 52707 |
| 540 | Ga0373923_0011900 | 3300035111 | Bacteria | 3203 |
| 541 | Ga0373932_0013426 | 3300035112 | Bacteria | 2037 |
| 542 | Ga0373932_0020952 | 3300035112 | Bacteria | 1720 |
| 543 | Ga0373936_0000905 | 3300035113 | Bacteria | 10588 |
| 544 | Ga0373936_0003422 | 3300035113 | Bacteria | 5947 |
| 545 | Ga0373936_0005643 | 3300035113 | Bacteria | 4720 |
| 546 | Ga0373936_0068709 | 3300035113 | Bacteria | 1457 |
| 547 | Ga0373939_0015215 | 3300035114 | Bacteria | 2010 |
| 548 | Ga0373939_0094515 | 3300035114 | Bacteria | 1016 |
| 549 | Ga0373945_0002850 | 3300035116 | Bacteria | 5435 |
| 550 | Ga0373945_0003715 | 3300035116 | Bacteria | 4810 |
| 551 | Ga0373953_0000990 | 3300035117 | Bacteria | 7988 |
| 552 | Ga0373953_0002139 | 3300035117 | Bacteria | 5912 |
| 553 | Ga0373953_0003638 | 3300035117 | Bacteria | 4830 |
| 554 | Ga0373953_0004159 | 3300035117 | Bacteria | 4589 |
| 555 | Ga0373954_0004938 | 3300035118 | Bacteria | 5760 |
| 556 | Ga0373954_0020374 | 3300035118 | Bacteria | 2999 |
| 557 | Ga0373954_0022670 | 3300035118 | Bacteria | 2851 |
| 558 | Ga0373954_0023101 | 3300035118 | Bacteria | 2825 |
| 559 | Ga0373954_0108806 | 3300035118 | Bacteria | 1340 |
| 560 | Ga0373956_0000341 | 3300035119 | Bacteria | 18807 |
| 561 | Ga0373956_0004508 | 3300035119 | Bacteria | 5564 |
| 562 | Ga0373957_0000371 | 3300035120 | Bacteria | 11376 |
| 563 | Ga0373957_0002612 | 3300035120 | Bacteria | 5171 |
| 564 | Ga0373957_0083864 | 3300035120 | Bacteria | 1260 |
| 565 | Ga0373943_0002186 | 3300035170 | Bacteria | 8893 |
| 566 | Ga0373943_0005979 | 3300035170 | Bacteria | 5462 |
| 567 | Ga0373946_0019584 | 3300035171 | Bacteria | 2608 |
| 568 | Ga0373946_0021989 | 3300035171 | Bacteria | 2478 |
| 569 | Ga0373946_0067073 | 3300035171 | Bacteria | 1540 |
| 570 | Ga0373955_0000222 | 3300035172 | Bacteria | 23967 |
| 571 | Ga0373955_0008996 | 3300035172 | Bacteria | 4661 |
| 572 | Ga0373955_0017139 | 3300035172 | Bacteria | 3579 |
| 573 | Ga0373955_0031556 | 3300035172 | Bacteria | 2776 |
| 574 | Ga0373955_0071868 | 3300035172 | Bacteria | 1936 |
| 575 | Ga0373955_0080727 | 3300035172 | Bacteria | 1837 |
| 576 | Ga0373942_0000072 | 3300035207 | Bacteria | 21354 |
| 577 | Ga0373961_0077201 | 3300035241 | Bacteria | 1041 |
| 578 | Ga0373924_0003863 | 3300035410 | Bacteria | 5188 |
| 579 | Ga0373924_0004071 | 3300035410 | Bacteria | 5081 |
| 580 | Ga0373924_0018236 | 3300035410 | Bacteria | 2701 |
| 581 | Ga0373935_0000226 | 3300035692 | Bacteria | 27564 |
| 582 | Ga0373935_0020539 | 3300035692 | Bacteria | 4036 |
| 583 | Ga0373935_0090453 | 3300035692 | Bacteria | 2003 |
| 584 | Ga0373935_0135706 | 3300035692 | Bacteria | 1657 |
| 585 | Ga0373935_0147310 | 3300035692 | Bacteria | 1595 |
| 586 | Ga0373935_0201137 | 3300035692 | Bacteria | 1376 |
| 587 | Ga0373935_0221170 | 3300035692 | Bacteria | 1315 |
| 588 | Ga0373927_0001109 | 3300035695 | Bacteria | 20443 |
| 589 | Ga0373927_0003893 | 3300035695 | Bacteria | 10588 |
| 590 | Ga0373927_0041735 | 3300035695 | Bacteria | 2975 |
| 591 | Ga0373927_0046013 | 3300035695 | Bacteria | 2824 |
| 592 | Ga0373927_0327340 | 3300035695 | Bacteria | 1009 |
| 593 | Ga0373933_0000848 | 3300035724 | Bacteria | 18692 |
| 594 | Ga0373933_0008999 | 3300035724 | Bacteria | 5447 |
| 595 | Ga0373933_0015466 | 3300035724 | Bacteria | 4253 |
| 596 | Ga0373933_0033164 | 3300035724 | Bacteria | 3002 |
| 597 | Ga0373933_0041241 | 3300035724 | Bacteria | 2724 |
| 598 | Ga0373933_0046628 | 3300035724 | Bacteria | 2574 |
| 599 | Ga0373933_0107543 | 3300035724 | Bacteria | 1736 |
| 600 | Ga0373933_0267636 | 3300035724 | Bacteria | 1102 |
| 601 | Ga0373947_0030651 | 3300035725 | Bacteria | 3161 |
| 602 | Ga0373947_0065021 | 3300035725 | Bacteria | 2224 |
| 603 | Ga0373947_0128343 | 3300035725 | Bacteria | 1616 |
| 604 | Ga0373937_0001634 | 3300036401 | Bacteria | 18834 |
| 605 | Ga0373937_0022580 | 3300036401 | Bacteria | 5659 |
| 606 | Ga0373937_0106626 | 3300036401 | Bacteria | 2604 |
| 607 | Ga0373937_0109859 | 3300036401 | Bacteria | 2564 |
| 608 | Ga0373937_0141967 | 3300036401 | Bacteria | 2247 |
| 609 | Ga0373925_0005454 | 3300037068 | Bacteria | 9473 |
| 610 | Ga0373925_0007437 | 3300037068 | Bacteria | 7991 |
| 611 | Ga0373925_0021225 | 3300037068 | Bacteria | 4732 |
| 612 | Ga0373925_0062762 | 3300037068 | Bacteria | 2794 |
| 613 | Ga0373925_0255154 | 3300037068 | Bacteria | 1407 |
| 614 | Ga0373925_0299506 | 3300037068 | Bacteria | 1298 |
| 615 | Ga0395898_0004690 | 3300037466 | Bacteria | 14880 |
| 616 | Ga0395898_0068565 | 3300037466 | Bacteria | 3433 |
| 617 | Ga0395898_0189341 | 3300037466 | Bacteria | 1966 |
| 618 | Ga0436364_0201885 | 3300037853 | Bacteria | 1887 |
| 619 | Ga0436364_0704698 | 3300037853 | Bacteria | 12100 |
| 620 | Ga0436364_0888788 | 3300037853 | Bacteria | 28172 |
| 621 | Ga0436364_1231391 | 3300037853 | Bacteria | 28702 |
| 622 | Ga0436364_1294101 | 3300037853 | Bacteria | 1313 |
| 623 | Ga0436364_1376954 | 3300037853 | Bacteria | 7454 |
| 624 | Ga0395901_0009504 | 3300038443 | Bacteria | 9864 |
| 625 | Ga0395901_0353653 | 3300038443 | Bacteria | 1516 |
| 626 | Ga0395901_0369029 | 3300038443 | Bacteria | 1479 |
| 627 | Ga0395901_0612173 | 3300038443 | Bacteria | 1097 |
| 628 | Ga0436365_1836282 | 3300039437 | Bacteria | 1510 |
| 629 | Ga0436365_1894323 | 3300039437 | Bacteria | 2658 |
| 630 | Ga0439461_0032856 | 3300041410 | Bacteria | 1090 |
| 631 | Ga0439435_0008382 | 3300042436 | Bacteria | 2395 |
| 632 | Ga0439440_0077155 | 3300042993 | Bacteria | 876 |
| 633 | Ga0466963_0132851 | 3300044694 | Bacteria | 1720 |
| 634 | Ga0466970_0013553 | 3300044765 | Bacteria | 4182 |
| 635 | Ga0466967_0000252 | 3300045976 | Bacteria | 23522 |
| 636 | Ga0466967_0017716 | 3300045976 | Bacteria | 5667 |
| 637 | Ga0495592_0001091 | 3300046454 | Bacteria | 18834 |
| 638 | Ga0495592_0004625 | 3300046454 | Bacteria | 10082 |
| 639 | Ga0495592_0021701 | 3300046454 | Bacteria | 4884 |
| 640 | Ga0495603_0001487 | 3300046455 | Bacteria | 13635 |
| 641 | Ga0495603_0006041 | 3300046455 | Bacteria | 7240 |
| 642 | Ga0495603_0067781 | 3300046455 | Bacteria | 2100 |
| 643 | Ga0495603_0072262 | 3300046455 | Bacteria | 2027 |
| 644 | Ga0495590_0062259 | 3300046457 | Bacteria | 1306 |
| 645 | Ga0495629_0001438 | 3300046459 | Bacteria | 18783 |
| 646 | Ga0495629_0007247 | 3300046459 | Bacteria | 8169 |
| 647 | Ga0495629_0015074 | 3300046459 | Bacteria | 5556 |
| 648 | Ga0495629_0025175 | 3300046459 | Bacteria | 4233 |
| 649 | Ga0495629_0053887 | 3300046459 | Bacteria | 2813 |
| 650 | Ga0495641_0004177 | 3300046461 | Bacteria | 10377 |
| 651 | Ga0495641_0006974 | 3300046461 | Bacteria | 7182 |
| 652 | Ga0495641_0022107 | 3300046461 | Bacteria | 3187 |
| 653 | Ga0495651_0001242 | 3300046462 | Bacteria | 19733 |
| 654 | Ga0495651_0001382 | 3300046462 | Bacteria | 18834 |
| 655 | Ga0495651_0002417 | 3300046462 | Bacteria | 14421 |
| 656 | Ga0495651_0008758 | 3300046462 | Bacteria | 7761 |
| 657 | Ga0495651_0026018 | 3300046462 | Bacteria | 4555 |
| 658 | Ga0495651_0046897 | 3300046462 | Bacteria | 3343 |
| 659 | Ga0495651_0122790 | 3300046462 | Bacteria | 1905 |
| 660 | Ga0495651_0253160 | 3300046462 | Bacteria | 1201 |
| 661 | Ga0495653_0005648 | 3300046463 | Bacteria | 10211 |
| 662 | Ga0495653_0032694 | 3300046463 | Bacteria | 4128 |
| 663 | Ga0495653_0033362 | 3300046463 | Bacteria | 4079 |
| 664 | Ga0495653_0073614 | 3300046463 | Bacteria | 2548 |
| 665 | Ga0495653_0081242 | 3300046463 | Bacteria | 2395 |
| 666 | Ga0495650_0051096 | 3300046471 | Bacteria | 1705 |
| 667 | Ga0495580_0006138 | 3300046472 | Bacteria | 9826 |
| 668 | Ga0495580_0010059 | 3300046472 | Bacteria | 7393 |
| 669 | Ga0495580_0041068 | 3300046472 | Bacteria | 3301 |
| 670 | Ga0495580_0193771 | 3300046472 | Bacteria | 1401 |
| 671 | Ga0495582_0002383 | 3300046473 | Bacteria | 10517 |
| 672 | Ga0495582_0002725 | 3300046473 | Bacteria | 9868 |
| 673 | Ga0495639_0001976 | 3300046475 | Bacteria | 9080 |
| 674 | Ga0495639_0003351 | 3300046475 | Bacteria | 6947 |
| 675 | Ga0495662_0000330 | 3300046476 | Bacteria | 20617 |
| 676 | Ga0495662_0006861 | 3300046476 | Bacteria | 5661 |
| 677 | Ga0495662_0008455 | 3300046476 | Bacteria | 5064 |
| 678 | Ga0495664_0020515 | 3300046477 | Bacteria | 3811 |
| 679 | Ga0495664_0048087 | 3300046477 | Bacteria | 2532 |
| 680 | Ga0495664_0049767 | 3300046477 | Bacteria | 2488 |
| 681 | Ga0495664_0054693 | 3300046477 | Bacteria | 2373 |
| 682 | Ga0495664_0060503 | 3300046477 | Bacteria | 2254 |
| 683 | Ga0495664_0111367 | 3300046477 | Bacteria | 1652 |
| 684 | Ga0495664_0138957 | 3300046477 | Bacteria | 1472 |
| 685 | Ga0495664_0200408 | 3300046477 | Bacteria | 1209 |
| 686 | Ga0495585_0009296 | 3300046492 | Bacteria | 5905 |
| 687 | Ga0495585_0063373 | 3300046492 | Bacteria | 2029 |
| 688 | Ga0495594_0004876 | 3300046499 | Bacteria | 6908 |
| 689 | Ga0495594_0037441 | 3300046499 | Bacteria | 2646 |
| 690 | Ga0495594_0088422 | 3300046499 | Bacteria | 1734 |
| 691 | Ga0495606_0011938 | 3300046507 | Bacteria | 7023 |
| 692 | Ga0495608_0001140 | 3300046511 | Bacteria | 18806 |
| 693 | Ga0495608_0003658 | 3300046511 | Bacteria | 11052 |
| 694 | Ga0495608_0013593 | 3300046511 | Bacteria | 5646 |
| 695 | Ga0495608_0014739 | 3300046511 | Bacteria | 5425 |
| 696 | Ga0495608_0022442 | 3300046511 | Bacteria | 4326 |
| 697 | Ga0495608_0094111 | 3300046511 | Bacteria | 1935 |
| 698 | Ga0495618_0018212 | 3300046514 | Bacteria | 4312 |
| 699 | Ga0495618_0037478 | 3300046514 | Bacteria | 3045 |
| 700 | Ga0495618_0041896 | 3300046514 | Bacteria | 2884 |
| 701 | Ga0495618_0108502 | 3300046514 | Bacteria | 1777 |
| 702 | Ga0495618_0264481 | 3300046514 | Bacteria | 1076 |
| 703 | Ga0495628_0003233 | 3300046516 | Bacteria | 14600 |
| 704 | Ga0495628_0035979 | 3300046516 | Bacteria | 3976 |
| 705 | Ga0495628_0099515 | 3300046516 | Bacteria | 2245 |
| 706 | Ga0495628_0151228 | 3300046516 | Bacteria | 1768 |
| 707 | Ga0495628_0186037 | 3300046516 | Bacteria | 1569 |
| 708 | Ga0495630_0002131 | 3300046517 | Bacteria | 13762 |
| 709 | Ga0495630_0006764 | 3300046517 | Bacteria | 8168 |
| 710 | Ga0495630_0025631 | 3300046517 | Bacteria | 4362 |
| 711 | Ga0495630_0071538 | 3300046517 | Bacteria | 2610 |
| 712 | Ga0495630_0136671 | 3300046517 | Bacteria | 1862 |
| 713 | Ga0495632_0024171 | 3300046519 | Bacteria | 3233 |
| 714 | Ga0495666_0009740 | 3300046526 | Bacteria | 4802 |
| 715 | Ga0495666_0024094 | 3300046526 | Bacteria | 3009 |
| 716 | Ga0495666_0032388 | 3300046526 | Bacteria | 2558 |
| 717 | Ga0495652_0002465 | 3300046529 | Bacteria | 19022 |
| 718 | Ga0495652_0003372 | 3300046529 | Bacteria | 15807 |
| 719 | Ga0495652_0029805 | 3300046529 | Bacteria | 4790 |
| 720 | Ga0495652_0037314 | 3300046529 | Bacteria | 4216 |
| 721 | Ga0495652_0049236 | 3300046529 | Bacteria | 3608 |
| 722 | Ga0495652_0066384 | 3300046529 | Bacteria | 3028 |
| 723 | Ga0495652_0098822 | 3300046529 | Bacteria | 2371 |
| 724 | Ga0495652_0130103 | 3300046529 | Bacteria | 1994 |
| 725 | Ga0495652_0244529 | 3300046529 | Bacteria | 1333 |
| 726 | Ga0495665_0001654 | 3300046531 | Bacteria | 11947 |
| 727 | Ga0495665_0006498 | 3300046531 | Bacteria | 6313 |
| 728 | Ga0495665_0027844 | 3300046531 | Bacteria | 3033 |
| 729 | Ga0495640_0010082 | 3300046533 | Bacteria | 7323 |
| 730 | Ga0495640_0012364 | 3300046533 | Bacteria | 6523 |
| 731 | Ga0495640_0045563 | 3300046533 | Bacteria | 3043 |
| 732 | Ga0495640_0056164 | 3300046533 | Bacteria | 2690 |
| 733 | Ga0495586_0002716 | 3300046535 | Bacteria | 9578 |
| 734 | Ga0495586_0029450 | 3300046535 | Bacteria | 2937 |
| 735 | Ga0495586_0084540 | 3300046535 | Bacteria | 1747 |
| 736 | Ga0495586_0201730 | 3300046535 | Bacteria | 1128 |
| 737 | Ga0495587_0000981 | 3300046536 | Bacteria | 18711 |
| 738 | Ga0495587_0003495 | 3300046536 | Bacteria | 10460 |
| 739 | Ga0495587_0004441 | 3300046536 | Bacteria | 9244 |
| 740 | Ga0495587_0006362 | 3300046536 | Bacteria | 7701 |
| 741 | Ga0495587_0007982 | 3300046536 | Bacteria | 6838 |
| 742 | Ga0495587_0028386 | 3300046536 | Bacteria | 3402 |
| 743 | Ga0495587_0105812 | 3300046536 | Bacteria | 1618 |
| 744 | Ga0495587_0172229 | 3300046536 | Bacteria | 1229 |
| 745 | Ga0495645_0009004 | 3300046543 | Bacteria | 6969 |
| 746 | Ga0495645_0010626 | 3300046543 | Bacteria | 6462 |
| 747 | Ga0495645_0019978 | 3300046543 | Bacteria | 4829 |
| 748 | Ga0495645_0024211 | 3300046543 | Bacteria | 4404 |
| 749 | Ga0495645_0042062 | 3300046543 | Bacteria | 3331 |
| 750 | Ga0495645_0047547 | 3300046543 | Bacteria | 3125 |
| 751 | Ga0495645_0066131 | 3300046543 | Bacteria | 2614 |
| 752 | Ga0495622_0008244 | 3300046557 | Bacteria | 4826 |
| 753 | Ga0495667_0000915 | 3300046559 | Bacteria | 19070 |
| 754 | Ga0495667_0002764 | 3300046559 | Bacteria | 11714 |
| 755 | Ga0495667_0021348 | 3300046559 | Bacteria | 4369 |
| 756 | Ga0495667_0024975 | 3300046559 | Bacteria | 4026 |
| 757 | Ga0495667_0027919 | 3300046559 | Bacteria | 3799 |
| 758 | Ga0495667_0030094 | 3300046559 | Bacteria | 3650 |
| 759 | Ga0495667_0067710 | 3300046559 | Bacteria | 2332 |
| 760 | Ga0495667_0074358 | 3300046559 | Bacteria | 2212 |
| 761 | Ga0495667_0271274 | 3300046559 | Bacteria | 1078 |
| 762 | Ga0495668_0000471 | 3300046616 | Bacteria | 50892 |
| 763 | Ga0495634_0010231 | 3300046642 | Bacteria | 6879 |
| 764 | Ga0495634_0033585 | 3300046642 | Bacteria | 3525 |
| 765 | Ga0495634_0048512 | 3300046642 | Bacteria | 2858 |
| 766 | Ga0495634_0079379 | 3300046642 | Bacteria | 2149 |
| 767 | Ga0495625_0000265 | 3300046660 | Bacteria | 81480 |
| 768 | Ga0495635_0003166 | 3300046663 | Bacteria | 11338 |
| 769 | Ga0495635_0015603 | 3300046663 | Bacteria | 5308 |
| 770 | Ga0495635_0042933 | 3300046663 | Bacteria | 3121 |
| 771 | Ga0495635_0056040 | 3300046663 | Bacteria | 2714 |
| 772 | Ga0495635_0063473 | 3300046663 | Bacteria | 2536 |
| 773 | Ga0495635_0076696 | 3300046663 | Bacteria | 2290 |
| 774 | Ga0495635_0078945 | 3300046663 | Bacteria | 2253 |
| 775 | Ga0495635_0248119 | 3300046663 | Bacteria | 1200 |
| 776 | Ga0495588_0031007 | 3300046674 | Bacteria | 2689 |
| 777 | Ga0495588_0069391 | 3300046674 | Bacteria | 1832 |
| 778 | Ga0495657_0001708 | 3300046675 | Bacteria | 18828 |
| 779 | Ga0495657_0003275 | 3300046675 | Bacteria | 13297 |
| 780 | Ga0495657_0008776 | 3300046675 | Bacteria | 7708 |
| 781 | Ga0495657_0050083 | 3300046675 | Bacteria | 2809 |
| 782 | Ga0495657_0069770 | 3300046675 | Bacteria | 2298 |
| 783 | Ga0495657_0120633 | 3300046675 | Bacteria | 1651 |
| 784 | Ga0495657_0253238 | 3300046675 | Bacteria | 1059 |
| 785 | Ga0495599_0000707 | 3300046678 | Bacteria | 18834 |
| 786 | Ga0495599_0004490 | 3300046678 | Bacteria | 8267 |
| 787 | Ga0495599_0005475 | 3300046678 | Bacteria | 7595 |
| 788 | Ga0495599_0009019 | 3300046678 | Bacteria | 6077 |
| 789 | Ga0495599_0036382 | 3300046678 | Bacteria | 3091 |
| 790 | Ga0495599_0055863 | 3300046678 | Bacteria | 2471 |
| 791 | Ga0495599_0139439 | 3300046678 | Bacteria | 1504 |
| 792 | Ga0495599_0155234 | 3300046678 | Bacteria | 1416 |
| 793 | Ga0495623_0003451 | 3300046679 | Bacteria | 10457 |
| 794 | Ga0495623_0009059 | 3300046679 | Bacteria | 6455 |
| 795 | Ga0495623_0048352 | 3300046679 | Bacteria | 2698 |
| 796 | Ga0495623_0054886 | 3300046679 | Bacteria | 2513 |
| 797 | Ga0495646_0009048 | 3300046680 | Bacteria | 6314 |
| 798 | Ga0495646_0011589 | 3300046680 | Bacteria | 5600 |
| 799 | Ga0495646_0024844 | 3300046680 | Bacteria | 3770 |
| 800 | Ga0495646_0042680 | 3300046680 | Bacteria | 2781 |
| 801 | Ga0495646_0148696 | 3300046680 | Bacteria | 1304 |
| 802 | Ga0495647_0016297 | 3300046681 | Bacteria | 2614 |
| 803 | Ga0495658_0001712 | 3300046683 | Bacteria | 11402 |
| 804 | Ga0495613_0001810 | 3300046689 | Bacteria | 16241 |
| 805 | Ga0495613_0003215 | 3300046689 | Bacteria | 12228 |
| 806 | Ga0495613_0157478 | 3300046689 | Bacteria | 1617 |
| 807 | Ga0495624_0003275 | 3300046690 | Bacteria | 12068 |
| 808 | Ga0495624_0051537 | 3300046690 | Bacteria | 2603 |
| 809 | Ga0495624_0070413 | 3300046690 | Bacteria | 2177 |
| 810 | Ga0495624_0081677 | 3300046690 | Bacteria | 2001 |
| 811 | Ga0495589_0023238 | 3300046794 | Bacteria | 3161 |
| 812 | Ga0495600_0001389 | 3300046809 | Bacteria | 13373 |
| 813 | Ga0495600_0024841 | 3300046809 | Bacteria | 3857 |
| 814 | Ga0495600_0041437 | 3300046809 | Bacteria | 3001 |
| 815 | Ga0495600_0119138 | 3300046809 | Bacteria | 1717 |
| 816 | Ga0495581_0001801 | 3300047315 | Bacteria | 11971 |
| 817 | Ga0495581_0007583 | 3300047315 | Bacteria | 6272 |
| 818 | Ga0495581_0066284 | 3300047315 | Bacteria | 2088 |
| 819 | Ga0495581_0243336 | 3300047315 | Bacteria | 1052 |
| 820 | Ga0495604_0001527 | 3300047317 | Bacteria | 19055 |
| 821 | Ga0495604_0003616 | 3300047317 | Bacteria | 12325 |
| 822 | Ga0495604_0013167 | 3300047317 | Bacteria | 6586 |
| 823 | Ga0495604_0018582 | 3300047317 | Bacteria | 5568 |
| 824 | Ga0495604_0022488 | 3300047317 | Bacteria | 5033 |
| 825 | Ga0495604_0023139 | 3300047317 | Bacteria | 4958 |
| 826 | Ga0495604_0031191 | 3300047317 | Bacteria | 4229 |
| 827 | Ga0495604_0031382 | 3300047317 | Bacteria | 4213 |
| 828 | Ga0495604_0092888 | 3300047317 | Bacteria | 2234 |
| 829 | Ga0495604_0104589 | 3300047317 | Bacteria | 2074 |
| 830 | Ga0495636_0009336 | 3300047318 | Bacteria | 3861 |
| 831 | Ga0495674_0010201 | 3300047319 | Bacteria | 8898 |
| 832 | Ga0495674_0013582 | 3300047319 | Bacteria | 7650 |
| 833 | Ga0495674_0017794 | 3300047319 | Bacteria | 6617 |
| 834 | Ga0495674_0018498 | 3300047319 | Bacteria | 6484 |
| 835 | Ga0495674_0099222 | 3300047319 | Bacteria | 2479 |
| 836 | Ga0495674_0102234 | 3300047319 | Bacteria | 2437 |
| 837 | Ga0495674_0125621 | 3300047319 | Bacteria | 2165 |
| 838 | Ga0495674_0212832 | 3300047319 | Bacteria | 1600 |
| 839 | Ga0495676_0002061 | 3300047321 | Bacteria | 17687 |
| 840 | Ga0495676_0016825 | 3300047321 | Bacteria | 6476 |
| 841 | Ga0495676_0022504 | 3300047321 | Bacteria | 5481 |
| 842 | Ga0495680_0002494 | 3300047322 | Bacteria | 18812 |
| 843 | Ga0495680_0004087 | 3300047322 | Bacteria | 14056 |
| 844 | Ga0495680_0013124 | 3300047322 | Bacteria | 7240 |
| 845 | Ga0495680_0017482 | 3300047322 | Bacteria | 6122 |
| 846 | Ga0495680_0024075 | 3300047322 | Bacteria | 5054 |
| 847 | Ga0495680_0025613 | 3300047322 | Bacteria | 4879 |
| 848 | Ga0495680_0058447 | 3300047322 | Bacteria | 2979 |
| 849 | Ga0495680_0069090 | 3300047322 | Bacteria | 2696 |
| 850 | Ga0495687_005985 | 3300047443 | Bacteria | 7581 |
| 851 | Ga0495675_0000440 | 3300047444 | Bacteria | 27746 |
| 852 | Ga0495675_0001608 | 3300047444 | Bacteria | 13581 |
| 853 | Ga0495675_0019850 | 3300047444 | Bacteria | 4270 |
| 854 | Ga0495675_0021821 | 3300047444 | Bacteria | 4079 |
| 855 | Ga0495675_0055500 | 3300047444 | Bacteria | 2512 |
| 856 | Ga0495675_0084364 | 3300047444 | Bacteria | 1999 |
| 857 | Ga0495675_0132355 | 3300047444 | Bacteria | 1549 |
| 858 | Ga0495684_0009270 | 3300047471 | Bacteria | 7598 |
| 859 | Ga0495684_0012323 | 3300047471 | Bacteria | 6594 |
| 860 | Ga0495684_0066981 | 3300047471 | Bacteria | 2730 |
| 861 | Ga0495684_0143107 | 3300047471 | Bacteria | 1792 |
| 862 | Ga0495684_0191565 | 3300047471 | Bacteria | 1511 |
| 863 | Ga0495686_0109153 | 3300047472 | Bacteria | 1661 |
| 864 | Ga0495593_0002356 | 3300047673 | Bacteria | 11347 |
| 865 | Ga0495593_0002885 | 3300047673 | Bacteria | 10364 |
| 866 | Ga0495602_0002471 | 3300048088 | Bacteria | 18834 |
| 867 | Ga0495602_0010201 | 3300048088 | Bacteria | 9749 |
| 868 | Ga0495602_0013999 | 3300048088 | Bacteria | 8165 |
| 869 | Ga0495602_0037969 | 3300048088 | Bacteria | 4460 |
| 870 | Ga0495602_0042251 | 3300048088 | Bacteria | 4155 |
| 871 | Ga0495602_0083881 | 3300048088 | Bacteria | 2667 |
| 872 | Ga0495602_0085388 | 3300048088 | Bacteria | 2638 |
| 873 | Ga0495602_0244590 | 3300048088 | Bacteria | 1340 |
| 874 | Ga0495614_0010426 | 3300048089 | Bacteria | 4097 |
| 875 | Ga0495626_0000509 | 3300048091 | Bacteria | 38930 |
| 876 | Ga0496100_0226858 | 3300048903 | Bacteria | 1373 |
| 877 | Ga0496101_0153065 | 3300048904 | Bacteria | 1765 |
| 878 | Ga0496102_0020030 | 3300048905 | Bacteria | 5904 |
| 879 | Ga0496102_0025368 | 3300048905 | Bacteria | 5277 |
| 880 | Ga0496102_0135800 | 3300048905 | Bacteria | 2304 |
| 881 | Ga0496102_0397021 | 3300048905 | Bacteria | 1297 |
| 882 | Ga0496103_0070107 | 3300048906 | Bacteria | 2193 |
| 883 | Ga0496104_0001455 | 3300048907 | Bacteria | 20467 |
| 884 | Ga0496104_0006424 | 3300048907 | Bacteria | 10336 |
| 885 | Ga0496104_0021408 | 3300048907 | Bacteria | 5936 |
| 886 | Ga0496104_0042179 | 3300048907 | Bacteria | 4280 |
| 887 | Ga0496104_0103253 | 3300048907 | Bacteria | 2731 |
| 888 | Ga0496104_0168199 | 3300048907 | Bacteria | 2102 |
| 889 | Ga0496105_0004910 | 3300048908 | Bacteria | 10110 |
| 890 | Ga0496105_0025548 | 3300048908 | Bacteria | 4809 |
| 891 | Ga0496105_0051608 | 3300048908 | Bacteria | 3397 |
| 892 | Ga0496105_0084414 | 3300048908 | Bacteria | 2623 |
| 893 | Ga0496105_0103161 | 3300048908 | Bacteria | 2355 |
| 894 | Ga0496105_0117019 | 3300048908 | Bacteria | 2198 |
| 895 | Ga0496105_0126660 | 3300048908 | Bacteria | 2105 |
| 896 | Ga0496106_0002362 | 3300048909 | Bacteria | 14048 |
| 897 | Ga0496106_0091822 | 3300048909 | Bacteria | 2344 |
| 898 | Ga0496106_0212902 | 3300048909 | Bacteria | 1540 |
| 899 | Ga0496106_0300118 | 3300048909 | Bacteria | 1288 |
| 900 | Ga0496107_0050839 | 3300048910 | Bacteria | 2988 |
| 901 | Ga0496107_0062591 | 3300048910 | Bacteria | 2696 |
| 902 | Ga0496108_0005696 | 3300048911 | Bacteria | 10084 |
| 903 | Ga0496108_0008118 | 3300048911 | Bacteria | 8513 |
| 904 | Ga0496108_0010587 | 3300048911 | Bacteria | 7485 |
| 905 | Ga0496108_0017005 | 3300048911 | Bacteria | 5944 |
| 906 | Ga0496108_0067962 | 3300048911 | Bacteria | 3006 |
| 907 | Ga0496108_0222307 | 3300048911 | Bacteria | 1641 |
| 908 | Ga0496108_0249282 | 3300048911 | Bacteria | 1545 |
| 909 | Ga0496108_0265937 | 3300048911 | Bacteria | 1492 |
| 910 | Ga0496109_0021940 | 3300048912 | Bacteria | 5653 |
| 911 | Ga0496109_0042177 | 3300048912 | Bacteria | 4132 |
| 912 | Ga0496109_0051182 | 3300048912 | Bacteria | 3761 |
| 913 | Ga0496110_0006941 | 3300048913 | Bacteria | 9006 |
| 914 | Ga0496110_0011473 | 3300048913 | Bacteria | 7252 |
| 915 | Ga0496110_0015992 | 3300048913 | Bacteria | 6257 |
| 916 | Ga0496111_0001546 | 3300048914 | Bacteria | 13249 |
| 917 | Ga0496111_0002777 | 3300048914 | Bacteria | 10661 |
| 918 | Ga0496111_0027944 | 3300048914 | Bacteria | 3995 |
| 919 | Ga0496111_0060266 | 3300048914 | Bacteria | 2751 |
| 920 | Ga0496111_0074794 | 3300048914 | Bacteria | 2468 |
| 921 | Ga0496111_0129268 | 3300048914 | Bacteria | 1868 |
| 922 | Ga0496112_0011884 | 3300048915 | Bacteria | 7974 |
| 923 | Ga0496112_0117384 | 3300048915 | Bacteria | 2631 |
| 924 | Ga0496112_0247493 | 3300048915 | Bacteria | 1734 |
| 925 | Ga0496112_0550786 | 3300048915 | Bacteria | 1087 |
| 926 | Ga0496113_0003244 | 3300048916 | Bacteria | 9706 |
| 927 | Ga0496113_0018560 | 3300048916 | Bacteria | 4847 |
| 928 | Ga0496113_0062099 | 3300048916 | Bacteria | 2821 |
| 929 | Ga0496113_0156486 | 3300048916 | Bacteria | 1800 |
| 930 | Ga0496114_0287409 | 3300048917 | Bacteria | 1450 |
| 931 | Ga0496114_0354023 | 3300048917 | Bacteria | 1299 |
| 932 | Ga0496114_0381281 | 3300048917 | Bacteria | 1248 |
| 933 | Ga0496115_0011638 | 3300048918 | Bacteria | 6601 |
| 934 | Ga0496115_0139962 | 3300048918 | Bacteria | 1996 |
| 935 | Ga0496115_0146114 | 3300048918 | Bacteria | 1951 |
| 936 | Ga0496115_0232422 | 3300048918 | Bacteria | 1520 |
| 937 | Ga0496119_0030341 | 3300048922 | Bacteria | 3648 |
| 938 | Ga0496119_0041464 | 3300048922 | Bacteria | 2931 |
| 939 | Ga0496126_0007060 | 3300048929 | Bacteria | 12375 |
| 940 | Ga0496126_0015348 | 3300048929 | Bacteria | 7705 |
| 941 | Ga0496126_0384897 | 3300048929 | Bacteria | 1141 |
| 942 | Ga0501039_0077001 | 3300049575 | Bacteria | 2594 |
| 943 | Ga0501046_0008733 | 3300049580 | Bacteria | 8803 |
| 944 | Ga0501047_0057673 | 3300049581 | Bacteria | 3755 |
| 945 | Ga0501047_0059036 | 3300049581 | Bacteria | 3704 |
| 946 | Ga0501047_0107421 | 3300049581 | Bacteria | 2672 |
| 947 | Ga0501047_0328485 | 3300049581 | Bacteria | 1368 |
| 948 | Ga0501047_0622297 | 3300049581 | Bacteria | 900 |
| 949 | Ga0501069_0184588 | 3300049585 | Bacteria | 1206 |
| 950 | Ga0501070_0098816 | 3300049586 | Bacteria | 2414 |
| 951 | Ga0501073_0151262 | 3300049589 | Bacteria | 1609 |
| 952 | Ga0501075_0227663 | 3300049591 | Bacteria | 1422 |
| 953 | Ga0501080_0090184 | 3300049742 | Bacteria | 2848 |
| 954 | Ga0501081_0355748 | 3300049743 | Bacteria | 1080 |
| 955 | Ga0501035_0052514 | 3300049822 | Bacteria | 3647 |
| 956 | Ga0501044_0112962 | 3300049823 | Bacteria | 2723 |
| 957 | Ga0501044_0160038 | 3300049823 | Bacteria | 2229 |
| 958 | nmdc:mga0yw44_185995_c1 | 3300050492 | Bacteria | 1369 |
| 959 | nmdc:mga0yw44_91953_c1 | 3300050492 | Bacteria | 1919 |
| 960 | nmdc:mga0yw44_94197_c1 | 3300050492 | Bacteria | 1898 |
| 961 | nmdc:mga05p37_108791_c1 | 3300050507 | Bacteria | 3410 |
| 962 | nmdc:mga08y16_12180_c1 | 3300050511 | Bacteria | 9039 |
| 963 | nmdc:mga08y16_13697_c1 | 3300050511 | Bacteria | 8537 |
| 964 | nmdc:mga08y16_38321_c1 | 3300050511 | Bacteria | 5034 |
| 965 | nmdc:mga0n895_20419_c1 | 3300050512 | Bacteria | 6179 |
| 966 | nmdc:mga0n895_345860_c1 | 3300050512 | Bacteria | 1506 |
| 967 | nmdc:mga0n895_45065_c1 | 3300050512 | Bacteria | 4303 |
| 968 | nmdc:mga0rr50_389063_c1 | 3300050513 | Bacteria | 1177 |
| 969 | nmdc:mga08x19_119112_c1 | 3300050514 | Bacteria | 1768 |
| 970 | nmdc:mga08x19_25122_c1 | 3300050514 | Bacteria | 3710 |
| 971 | nmdc:mga08x19_67768_c1 | 3300050514 | Bacteria | 2322 |
| 972 | nmdc:mga08x19_98864_c1 | 3300050514 | Bacteria | 1933 |
| 973 | nmdc:mga0a205_10813_c1 | 3300050515 | Bacteria | 8397 |
| 974 | nmdc:mga0a205_2165_c1 | 3300050515 | Bacteria | 17267 |
| 975 | nmdc:mga0a205_26974_c1 | 3300050515 | Bacteria | 5484 |
| 976 | nmdc:mga0sz30_4301_c1 | 3300050516 | Bacteria | 5139 |
| 977 | Ga0495601_0010558 | 3300053077 | Bacteria | 5499 |
| 978 | Ga0495601_0057308 | 3300053077 | Bacteria | 2468 |
| 979 | Ga0495601_0070754 | 3300053077 | Bacteria | 2227 |
| 980 | Ga0495601_0181182 | 3300053077 | Bacteria | 1377 |
| 981 | Ga0495612_0001401 | 3300053078 | Bacteria | 9918 |
| 982 | Ga0495612_0007573 | 3300053078 | Bacteria | 4436 |
| 983 | Ga0495612_0094193 | 3300053078 | Bacteria | 1271 |
| 984 | Ga0495612_0131641 | 3300053078 | Bacteria | 1081 |
| 985 | Ga0495595_0000359 | 3300053084 | Bacteria | 17316 |
| 986 | Ga0495595_0004553 | 3300053084 | Bacteria | 5575 |
| 987 | Ga0495595_0035424 | 3300053084 | Bacteria | 2261 |
| 988 | Ga0495619_0003203 | 3300053085 | Bacteria | 10600 |
| 989 | Ga0495619_0052202 | 3300053085 | Bacteria | 2702 |
| 990 | Ga0495619_0286502 | 3300053085 | Bacteria | 1141 |
| 991 | Ga0500554_068352 | 3300053102 | Bacteria | 1152 |
| 992 | Ga0500594_0021175 | 3300053118 | Bacteria | 1628 |
| 993 | Ga0500616_0012339 | 3300053153 | Bacteria | 5003 |
| 994 | Ga0500630_134088 | 3300053159 | Bacteria | 1077 |
| 995 | Ga0500633_0034268 | 3300053160 | Bacteria | 1664 |
| 996 | 2547410688 | 2547132111 | Bacteria | 8013147 |
| 997 | 2548693720 | 2547132424 | Bacteria | 8348532 |
| 998 | 2552110534 | 2551306166 | Bacteria | 9731570 |
| 999 | 2558911402 | 2558860112 | Bacteria | 9931328 |
| 1000 | 2586059882 | 2585427649 | Bacteria | 9053857 |
| 1001 | 2643901504 | 2643221578 | Bacteria | 9213798 |
| 1002 | 2643942289 | 2643221587 | Bacteria | 7586415 |
| 1003 | 2644387059 | 2643221670 | Bacteria | 6497041 |
| 1004 | 2644407650 | 2643221673 | Bacteria | 9196637 |
| 1005 | 2644429372 | 2643221677 | Bacteria | 7584031 |
| 1006 | 2676474053 | 2675903058 | Bacteria | 6822861 |
| 1007 | 2676484290 | 2675903059 | Bacteria | 8644972 |
| 1008 | 2676487866 | 2675903060 | Bacteria | 10051191 |
| 1009 | 2784592660 | 2784132148 | Bacteria | 8627943 |
| 1010 | 2804848638 | 2802429296 | Bacteria | 7227771 |
| 1011 | 2809236293 | 2808606448 | Bacteria | 8656184 |
| 1012 | 2816504320 | 2816332139 | Bacteria | 9138787 |
| 1013 | 2816504414 | 2816332139 | Bacteria | 9138787 |
| 1014 | 2827628944 | 2827628540 | Bacteria | 6858585 |
| 1015 | 2837270622 | 2837268691 | Bacteria | 7850704 |
| 1016 | 2856741854 | 2856741275 | Bacteria | 8096094 |
| 1017 | 2862291851 | 2862290372 | Bacteria | 7471434 |
| 1018 | 2867305986 | 2867302475 | Bacteria | 7087181 |
| 1019 | 2873157968 | 2873151551 | Bacteria | 8625867 |
| 1020 | 2880491552 | 2880489317 | Bacteria | 7096270 |
| 1021 | 2884696441 | 2884693830 | Bacteria | 11273186 |
| 1022 | 2891554420 | 2891554331 | Bacteria | 8812224 |
| 1023 | 2891563975 | 2891562705 | Bacteria | 8039471 |
| 1024 | 2891567336 | 2891562705 | Bacteria | 8039471 |
| 1025 | 2895446987 | 2895442618 | Bacteria | 11027144 |
| 1026 | 2895449794 | 2895442618 | Bacteria | 11027144 |
| 1027 | 2919473268 | 2919468124 | Bacteria | 9133025 |
| 1028 | 2919717766 | 2919713450 | Bacteria | 7431245 |
| 1029 | 2946046389 | 2946045630 | Bacteria | 8527308 |
| 1030 | 2954381067 | 2954380949 | Bacteria | 10050426 |
| 1031 | 3006327278 | 3006321560 | Bacteria | 8247479 |
| 1032 | 8001786713 | 8001781756 | Bacteria | 9586736 |
| 1033 | 8023630922 | 8023623736 | Bacteria | 8593882 |
| 1034 | 8025419095 | 8025413630 | Bacteria | 7014048 |
| 1035 | 8054165890 | 8054160619 | Bacteria | 7783213 |
| 1036 | 8054731203 | 8054727385 | Bacteria | 7558670 |
| 1037 | 8054735934 | 8054734606 | Bacteria | 6947278 |
| 1038 | 8056062673 | 8056060235 | Bacteria | 7259403 |
| 1039 | 8056063261 | 8056060235 | Bacteria | 7259403 |
| 1040 | Ga0070699_100053909 | |||
| 1041 | JGI25407J50210_10020823 | |||
| 1042 | JGI25407J50210_10022959 | |||
| 1043 | Ga0006562J51391_1067189 | |||
| 1044 | Ga0070658_10011944 | |||
| 1045 | Ga0070658_10029511 | |||
| 1046 | Ga0070658_10189631 | |||
| 1047 | Ga0070676_10045501 | |||
| 1048 | Ga0070683_100011495 | |||
| 1049 | Ga0070683_100014960 | |||
| 1050 | Ga0070683_100059997 | |||
| 1051 | Ga0070683_100114284 | |||
| 1052 | Ga0070683_100228096 | |||
| 1053 | Ga0070683_100374565 | |||
| 1054 | Ga0070670_100037114 | |||
| 1055 | Ga0070680_100124046 | |||
| 1056 | Ga0070682_100005687 | |||
| 1057 | Ga0070682_100151362 | |||
| 1058 | Ga0068868_100054655 | |||
| 1059 | Ga0068868_100116078 | |||
| 1060 | Ga0068868_100178983 | |||
| 1061 | Ga0068868_100188550 | |||
| 1062 | Ga0068868_100552028 | |||
| 1063 | Ga0070660_100026523 | |||
| 1064 | Ga0070660_100048090 | |||
| 1065 | Ga0070660_100085264 | |||
| 1066 | Ga0070660_100149314 | |||
| 1067 | Ga0070660_100149635 | |||
| 1068 | Ga0070689_100119117 | |||
| 1069 | Ga0070689_100153064 | |||
| 1070 | Ga0070689_100295229 | |||
| 1071 | Ga0070691_10036799 | |||
| 1072 | Ga0070691_10083390 | |||
| 1073 | Ga0070661_100006301 | |||
| 1074 | Ga0070661_100038387 | |||
| 1075 | Ga0070692_10055550 | |||
| 1076 | Ga0070668_100000999 | |||
| 1077 | Ga0070668_100093892 | |||
| 1078 | Ga0070668_100188855 | |||
| 1079 | Ga0070675_100002751 | |||
| 1080 | Ga0070675_100444516 | |||
| 1081 | Ga0070671_100014133 | |||
| 1082 | Ga0070671_100142491 | |||
| 1083 | Ga0070671_100172373 | |||
| 1084 | Ga0070688_100353060 | |||
| 1085 | Ga0070659_100027135 | |||
| 1086 | Ga0070659_100065344 | |||
| 1087 | Ga0070667_100116861 | |||
| 1088 | Ga0070667_100427126 | |||
| 1089 | Ga0070709_10000477 | |||
| 1090 | Ga0070709_10000627 | |||
| 1091 | Ga0070709_10020435 | |||
| 1092 | Ga0070709_10030131 | |||
| 1093 | Ga0070709_10059486 | |||
| 1094 | Ga0070709_10128682 | |||
| 1095 | Ga0070709_10161538 | |||
| 1096 | Ga0070709_10413892 | |||
| 1097 | Ga0070714_100004636 | |||
| 1098 | Ga0070714_100013944 | |||
| 1099 | Ga0070714_100025486 | |||
| 1100 | Ga0070714_100025879 | |||
| 1101 | Ga0070714_100026874 | |||
| 1102 | Ga0070714_100072928 | |||
| 1103 | Ga0070714_100088662 | |||
| 1104 | Ga0070714_100097470 | |||
| 1105 | Ga0070714_100117078 | |||
| 1106 | Ga0070714_100331826 | |||
| 1107 | Ga0070713_100002040 | |||
| 1108 | Ga0070713_100003954 | |||
| 1109 | Ga0070713_100024161 | |||
| 1110 | Ga0070713_100075084 | |||
| 1111 | Ga0070713_100149785 | |||
| 1112 | Ga0070713_100184136 | |||
| 1113 | Ga0070713_100248638 | |||
| 1114 | Ga0070713_100265690 | |||
| 1115 | Ga0070713_100330546 | |||
| 1116 | Ga0070710_10000164 | |||
| 1117 | Ga0070710_10001276 | |||
| 1118 | Ga0070710_10065636 | |||
| 1119 | Ga0070710_10070341 | |||
| 1120 | Ga0070710_10110500 | |||
| 1121 | Ga0070710_10227512 | |||
| 1122 | Ga0070711_100001597 | |||
| 1123 | Ga0070711_100002658 | |||
| 1124 | Ga0070711_100035461 | |||
| 1125 | Ga0070711_100059477 | |||
| 1126 | Ga0070711_100084035 | |||
| 1127 | Ga0070711_100115612 | |||
| 1128 | Ga0070700_100040775 | |||
| 1129 | Ga0070700_100052862 | |||
| 1130 | Ga0070700_100081594 | |||
| 1131 | Ga0070708_100007848 | |||
| 1132 | Ga0070708_100475795 | |||
| 1133 | Ga0070663_100016089 | |||
| 1134 | Ga0070663_100022746 | |||
| 1135 | Ga0070663_100026427 | |||
| 1136 | Ga0070663_100091135 | |||
| 1137 | Ga0070663_100312121 | |||
| 1138 | Ga0070678_100003251 | |||
| 1139 | Ga0070678_100095468 | |||
| 1140 | Ga0070678_100116493 | |||
| 1141 | Ga0070678_100243267 | |||
| 1142 | Ga0070662_100210774 | |||
| 1143 | Ga0070681_10009753 | |||
| 1144 | Ga0070681_10043153 | |||
| 1145 | Ga0070681_10232533 | |||
| 1146 | Ga0068867_100149715 | |||
| 1147 | Ga0070706_100018333 | |||
| 1148 | Ga0070706_100230225 | |||
| 1149 | Ga0070707_100024117 | |||
| 1150 | Ga0070707_100036986 | |||
| 1151 | Ga0070707_100198647 | |||
| 1152 | Ga0070707_100255051 | |||
| 1153 | Ga0070698_100002287 | |||
| 1154 | Ga0070698_100031924 | |||
| 1155 | Ga0070698_100038462 | |||
| 1156 | Ga0070698_100084629 | |||
| 1157 | Ga0070699_100000948 | |||
| 1158 | Ga0070699_100065755 | |||
| 1159 | Ga0070699_100077022 | |||
| 1160 | Ga0070679_100003495 | |||
| 1161 | Ga0070684_100023446 | |||
| 1162 | Ga0070684_100040831 | |||
| 1163 | Ga0070684_100181809 | |||
| 1164 | Ga0070697_100008889 | |||
| 1165 | Ga0070695_100022737 | |||
| 1166 | Ga0070695_100092444 | |||
| 1167 | Ga0070696_100154702 | |||
| 1168 | Ga0070693_100005295 | |||
| 1169 | Ga0070665_100005105 | |||
| 1170 | Ga0070665_100203055 | |||
| 1171 | Ga0070665_100289707 | |||
| 1172 | Ga0070665_100323732 | |||
| 1173 | Ga0070704_100021889 | |||
| 1174 | Ga0070704_100261238 | |||
| 1175 | Ga0068855_100241787 | |||
| 1176 | Ga0068855_100345909 | |||
| 1177 | Ga0068855_100396779 | |||
| 1178 | Ga0070664_100001178 | |||
| 1179 | Ga0070664_100125147 | |||
| 1180 | Ga0070664_100332178 | |||
| 1181 | Ga0068857_100035920 | |||
| 1182 | Ga0068857_100101216 | |||
| 1183 | Ga0068857_100160073 | |||
| 1184 | Ga0068857_100206949 | |||
| 1185 | Ga0068857_100321380 | |||
| 1186 | Ga0068857_100437973 | |||
| 1187 | Ga0068854_100084860 | |||
| 1188 | Ga0068856_100101655 | |||
| 1189 | Ga0068856_100145093 | |||
| 1190 | Ga0068856_100243393 | |||
| 1191 | Ga0068856_100278317 | |||
| 1192 | Ga0070702_100282553 | |||
| 1193 | Ga0068852_100003246 | |||
| 1194 | Ga0068852_100045379 | |||
| 1195 | Ga0068859_100119096 | |||
| 1196 | Ga0068859_100152308 | |||
| 1197 | Ga0068864_100013080 | |||
| 1198 | Ga0068864_100051391 | |||
| 1199 | Ga0068864_100053404 | |||
| 1200 | Ga0068864_100101677 | |||
| 1201 | Ga0068864_100256787 | |||
| 1202 | Ga0068861_100013229 | |||
| 1203 | Ga0068861_100323338 | |||
| 1204 | Ga0068851_10064525 | |||
| 1205 | Ga0068851_10102384 | |||
| 1206 | Ga0068851_10210825 | |||
| 1207 | Ga0068870_10003463 | |||
| 1208 | Ga0068870_10095144 | |||
| 1209 | Ga0068870_10192428 | |||
| 1210 | Ga0068863_100012759 | |||
| 1211 | Ga0068863_100175856 | |||
| 1212 | Ga0068863_100305220 | |||
| 1213 | Ga0068863_100318071 | |||
| 1214 | Ga0068863_100422151 | |||
| 1215 | Ga0068858_100171304 | |||
| 1216 | Ga0068858_100190227 | |||
| 1217 | Ga0068858_100472552 | |||
| 1218 | Ga0068858_100525212 | |||
| 1219 | Ga0068860_100362101 | |||
| 1220 | Ga0068860_100405915 | |||
| 1221 | Ga0068862_100064439 | |||
| 1222 | Ga0081538_10000493 | |||
| 1223 | Ga0081538_10003125 | |||
| 1224 | Ga0081540_1000473 | |||
| 1225 | Ga0081540_1002525 | |||
| 1226 | Ga0081540_1004569 | |||
| 1227 | Ga0081540_1007797 | |||
| 1228 | Ga0081540_1027473 | |||
| 1229 | Ga0070717_10003546 | |||
| 1230 | Ga0070717_10007901 | |||
| 1231 | Ga0070717_10019237 | |||
| 1232 | Ga0070717_10053112 | |||
| 1233 | Ga0070717_10073640 | |||
| 1234 | Ga0070717_10128125 | |||
| 1235 | Ga0070717_10130194 | |||
| 1236 | Ga0070717_10154049 | |||
| 1237 | Ga0070717_10204097 | |||
| 1238 | Ga0075365_10014630 | |||
| 1239 | Ga0075363_100000934 | |||
| 1240 | Ga0075364_10120803 | |||
| 1241 | Ga0070715_10000665 | |||
| 1242 | Ga0070716_100000375 | |||
| 1243 | Ga0070716_100005685 | |||
| 1244 | Ga0070716_100014994 | |||
| 1245 | Ga0070716_100025495 | |||
| 1246 | Ga0070716_100026047 | |||
| 1247 | Ga0070716_100050911 | |||
| 1248 | Ga0070716_100071058 | |||
| 1249 | Ga0070716_100092279 | |||
| 1250 | Ga0070716_100181724 | |||
| 1251 | Ga0070712_100001381 | |||
| 1252 | Ga0070712_100002762 | |||
| 1253 | Ga0070712_100056731 | |||
| 1254 | Ga0070712_100072757 | |||
| 1255 | Ga0070712_100089790 | |||
| 1256 | Ga0097621_100016068 | |||
| 1257 | Ga0097621_100097355 | |||
| 1258 | Ga0097621_100135421 | |||
| 1259 | Ga0097621_100183115 | |||
| 1260 | Ga0068871_100094421 | |||
| 1261 | Ga0068871_100158077 | |||
| 1262 | Ga0075428_100000664 | |||
| 1263 | Ga0075428_100078877 | |||
| 1264 | Ga0075433_10004765 | |||
| 1265 | Ga0075433_10032192 | |||
| 1266 | Ga0075434_100011323 | |||
| 1267 | Ga0075434_100061903 | |||
| 1268 | Ga0075434_100090488 | |||
| 1269 | Ga0075434_100162704 | |||
| 1270 | Ga0075434_100200253 | |||
| 1271 | Ga0075434_100208778 | |||
| 1272 | Ga0075436_100001878 | |||
| 1273 | Ga0075436_100014158 | |||
| 1274 | Ga0075436_100095790 | |||
| 1275 | Ga0075436_100143074 | |||
| 1276 | Ga0075436_100216420 | |||
| 1277 | Ga0075436_100225777 | |||
| 1278 | Ga0097620_100119092 | |||
| 1279 | Ga0097620_100152317 | |||
| 1280 | Ga0075435_100002133 | |||
| 1281 | Ga0075435_100451516 | |||
| 1282 | Ga0105251_10075170 | |||
| 1283 | Ga0105244_10131863 | |||
| 1284 | Ga0105240_10077104 | |||
| 1285 | Ga0105240_10609961 | |||
| 1286 | Ga0111539_10080590 | |||
| 1287 | Ga0111539_10288151 | |||
| 1288 | Ga0111539_10332785 | |||
| 1289 | Ga0105245_10005419 | |||
| 1290 | Ga0105245_10025504 | |||
| 1291 | Ga0105245_10065273 | |||
| 1292 | Ga0105245_10152823 | |||
| 1293 | Ga0105247_10032888 | |||
| 1294 | Ga0105247_10145175 | |||
| 1295 | Ga0105241_10004425 | |||
| 1296 | Ga0105241_10056299 | |||
| 1297 | Ga0105241_10210441 | |||
| 1298 | Ga0105248_10246443 | |||
| 1299 | Ga0105248_10430796 | |||
| 1300 | Ga0105237_10145425 | |||
| 1301 | Ga0105237_10202179 | |||
| 1302 | Ga0105237_10274057 | |||
| 1303 | Ga0099796_10082017 | |||
| 1304 | Ga0105239_10143288 | |||
| 1305 | Ga0105239_10179273 | |||
| 1306 | Ga0105239_10193477 | |||
| 1307 | Ga0105239_10333206 | |||
| 1308 | Ga0105239_10488101 | |||
| 1309 | Ga0105239_10637268 | |||
| 1310 | Ga0105246_10000911 | |||
| 1311 | Ga0105246_10032279 | |||
| 1312 | Ga0105246_10313536 | |||
| 1313 | Ga0157370_10156010 | |||
| 1314 | Ga0157369_10029633 | |||
| 1315 | Ga0157374_10174320 | |||
| 1316 | Ga0157374_10213713 | |||
| 1317 | Ga0157378_10170911 | |||
| 1318 | Ga0163162_10209574 | |||
| 1319 | Ga0163162_10241975 | |||
| 1320 | Ga0157372_10164791 | |||
| 1321 | Ga0157375_10243031 | |||
| 1322 | Ga0157375_10363046 | |||
| 1323 | Ga0157375_10608263 | |||
| 1324 | Ga0163163_10059222 | |||
| 1325 | Ga0163163_10111260 | |||
| 1326 | Ga0163163_10351494 | |||
| 1327 | Ga0163163_10508095 | |||
| 1328 | Ga0157380_10261039 | |||
| 1329 | Ga0182008_10056488 | |||
| 1330 | Ga0157377_10006253 | |||
| 1331 | Ga0157377_10010126 | |||
| 1332 | Ga0157377_10208763 | |||
| 1333 | Ga0157379_10007497 | |||
| 1334 | Ga0157379_10026531 | |||
| 1335 | Ga0157379_10414333 | |||
| 1336 | Ga0157376_10017121 | |||
| 1337 | Ga0157376_10105242 | |||
| 1338 | Ga0157376_10120379 | |||
| 1339 | Ga0197907_10187271 | |||
| 1340 | Ga0206354_10057982 | |||
| 1341 | Ga0206354_10343418 | |||
| 1342 | Ga0206354_10978843 | |||
| 1343 | Ga0206354_11413288 | |||
| 1344 | Ga0206353_10026372 | |||
| 1345 | Ga0213876_10051303 | |||
| 1346 | Ga0213875_10000588 | |||
| 1347 | Ga0213875_10001911 | |||
| 1348 | Ga0213875_10066161 | |||
| 1349 | Ga0224572_1000284 | |||
| 1350 | Ga0224572_1001967 | |||
| 1351 | Ga0207656_10027109 | |||
| 1352 | Ga0207653_10007871 | |||
| 1353 | Ga0207692_10004417 | |||
| 1354 | Ga0207692_10008718 | |||
| 1355 | Ga0207692_10011762 | |||
| 1356 | Ga0207692_10013217 | |||
| 1357 | Ga0207692_10014942 | |||
| 1358 | Ga0207692_10070034 | |||
| 1359 | Ga0207692_10112103 | |||
| 1360 | Ga0207688_10001876 | |||
| 1361 | Ga0207688_10002209 | |||
| 1362 | Ga0207688_10002950 | |||
| 1363 | Ga0207680_10082525 | |||
| 1364 | Ga0207647_10170609 | |||
| 1365 | Ga0207685_10002951 | |||
| 1366 | Ga0207685_10044970 | |||
| 1367 | Ga0207699_10001982 | |||
| 1368 | Ga0207699_10002377 | |||
| 1369 | Ga0207699_10009162 | |||
| 1370 | Ga0207699_10044967 | |||
| 1371 | Ga0207699_10055407 | |||
| 1372 | Ga0207699_10093269 | |||
| 1373 | Ga0207699_10114364 | |||
| 1374 | Ga0207645_10017159 | |||
| 1375 | Ga0207643_10001978 | |||
| 1376 | Ga0207643_10044638 | |||
| 1377 | Ga0207705_10035716 | |||
| 1378 | Ga0207705_10092860 | |||
| 1379 | Ga0207705_10131874 | |||
| 1380 | Ga0207684_10004761 | |||
| 1381 | Ga0207684_10209888 | |||
| 1382 | Ga0207684_10247495 | |||
| 1383 | Ga0207684_10257127 | |||
| 1384 | Ga0207684_10277926 | |||
| 1385 | Ga0207654_10048299 | |||
| 1386 | Ga0207654_10099120 | |||
| 1387 | Ga0207707_10010532 | |||
| 1388 | Ga0207707_10011990 | |||
| 1389 | Ga0207695_10334862 | |||
| 1390 | Ga0207671_10113486 | |||
| 1391 | Ga0207671_10311612 | |||
| 1392 | Ga0207693_10001158 | |||
| 1393 | Ga0207693_10002507 | |||
| 1394 | Ga0207693_10003174 | |||
| 1395 | Ga0207693_10050876 | |||
| 1396 | Ga0207693_10074359 | |||
| 1397 | Ga0207693_10129690 | |||
| 1398 | Ga0207663_10033106 | |||
| 1399 | Ga0207663_10046792 | |||
| 1400 | Ga0207663_10085691 | |||
| 1401 | Ga0207663_10137468 | |||
| 1402 | Ga0207663_10160631 | |||
| 1403 | Ga0207663_10194334 | |||
| 1404 | Ga0207660_10038996 | |||
| 1405 | Ga0207662_10041543 | |||
| 1406 | Ga0207657_10003201 | |||
| 1407 | Ga0207657_10011654 | |||
| 1408 | Ga0207657_10016690 | |||
| 1409 | Ga0207657_10135807 | |||
| 1410 | Ga0207649_10018319 | |||
| 1411 | Ga0207649_10219600 | |||
| 1412 | Ga0207652_10003458 | |||
| 1413 | Ga0207652_10004897 | |||
| 1414 | Ga0207652_10171445 | |||
| 1415 | Ga0207646_10030826 | |||
| 1416 | Ga0207646_10039968 | |||
| 1417 | Ga0207646_10054609 | |||
| 1418 | Ga0207646_10071943 | |||
| 1419 | Ga0207646_10114882 | |||
| 1420 | Ga0207646_10131403 | |||
| 1421 | Ga0207646_10183587 | |||
| 1422 | Ga0207694_10181915 | |||
| 1423 | Ga0207694_10429761 | |||
| 1424 | Ga0207659_10006338 | |||
| 1425 | Ga0207659_10372898 | |||
| 1426 | Ga0207687_10125471 | |||
| 1427 | Ga0207687_10147664 | |||
| 1428 | Ga0207687_10274814 | |||
| 1429 | Ga0207700_10000263 | |||
| 1430 | Ga0207700_10000366 | |||
| 1431 | Ga0207700_10001149 | |||
| 1432 | Ga0207700_10005691 | |||
| 1433 | Ga0207700_10021731 | |||
| 1434 | Ga0207700_10051679 | |||
| 1435 | Ga0207700_10114012 | |||
| 1436 | Ga0207700_10147569 | |||
| 1437 | Ga0207700_10184056 | |||
| 1438 | Ga0207700_10254889 | |||
| 1439 | Ga0207700_10335667 | |||
| 1440 | Ga0207700_10371825 | |||
| 1441 | Ga0207664_10000900 | |||
| 1442 | Ga0207664_10001450 | |||
| 1443 | Ga0207664_10003326 | |||
| 1444 | Ga0207664_10014185 | |||
| 1445 | Ga0207664_10019481 | |||
| 1446 | Ga0207664_10025112 | |||
| 1447 | Ga0207664_10057019 | |||
| 1448 | Ga0207664_10069775 | |||
| 1449 | Ga0207664_10083004 | |||
| 1450 | Ga0207664_10145176 | |||
| 1451 | Ga0207664_10154494 | |||
| 1452 | Ga0207664_10177245 | |||
| 1453 | Ga0207664_10199781 | |||
| 1454 | Ga0207664_10243384 | |||
| 1455 | Ga0207644_10006975 | |||
| 1456 | Ga0207690_10009515 | |||
| 1457 | Ga0207706_10036588 | |||
| 1458 | Ga0207706_10210908 | |||
| 1459 | Ga0207670_10045741 | |||
| 1460 | Ga0207670_10155763 | |||
| 1461 | Ga0207669_10065321 | |||
| 1462 | Ga0207704_10077380 | |||
| 1463 | Ga0207665_10002699 | |||
| 1464 | Ga0207665_10004673 | |||
| 1465 | Ga0207665_10009299 | |||
| 1466 | Ga0207665_10027982 | |||
| 1467 | Ga0207665_10029804 | |||
| 1468 | Ga0207665_10058579 | |||
| 1469 | Ga0207665_10110804 | |||
| 1470 | Ga0207665_10150388 | |||
| 1471 | Ga0207665_10265674 | |||
| 1472 | Ga0207691_10040207 | |||
| 1473 | Ga0207691_10096477 | |||
| 1474 | Ga0207711_10298737 | |||
| 1475 | Ga0207689_10002083 | |||
| 1476 | Ga0207689_10010824 | |||
| 1477 | Ga0207689_10052504 | |||
| 1478 | Ga0207689_10053892 | |||
| 1479 | Ga0207689_10100002 | |||
| 1480 | Ga0207661_10009569 | |||
| 1481 | Ga0207661_10034426 | |||
| 1482 | Ga0207679_10000682 | |||
| 1483 | Ga0207679_10347890 | |||
| 1484 | Ga0207667_10112718 | |||
| 1485 | Ga0207667_10564296 | |||
| 1486 | Ga0207668_10087223 | |||
| 1487 | Ga0207668_10274363 | |||
| 1488 | Ga0207640_10102805 | |||
| 1489 | Ga0207640_10533009 | |||
| 1490 | Ga0207677_10104941 | |||
| 1491 | Ga0207677_10351622 | |||
| 1492 | Ga0207703_10062086 | |||
| 1493 | Ga0207703_10133257 | |||
| 1494 | Ga0207639_10165093 | |||
| 1495 | Ga0207678_10000539 | |||
| 1496 | Ga0207678_10037818 | |||
| 1497 | Ga0207678_10056165 | |||
| 1498 | Ga0207678_10109763 | |||
| 1499 | Ga0207678_10150666 | |||
| 1500 | Ga0207708_10018103 | |||
| 1501 | Ga0207708_10034183 | |||
| 1502 | Ga0207708_10039594 | |||
| 1503 | Ga0207708_10107881 | |||
| 1504 | Ga0207702_10006037 | |||
| 1505 | Ga0207702_10104537 | |||
| 1506 | Ga0207702_10228954 | |||
| 1507 | Ga0207641_10100640 | |||
| 1508 | Ga0207648_10059647 | |||
| 1509 | Ga0207648_10088399 | |||
| 1510 | Ga0207648_10127939 | |||
| 1511 | Ga0207676_10050059 | |||
| 1512 | Ga0207676_10190443 | |||
| 1513 | Ga0207676_10207549 | |||
| 1514 | Ga0207674_10010256 | |||
| 1515 | Ga0207674_10017051 | |||
| 1516 | Ga0207674_10018405 | |||
| 1517 | Ga0207674_10039117 | |||
| 1518 | Ga0207674_10079326 | |||
| 1519 | Ga0207674_10135329 | |||
| 1520 | Ga0207674_10306562 | |||
| 1521 | Ga0207675_100040011 | |||
| 1522 | Ga0207675_100120200 | |||
| 1523 | Ga0207675_100412970 | |||
| 1524 | Ga0207683_10004433 | |||
| 1525 | Ga0207683_10006189 | |||
| 1526 | Ga0207698_10022386 | |||
| 1527 | Ga0207698_10056701 | |||
| 1528 | Ga0207698_10282871 | |||
| 1529 | Ga0207428_10212858 | |||
| 1530 | Ga0268266_10023738 | |||
| 1531 | Ga0268266_10146044 | |||
| 1532 | Ga0268265_10036886 | |||
| 1533 | Ga0268265_10090899 | |||
| 1534 | Ga0268264_10283291 | |||
| 1535 | Ga0307517_10030403 | |||
| 1536 | Ga0307515_10019119 | |||
| 1537 | Ga0307515_10048095 | |||
| 1538 | Ga0265338_10004490 | |||
| 1539 | Ga0307512_10002799 | |||
| 1540 | Ga0307512_10008268 | |||
| 1541 | Ga0316177_1173943 | |||
| 1542 | Ga0316176_1033292 | |||
| 1543 | Ga0314311_1137046 | |||
| 1544 | Ga0307513_10017242 | |||
| 1545 | Ga0307513_10021598 | |||
| 1546 | Ga0307513_10041651 | |||
| 1547 | Ga0307508_10033376 | |||
| 1548 | Ga0307508_10038806 | |||
| 1549 | Ga0307516_10025692 | |||
| 1550 | Ga0307516_10031906 | |||
| 1551 | Ga0307518_10000232 | |||
| 1552 | Ga0326468_10000194 | |||
| 1553 | Ga0307407_10048845 | |||
| 1554 | Ga0307409_100108688 | |||
| 1555 | Ga0307409_100145861 | |||
| 1556 | Ga0307409_100221793 | |||
| 1557 | Ga0307416_100192736 | |||
| 1558 | Ga0307416_100208676 | |||
| 1559 | Ga0307416_100234286 | |||
| 1560 | Ga0307416_100359168 | |||
| 1561 | Ga0307411_10305563 | |||
| 1562 | Ga0307415_100095063 | |||
| 1563 | Ga0307507_10047237 | |||
| 1564 | Ga0373938_0007695 | |||
| 1565 | Ga0373926_0000209 | |||
| 1566 | Ga0373926_0000481 | |||
| 1567 | Ga0373928_0010206 | |||
| 1568 | Ga0373929_0040540 | |||
| 1569 | Ga0373934_0000464 | |||
| 1570 | Ga0373934_0004916 | |||
| 1571 | Ga0373940_0012633 | |||
| 1572 | Ga0373940_0033813 | |||
| 1573 | Ga0373940_0048069 | |||
| 1574 | Ga0373944_0000324 | |||
| 1575 | Ga0373944_0001985 | |||
| 1576 | Ga0373949_0030098 | |||
| 1577 | Ga0373949_0034803 | |||
| 1578 | Ga0373951_0000035 | |||
| 1579 | Ga0373923_0011900 | |||
| 1580 | Ga0373932_0013426 | |||
| 1581 | Ga0373932_0020952 | |||
| 1582 | Ga0373936_0000905 | |||
| 1583 | Ga0373936_0003422 | |||
| 1584 | Ga0373936_0005643 | |||
| 1585 | Ga0373936_0068709 | |||
| 1586 | Ga0373939_0015215 | |||
| 1587 | Ga0373939_0094515 | |||
| 1588 | Ga0373945_0002850 | |||
| 1589 | Ga0373945_0003715 | |||
| 1590 | Ga0373953_0000990 | |||
| 1591 | Ga0373953_0002139 | |||
| 1592 | Ga0373953_0003638 | |||
| 1593 | Ga0373953_0004159 | |||
| 1594 | Ga0373954_0004938 | |||
| 1595 | Ga0373954_0020374 | |||
| 1596 | Ga0373954_0022670 | |||
| 1597 | Ga0373954_0023101 | |||
| 1598 | Ga0373954_0108806 | |||
| 1599 | Ga0373956_0000341 | |||
| 1600 | Ga0373956_0004508 | |||
| 1601 | Ga0373957_0000371 | |||
| 1602 | Ga0373957_0002612 | |||
| 1603 | Ga0373957_0083864 | |||
| 1604 | Ga0373943_0002186 | |||
| 1605 | Ga0373943_0005979 | |||
| 1606 | Ga0373946_0019584 | |||
| 1607 | Ga0373946_0021989 | |||
| 1608 | Ga0373946_0067073 | |||
| 1609 | Ga0373955_0000222 | |||
| 1610 | Ga0373955_0008996 | |||
| 1611 | Ga0373955_0017139 | |||
| 1612 | Ga0373955_0031556 | |||
| 1613 | Ga0373955_0071868 | |||
| 1614 | Ga0373955_0080727 | |||
| 1615 | Ga0373942_0000072 | |||
| 1616 | Ga0373961_0077201 | |||
| 1617 | Ga0373924_0003863 | |||
| 1618 | Ga0373924_0004071 | |||
| 1619 | Ga0373924_0018236 | |||
| 1620 | Ga0373935_0000226 | |||
| 1621 | Ga0373935_0020539 | |||
| 1622 | Ga0373935_0090453 | |||
| 1623 | Ga0373935_0135706 | |||
| 1624 | Ga0373935_0147310 | |||
| 1625 | Ga0373935_0201137 | |||
| 1626 | Ga0373935_0221170 | |||
| 1627 | Ga0373927_0001109 | |||
| 1628 | Ga0373927_0003893 | |||
| 1629 | Ga0373927_0041735 | |||
| 1630 | Ga0373927_0046013 | |||
| 1631 | Ga0373927_0327340 | |||
| 1632 | Ga0373933_0000848 | |||
| 1633 | Ga0373933_0008999 | |||
| 1634 | Ga0373933_0015466 | |||
| 1635 | Ga0373933_0033164 | |||
| 1636 | Ga0373933_0041241 | |||
| 1637 | Ga0373933_0046628 | |||
| 1638 | Ga0373933_0107543 | |||
| 1639 | Ga0373933_0267636 | |||
| 1640 | Ga0373947_0030651 | |||
| 1641 | Ga0373947_0065021 | |||
| 1642 | Ga0373947_0128343 | |||
| 1643 | Ga0373937_0001634 | |||
| 1644 | Ga0373937_0022580 | |||
| 1645 | Ga0373937_0106626 | |||
| 1646 | Ga0373937_0109859 | |||
| 1647 | Ga0373937_0141967 | |||
| 1648 | Ga0373925_0005454 | |||
| 1649 | Ga0373925_0007437 | |||
| 1650 | Ga0373925_0021225 | |||
| 1651 | Ga0373925_0062762 | |||
| 1652 | Ga0373925_0255154 | |||
| 1653 | Ga0373925_0299506 | |||
| 1654 | Ga0395898_0004690 | |||
| 1655 | Ga0395898_0068565 | |||
| 1656 | Ga0395898_0189341 | |||
| 1657 | Ga0436364_0201885 | |||
| 1658 | Ga0436364_0704698 | |||
| 1659 | Ga0436364_0888788 | |||
| 1660 | Ga0436364_1231391 | |||
| 1661 | Ga0436364_1294101 | |||
| 1662 | Ga0436364_1376954 | |||
| 1663 | Ga0395901_0009504 | |||
| 1664 | Ga0395901_0353653 | |||
| 1665 | Ga0395901_0369029 | |||
| 1666 | Ga0395901_0612173 | |||
| 1667 | Ga0436365_1836282 | |||
| 1668 | Ga0436365_1894323 | |||
| 1669 | Ga0439461_0032856 | |||
| 1670 | Ga0439435_0008382 | |||
| 1671 | Ga0439440_0077155 | |||
| 1672 | Ga0466963_0132851 | |||
| 1673 | Ga0466970_0013553 | |||
| 1674 | Ga0466967_0000252 | |||
| 1675 | Ga0466967_0017716 | |||
| 1676 | Ga0495592_0001091 | |||
| 1677 | Ga0495592_0004625 | |||
| 1678 | Ga0495592_0021701 | |||
| 1679 | Ga0495603_0001487 | |||
| 1680 | Ga0495603_0006041 | |||
| 1681 | Ga0495603_0067781 | |||
| 1682 | Ga0495603_0072262 | |||
| 1683 | Ga0495590_0062259 | |||
| 1684 | Ga0495629_0001438 | |||
| 1685 | Ga0495629_0007247 | |||
| 1686 | Ga0495629_0015074 | |||
| 1687 | Ga0495629_0025175 | |||
| 1688 | Ga0495629_0053887 | |||
| 1689 | Ga0495641_0004177 | |||
| 1690 | Ga0495641_0006974 | |||
| 1691 | Ga0495641_0022107 | |||
| 1692 | Ga0495651_0001242 | |||
| 1693 | Ga0495651_0001382 | |||
| 1694 | Ga0495651_0002417 | |||
| 1695 | Ga0495651_0008758 | |||
| 1696 | Ga0495651_0026018 | |||
| 1697 | Ga0495651_0046897 | |||
| 1698 | Ga0495651_0122790 | |||
| 1699 | Ga0495651_0253160 | |||
| 1700 | Ga0495653_0005648 | |||
| 1701 | Ga0495653_0032694 | |||
| 1702 | Ga0495653_0033362 | |||
| 1703 | Ga0495653_0073614 | |||
| 1704 | Ga0495653_0081242 | |||
| 1705 | Ga0495650_0051096 | |||
| 1706 | Ga0495580_0006138 | |||
| 1707 | Ga0495580_0010059 | |||
| 1708 | Ga0495580_0041068 | |||
| 1709 | Ga0495580_0193771 | |||
| 1710 | Ga0495582_0002383 | |||
| 1711 | Ga0495582_0002725 | |||
| 1712 | Ga0495639_0001976 | |||
| 1713 | Ga0495639_0003351 | |||
| 1714 | Ga0495662_0000330 | |||
| 1715 | Ga0495662_0006861 | |||
| 1716 | Ga0495662_0008455 | |||
| 1717 | Ga0495664_0020515 | |||
| 1718 | Ga0495664_0048087 | |||
| 1719 | Ga0495664_0049767 | |||
| 1720 | Ga0495664_0054693 | |||
| 1721 | Ga0495664_0060503 | |||
| 1722 | Ga0495664_0111367 | |||
| 1723 | Ga0495664_0138957 | |||
| 1724 | Ga0495664_0200408 | |||
| 1725 | Ga0495585_0009296 | |||
| 1726 | Ga0495585_0063373 | |||
| 1727 | Ga0495594_0004876 | |||
| 1728 | Ga0495594_0037441 | |||
| 1729 | Ga0495594_0088422 | |||
| 1730 | Ga0495606_0011938 | |||
| 1731 | Ga0495608_0001140 | |||
| 1732 | Ga0495608_0003658 | |||
| 1733 | Ga0495608_0013593 | |||
| 1734 | Ga0495608_0014739 | |||
| 1735 | Ga0495608_0022442 | |||
| 1736 | Ga0495608_0094111 | |||
| 1737 | Ga0495618_0018212 | |||
| 1738 | Ga0495618_0037478 | |||
| 1739 | Ga0495618_0041896 | |||
| 1740 | Ga0495618_0108502 | |||
| 1741 | Ga0495618_0264481 | |||
| 1742 | Ga0495628_0003233 | |||
| 1743 | Ga0495628_0035979 | |||
| 1744 | Ga0495628_0099515 | |||
| 1745 | Ga0495628_0151228 | |||
| 1746 | Ga0495628_0186037 | |||
| 1747 | Ga0495630_0002131 | |||
| 1748 | Ga0495630_0006764 | |||
| 1749 | Ga0495630_0025631 | |||
| 1750 | Ga0495630_0071538 | |||
| 1751 | Ga0495630_0136671 | |||
| 1752 | Ga0495632_0024171 | |||
| 1753 | Ga0495666_0009740 | |||
| 1754 | Ga0495666_0024094 | |||
| 1755 | Ga0495666_0032388 | |||
| 1756 | Ga0495652_0002465 | |||
| 1757 | Ga0495652_0003372 | |||
| 1758 | Ga0495652_0029805 | |||
| 1759 | Ga0495652_0037314 | |||
| 1760 | Ga0495652_0049236 | |||
| 1761 | Ga0495652_0066384 | |||
| 1762 | Ga0495652_0098822 | |||
| 1763 | Ga0495652_0130103 | |||
| 1764 | Ga0495652_0244529 | |||
| 1765 | Ga0495665_0001654 | |||
| 1766 | Ga0495665_0006498 | |||
| 1767 | Ga0495665_0027844 | |||
| 1768 | Ga0495640_0010082 | |||
| 1769 | Ga0495640_0012364 | |||
| 1770 | Ga0495640_0045563 | |||
| 1771 | Ga0495640_0056164 | |||
| 1772 | Ga0495586_0002716 | |||
| 1773 | Ga0495586_0029450 | |||
| 1774 | Ga0495586_0084540 | |||
| 1775 | Ga0495586_0201730 | |||
| 1776 | Ga0495587_0000981 | |||
| 1777 | Ga0495587_0003495 | |||
| 1778 | Ga0495587_0004441 | |||
| 1779 | Ga0495587_0006362 | |||
| 1780 | Ga0495587_0007982 | |||
| 1781 | Ga0495587_0028386 | |||
| 1782 | Ga0495587_0105812 | |||
| 1783 | Ga0495587_0172229 | |||
| 1784 | Ga0495645_0009004 | |||
| 1785 | Ga0495645_0010626 | |||
| 1786 | Ga0495645_0019978 | |||
| 1787 | Ga0495645_0024211 | |||
| 1788 | Ga0495645_0042062 | |||
| 1789 | Ga0495645_0047547 | |||
| 1790 | Ga0495645_0066131 | |||
| 1791 | Ga0495622_0008244 | |||
| 1792 | Ga0495667_0000915 | |||
| 1793 | Ga0495667_0002764 | |||
| 1794 | Ga0495667_0021348 | |||
| 1795 | Ga0495667_0024975 | |||
| 1796 | Ga0495667_0027919 | |||
| 1797 | Ga0495667_0030094 | |||
| 1798 | Ga0495667_0067710 | |||
| 1799 | Ga0495667_0074358 | |||
| 1800 | Ga0495667_0271274 | |||
| 1801 | Ga0495668_0000471 | |||
| 1802 | Ga0495634_0010231 | |||
| 1803 | Ga0495634_0033585 | |||
| 1804 | Ga0495634_0048512 | |||
| 1805 | Ga0495634_0079379 | |||
| 1806 | Ga0495625_0000265 | |||
| 1807 | Ga0495635_0003166 | |||
| 1808 | Ga0495635_0015603 | |||
| 1809 | Ga0495635_0042933 | |||
| 1810 | Ga0495635_0056040 | |||
| 1811 | Ga0495635_0063473 | |||
| 1812 | Ga0495635_0076696 | |||
| 1813 | Ga0495635_0078945 | |||
| 1814 | Ga0495635_0248119 | |||
| 1815 | Ga0495588_0031007 | |||
| 1816 | Ga0495588_0069391 | |||
| 1817 | Ga0495657_0001708 | |||
| 1818 | Ga0495657_0003275 | |||
| 1819 | Ga0495657_0008776 | |||
| 1820 | Ga0495657_0050083 | |||
| 1821 | Ga0495657_0069770 | |||
| 1822 | Ga0495657_0120633 | |||
| 1823 | Ga0495657_0253238 | |||
| 1824 | Ga0495599_0000707 | |||
| 1825 | Ga0495599_0004490 | |||
| 1826 | Ga0495599_0005475 | |||
| 1827 | Ga0495599_0009019 | |||
| 1828 | Ga0495599_0036382 | |||
| 1829 | Ga0495599_0055863 | |||
| 1830 | Ga0495599_0139439 | |||
| 1831 | Ga0495599_0155234 | |||
| 1832 | Ga0495623_0003451 | |||
| 1833 | Ga0495623_0009059 | |||
| 1834 | Ga0495623_0048352 | |||
| 1835 | Ga0495623_0054886 | |||
| 1836 | Ga0495646_0009048 | |||
| 1837 | Ga0495646_0011589 | |||
| 1838 | Ga0495646_0024844 | |||
| 1839 | Ga0495646_0042680 | |||
| 1840 | Ga0495646_0148696 | |||
| 1841 | Ga0495647_0016297 | |||
| 1842 | Ga0495658_0001712 | |||
| 1843 | Ga0495613_0001810 | |||
| 1844 | Ga0495613_0003215 | |||
| 1845 | Ga0495613_0157478 | |||
| 1846 | Ga0495624_0003275 | |||
| 1847 | Ga0495624_0051537 | |||
| 1848 | Ga0495624_0070413 | |||
| 1849 | Ga0495624_0081677 | |||
| 1850 | Ga0495589_0023238 | |||
| 1851 | Ga0495600_0001389 | |||
| 1852 | Ga0495600_0024841 | |||
| 1853 | Ga0495600_0041437 | |||
| 1854 | Ga0495600_0119138 | |||
| 1855 | Ga0495581_0001801 | |||
| 1856 | Ga0495581_0007583 | |||
| 1857 | Ga0495581_0066284 | |||
| 1858 | Ga0495581_0243336 | |||
| 1859 | Ga0495604_0001527 | |||
| 1860 | Ga0495604_0003616 | |||
| 1861 | Ga0495604_0013167 | |||
| 1862 | Ga0495604_0018582 | |||
| 1863 | Ga0495604_0022488 | |||
| 1864 | Ga0495604_0023139 | |||
| 1865 | Ga0495604_0031191 | |||
| 1866 | Ga0495604_0031382 | |||
| 1867 | Ga0495604_0092888 | |||
| 1868 | Ga0495604_0104589 | |||
| 1869 | Ga0495636_0009336 | |||
| 1870 | Ga0495674_0010201 | |||
| 1871 | Ga0495674_0013582 | |||
| 1872 | Ga0495674_0017794 | |||
| 1873 | Ga0495674_0018498 | |||
| 1874 | Ga0495674_0099222 | |||
| 1875 | Ga0495674_0102234 | |||
| 1876 | Ga0495674_0125621 | |||
| 1877 | Ga0495674_0212832 | |||
| 1878 | Ga0495676_0002061 | |||
| 1879 | Ga0495676_0016825 | |||
| 1880 | Ga0495676_0022504 | |||
| 1881 | Ga0495680_0002494 | |||
| 1882 | Ga0495680_0004087 | |||
| 1883 | Ga0495680_0013124 | |||
| 1884 | Ga0495680_0017482 | |||
| 1885 | Ga0495680_0024075 | |||
| 1886 | Ga0495680_0025613 | |||
| 1887 | Ga0495680_0058447 | |||
| 1888 | Ga0495680_0069090 | |||
| 1889 | Ga0495687_005985 | |||
| 1890 | Ga0495675_0000440 | |||
| 1891 | Ga0495675_0001608 | |||
| 1892 | Ga0495675_0019850 | |||
| 1893 | Ga0495675_0021821 | |||
| 1894 | Ga0495675_0055500 | |||
| 1895 | Ga0495675_0084364 | |||
| 1896 | Ga0495675_0132355 | |||
| 1897 | Ga0495684_0009270 | |||
| 1898 | Ga0495684_0012323 | |||
| 1899 | Ga0495684_0066981 | |||
| 1900 | Ga0495684_0143107 | |||
| 1901 | Ga0495684_0191565 | |||
| 1902 | Ga0495686_0109153 | |||
| 1903 | Ga0495593_0002356 | |||
| 1904 | Ga0495593_0002885 | |||
| 1905 | Ga0495602_0002471 | |||
| 1906 | Ga0495602_0010201 | |||
| 1907 | Ga0495602_0013999 | |||
| 1908 | Ga0495602_0037969 | |||
| 1909 | Ga0495602_0042251 | |||
| 1910 | Ga0495602_0083881 | |||
| 1911 | Ga0495602_0085388 | |||
| 1912 | Ga0495602_0244590 | |||
| 1913 | Ga0495614_0010426 | |||
| 1914 | Ga0495626_0000509 | |||
| 1915 | Ga0496100_0226858 | |||
| 1916 | Ga0496101_0153065 | |||
| 1917 | Ga0496102_0020030 | |||
| 1918 | Ga0496102_0025368 | |||
| 1919 | Ga0496102_0135800 | |||
| 1920 | Ga0496102_0397021 | |||
| 1921 | Ga0496103_0070107 | |||
| 1922 | Ga0496104_0001455 | |||
| 1923 | Ga0496104_0006424 | |||
| 1924 | Ga0496104_0021408 | |||
| 1925 | Ga0496104_0042179 | |||
| 1926 | Ga0496104_0103253 | |||
| 1927 | Ga0496104_0168199 | |||
| 1928 | Ga0496105_0004910 | |||
| 1929 | Ga0496105_0025548 | |||
| 1930 | Ga0496105_0051608 | |||
| 1931 | Ga0496105_0084414 | |||
| 1932 | Ga0496105_0103161 | |||
| 1933 | Ga0496105_0117019 | |||
| 1934 | Ga0496105_0126660 | |||
| 1935 | Ga0496106_0002362 | |||
| 1936 | Ga0496106_0091822 | |||
| 1937 | Ga0496106_0212902 | |||
| 1938 | Ga0496106_0300118 | |||
| 1939 | Ga0496107_0050839 | |||
| 1940 | Ga0496107_0062591 | |||
| 1941 | Ga0496108_0005696 | |||
| 1942 | Ga0496108_0008118 | |||
| 1943 | Ga0496108_0010587 | |||
| 1944 | Ga0496108_0017005 | |||
| 1945 | Ga0496108_0067962 | |||
| 1946 | Ga0496108_0222307 | |||
| 1947 | Ga0496108_0249282 | |||
| 1948 | Ga0496108_0265937 | |||
| 1949 | Ga0496109_0021940 | |||
| 1950 | Ga0496109_0042177 | |||
| 1951 | Ga0496109_0051182 | |||
| 1952 | Ga0496110_0006941 | |||
| 1953 | Ga0496110_0011473 | |||
| 1954 | Ga0496110_0015992 | |||
| 1955 | Ga0496111_0001546 | |||
| 1956 | Ga0496111_0002777 | |||
| 1957 | Ga0496111_0027944 | |||
| 1958 | Ga0496111_0060266 | |||
| 1959 | Ga0496111_0074794 | |||
| 1960 | Ga0496111_0129268 | |||
| 1961 | Ga0496112_0011884 | |||
| 1962 | Ga0496112_0117384 | |||
| 1963 | Ga0496112_0247493 | |||
| 1964 | Ga0496112_0550786 | |||
| 1965 | Ga0496113_0003244 | |||
| 1966 | Ga0496113_0018560 | |||
| 1967 | Ga0496113_0062099 | |||
| 1968 | Ga0496113_0156486 | |||
| 1969 | Ga0496114_0287409 | |||
| 1970 | Ga0496114_0354023 | |||
| 1971 | Ga0496114_0381281 | |||
| 1972 | Ga0496115_0011638 | |||
| 1973 | Ga0496115_0139962 | |||
| 1974 | Ga0496115_0146114 | |||
| 1975 | Ga0496115_0232422 | |||
| 1976 | Ga0496119_0030341 | |||
| 1977 | Ga0496119_0041464 | |||
| 1978 | Ga0496126_0007060 | |||
| 1979 | Ga0496126_0015348 | |||
| 1980 | Ga0496126_0384897 | |||
| 1981 | Ga0501039_0077001 | |||
| 1982 | Ga0501046_0008733 | |||
| 1983 | Ga0501047_0057673 | |||
| 1984 | Ga0501047_0059036 | |||
| 1985 | Ga0501047_0107421 | |||
| 1986 | Ga0501047_0328485 | |||
| 1987 | Ga0501047_0622297 | |||
| 1988 | Ga0501069_0184588 | |||
| 1989 | Ga0501070_0098816 | |||
| 1990 | Ga0501073_0151262 | |||
| 1991 | Ga0501075_0227663 | |||
| 1992 | Ga0501080_0090184 | |||
| 1993 | Ga0501081_0355748 | |||
| 1994 | Ga0501035_0052514 | |||
| 1995 | Ga0501044_0112962 | |||
| 1996 | Ga0501044_0160038 | |||
| 1997 | nmdc:mga0yw44_185995_c1 | |||
| 1998 | nmdc:mga0yw44_91953_c1 | |||
| 1999 | nmdc:mga0yw44_94197_c1 | |||
| 2000 | nmdc:mga05p37_108791_c1 | |||
| 2001 | nmdc:mga08y16_12180_c1 | |||
| 2002 | nmdc:mga08y16_13697_c1 | |||
| 2003 | nmdc:mga08y16_38321_c1 | |||
| 2004 | nmdc:mga0n895_20419_c1 | |||
| 2005 | nmdc:mga0n895_345860_c1 | |||
| 2006 | nmdc:mga0n895_45065_c1 | |||
| 2007 | nmdc:mga0rr50_389063_c1 | |||
| 2008 | nmdc:mga08x19_119112_c1 | |||
| 2009 | nmdc:mga08x19_25122_c1 | |||
| 2010 | nmdc:mga08x19_67768_c1 | |||
| 2011 | nmdc:mga08x19_98864_c1 | |||
| 2012 | nmdc:mga0a205_10813_c1 | |||
| 2013 | nmdc:mga0a205_2165_c1 | |||
| 2014 | nmdc:mga0a205_26974_c1 | |||
| 2015 | nmdc:mga0sz30_4301_c1 | |||
| 2016 | Ga0495601_0010558 | |||
| 2017 | Ga0495601_0057308 | |||
| 2018 | Ga0495601_0070754 | |||
| 2019 | Ga0495601_0181182 | |||
| 2020 | Ga0495612_0001401 | |||
| 2021 | Ga0495612_0007573 | |||
| 2022 | Ga0495612_0094193 | |||
| 2023 | Ga0495612_0131641 | |||
| 2024 | Ga0495595_0000359 | |||
| 2025 | Ga0495595_0004553 | |||
| 2026 | Ga0495595_0035424 | |||
| 2027 | Ga0495619_0003203 | |||
| 2028 | Ga0495619_0052202 | |||
| 2029 | Ga0495619_0286502 | |||
| 2030 | Ga0500554_068352 | |||
| 2031 | Ga0500594_0021175 | |||
| 2032 | Ga0500616_0012339 | |||
| 2033 | Ga0500630_134088 | |||
| 2034 | Ga0500633_0034268 | |||
| 2035 | 2547410688 | |||
| 2036 | 2548693720 | |||
| 2037 | 2552110534 | |||
| 2038 | 2558911402 | |||
| 2039 | 2586059882 | |||
| 2040 | 2643901504 | |||
| 2041 | 2643942289 | |||
| 2042 | 2644387059 | |||
| 2043 | 2644407650 | |||
| 2044 | 2644429372 | |||
| 2045 | 2676474053 | |||
| 2046 | 2676484290 | |||
| 2047 | 2676487866 | |||
| 2048 | 2784592660 | |||
| 2049 | 2804848638 | |||
| 2050 | 2809236293 | |||
| 2051 | 2816504320 | |||
| 2052 | 2816504414 | |||
| 2053 | 2827628944 | |||
| 2054 | 2837270622 | |||
| 2055 | 2856741854 | |||
| 2056 | 2862291851 | |||
| 2057 | 2867305986 | |||
| 2058 | 2873157968 | |||
| 2059 | 2880491552 | |||
| 2060 | 2884696441 | |||
| 2061 | 2891554420 | |||
| 2062 | 2891563975 | |||
| 2063 | 2891567336 | |||
| 2064 | 2895446987 | |||
| 2065 | 2895449794 | |||
| 2066 | 2919473268 | |||
| 2067 | 2919717766 | |||
| 2068 | 2946046389 | |||
| 2069 | 2954381067 | |||
| 2070 | 3006327278 | |||
| 2071 | 8001786713 | |||
| 2072 | 8023630922 | |||
| 2073 | 8025419095 | |||
| 2074 | 8054165890 | |||
| 2075 | 8054731203 | |||
| 2076 | 8054735934 | |||
| 2077 | 8056062673 | |||
| 2078 | 8056063261 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy