F488780

General Info

Members Datasets Scaffolds Average Seq Length
1039 372 2078 304

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100053909|Ga0070699_1000539093
Length 361
Sequence MSERRQLINLAYRLLGSLAEAEDAVQETYARWYAMTRQQQEAIESPGAWLTTVASRLCLDLLGSARARRERYVGEWLPEPLPERAEWISGRPGAAAADPADRVTLDESVSMAFLVVLESMTPAERVALILHDVFRYSFAEVAEIAGRTPAACRQLASSARRRIRASQAPASPAARQAGIVRAFKAAWEAKDIDALIGLLDPDATATADGGGLATTFLRPIEGGEQIARAWVVIANRAPSNMTFLERTVNGQPGLVAQQDGVTATVFAFDVAGDRIKHIWAVRNPKKLRPWTTGWRAAASHRVRSEPTPPSLHALPGGLGPPRLRRGKGQPAAASYSDHWQERTSGHPQGPRPPATTSGNGL

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
174 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
175 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
176 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
177 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
181 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
188 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
189 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
190 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
191 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
192 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
193 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
194 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
195 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
196 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
201 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
202 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
203 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
204 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
205 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
210 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
211 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
223 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
224 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
225 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
226 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
230 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
231 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
232 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
233 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
234 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
235 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
236 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
237 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
238 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
239 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
240 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
241 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
242 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
243 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
244 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
245 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
246 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
247 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
248 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
249 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
250 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
251 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
252 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
253 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
254 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
255 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
256 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
257 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
258 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
263 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
264 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
265 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
266 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
267 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
268 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
269 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
270 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
271 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
274 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
275 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
280 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
281 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
282 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
283 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
284 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
285 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
286 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
287 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
288 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
289 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
290 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
294 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
295 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
296 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
299 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
300 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
303 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
304 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
305 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
309 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
310 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
311 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
314 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
316 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
319 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
320 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
321 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
322 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
323 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
324 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
325 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
326 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
327 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
328 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
329 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
330 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
331 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
332 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
333 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
334 2547132424 Nocardia nova SH22a Isolate Unclassified
335 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
336 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
337 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
338 2643221578 Streptomyces sp. Root63 Isolate Unclassified
339 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
340 2643221670 Streptomyces sp. Root431 Isolate Unclassified
341 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
342 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
343 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
344 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
345 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
346 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
347 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
348 2808606448 Streptomyces sp. 193411 Isolate Unclassified
349 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
350 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
351 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
352 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
353 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
354 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
355 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
356 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
357 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
358 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
359 2891562705 Microbispora tritici MT50 Isolate Unclassified
360 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
361 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
362 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
363 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
364 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
365 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
366 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
367 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
368 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
369 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
370 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
371 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
372 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.09
Metatranscriptomes 0.67
Isolates 4.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 0.19
Rhizoplane 5.87
Rhizosphere 87.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100053909 3300005518 Bacteria 3481
2 JGI25407J50210_10020823 3300003373 Bacteria 1705
3 JGI25407J50210_10022959 3300003373 Bacteria 1620
4 Ga0006562J51391_1067189 3300003578 Bacteria 2160
5 Ga0070658_10011944 3300005327 Bacteria 6973
6 Ga0070658_10029511 3300005327 Bacteria 4406
7 Ga0070658_10189631 3300005327 Bacteria 1733
8 Ga0070676_10045501 3300005328 Bacteria 2557
9 Ga0070683_100011495 3300005329 Bacteria 7656
10 Ga0070683_100014960 3300005329 Bacteria 6805
11 Ga0070683_100059997 3300005329 Bacteria 3535
12 Ga0070683_100114284 3300005329 Bacteria 2548
13 Ga0070683_100228096 3300005329 Bacteria 1770
14 Ga0070683_100374565 3300005329 Bacteria 1356
15 Ga0070670_100037114 3300005331 Bacteria 4193
16 Ga0070680_100124046 3300005336 Bacteria 2157
17 Ga0070682_100005687 3300005337 Bacteria 6948
18 Ga0070682_100151362 3300005337 Bacteria 1592
19 Ga0068868_100054655 3300005338 Bacteria 3148
20 Ga0068868_100116078 3300005338 Bacteria 2180
21 Ga0068868_100178983 3300005338 Bacteria 1758
22 Ga0068868_100188550 3300005338 Bacteria 1714
23 Ga0068868_100552028 3300005338 Bacteria 1015
24 Ga0070660_100026523 3300005339 Bacteria 4314
25 Ga0070660_100048090 3300005339 Bacteria 3275
26 Ga0070660_100085264 3300005339 Bacteria 2484
27 Ga0070660_100149314 3300005339 Bacteria 1878
28 Ga0070660_100149635 3300005339 Bacteria 1876
29 Ga0070689_100119117 3300005340 Bacteria 2107
30 Ga0070689_100153064 3300005340 Bacteria 1861
31 Ga0070689_100295229 3300005340 Bacteria 1348
32 Ga0070691_10036799 3300005341 Bacteria 2308
33 Ga0070691_10083390 3300005341 Bacteria 1568
34 Ga0070661_100006301 3300005344 Bacteria 8183
35 Ga0070661_100038387 3300005344 Bacteria 3486
36 Ga0070692_10055550 3300005345 Bacteria 2070
37 Ga0070668_100000999 3300005347 Bacteria 19811
38 Ga0070668_100093892 3300005347 Bacteria 2368
39 Ga0070668_100188855 3300005347 Bacteria 1687
40 Ga0070675_100002751 3300005354 Bacteria 13216
41 Ga0070675_100444516 3300005354 Bacteria 1162
42 Ga0070671_100014133 3300005355 Bacteria 6446
43 Ga0070671_100142491 3300005355 Bacteria 2023
44 Ga0070671_100172373 3300005355 Bacteria 1830
45 Ga0070688_100353060 3300005365 Bacteria 1077
46 Ga0070659_100027135 3300005366 Bacteria 4409
47 Ga0070659_100065344 3300005366 Bacteria 2881
48 Ga0070667_100116861 3300005367 Bacteria 2316
49 Ga0070667_100427126 3300005367 Bacteria 1209
50 Ga0070709_10000477 3300005434 Bacteria 23762
51 Ga0070709_10000627 3300005434 Bacteria 20180
52 Ga0070709_10020435 3300005434 Bacteria 3841
53 Ga0070709_10030131 3300005434 Bacteria 3253
54 Ga0070709_10059486 3300005434 Bacteria 2426
55 Ga0070709_10128682 3300005434 Bacteria 1726
56 Ga0070709_10161538 3300005434 Bacteria 1558
57 Ga0070709_10413892 3300005434 Bacteria 1009
58 Ga0070714_100004636 3300005435 Bacteria 10374
59 Ga0070714_100013944 3300005435 Bacteria 6449
60 Ga0070714_100025486 3300005435 Bacteria 4881
61 Ga0070714_100025879 3300005435 Bacteria 4846
62 Ga0070714_100026874 3300005435 Bacteria 4760
63 Ga0070714_100072928 3300005435 Bacteria 2973
64 Ga0070714_100088662 3300005435 Bacteria 2707
65 Ga0070714_100097470 3300005435 Bacteria 2585
66 Ga0070714_100117078 3300005435 Bacteria 2366
67 Ga0070714_100331826 3300005435 Bacteria 1424
68 Ga0070713_100002040 3300005436 Bacteria 13058
69 Ga0070713_100003954 3300005436 Bacteria 9851
70 Ga0070713_100024161 3300005436 Bacteria 4730
71 Ga0070713_100075084 3300005436 Bacteria 2866
72 Ga0070713_100149785 3300005436 Bacteria 2074
73 Ga0070713_100184136 3300005436 Bacteria 1878
74 Ga0070713_100248638 3300005436 Bacteria 1621
75 Ga0070713_100265690 3300005436 Bacteria 1569
76 Ga0070713_100330546 3300005436 Bacteria 1410
77 Ga0070710_10000164 3300005437 Bacteria 30733
78 Ga0070710_10001276 3300005437 Bacteria 11964
79 Ga0070710_10065636 3300005437 Bacteria 2079
80 Ga0070710_10070341 3300005437 Bacteria 2015
81 Ga0070710_10110500 3300005437 Bacteria 1650
82 Ga0070710_10227512 3300005437 Bacteria 1189
83 Ga0070711_100001597 3300005439 Bacteria 12490
84 Ga0070711_100002658 3300005439 Bacteria 10241
85 Ga0070711_100035461 3300005439 Bacteria 3336
86 Ga0070711_100059477 3300005439 Bacteria 2653
87 Ga0070711_100084035 3300005439 Bacteria 2276
88 Ga0070711_100115612 3300005439 Bacteria 1976
89 Ga0070700_100040775 3300005441 Bacteria 2844
90 Ga0070700_100052862 3300005441 Bacteria 2534
91 Ga0070700_100081594 3300005441 Bacteria 2089
92 Ga0070708_100007848 3300005445 Bacteria 8547
93 Ga0070708_100475795 3300005445 Bacteria 1178
94 Ga0070663_100016089 3300005455 Bacteria 4845
95 Ga0070663_100022746 3300005455 Bacteria 4194
96 Ga0070663_100026427 3300005455 Bacteria 3933
97 Ga0070663_100091135 3300005455 Bacteria 2258
98 Ga0070663_100312121 3300005455 Bacteria 1262
99 Ga0070678_100003251 3300005456 Bacteria 9027
100 Ga0070678_100095468 3300005456 Bacteria 2291
101 Ga0070678_100116493 3300005456 Bacteria 2099
102 Ga0070678_100243267 3300005456 Bacteria 1505
103 Ga0070662_100210774 3300005457 Bacteria 1546
104 Ga0070681_10009753 3300005458 Bacteria 9450
105 Ga0070681_10043153 3300005458 Bacteria 4518
106 Ga0070681_10232533 3300005458 Bacteria 1757
107 Ga0068867_100149715 3300005459 Bacteria 1832
108 Ga0070706_100018333 3300005467 Bacteria 6458
109 Ga0070706_100230225 3300005467 Bacteria 1730
110 Ga0070707_100024117 3300005468 Bacteria 5758
111 Ga0070707_100036986 3300005468 Bacteria 4658
112 Ga0070707_100198647 3300005468 Bacteria 1955
113 Ga0070707_100255051 3300005468 Bacteria 1707
114 Ga0070698_100002287 3300005471 Bacteria 21212
115 Ga0070698_100031924 3300005471 Bacteria 5458
116 Ga0070698_100038462 3300005471 Bacteria 4929
117 Ga0070698_100084629 3300005471 Bacteria 3159
118 Ga0070699_100000948 3300005518 Bacteria 27070
119 Ga0070699_100065755 3300005518 Bacteria 3147
120 Ga0070699_100077022 3300005518 Bacteria 2903
121 Ga0070679_100003495 3300005530 Bacteria 14381
122 Ga0070684_100023446 3300005535 Bacteria 5162
123 Ga0070684_100040831 3300005535 Bacteria 3997
124 Ga0070684_100181809 3300005535 Bacteria 1912
125 Ga0070697_100008889 3300005536 Bacteria 7843
126 Ga0070695_100022737 3300005545 Bacteria 3848
127 Ga0070695_100092444 3300005545 Bacteria 2022
128 Ga0070696_100154702 3300005546 Bacteria 1685
129 Ga0070693_100005295 3300005547 Bacteria 6183
130 Ga0070665_100005105 3300005548 Bacteria 13618
131 Ga0070665_100203055 3300005548 Bacteria 1982
132 Ga0070665_100289707 3300005548 Bacteria 1640
133 Ga0070665_100323732 3300005548 Bacteria 1546
134 Ga0070704_100021889 3300005549 Bacteria 4152
135 Ga0070704_100261238 3300005549 Bacteria 1426
136 Ga0068855_100241787 3300005563 Bacteria 2017
137 Ga0068855_100345909 3300005563 Bacteria 1639
138 Ga0068855_100396779 3300005563 Bacteria 1512
139 Ga0070664_100001178 3300005564 Bacteria 20808
140 Ga0070664_100125147 3300005564 Bacteria 2254
141 Ga0070664_100332178 3300005564 Bacteria 1379
142 Ga0068857_100035920 3300005577 Bacteria 4390
143 Ga0068857_100101216 3300005577 Bacteria 2586
144 Ga0068857_100160073 3300005577 Bacteria 2043
145 Ga0068857_100206949 3300005577 Bacteria 1790
146 Ga0068857_100321380 3300005577 Bacteria 1429
147 Ga0068857_100437973 3300005577 Bacteria 1221
148 Ga0068854_100084860 3300005578 Bacteria 2344
149 Ga0068856_100101655 3300005614 Bacteria 2867
150 Ga0068856_100145093 3300005614 Bacteria 2381
151 Ga0068856_100243393 3300005614 Bacteria 1814
152 Ga0068856_100278317 3300005614 Bacteria 1690
153 Ga0070702_100282553 3300005615 Bacteria 1140
154 Ga0068852_100003246 3300005616 Bacteria 11348
155 Ga0068852_100045379 3300005616 Bacteria 3738
156 Ga0068859_100119096 3300005617 Bacteria 2706
157 Ga0068859_100152308 3300005617 Bacteria 2388
158 Ga0068864_100013080 3300005618 Bacteria 6874
159 Ga0068864_100051391 3300005618 Bacteria 3551
160 Ga0068864_100053404 3300005618 Bacteria 3486
161 Ga0068864_100101677 3300005618 Bacteria 2550
162 Ga0068864_100256787 3300005618 Bacteria 1624
163 Ga0068861_100013229 3300005719 Bacteria 5774
164 Ga0068861_100323338 3300005719 Bacteria 1344
165 Ga0068851_10064525 3300005834 Bacteria 1882
166 Ga0068851_10102384 3300005834 Bacteria 1521
167 Ga0068851_10210825 3300005834 Bacteria 1088
168 Ga0068870_10003463 3300005840 Bacteria 6687
169 Ga0068870_10095144 3300005840 Bacteria 1673
170 Ga0068870_10192428 3300005840 Bacteria 1232
171 Ga0068863_100012759 3300005841 Bacteria 8103
172 Ga0068863_100175856 3300005841 Bacteria 2054
173 Ga0068863_100305220 3300005841 Bacteria 1544
174 Ga0068863_100318071 3300005841 Bacteria 1511
175 Ga0068863_100422151 3300005841 Bacteria 1307
176 Ga0068858_100171304 3300005842 Bacteria 2047
177 Ga0068858_100190227 3300005842 Bacteria 1939
178 Ga0068858_100472552 3300005842 Bacteria 1209
179 Ga0068858_100525212 3300005842 Bacteria 1145
180 Ga0068860_100362101 3300005843 Bacteria 1429
181 Ga0068860_100405915 3300005843 Bacteria 1348
182 Ga0068862_100064439 3300005844 Bacteria 3155
183 Ga0081538_10000493 3300005981 Bacteria 44022
184 Ga0081538_10003125 3300005981 Bacteria 15747
185 Ga0081540_1000473 3300005983 Bacteria 39545
186 Ga0081540_1002525 3300005983 Bacteria 14861
187 Ga0081540_1004569 3300005983 Bacteria 10483
188 Ga0081540_1007797 3300005983 Bacteria 7576
189 Ga0081540_1027473 3300005983 Bacteria 3223
190 Ga0070717_10003546 3300006028 Bacteria 11189
191 Ga0070717_10007901 3300006028 Bacteria 7922
192 Ga0070717_10019237 3300006028 Bacteria 5353
193 Ga0070717_10053112 3300006028 Bacteria 3340
194 Ga0070717_10073640 3300006028 Bacteria 2855
195 Ga0070717_10128125 3300006028 Bacteria 2180
196 Ga0070717_10130194 3300006028 Bacteria 2163
197 Ga0070717_10154049 3300006028 Bacteria 1990
198 Ga0070717_10204097 3300006028 Bacteria 1732
199 Ga0075365_10014630 3300006038 Bacteria 4726
200 Ga0075363_100000934 3300006048 Bacteria 10342
201 Ga0075364_10120803 3300006051 Bacteria 1753
202 Ga0070715_10000665 3300006163 Bacteria 9186
203 Ga0070716_100000375 3300006173 Bacteria 18369
204 Ga0070716_100005685 3300006173 Bacteria 6053
205 Ga0070716_100014994 3300006173 Bacteria 3976
206 Ga0070716_100025495 3300006173 Bacteria 3155
207 Ga0070716_100026047 3300006173 Bacteria 3127
208 Ga0070716_100050911 3300006173 Bacteria 2353
209 Ga0070716_100071058 3300006173 Bacteria 2045
210 Ga0070716_100092279 3300006173 Bacteria 1835
211 Ga0070716_100181724 3300006173 Bacteria 1381
212 Ga0070712_100001381 3300006175 Bacteria 14730
213 Ga0070712_100002762 3300006175 Bacteria 10849
214 Ga0070712_100056731 3300006175 Bacteria 2748
215 Ga0070712_100072757 3300006175 Bacteria 2463
216 Ga0070712_100089790 3300006175 Bacteria 2248
217 Ga0097621_100016068 3300006237 Bacteria 5649
218 Ga0097621_100097355 3300006237 Bacteria 2470
219 Ga0097621_100135421 3300006237 Bacteria 2100
220 Ga0097621_100183115 3300006237 Bacteria 1811
221 Ga0068871_100094421 3300006358 Bacteria 2497
222 Ga0068871_100158077 3300006358 Bacteria 1937
223 Ga0075428_100000664 3300006844 Bacteria 35332
224 Ga0075428_100078877 3300006844 Bacteria 3594
225 Ga0075433_10004765 3300006852 Bacteria 10583
226 Ga0075433_10032192 3300006852 Bacteria 4490
227 Ga0075434_100011323 3300006871 Bacteria 8405
228 Ga0075434_100061903 3300006871 Bacteria 3724
229 Ga0075434_100090488 3300006871 Bacteria 3061
230 Ga0075434_100162704 3300006871 Bacteria 2251
231 Ga0075434_100200253 3300006871 Bacteria 2016
232 Ga0075434_100208778 3300006871 Bacteria 1973
233 Ga0075436_100001878 3300006914 Bacteria 14437
234 Ga0075436_100014158 3300006914 Bacteria 5460
235 Ga0075436_100095790 3300006914 Bacteria 2065
236 Ga0075436_100143074 3300006914 Bacteria 1681
237 Ga0075436_100216420 3300006914 Bacteria 1359
238 Ga0075436_100225777 3300006914 Bacteria 1329
239 Ga0097620_100119092 3300006931 Bacteria 2706
240 Ga0097620_100152317 3300006931 Bacteria 2388
241 Ga0075435_100002133 3300007076 Bacteria 13029
242 Ga0075435_100451516 3300007076 Bacteria 1108
243 Ga0105251_10075170 3300009011 Bacteria 1569
244 Ga0105244_10131863 3300009036 Bacteria 1206
245 Ga0105240_10077104 3300009093 Bacteria 4108
246 Ga0105240_10609961 3300009093 Bacteria 1201
247 Ga0111539_10080590 3300009094 Bacteria 3829
248 Ga0111539_10288151 3300009094 Bacteria 1911
249 Ga0111539_10332785 3300009094 Bacteria 1768
250 Ga0105245_10005419 3300009098 Bacteria 11212
251 Ga0105245_10025504 3300009098 Bacteria 5199
252 Ga0105245_10065273 3300009098 Bacteria 3292
253 Ga0105245_10152823 3300009098 Bacteria 2184
254 Ga0105247_10032888 3300009101 Bacteria 3152
255 Ga0105247_10145175 3300009101 Bacteria 1559
256 Ga0105241_10004425 3300009174 Bacteria 10390
257 Ga0105241_10056299 3300009174 Bacteria 3015
258 Ga0105241_10210441 3300009174 Bacteria 1629
259 Ga0105248_10246443 3300009177 Bacteria 2011
260 Ga0105248_10430796 3300009177 Bacteria 1485
261 Ga0105237_10145425 3300009545 Bacteria 2365
262 Ga0105237_10202179 3300009545 Bacteria 1987
263 Ga0105237_10274057 3300009545 Bacteria 1690
264 Ga0099796_10082017 3300010159 Bacteria 1184
265 Ga0105239_10143288 3300010375 Bacteria 2664
266 Ga0105239_10179273 3300010375 Bacteria 2370
267 Ga0105239_10193477 3300010375 Bacteria 2277
268 Ga0105239_10333206 3300010375 Bacteria 1712
269 Ga0105239_10488101 3300010375 Bacteria 1400
270 Ga0105239_10637268 3300010375 Bacteria 1217
271 Ga0105246_10000911 3300011119 Bacteria 16930
272 Ga0105246_10032279 3300011119 Bacteria 3472
273 Ga0105246_10313536 3300011119 Bacteria 1272
274 Ga0157370_10156010 3300013104 Bacteria 2124
275 Ga0157369_10029633 3300013105 Bacteria 6046
276 Ga0157374_10174320 3300013296 Bacteria 2099
277 Ga0157374_10213713 3300013296 Bacteria 1891
278 Ga0157378_10170911 3300013297 Bacteria 2038
279 Ga0163162_10209574 3300013306 Bacteria 2078
280 Ga0163162_10241975 3300013306 Bacteria 1935
281 Ga0157372_10164791 3300013307 Bacteria 2563
282 Ga0157375_10243031 3300013308 Bacteria 1960
283 Ga0157375_10363046 3300013308 Bacteria 1614
284 Ga0157375_10608263 3300013308 Bacteria 1252
285 Ga0163163_10059222 3300014325 Bacteria 3787
286 Ga0163163_10111260 3300014325 Bacteria 2768
287 Ga0163163_10351494 3300014325 Bacteria 1530
288 Ga0163163_10508095 3300014325 Bacteria 1267
289 Ga0157380_10261039 3300014326 Bacteria 1573
290 Ga0182008_10056488 3300014497 Bacteria 1939
291 Ga0157377_10006253 3300014745 Bacteria 5669
292 Ga0157377_10010126 3300014745 Bacteria 4652
293 Ga0157377_10208763 3300014745 Bacteria 1244
294 Ga0157379_10007497 3300014968 Bacteria 9445
295 Ga0157379_10026531 3300014968 Bacteria 5157
296 Ga0157379_10414333 3300014968 Bacteria 1240
297 Ga0157376_10017121 3300014969 Bacteria 5521
298 Ga0157376_10105242 3300014969 Bacteria 2474
299 Ga0157376_10120379 3300014969 Bacteria 2325
300 Ga0197907_10187271 3300020069 Bacteria 1462
301 Ga0206354_10057982 3300020081 Bacteria 1695
302 Ga0206354_10343418 3300020081 Bacteria 1065
303 Ga0206354_10978843 3300020081 Bacteria 1811
304 Ga0206354_11413288 3300020081 Bacteria 2598
305 Ga0206353_10026372 3300020082 Bacteria 6034
306 Ga0213876_10051303 3300021384 Bacteria 2180
307 Ga0213875_10000588 3300021388 Bacteria 29434
308 Ga0213875_10001911 3300021388 Bacteria 12893
309 Ga0213875_10066161 3300021388 Bacteria 1689
310 Ga0224572_1000284 3300024225 Bacteria 5312
311 Ga0224572_1001967 3300024225 Bacteria 3206
312 Ga0207656_10027109 3300025321 Bacteria 2341
313 Ga0207653_10007871 3300025885 Bacteria 3322
314 Ga0207692_10004417 3300025898 Bacteria 5566
315 Ga0207692_10008718 3300025898 Bacteria 4210
316 Ga0207692_10011762 3300025898 Bacteria 3737
317 Ga0207692_10013217 3300025898 Bacteria 3575
318 Ga0207692_10014942 3300025898 Bacteria 3404
319 Ga0207692_10070034 3300025898 Bacteria 1845
320 Ga0207692_10112103 3300025898 Bacteria 1514
321 Ga0207688_10001876 3300025901 Bacteria 11251
322 Ga0207688_10002209 3300025901 Bacteria 10475
323 Ga0207688_10002950 3300025901 Bacteria 9258
324 Ga0207680_10082525 3300025903 Bacteria 2023
325 Ga0207647_10170609 3300025904 Bacteria 1267
326 Ga0207685_10002951 3300025905 Bacteria 4028
327 Ga0207685_10044970 3300025905 Bacteria 1672
328 Ga0207699_10001982 3300025906 Bacteria 9671
329 Ga0207699_10002377 3300025906 Bacteria 8879
330 Ga0207699_10009162 3300025906 Bacteria 4917
331 Ga0207699_10044967 3300025906 Bacteria 2574
332 Ga0207699_10055407 3300025906 Bacteria 2359
333 Ga0207699_10093269 3300025906 Bacteria 1895
334 Ga0207699_10114364 3300025906 Bacteria 1735
335 Ga0207645_10017159 3300025907 Bacteria 4781
336 Ga0207643_10001978 3300025908 Bacteria 11314
337 Ga0207643_10044638 3300025908 Bacteria 2502
338 Ga0207705_10035716 3300025909 Bacteria 3555
339 Ga0207705_10092860 3300025909 Bacteria 2212
340 Ga0207705_10131874 3300025909 Bacteria 1860
341 Ga0207684_10004761 3300025910 Bacteria 12712
342 Ga0207684_10209888 3300025910 Bacteria 1680
343 Ga0207684_10247495 3300025910 Bacteria 1538
344 Ga0207684_10257127 3300025910 Bacteria 1507
345 Ga0207684_10277926 3300025910 Bacteria 1444
346 Ga0207654_10048299 3300025911 Bacteria 2435
347 Ga0207654_10099120 3300025911 Bacteria 1792
348 Ga0207707_10010532 3300025912 Bacteria 8028
349 Ga0207707_10011990 3300025912 Bacteria 7536
350 Ga0207695_10334862 3300025913 Bacteria 1402
351 Ga0207671_10113486 3300025914 Bacteria 2064
352 Ga0207671_10311612 3300025914 Bacteria 1244
353 Ga0207693_10001158 3300025915 Bacteria 23531
354 Ga0207693_10002507 3300025915 Bacteria 15965
355 Ga0207693_10003174 3300025915 Bacteria 14119
356 Ga0207693_10050876 3300025915 Bacteria 3252
357 Ga0207693_10074359 3300025915 Bacteria 2661
358 Ga0207693_10129690 3300025915 Bacteria 1982
359 Ga0207663_10033106 3300025916 Bacteria 3075
360 Ga0207663_10046792 3300025916 Bacteria 2667
361 Ga0207663_10085691 3300025916 Bacteria 2075
362 Ga0207663_10137468 3300025916 Bacteria 1698
363 Ga0207663_10160631 3300025916 Bacteria 1586
364 Ga0207663_10194334 3300025916 Bacteria 1459
365 Ga0207660_10038996 3300025917 Bacteria 3319
366 Ga0207662_10041543 3300025918 Bacteria 2708
367 Ga0207657_10003201 3300025919 Bacteria 17523
368 Ga0207657_10011654 3300025919 Bacteria 8716
369 Ga0207657_10016690 3300025919 Bacteria 7075
370 Ga0207657_10135807 3300025919 Bacteria 2012
371 Ga0207649_10018319 3300025920 Bacteria 3980
372 Ga0207649_10219600 3300025920 Bacteria 1353
373 Ga0207652_10003458 3300025921 Bacteria 13025
374 Ga0207652_10004897 3300025921 Bacteria 10832
375 Ga0207652_10171445 3300025921 Bacteria 1947
376 Ga0207646_10030826 3300025922 Bacteria 4858
377 Ga0207646_10039968 3300025922 Bacteria 4221
378 Ga0207646_10054609 3300025922 Bacteria 3572
379 Ga0207646_10071943 3300025922 Bacteria 3088
380 Ga0207646_10114882 3300025922 Bacteria 2417
381 Ga0207646_10131403 3300025922 Bacteria 2253
382 Ga0207646_10183587 3300025922 Bacteria 1889
383 Ga0207694_10181915 3300025924 Bacteria 1705
384 Ga0207694_10429761 3300025924 Bacteria 1101
385 Ga0207659_10006338 3300025926 Bacteria 7242
386 Ga0207659_10372898 3300025926 Bacteria 1189
387 Ga0207687_10125471 3300025927 Bacteria 1926
388 Ga0207687_10147664 3300025927 Bacteria 1790
389 Ga0207687_10274814 3300025927 Bacteria 1348
390 Ga0207700_10000263 3300025928 Bacteria 31277
391 Ga0207700_10000366 3300025928 Bacteria 26382
392 Ga0207700_10001149 3300025928 Bacteria 15207
393 Ga0207700_10005691 3300025928 Bacteria 7483
394 Ga0207700_10021731 3300025928 Bacteria 4387
395 Ga0207700_10051679 3300025928 Bacteria 3068
396 Ga0207700_10114012 3300025928 Bacteria 2180
397 Ga0207700_10147569 3300025928 Bacteria 1940
398 Ga0207700_10184056 3300025928 Bacteria 1751
399 Ga0207700_10254889 3300025928 Bacteria 1500
400 Ga0207700_10335667 3300025928 Bacteria 1313
401 Ga0207700_10371825 3300025928 Bacteria 1248
402 Ga0207664_10000900 3300025929 Bacteria 20073
403 Ga0207664_10001450 3300025929 Bacteria 15575
404 Ga0207664_10003326 3300025929 Bacteria 10694
405 Ga0207664_10014185 3300025929 Bacteria 5747
406 Ga0207664_10019481 3300025929 Bacteria 5015
407 Ga0207664_10025112 3300025929 Bacteria 4483
408 Ga0207664_10057019 3300025929 Bacteria 3104
409 Ga0207664_10069775 3300025929 Bacteria 2826
410 Ga0207664_10083004 3300025929 Bacteria 2611
411 Ga0207664_10145176 3300025929 Bacteria 2011
412 Ga0207664_10154494 3300025929 Bacteria 1952
413 Ga0207664_10177245 3300025929 Bacteria 1828
414 Ga0207664_10199781 3300025929 Bacteria 1725
415 Ga0207664_10243384 3300025929 Bacteria 1567
416 Ga0207644_10006975 3300025931 Bacteria 7357
417 Ga0207690_10009515 3300025932 Bacteria 5772
418 Ga0207706_10036588 3300025933 Bacteria 4360
419 Ga0207706_10210908 3300025933 Bacteria 1703
420 Ga0207670_10045741 3300025936 Bacteria 2903
421 Ga0207670_10155763 3300025936 Bacteria 1700
422 Ga0207669_10065321 3300025937 Bacteria 2257
423 Ga0207704_10077380 3300025938 Bacteria 2135
424 Ga0207665_10002699 3300025939 Bacteria 11897
425 Ga0207665_10004673 3300025939 Bacteria 9098
426 Ga0207665_10009299 3300025939 Bacteria 6451
427 Ga0207665_10027982 3300025939 Bacteria 3724
428 Ga0207665_10029804 3300025939 Bacteria 3605
429 Ga0207665_10058579 3300025939 Bacteria 2604
430 Ga0207665_10110804 3300025939 Bacteria 1928
431 Ga0207665_10150388 3300025939 Bacteria 1667
432 Ga0207665_10265674 3300025939 Bacteria 1273
433 Ga0207691_10040207 3300025940 Bacteria 4322
434 Ga0207691_10096477 3300025940 Bacteria 2643
435 Ga0207711_10298737 3300025941 Bacteria 1485
436 Ga0207689_10002083 3300025942 Bacteria 18876
437 Ga0207689_10010824 3300025942 Bacteria 7846
438 Ga0207689_10052504 3300025942 Bacteria 3359
439 Ga0207689_10053892 3300025942 Bacteria 3313
440 Ga0207689_10100002 3300025942 Bacteria 2383
441 Ga0207661_10009569 3300025944 Bacteria 6955
442 Ga0207661_10034426 3300025944 Bacteria 3939
443 Ga0207679_10000682 3300025945 Bacteria 22742
444 Ga0207679_10347890 3300025945 Bacteria 1291
445 Ga0207667_10112718 3300025949 Bacteria 2804
446 Ga0207667_10564296 3300025949 Bacteria 1150
447 Ga0207668_10087223 3300025972 Bacteria 2282
448 Ga0207668_10274363 3300025972 Bacteria 1380
449 Ga0207640_10102805 3300025981 Bacteria 2007
450 Ga0207640_10533009 3300025981 Bacteria 983
451 Ga0207677_10104941 3300026023 Bacteria 2090
452 Ga0207677_10351622 3300026023 Bacteria 1235
453 Ga0207703_10062086 3300026035 Bacteria 3060
454 Ga0207703_10133257 3300026035 Bacteria 2148
455 Ga0207639_10165093 3300026041 Bacteria 1870
456 Ga0207678_10000539 3300026067 Bacteria 34560
457 Ga0207678_10037818 3300026067 Bacteria 4197
458 Ga0207678_10056165 3300026067 Bacteria 3390
459 Ga0207678_10109763 3300026067 Bacteria 2353
460 Ga0207678_10150666 3300026067 Bacteria 1986
461 Ga0207708_10018103 3300026075 Bacteria 5302
462 Ga0207708_10034183 3300026075 Bacteria 3866
463 Ga0207708_10039594 3300026075 Bacteria 3592
464 Ga0207708_10107881 3300026075 Bacteria 2159
465 Ga0207702_10006037 3300026078 Bacteria 10513
466 Ga0207702_10104537 3300026078 Bacteria 2506
467 Ga0207702_10228954 3300026078 Bacteria 1736
468 Ga0207641_10100640 3300026088 Bacteria 2546
469 Ga0207648_10059647 3300026089 Bacteria 3328
470 Ga0207648_10088399 3300026089 Bacteria 2705
471 Ga0207648_10127939 3300026089 Bacteria 2235
472 Ga0207676_10050059 3300026095 Bacteria 3255
473 Ga0207676_10190443 3300026095 Bacteria 1804
474 Ga0207676_10207549 3300026095 Bacteria 1735
475 Ga0207674_10010256 3300026116 Bacteria 10635
476 Ga0207674_10017051 3300026116 Bacteria 7928
477 Ga0207674_10018405 3300026116 Bacteria 7594
478 Ga0207674_10039117 3300026116 Bacteria 4918
479 Ga0207674_10079326 3300026116 Bacteria 3287
480 Ga0207674_10135329 3300026116 Bacteria 2426
481 Ga0207674_10306562 3300026116 Bacteria 1537
482 Ga0207675_100040011 3300026118 Bacteria 4375
483 Ga0207675_100120200 3300026118 Bacteria 2485
484 Ga0207675_100412970 3300026118 Bacteria 1332
485 Ga0207683_10004433 3300026121 Bacteria 12130
486 Ga0207683_10006189 3300026121 Bacteria 10253
487 Ga0207698_10022386 3300026142 Bacteria 4390
488 Ga0207698_10056701 3300026142 Bacteria 3026
489 Ga0207698_10282871 3300026142 Bacteria 1535
490 Ga0207428_10212858 3300027907 Bacteria 1451
491 Ga0268266_10023738 3300028379 Bacteria 5219
492 Ga0268266_10146044 3300028379 Bacteria 2127
493 Ga0268265_10036886 3300028380 Bacteria 3584
494 Ga0268265_10090899 3300028380 Bacteria 2440
495 Ga0268264_10283291 3300028381 Bacteria 1553
496 Ga0307517_10030403 3300028786 Bacteria 6332
497 Ga0307515_10019119 3300028794 Bacteria 12352
498 Ga0307515_10048095 3300028794 Bacteria 6459
499 Ga0265338_10004490 3300028800 Bacteria 18814
500 Ga0307512_10002799 3300030522 Bacteria 21251
501 Ga0307512_10008268 3300030522 Bacteria 10171
502 Ga0316177_1173943 3300030731 Bacteria 3739
503 Ga0316176_1033292 3300030732 Bacteria 5298
504 Ga0314311_1137046 3300030733 Bacteria 2064
505 Ga0307513_10017242 3300031456 Bacteria 8664
506 Ga0307513_10021598 3300031456 Bacteria 7595
507 Ga0307513_10041651 3300031456 Bacteria 5066
508 Ga0307508_10033376 3300031616 Bacteria 4645
509 Ga0307508_10038806 3300031616 Bacteria 4279
510 Ga0307516_10025692 3300031730 Bacteria 5993
511 Ga0307516_10031906 3300031730 Bacteria 5309
512 Ga0307518_10000232 3300031838 Bacteria 42086
513 Ga0326468_10000194 3300031889 Bacteria 6226
514 Ga0307407_10048845 3300031903 Bacteria 2411
515 Ga0307409_100108688 3300031995 Bacteria 2320
516 Ga0307409_100145861 3300031995 Bacteria 2047
517 Ga0307409_100221793 3300031995 Bacteria 1707
518 Ga0307416_100192736 3300032002 Bacteria 1924
519 Ga0307416_100208676 3300032002 Bacteria 1861
520 Ga0307416_100234286 3300032002 Bacteria 1773
521 Ga0307416_100359168 3300032002 Bacteria 1478
522 Ga0307411_10305563 3300032005 Bacteria 1278
523 Ga0307415_100095063 3300032126 Bacteria 2169
524 Ga0307507_10047237 3300033179 Bacteria 4208
525 Ga0373938_0007695 3300034957 Bacteria 1903
526 Ga0373926_0000209 3300035083 Bacteria 13645
527 Ga0373926_0000481 3300035083 Bacteria 10558
528 Ga0373928_0010206 3300035084 Bacteria 1842
529 Ga0373929_0040540 3300035085 Bacteria 1032
530 Ga0373934_0000464 3300035086 Bacteria 14174
531 Ga0373934_0004916 3300035086 Bacteria 4947
532 Ga0373940_0012633 3300035088 Bacteria 2026
533 Ga0373940_0033813 3300035088 Bacteria 1377
534 Ga0373940_0048069 3300035088 Bacteria 1191
535 Ga0373944_0000324 3300035089 Bacteria 10702
536 Ga0373944_0001985 3300035089 Bacteria 5181
537 Ga0373949_0030098 3300035090 Bacteria 1289
538 Ga0373949_0034803 3300035090 Bacteria 1216
539 Ga0373951_0000035 3300035091 Bacteria 52707
540 Ga0373923_0011900 3300035111 Bacteria 3203
541 Ga0373932_0013426 3300035112 Bacteria 2037
542 Ga0373932_0020952 3300035112 Bacteria 1720
543 Ga0373936_0000905 3300035113 Bacteria 10588
544 Ga0373936_0003422 3300035113 Bacteria 5947
545 Ga0373936_0005643 3300035113 Bacteria 4720
546 Ga0373936_0068709 3300035113 Bacteria 1457
547 Ga0373939_0015215 3300035114 Bacteria 2010
548 Ga0373939_0094515 3300035114 Bacteria 1016
549 Ga0373945_0002850 3300035116 Bacteria 5435
550 Ga0373945_0003715 3300035116 Bacteria 4810
551 Ga0373953_0000990 3300035117 Bacteria 7988
552 Ga0373953_0002139 3300035117 Bacteria 5912
553 Ga0373953_0003638 3300035117 Bacteria 4830
554 Ga0373953_0004159 3300035117 Bacteria 4589
555 Ga0373954_0004938 3300035118 Bacteria 5760
556 Ga0373954_0020374 3300035118 Bacteria 2999
557 Ga0373954_0022670 3300035118 Bacteria 2851
558 Ga0373954_0023101 3300035118 Bacteria 2825
559 Ga0373954_0108806 3300035118 Bacteria 1340
560 Ga0373956_0000341 3300035119 Bacteria 18807
561 Ga0373956_0004508 3300035119 Bacteria 5564
562 Ga0373957_0000371 3300035120 Bacteria 11376
563 Ga0373957_0002612 3300035120 Bacteria 5171
564 Ga0373957_0083864 3300035120 Bacteria 1260
565 Ga0373943_0002186 3300035170 Bacteria 8893
566 Ga0373943_0005979 3300035170 Bacteria 5462
567 Ga0373946_0019584 3300035171 Bacteria 2608
568 Ga0373946_0021989 3300035171 Bacteria 2478
569 Ga0373946_0067073 3300035171 Bacteria 1540
570 Ga0373955_0000222 3300035172 Bacteria 23967
571 Ga0373955_0008996 3300035172 Bacteria 4661
572 Ga0373955_0017139 3300035172 Bacteria 3579
573 Ga0373955_0031556 3300035172 Bacteria 2776
574 Ga0373955_0071868 3300035172 Bacteria 1936
575 Ga0373955_0080727 3300035172 Bacteria 1837
576 Ga0373942_0000072 3300035207 Bacteria 21354
577 Ga0373961_0077201 3300035241 Bacteria 1041
578 Ga0373924_0003863 3300035410 Bacteria 5188
579 Ga0373924_0004071 3300035410 Bacteria 5081
580 Ga0373924_0018236 3300035410 Bacteria 2701
581 Ga0373935_0000226 3300035692 Bacteria 27564
582 Ga0373935_0020539 3300035692 Bacteria 4036
583 Ga0373935_0090453 3300035692 Bacteria 2003
584 Ga0373935_0135706 3300035692 Bacteria 1657
585 Ga0373935_0147310 3300035692 Bacteria 1595
586 Ga0373935_0201137 3300035692 Bacteria 1376
587 Ga0373935_0221170 3300035692 Bacteria 1315
588 Ga0373927_0001109 3300035695 Bacteria 20443
589 Ga0373927_0003893 3300035695 Bacteria 10588
590 Ga0373927_0041735 3300035695 Bacteria 2975
591 Ga0373927_0046013 3300035695 Bacteria 2824
592 Ga0373927_0327340 3300035695 Bacteria 1009
593 Ga0373933_0000848 3300035724 Bacteria 18692
594 Ga0373933_0008999 3300035724 Bacteria 5447
595 Ga0373933_0015466 3300035724 Bacteria 4253
596 Ga0373933_0033164 3300035724 Bacteria 3002
597 Ga0373933_0041241 3300035724 Bacteria 2724
598 Ga0373933_0046628 3300035724 Bacteria 2574
599 Ga0373933_0107543 3300035724 Bacteria 1736
600 Ga0373933_0267636 3300035724 Bacteria 1102
601 Ga0373947_0030651 3300035725 Bacteria 3161
602 Ga0373947_0065021 3300035725 Bacteria 2224
603 Ga0373947_0128343 3300035725 Bacteria 1616
604 Ga0373937_0001634 3300036401 Bacteria 18834
605 Ga0373937_0022580 3300036401 Bacteria 5659
606 Ga0373937_0106626 3300036401 Bacteria 2604
607 Ga0373937_0109859 3300036401 Bacteria 2564
608 Ga0373937_0141967 3300036401 Bacteria 2247
609 Ga0373925_0005454 3300037068 Bacteria 9473
610 Ga0373925_0007437 3300037068 Bacteria 7991
611 Ga0373925_0021225 3300037068 Bacteria 4732
612 Ga0373925_0062762 3300037068 Bacteria 2794
613 Ga0373925_0255154 3300037068 Bacteria 1407
614 Ga0373925_0299506 3300037068 Bacteria 1298
615 Ga0395898_0004690 3300037466 Bacteria 14880
616 Ga0395898_0068565 3300037466 Bacteria 3433
617 Ga0395898_0189341 3300037466 Bacteria 1966
618 Ga0436364_0201885 3300037853 Bacteria 1887
619 Ga0436364_0704698 3300037853 Bacteria 12100
620 Ga0436364_0888788 3300037853 Bacteria 28172
621 Ga0436364_1231391 3300037853 Bacteria 28702
622 Ga0436364_1294101 3300037853 Bacteria 1313
623 Ga0436364_1376954 3300037853 Bacteria 7454
624 Ga0395901_0009504 3300038443 Bacteria 9864
625 Ga0395901_0353653 3300038443 Bacteria 1516
626 Ga0395901_0369029 3300038443 Bacteria 1479
627 Ga0395901_0612173 3300038443 Bacteria 1097
628 Ga0436365_1836282 3300039437 Bacteria 1510
629 Ga0436365_1894323 3300039437 Bacteria 2658
630 Ga0439461_0032856 3300041410 Bacteria 1090
631 Ga0439435_0008382 3300042436 Bacteria 2395
632 Ga0439440_0077155 3300042993 Bacteria 876
633 Ga0466963_0132851 3300044694 Bacteria 1720
634 Ga0466970_0013553 3300044765 Bacteria 4182
635 Ga0466967_0000252 3300045976 Bacteria 23522
636 Ga0466967_0017716 3300045976 Bacteria 5667
637 Ga0495592_0001091 3300046454 Bacteria 18834
638 Ga0495592_0004625 3300046454 Bacteria 10082
639 Ga0495592_0021701 3300046454 Bacteria 4884
640 Ga0495603_0001487 3300046455 Bacteria 13635
641 Ga0495603_0006041 3300046455 Bacteria 7240
642 Ga0495603_0067781 3300046455 Bacteria 2100
643 Ga0495603_0072262 3300046455 Bacteria 2027
644 Ga0495590_0062259 3300046457 Bacteria 1306
645 Ga0495629_0001438 3300046459 Bacteria 18783
646 Ga0495629_0007247 3300046459 Bacteria 8169
647 Ga0495629_0015074 3300046459 Bacteria 5556
648 Ga0495629_0025175 3300046459 Bacteria 4233
649 Ga0495629_0053887 3300046459 Bacteria 2813
650 Ga0495641_0004177 3300046461 Bacteria 10377
651 Ga0495641_0006974 3300046461 Bacteria 7182
652 Ga0495641_0022107 3300046461 Bacteria 3187
653 Ga0495651_0001242 3300046462 Bacteria 19733
654 Ga0495651_0001382 3300046462 Bacteria 18834
655 Ga0495651_0002417 3300046462 Bacteria 14421
656 Ga0495651_0008758 3300046462 Bacteria 7761
657 Ga0495651_0026018 3300046462 Bacteria 4555
658 Ga0495651_0046897 3300046462 Bacteria 3343
659 Ga0495651_0122790 3300046462 Bacteria 1905
660 Ga0495651_0253160 3300046462 Bacteria 1201
661 Ga0495653_0005648 3300046463 Bacteria 10211
662 Ga0495653_0032694 3300046463 Bacteria 4128
663 Ga0495653_0033362 3300046463 Bacteria 4079
664 Ga0495653_0073614 3300046463 Bacteria 2548
665 Ga0495653_0081242 3300046463 Bacteria 2395
666 Ga0495650_0051096 3300046471 Bacteria 1705
667 Ga0495580_0006138 3300046472 Bacteria 9826
668 Ga0495580_0010059 3300046472 Bacteria 7393
669 Ga0495580_0041068 3300046472 Bacteria 3301
670 Ga0495580_0193771 3300046472 Bacteria 1401
671 Ga0495582_0002383 3300046473 Bacteria 10517
672 Ga0495582_0002725 3300046473 Bacteria 9868
673 Ga0495639_0001976 3300046475 Bacteria 9080
674 Ga0495639_0003351 3300046475 Bacteria 6947
675 Ga0495662_0000330 3300046476 Bacteria 20617
676 Ga0495662_0006861 3300046476 Bacteria 5661
677 Ga0495662_0008455 3300046476 Bacteria 5064
678 Ga0495664_0020515 3300046477 Bacteria 3811
679 Ga0495664_0048087 3300046477 Bacteria 2532
680 Ga0495664_0049767 3300046477 Bacteria 2488
681 Ga0495664_0054693 3300046477 Bacteria 2373
682 Ga0495664_0060503 3300046477 Bacteria 2254
683 Ga0495664_0111367 3300046477 Bacteria 1652
684 Ga0495664_0138957 3300046477 Bacteria 1472
685 Ga0495664_0200408 3300046477 Bacteria 1209
686 Ga0495585_0009296 3300046492 Bacteria 5905
687 Ga0495585_0063373 3300046492 Bacteria 2029
688 Ga0495594_0004876 3300046499 Bacteria 6908
689 Ga0495594_0037441 3300046499 Bacteria 2646
690 Ga0495594_0088422 3300046499 Bacteria 1734
691 Ga0495606_0011938 3300046507 Bacteria 7023
692 Ga0495608_0001140 3300046511 Bacteria 18806
693 Ga0495608_0003658 3300046511 Bacteria 11052
694 Ga0495608_0013593 3300046511 Bacteria 5646
695 Ga0495608_0014739 3300046511 Bacteria 5425
696 Ga0495608_0022442 3300046511 Bacteria 4326
697 Ga0495608_0094111 3300046511 Bacteria 1935
698 Ga0495618_0018212 3300046514 Bacteria 4312
699 Ga0495618_0037478 3300046514 Bacteria 3045
700 Ga0495618_0041896 3300046514 Bacteria 2884
701 Ga0495618_0108502 3300046514 Bacteria 1777
702 Ga0495618_0264481 3300046514 Bacteria 1076
703 Ga0495628_0003233 3300046516 Bacteria 14600
704 Ga0495628_0035979 3300046516 Bacteria 3976
705 Ga0495628_0099515 3300046516 Bacteria 2245
706 Ga0495628_0151228 3300046516 Bacteria 1768
707 Ga0495628_0186037 3300046516 Bacteria 1569
708 Ga0495630_0002131 3300046517 Bacteria 13762
709 Ga0495630_0006764 3300046517 Bacteria 8168
710 Ga0495630_0025631 3300046517 Bacteria 4362
711 Ga0495630_0071538 3300046517 Bacteria 2610
712 Ga0495630_0136671 3300046517 Bacteria 1862
713 Ga0495632_0024171 3300046519 Bacteria 3233
714 Ga0495666_0009740 3300046526 Bacteria 4802
715 Ga0495666_0024094 3300046526 Bacteria 3009
716 Ga0495666_0032388 3300046526 Bacteria 2558
717 Ga0495652_0002465 3300046529 Bacteria 19022
718 Ga0495652_0003372 3300046529 Bacteria 15807
719 Ga0495652_0029805 3300046529 Bacteria 4790
720 Ga0495652_0037314 3300046529 Bacteria 4216
721 Ga0495652_0049236 3300046529 Bacteria 3608
722 Ga0495652_0066384 3300046529 Bacteria 3028
723 Ga0495652_0098822 3300046529 Bacteria 2371
724 Ga0495652_0130103 3300046529 Bacteria 1994
725 Ga0495652_0244529 3300046529 Bacteria 1333
726 Ga0495665_0001654 3300046531 Bacteria 11947
727 Ga0495665_0006498 3300046531 Bacteria 6313
728 Ga0495665_0027844 3300046531 Bacteria 3033
729 Ga0495640_0010082 3300046533 Bacteria 7323
730 Ga0495640_0012364 3300046533 Bacteria 6523
731 Ga0495640_0045563 3300046533 Bacteria 3043
732 Ga0495640_0056164 3300046533 Bacteria 2690
733 Ga0495586_0002716 3300046535 Bacteria 9578
734 Ga0495586_0029450 3300046535 Bacteria 2937
735 Ga0495586_0084540 3300046535 Bacteria 1747
736 Ga0495586_0201730 3300046535 Bacteria 1128
737 Ga0495587_0000981 3300046536 Bacteria 18711
738 Ga0495587_0003495 3300046536 Bacteria 10460
739 Ga0495587_0004441 3300046536 Bacteria 9244
740 Ga0495587_0006362 3300046536 Bacteria 7701
741 Ga0495587_0007982 3300046536 Bacteria 6838
742 Ga0495587_0028386 3300046536 Bacteria 3402
743 Ga0495587_0105812 3300046536 Bacteria 1618
744 Ga0495587_0172229 3300046536 Bacteria 1229
745 Ga0495645_0009004 3300046543 Bacteria 6969
746 Ga0495645_0010626 3300046543 Bacteria 6462
747 Ga0495645_0019978 3300046543 Bacteria 4829
748 Ga0495645_0024211 3300046543 Bacteria 4404
749 Ga0495645_0042062 3300046543 Bacteria 3331
750 Ga0495645_0047547 3300046543 Bacteria 3125
751 Ga0495645_0066131 3300046543 Bacteria 2614
752 Ga0495622_0008244 3300046557 Bacteria 4826
753 Ga0495667_0000915 3300046559 Bacteria 19070
754 Ga0495667_0002764 3300046559 Bacteria 11714
755 Ga0495667_0021348 3300046559 Bacteria 4369
756 Ga0495667_0024975 3300046559 Bacteria 4026
757 Ga0495667_0027919 3300046559 Bacteria 3799
758 Ga0495667_0030094 3300046559 Bacteria 3650
759 Ga0495667_0067710 3300046559 Bacteria 2332
760 Ga0495667_0074358 3300046559 Bacteria 2212
761 Ga0495667_0271274 3300046559 Bacteria 1078
762 Ga0495668_0000471 3300046616 Bacteria 50892
763 Ga0495634_0010231 3300046642 Bacteria 6879
764 Ga0495634_0033585 3300046642 Bacteria 3525
765 Ga0495634_0048512 3300046642 Bacteria 2858
766 Ga0495634_0079379 3300046642 Bacteria 2149
767 Ga0495625_0000265 3300046660 Bacteria 81480
768 Ga0495635_0003166 3300046663 Bacteria 11338
769 Ga0495635_0015603 3300046663 Bacteria 5308
770 Ga0495635_0042933 3300046663 Bacteria 3121
771 Ga0495635_0056040 3300046663 Bacteria 2714
772 Ga0495635_0063473 3300046663 Bacteria 2536
773 Ga0495635_0076696 3300046663 Bacteria 2290
774 Ga0495635_0078945 3300046663 Bacteria 2253
775 Ga0495635_0248119 3300046663 Bacteria 1200
776 Ga0495588_0031007 3300046674 Bacteria 2689
777 Ga0495588_0069391 3300046674 Bacteria 1832
778 Ga0495657_0001708 3300046675 Bacteria 18828
779 Ga0495657_0003275 3300046675 Bacteria 13297
780 Ga0495657_0008776 3300046675 Bacteria 7708
781 Ga0495657_0050083 3300046675 Bacteria 2809
782 Ga0495657_0069770 3300046675 Bacteria 2298
783 Ga0495657_0120633 3300046675 Bacteria 1651
784 Ga0495657_0253238 3300046675 Bacteria 1059
785 Ga0495599_0000707 3300046678 Bacteria 18834
786 Ga0495599_0004490 3300046678 Bacteria 8267
787 Ga0495599_0005475 3300046678 Bacteria 7595
788 Ga0495599_0009019 3300046678 Bacteria 6077
789 Ga0495599_0036382 3300046678 Bacteria 3091
790 Ga0495599_0055863 3300046678 Bacteria 2471
791 Ga0495599_0139439 3300046678 Bacteria 1504
792 Ga0495599_0155234 3300046678 Bacteria 1416
793 Ga0495623_0003451 3300046679 Bacteria 10457
794 Ga0495623_0009059 3300046679 Bacteria 6455
795 Ga0495623_0048352 3300046679 Bacteria 2698
796 Ga0495623_0054886 3300046679 Bacteria 2513
797 Ga0495646_0009048 3300046680 Bacteria 6314
798 Ga0495646_0011589 3300046680 Bacteria 5600
799 Ga0495646_0024844 3300046680 Bacteria 3770
800 Ga0495646_0042680 3300046680 Bacteria 2781
801 Ga0495646_0148696 3300046680 Bacteria 1304
802 Ga0495647_0016297 3300046681 Bacteria 2614
803 Ga0495658_0001712 3300046683 Bacteria 11402
804 Ga0495613_0001810 3300046689 Bacteria 16241
805 Ga0495613_0003215 3300046689 Bacteria 12228
806 Ga0495613_0157478 3300046689 Bacteria 1617
807 Ga0495624_0003275 3300046690 Bacteria 12068
808 Ga0495624_0051537 3300046690 Bacteria 2603
809 Ga0495624_0070413 3300046690 Bacteria 2177
810 Ga0495624_0081677 3300046690 Bacteria 2001
811 Ga0495589_0023238 3300046794 Bacteria 3161
812 Ga0495600_0001389 3300046809 Bacteria 13373
813 Ga0495600_0024841 3300046809 Bacteria 3857
814 Ga0495600_0041437 3300046809 Bacteria 3001
815 Ga0495600_0119138 3300046809 Bacteria 1717
816 Ga0495581_0001801 3300047315 Bacteria 11971
817 Ga0495581_0007583 3300047315 Bacteria 6272
818 Ga0495581_0066284 3300047315 Bacteria 2088
819 Ga0495581_0243336 3300047315 Bacteria 1052
820 Ga0495604_0001527 3300047317 Bacteria 19055
821 Ga0495604_0003616 3300047317 Bacteria 12325
822 Ga0495604_0013167 3300047317 Bacteria 6586
823 Ga0495604_0018582 3300047317 Bacteria 5568
824 Ga0495604_0022488 3300047317 Bacteria 5033
825 Ga0495604_0023139 3300047317 Bacteria 4958
826 Ga0495604_0031191 3300047317 Bacteria 4229
827 Ga0495604_0031382 3300047317 Bacteria 4213
828 Ga0495604_0092888 3300047317 Bacteria 2234
829 Ga0495604_0104589 3300047317 Bacteria 2074
830 Ga0495636_0009336 3300047318 Bacteria 3861
831 Ga0495674_0010201 3300047319 Bacteria 8898
832 Ga0495674_0013582 3300047319 Bacteria 7650
833 Ga0495674_0017794 3300047319 Bacteria 6617
834 Ga0495674_0018498 3300047319 Bacteria 6484
835 Ga0495674_0099222 3300047319 Bacteria 2479
836 Ga0495674_0102234 3300047319 Bacteria 2437
837 Ga0495674_0125621 3300047319 Bacteria 2165
838 Ga0495674_0212832 3300047319 Bacteria 1600
839 Ga0495676_0002061 3300047321 Bacteria 17687
840 Ga0495676_0016825 3300047321 Bacteria 6476
841 Ga0495676_0022504 3300047321 Bacteria 5481
842 Ga0495680_0002494 3300047322 Bacteria 18812
843 Ga0495680_0004087 3300047322 Bacteria 14056
844 Ga0495680_0013124 3300047322 Bacteria 7240
845 Ga0495680_0017482 3300047322 Bacteria 6122
846 Ga0495680_0024075 3300047322 Bacteria 5054
847 Ga0495680_0025613 3300047322 Bacteria 4879
848 Ga0495680_0058447 3300047322 Bacteria 2979
849 Ga0495680_0069090 3300047322 Bacteria 2696
850 Ga0495687_005985 3300047443 Bacteria 7581
851 Ga0495675_0000440 3300047444 Bacteria 27746
852 Ga0495675_0001608 3300047444 Bacteria 13581
853 Ga0495675_0019850 3300047444 Bacteria 4270
854 Ga0495675_0021821 3300047444 Bacteria 4079
855 Ga0495675_0055500 3300047444 Bacteria 2512
856 Ga0495675_0084364 3300047444 Bacteria 1999
857 Ga0495675_0132355 3300047444 Bacteria 1549
858 Ga0495684_0009270 3300047471 Bacteria 7598
859 Ga0495684_0012323 3300047471 Bacteria 6594
860 Ga0495684_0066981 3300047471 Bacteria 2730
861 Ga0495684_0143107 3300047471 Bacteria 1792
862 Ga0495684_0191565 3300047471 Bacteria 1511
863 Ga0495686_0109153 3300047472 Bacteria 1661
864 Ga0495593_0002356 3300047673 Bacteria 11347
865 Ga0495593_0002885 3300047673 Bacteria 10364
866 Ga0495602_0002471 3300048088 Bacteria 18834
867 Ga0495602_0010201 3300048088 Bacteria 9749
868 Ga0495602_0013999 3300048088 Bacteria 8165
869 Ga0495602_0037969 3300048088 Bacteria 4460
870 Ga0495602_0042251 3300048088 Bacteria 4155
871 Ga0495602_0083881 3300048088 Bacteria 2667
872 Ga0495602_0085388 3300048088 Bacteria 2638
873 Ga0495602_0244590 3300048088 Bacteria 1340
874 Ga0495614_0010426 3300048089 Bacteria 4097
875 Ga0495626_0000509 3300048091 Bacteria 38930
876 Ga0496100_0226858 3300048903 Bacteria 1373
877 Ga0496101_0153065 3300048904 Bacteria 1765
878 Ga0496102_0020030 3300048905 Bacteria 5904
879 Ga0496102_0025368 3300048905 Bacteria 5277
880 Ga0496102_0135800 3300048905 Bacteria 2304
881 Ga0496102_0397021 3300048905 Bacteria 1297
882 Ga0496103_0070107 3300048906 Bacteria 2193
883 Ga0496104_0001455 3300048907 Bacteria 20467
884 Ga0496104_0006424 3300048907 Bacteria 10336
885 Ga0496104_0021408 3300048907 Bacteria 5936
886 Ga0496104_0042179 3300048907 Bacteria 4280
887 Ga0496104_0103253 3300048907 Bacteria 2731
888 Ga0496104_0168199 3300048907 Bacteria 2102
889 Ga0496105_0004910 3300048908 Bacteria 10110
890 Ga0496105_0025548 3300048908 Bacteria 4809
891 Ga0496105_0051608 3300048908 Bacteria 3397
892 Ga0496105_0084414 3300048908 Bacteria 2623
893 Ga0496105_0103161 3300048908 Bacteria 2355
894 Ga0496105_0117019 3300048908 Bacteria 2198
895 Ga0496105_0126660 3300048908 Bacteria 2105
896 Ga0496106_0002362 3300048909 Bacteria 14048
897 Ga0496106_0091822 3300048909 Bacteria 2344
898 Ga0496106_0212902 3300048909 Bacteria 1540
899 Ga0496106_0300118 3300048909 Bacteria 1288
900 Ga0496107_0050839 3300048910 Bacteria 2988
901 Ga0496107_0062591 3300048910 Bacteria 2696
902 Ga0496108_0005696 3300048911 Bacteria 10084
903 Ga0496108_0008118 3300048911 Bacteria 8513
904 Ga0496108_0010587 3300048911 Bacteria 7485
905 Ga0496108_0017005 3300048911 Bacteria 5944
906 Ga0496108_0067962 3300048911 Bacteria 3006
907 Ga0496108_0222307 3300048911 Bacteria 1641
908 Ga0496108_0249282 3300048911 Bacteria 1545
909 Ga0496108_0265937 3300048911 Bacteria 1492
910 Ga0496109_0021940 3300048912 Bacteria 5653
911 Ga0496109_0042177 3300048912 Bacteria 4132
912 Ga0496109_0051182 3300048912 Bacteria 3761
913 Ga0496110_0006941 3300048913 Bacteria 9006
914 Ga0496110_0011473 3300048913 Bacteria 7252
915 Ga0496110_0015992 3300048913 Bacteria 6257
916 Ga0496111_0001546 3300048914 Bacteria 13249
917 Ga0496111_0002777 3300048914 Bacteria 10661
918 Ga0496111_0027944 3300048914 Bacteria 3995
919 Ga0496111_0060266 3300048914 Bacteria 2751
920 Ga0496111_0074794 3300048914 Bacteria 2468
921 Ga0496111_0129268 3300048914 Bacteria 1868
922 Ga0496112_0011884 3300048915 Bacteria 7974
923 Ga0496112_0117384 3300048915 Bacteria 2631
924 Ga0496112_0247493 3300048915 Bacteria 1734
925 Ga0496112_0550786 3300048915 Bacteria 1087
926 Ga0496113_0003244 3300048916 Bacteria 9706
927 Ga0496113_0018560 3300048916 Bacteria 4847
928 Ga0496113_0062099 3300048916 Bacteria 2821
929 Ga0496113_0156486 3300048916 Bacteria 1800
930 Ga0496114_0287409 3300048917 Bacteria 1450
931 Ga0496114_0354023 3300048917 Bacteria 1299
932 Ga0496114_0381281 3300048917 Bacteria 1248
933 Ga0496115_0011638 3300048918 Bacteria 6601
934 Ga0496115_0139962 3300048918 Bacteria 1996
935 Ga0496115_0146114 3300048918 Bacteria 1951
936 Ga0496115_0232422 3300048918 Bacteria 1520
937 Ga0496119_0030341 3300048922 Bacteria 3648
938 Ga0496119_0041464 3300048922 Bacteria 2931
939 Ga0496126_0007060 3300048929 Bacteria 12375
940 Ga0496126_0015348 3300048929 Bacteria 7705
941 Ga0496126_0384897 3300048929 Bacteria 1141
942 Ga0501039_0077001 3300049575 Bacteria 2594
943 Ga0501046_0008733 3300049580 Bacteria 8803
944 Ga0501047_0057673 3300049581 Bacteria 3755
945 Ga0501047_0059036 3300049581 Bacteria 3704
946 Ga0501047_0107421 3300049581 Bacteria 2672
947 Ga0501047_0328485 3300049581 Bacteria 1368
948 Ga0501047_0622297 3300049581 Bacteria 900
949 Ga0501069_0184588 3300049585 Bacteria 1206
950 Ga0501070_0098816 3300049586 Bacteria 2414
951 Ga0501073_0151262 3300049589 Bacteria 1609
952 Ga0501075_0227663 3300049591 Bacteria 1422
953 Ga0501080_0090184 3300049742 Bacteria 2848
954 Ga0501081_0355748 3300049743 Bacteria 1080
955 Ga0501035_0052514 3300049822 Bacteria 3647
956 Ga0501044_0112962 3300049823 Bacteria 2723
957 Ga0501044_0160038 3300049823 Bacteria 2229
958 nmdc:mga0yw44_185995_c1 3300050492 Bacteria 1369
959 nmdc:mga0yw44_91953_c1 3300050492 Bacteria 1919
960 nmdc:mga0yw44_94197_c1 3300050492 Bacteria 1898
961 nmdc:mga05p37_108791_c1 3300050507 Bacteria 3410
962 nmdc:mga08y16_12180_c1 3300050511 Bacteria 9039
963 nmdc:mga08y16_13697_c1 3300050511 Bacteria 8537
964 nmdc:mga08y16_38321_c1 3300050511 Bacteria 5034
965 nmdc:mga0n895_20419_c1 3300050512 Bacteria 6179
966 nmdc:mga0n895_345860_c1 3300050512 Bacteria 1506
967 nmdc:mga0n895_45065_c1 3300050512 Bacteria 4303
968 nmdc:mga0rr50_389063_c1 3300050513 Bacteria 1177
969 nmdc:mga08x19_119112_c1 3300050514 Bacteria 1768
970 nmdc:mga08x19_25122_c1 3300050514 Bacteria 3710
971 nmdc:mga08x19_67768_c1 3300050514 Bacteria 2322
972 nmdc:mga08x19_98864_c1 3300050514 Bacteria 1933
973 nmdc:mga0a205_10813_c1 3300050515 Bacteria 8397
974 nmdc:mga0a205_2165_c1 3300050515 Bacteria 17267
975 nmdc:mga0a205_26974_c1 3300050515 Bacteria 5484
976 nmdc:mga0sz30_4301_c1 3300050516 Bacteria 5139
977 Ga0495601_0010558 3300053077 Bacteria 5499
978 Ga0495601_0057308 3300053077 Bacteria 2468
979 Ga0495601_0070754 3300053077 Bacteria 2227
980 Ga0495601_0181182 3300053077 Bacteria 1377
981 Ga0495612_0001401 3300053078 Bacteria 9918
982 Ga0495612_0007573 3300053078 Bacteria 4436
983 Ga0495612_0094193 3300053078 Bacteria 1271
984 Ga0495612_0131641 3300053078 Bacteria 1081
985 Ga0495595_0000359 3300053084 Bacteria 17316
986 Ga0495595_0004553 3300053084 Bacteria 5575
987 Ga0495595_0035424 3300053084 Bacteria 2261
988 Ga0495619_0003203 3300053085 Bacteria 10600
989 Ga0495619_0052202 3300053085 Bacteria 2702
990 Ga0495619_0286502 3300053085 Bacteria 1141
991 Ga0500554_068352 3300053102 Bacteria 1152
992 Ga0500594_0021175 3300053118 Bacteria 1628
993 Ga0500616_0012339 3300053153 Bacteria 5003
994 Ga0500630_134088 3300053159 Bacteria 1077
995 Ga0500633_0034268 3300053160 Bacteria 1664
996 2547410688 2547132111 Bacteria 8013147
997 2548693720 2547132424 Bacteria 8348532
998 2552110534 2551306166 Bacteria 9731570
999 2558911402 2558860112 Bacteria 9931328
1000 2586059882 2585427649 Bacteria 9053857
1001 2643901504 2643221578 Bacteria 9213798
1002 2643942289 2643221587 Bacteria 7586415
1003 2644387059 2643221670 Bacteria 6497041
1004 2644407650 2643221673 Bacteria 9196637
1005 2644429372 2643221677 Bacteria 7584031
1006 2676474053 2675903058 Bacteria 6822861
1007 2676484290 2675903059 Bacteria 8644972
1008 2676487866 2675903060 Bacteria 10051191
1009 2784592660 2784132148 Bacteria 8627943
1010 2804848638 2802429296 Bacteria 7227771
1011 2809236293 2808606448 Bacteria 8656184
1012 2816504320 2816332139 Bacteria 9138787
1013 2816504414 2816332139 Bacteria 9138787
1014 2827628944 2827628540 Bacteria 6858585
1015 2837270622 2837268691 Bacteria 7850704
1016 2856741854 2856741275 Bacteria 8096094
1017 2862291851 2862290372 Bacteria 7471434
1018 2867305986 2867302475 Bacteria 7087181
1019 2873157968 2873151551 Bacteria 8625867
1020 2880491552 2880489317 Bacteria 7096270
1021 2884696441 2884693830 Bacteria 11273186
1022 2891554420 2891554331 Bacteria 8812224
1023 2891563975 2891562705 Bacteria 8039471
1024 2891567336 2891562705 Bacteria 8039471
1025 2895446987 2895442618 Bacteria 11027144
1026 2895449794 2895442618 Bacteria 11027144
1027 2919473268 2919468124 Bacteria 9133025
1028 2919717766 2919713450 Bacteria 7431245
1029 2946046389 2946045630 Bacteria 8527308
1030 2954381067 2954380949 Bacteria 10050426
1031 3006327278 3006321560 Bacteria 8247479
1032 8001786713 8001781756 Bacteria 9586736
1033 8023630922 8023623736 Bacteria 8593882
1034 8025419095 8025413630 Bacteria 7014048
1035 8054165890 8054160619 Bacteria 7783213
1036 8054731203 8054727385 Bacteria 7558670
1037 8054735934 8054734606 Bacteria 6947278
1038 8056062673 8056060235 Bacteria 7259403
1039 8056063261 8056060235 Bacteria 7259403
1040 Ga0070699_100053909
1041 JGI25407J50210_10020823
1042 JGI25407J50210_10022959
1043 Ga0006562J51391_1067189
1044 Ga0070658_10011944
1045 Ga0070658_10029511
1046 Ga0070658_10189631
1047 Ga0070676_10045501
1048 Ga0070683_100011495
1049 Ga0070683_100014960
1050 Ga0070683_100059997
1051 Ga0070683_100114284
1052 Ga0070683_100228096
1053 Ga0070683_100374565
1054 Ga0070670_100037114
1055 Ga0070680_100124046
1056 Ga0070682_100005687
1057 Ga0070682_100151362
1058 Ga0068868_100054655
1059 Ga0068868_100116078
1060 Ga0068868_100178983
1061 Ga0068868_100188550
1062 Ga0068868_100552028
1063 Ga0070660_100026523
1064 Ga0070660_100048090
1065 Ga0070660_100085264
1066 Ga0070660_100149314
1067 Ga0070660_100149635
1068 Ga0070689_100119117
1069 Ga0070689_100153064
1070 Ga0070689_100295229
1071 Ga0070691_10036799
1072 Ga0070691_10083390
1073 Ga0070661_100006301
1074 Ga0070661_100038387
1075 Ga0070692_10055550
1076 Ga0070668_100000999
1077 Ga0070668_100093892
1078 Ga0070668_100188855
1079 Ga0070675_100002751
1080 Ga0070675_100444516
1081 Ga0070671_100014133
1082 Ga0070671_100142491
1083 Ga0070671_100172373
1084 Ga0070688_100353060
1085 Ga0070659_100027135
1086 Ga0070659_100065344
1087 Ga0070667_100116861
1088 Ga0070667_100427126
1089 Ga0070709_10000477
1090 Ga0070709_10000627
1091 Ga0070709_10020435
1092 Ga0070709_10030131
1093 Ga0070709_10059486
1094 Ga0070709_10128682
1095 Ga0070709_10161538
1096 Ga0070709_10413892
1097 Ga0070714_100004636
1098 Ga0070714_100013944
1099 Ga0070714_100025486
1100 Ga0070714_100025879
1101 Ga0070714_100026874
1102 Ga0070714_100072928
1103 Ga0070714_100088662
1104 Ga0070714_100097470
1105 Ga0070714_100117078
1106 Ga0070714_100331826
1107 Ga0070713_100002040
1108 Ga0070713_100003954
1109 Ga0070713_100024161
1110 Ga0070713_100075084
1111 Ga0070713_100149785
1112 Ga0070713_100184136
1113 Ga0070713_100248638
1114 Ga0070713_100265690
1115 Ga0070713_100330546
1116 Ga0070710_10000164
1117 Ga0070710_10001276
1118 Ga0070710_10065636
1119 Ga0070710_10070341
1120 Ga0070710_10110500
1121 Ga0070710_10227512
1122 Ga0070711_100001597
1123 Ga0070711_100002658
1124 Ga0070711_100035461
1125 Ga0070711_100059477
1126 Ga0070711_100084035
1127 Ga0070711_100115612
1128 Ga0070700_100040775
1129 Ga0070700_100052862
1130 Ga0070700_100081594
1131 Ga0070708_100007848
1132 Ga0070708_100475795
1133 Ga0070663_100016089
1134 Ga0070663_100022746
1135 Ga0070663_100026427
1136 Ga0070663_100091135
1137 Ga0070663_100312121
1138 Ga0070678_100003251
1139 Ga0070678_100095468
1140 Ga0070678_100116493
1141 Ga0070678_100243267
1142 Ga0070662_100210774
1143 Ga0070681_10009753
1144 Ga0070681_10043153
1145 Ga0070681_10232533
1146 Ga0068867_100149715
1147 Ga0070706_100018333
1148 Ga0070706_100230225
1149 Ga0070707_100024117
1150 Ga0070707_100036986
1151 Ga0070707_100198647
1152 Ga0070707_100255051
1153 Ga0070698_100002287
1154 Ga0070698_100031924
1155 Ga0070698_100038462
1156 Ga0070698_100084629
1157 Ga0070699_100000948
1158 Ga0070699_100065755
1159 Ga0070699_100077022
1160 Ga0070679_100003495
1161 Ga0070684_100023446
1162 Ga0070684_100040831
1163 Ga0070684_100181809
1164 Ga0070697_100008889
1165 Ga0070695_100022737
1166 Ga0070695_100092444
1167 Ga0070696_100154702
1168 Ga0070693_100005295
1169 Ga0070665_100005105
1170 Ga0070665_100203055
1171 Ga0070665_100289707
1172 Ga0070665_100323732
1173 Ga0070704_100021889
1174 Ga0070704_100261238
1175 Ga0068855_100241787
1176 Ga0068855_100345909
1177 Ga0068855_100396779
1178 Ga0070664_100001178
1179 Ga0070664_100125147
1180 Ga0070664_100332178
1181 Ga0068857_100035920
1182 Ga0068857_100101216
1183 Ga0068857_100160073
1184 Ga0068857_100206949
1185 Ga0068857_100321380
1186 Ga0068857_100437973
1187 Ga0068854_100084860
1188 Ga0068856_100101655
1189 Ga0068856_100145093
1190 Ga0068856_100243393
1191 Ga0068856_100278317
1192 Ga0070702_100282553
1193 Ga0068852_100003246
1194 Ga0068852_100045379
1195 Ga0068859_100119096
1196 Ga0068859_100152308
1197 Ga0068864_100013080
1198 Ga0068864_100051391
1199 Ga0068864_100053404
1200 Ga0068864_100101677
1201 Ga0068864_100256787
1202 Ga0068861_100013229
1203 Ga0068861_100323338
1204 Ga0068851_10064525
1205 Ga0068851_10102384
1206 Ga0068851_10210825
1207 Ga0068870_10003463
1208 Ga0068870_10095144
1209 Ga0068870_10192428
1210 Ga0068863_100012759
1211 Ga0068863_100175856
1212 Ga0068863_100305220
1213 Ga0068863_100318071
1214 Ga0068863_100422151
1215 Ga0068858_100171304
1216 Ga0068858_100190227
1217 Ga0068858_100472552
1218 Ga0068858_100525212
1219 Ga0068860_100362101
1220 Ga0068860_100405915
1221 Ga0068862_100064439
1222 Ga0081538_10000493
1223 Ga0081538_10003125
1224 Ga0081540_1000473
1225 Ga0081540_1002525
1226 Ga0081540_1004569
1227 Ga0081540_1007797
1228 Ga0081540_1027473
1229 Ga0070717_10003546
1230 Ga0070717_10007901
1231 Ga0070717_10019237
1232 Ga0070717_10053112
1233 Ga0070717_10073640
1234 Ga0070717_10128125
1235 Ga0070717_10130194
1236 Ga0070717_10154049
1237 Ga0070717_10204097
1238 Ga0075365_10014630
1239 Ga0075363_100000934
1240 Ga0075364_10120803
1241 Ga0070715_10000665
1242 Ga0070716_100000375
1243 Ga0070716_100005685
1244 Ga0070716_100014994
1245 Ga0070716_100025495
1246 Ga0070716_100026047
1247 Ga0070716_100050911
1248 Ga0070716_100071058
1249 Ga0070716_100092279
1250 Ga0070716_100181724
1251 Ga0070712_100001381
1252 Ga0070712_100002762
1253 Ga0070712_100056731
1254 Ga0070712_100072757
1255 Ga0070712_100089790
1256 Ga0097621_100016068
1257 Ga0097621_100097355
1258 Ga0097621_100135421
1259 Ga0097621_100183115
1260 Ga0068871_100094421
1261 Ga0068871_100158077
1262 Ga0075428_100000664
1263 Ga0075428_100078877
1264 Ga0075433_10004765
1265 Ga0075433_10032192
1266 Ga0075434_100011323
1267 Ga0075434_100061903
1268 Ga0075434_100090488
1269 Ga0075434_100162704
1270 Ga0075434_100200253
1271 Ga0075434_100208778
1272 Ga0075436_100001878
1273 Ga0075436_100014158
1274 Ga0075436_100095790
1275 Ga0075436_100143074
1276 Ga0075436_100216420
1277 Ga0075436_100225777
1278 Ga0097620_100119092
1279 Ga0097620_100152317
1280 Ga0075435_100002133
1281 Ga0075435_100451516
1282 Ga0105251_10075170
1283 Ga0105244_10131863
1284 Ga0105240_10077104
1285 Ga0105240_10609961
1286 Ga0111539_10080590
1287 Ga0111539_10288151
1288 Ga0111539_10332785
1289 Ga0105245_10005419
1290 Ga0105245_10025504
1291 Ga0105245_10065273
1292 Ga0105245_10152823
1293 Ga0105247_10032888
1294 Ga0105247_10145175
1295 Ga0105241_10004425
1296 Ga0105241_10056299
1297 Ga0105241_10210441
1298 Ga0105248_10246443
1299 Ga0105248_10430796
1300 Ga0105237_10145425
1301 Ga0105237_10202179
1302 Ga0105237_10274057
1303 Ga0099796_10082017
1304 Ga0105239_10143288
1305 Ga0105239_10179273
1306 Ga0105239_10193477
1307 Ga0105239_10333206
1308 Ga0105239_10488101
1309 Ga0105239_10637268
1310 Ga0105246_10000911
1311 Ga0105246_10032279
1312 Ga0105246_10313536
1313 Ga0157370_10156010
1314 Ga0157369_10029633
1315 Ga0157374_10174320
1316 Ga0157374_10213713
1317 Ga0157378_10170911
1318 Ga0163162_10209574
1319 Ga0163162_10241975
1320 Ga0157372_10164791
1321 Ga0157375_10243031
1322 Ga0157375_10363046
1323 Ga0157375_10608263
1324 Ga0163163_10059222
1325 Ga0163163_10111260
1326 Ga0163163_10351494
1327 Ga0163163_10508095
1328 Ga0157380_10261039
1329 Ga0182008_10056488
1330 Ga0157377_10006253
1331 Ga0157377_10010126
1332 Ga0157377_10208763
1333 Ga0157379_10007497
1334 Ga0157379_10026531
1335 Ga0157379_10414333
1336 Ga0157376_10017121
1337 Ga0157376_10105242
1338 Ga0157376_10120379
1339 Ga0197907_10187271
1340 Ga0206354_10057982
1341 Ga0206354_10343418
1342 Ga0206354_10978843
1343 Ga0206354_11413288
1344 Ga0206353_10026372
1345 Ga0213876_10051303
1346 Ga0213875_10000588
1347 Ga0213875_10001911
1348 Ga0213875_10066161
1349 Ga0224572_1000284
1350 Ga0224572_1001967
1351 Ga0207656_10027109
1352 Ga0207653_10007871
1353 Ga0207692_10004417
1354 Ga0207692_10008718
1355 Ga0207692_10011762
1356 Ga0207692_10013217
1357 Ga0207692_10014942
1358 Ga0207692_10070034
1359 Ga0207692_10112103
1360 Ga0207688_10001876
1361 Ga0207688_10002209
1362 Ga0207688_10002950
1363 Ga0207680_10082525
1364 Ga0207647_10170609
1365 Ga0207685_10002951
1366 Ga0207685_10044970
1367 Ga0207699_10001982
1368 Ga0207699_10002377
1369 Ga0207699_10009162
1370 Ga0207699_10044967
1371 Ga0207699_10055407
1372 Ga0207699_10093269
1373 Ga0207699_10114364
1374 Ga0207645_10017159
1375 Ga0207643_10001978
1376 Ga0207643_10044638
1377 Ga0207705_10035716
1378 Ga0207705_10092860
1379 Ga0207705_10131874
1380 Ga0207684_10004761
1381 Ga0207684_10209888
1382 Ga0207684_10247495
1383 Ga0207684_10257127
1384 Ga0207684_10277926
1385 Ga0207654_10048299
1386 Ga0207654_10099120
1387 Ga0207707_10010532
1388 Ga0207707_10011990
1389 Ga0207695_10334862
1390 Ga0207671_10113486
1391 Ga0207671_10311612
1392 Ga0207693_10001158
1393 Ga0207693_10002507
1394 Ga0207693_10003174
1395 Ga0207693_10050876
1396 Ga0207693_10074359
1397 Ga0207693_10129690
1398 Ga0207663_10033106
1399 Ga0207663_10046792
1400 Ga0207663_10085691
1401 Ga0207663_10137468
1402 Ga0207663_10160631
1403 Ga0207663_10194334
1404 Ga0207660_10038996
1405 Ga0207662_10041543
1406 Ga0207657_10003201
1407 Ga0207657_10011654
1408 Ga0207657_10016690
1409 Ga0207657_10135807
1410 Ga0207649_10018319
1411 Ga0207649_10219600
1412 Ga0207652_10003458
1413 Ga0207652_10004897
1414 Ga0207652_10171445
1415 Ga0207646_10030826
1416 Ga0207646_10039968
1417 Ga0207646_10054609
1418 Ga0207646_10071943
1419 Ga0207646_10114882
1420 Ga0207646_10131403
1421 Ga0207646_10183587
1422 Ga0207694_10181915
1423 Ga0207694_10429761
1424 Ga0207659_10006338
1425 Ga0207659_10372898
1426 Ga0207687_10125471
1427 Ga0207687_10147664
1428 Ga0207687_10274814
1429 Ga0207700_10000263
1430 Ga0207700_10000366
1431 Ga0207700_10001149
1432 Ga0207700_10005691
1433 Ga0207700_10021731
1434 Ga0207700_10051679
1435 Ga0207700_10114012
1436 Ga0207700_10147569
1437 Ga0207700_10184056
1438 Ga0207700_10254889
1439 Ga0207700_10335667
1440 Ga0207700_10371825
1441 Ga0207664_10000900
1442 Ga0207664_10001450
1443 Ga0207664_10003326
1444 Ga0207664_10014185
1445 Ga0207664_10019481
1446 Ga0207664_10025112
1447 Ga0207664_10057019
1448 Ga0207664_10069775
1449 Ga0207664_10083004
1450 Ga0207664_10145176
1451 Ga0207664_10154494
1452 Ga0207664_10177245
1453 Ga0207664_10199781
1454 Ga0207664_10243384
1455 Ga0207644_10006975
1456 Ga0207690_10009515
1457 Ga0207706_10036588
1458 Ga0207706_10210908
1459 Ga0207670_10045741
1460 Ga0207670_10155763
1461 Ga0207669_10065321
1462 Ga0207704_10077380
1463 Ga0207665_10002699
1464 Ga0207665_10004673
1465 Ga0207665_10009299
1466 Ga0207665_10027982
1467 Ga0207665_10029804
1468 Ga0207665_10058579
1469 Ga0207665_10110804
1470 Ga0207665_10150388
1471 Ga0207665_10265674
1472 Ga0207691_10040207
1473 Ga0207691_10096477
1474 Ga0207711_10298737
1475 Ga0207689_10002083
1476 Ga0207689_10010824
1477 Ga0207689_10052504
1478 Ga0207689_10053892
1479 Ga0207689_10100002
1480 Ga0207661_10009569
1481 Ga0207661_10034426
1482 Ga0207679_10000682
1483 Ga0207679_10347890
1484 Ga0207667_10112718
1485 Ga0207667_10564296
1486 Ga0207668_10087223
1487 Ga0207668_10274363
1488 Ga0207640_10102805
1489 Ga0207640_10533009
1490 Ga0207677_10104941
1491 Ga0207677_10351622
1492 Ga0207703_10062086
1493 Ga0207703_10133257
1494 Ga0207639_10165093
1495 Ga0207678_10000539
1496 Ga0207678_10037818
1497 Ga0207678_10056165
1498 Ga0207678_10109763
1499 Ga0207678_10150666
1500 Ga0207708_10018103
1501 Ga0207708_10034183
1502 Ga0207708_10039594
1503 Ga0207708_10107881
1504 Ga0207702_10006037
1505 Ga0207702_10104537
1506 Ga0207702_10228954
1507 Ga0207641_10100640
1508 Ga0207648_10059647
1509 Ga0207648_10088399
1510 Ga0207648_10127939
1511 Ga0207676_10050059
1512 Ga0207676_10190443
1513 Ga0207676_10207549
1514 Ga0207674_10010256
1515 Ga0207674_10017051
1516 Ga0207674_10018405
1517 Ga0207674_10039117
1518 Ga0207674_10079326
1519 Ga0207674_10135329
1520 Ga0207674_10306562
1521 Ga0207675_100040011
1522 Ga0207675_100120200
1523 Ga0207675_100412970
1524 Ga0207683_10004433
1525 Ga0207683_10006189
1526 Ga0207698_10022386
1527 Ga0207698_10056701
1528 Ga0207698_10282871
1529 Ga0207428_10212858
1530 Ga0268266_10023738
1531 Ga0268266_10146044
1532 Ga0268265_10036886
1533 Ga0268265_10090899
1534 Ga0268264_10283291
1535 Ga0307517_10030403
1536 Ga0307515_10019119
1537 Ga0307515_10048095
1538 Ga0265338_10004490
1539 Ga0307512_10002799
1540 Ga0307512_10008268
1541 Ga0316177_1173943
1542 Ga0316176_1033292
1543 Ga0314311_1137046
1544 Ga0307513_10017242
1545 Ga0307513_10021598
1546 Ga0307513_10041651
1547 Ga0307508_10033376
1548 Ga0307508_10038806
1549 Ga0307516_10025692
1550 Ga0307516_10031906
1551 Ga0307518_10000232
1552 Ga0326468_10000194
1553 Ga0307407_10048845
1554 Ga0307409_100108688
1555 Ga0307409_100145861
1556 Ga0307409_100221793
1557 Ga0307416_100192736
1558 Ga0307416_100208676
1559 Ga0307416_100234286
1560 Ga0307416_100359168
1561 Ga0307411_10305563
1562 Ga0307415_100095063
1563 Ga0307507_10047237
1564 Ga0373938_0007695
1565 Ga0373926_0000209
1566 Ga0373926_0000481
1567 Ga0373928_0010206
1568 Ga0373929_0040540
1569 Ga0373934_0000464
1570 Ga0373934_0004916
1571 Ga0373940_0012633
1572 Ga0373940_0033813
1573 Ga0373940_0048069
1574 Ga0373944_0000324
1575 Ga0373944_0001985
1576 Ga0373949_0030098
1577 Ga0373949_0034803
1578 Ga0373951_0000035
1579 Ga0373923_0011900
1580 Ga0373932_0013426
1581 Ga0373932_0020952
1582 Ga0373936_0000905
1583 Ga0373936_0003422
1584 Ga0373936_0005643
1585 Ga0373936_0068709
1586 Ga0373939_0015215
1587 Ga0373939_0094515
1588 Ga0373945_0002850
1589 Ga0373945_0003715
1590 Ga0373953_0000990
1591 Ga0373953_0002139
1592 Ga0373953_0003638
1593 Ga0373953_0004159
1594 Ga0373954_0004938
1595 Ga0373954_0020374
1596 Ga0373954_0022670
1597 Ga0373954_0023101
1598 Ga0373954_0108806
1599 Ga0373956_0000341
1600 Ga0373956_0004508
1601 Ga0373957_0000371
1602 Ga0373957_0002612
1603 Ga0373957_0083864
1604 Ga0373943_0002186
1605 Ga0373943_0005979
1606 Ga0373946_0019584
1607 Ga0373946_0021989
1608 Ga0373946_0067073
1609 Ga0373955_0000222
1610 Ga0373955_0008996
1611 Ga0373955_0017139
1612 Ga0373955_0031556
1613 Ga0373955_0071868
1614 Ga0373955_0080727
1615 Ga0373942_0000072
1616 Ga0373961_0077201
1617 Ga0373924_0003863
1618 Ga0373924_0004071
1619 Ga0373924_0018236
1620 Ga0373935_0000226
1621 Ga0373935_0020539
1622 Ga0373935_0090453
1623 Ga0373935_0135706
1624 Ga0373935_0147310
1625 Ga0373935_0201137
1626 Ga0373935_0221170
1627 Ga0373927_0001109
1628 Ga0373927_0003893
1629 Ga0373927_0041735
1630 Ga0373927_0046013
1631 Ga0373927_0327340
1632 Ga0373933_0000848
1633 Ga0373933_0008999
1634 Ga0373933_0015466
1635 Ga0373933_0033164
1636 Ga0373933_0041241
1637 Ga0373933_0046628
1638 Ga0373933_0107543
1639 Ga0373933_0267636
1640 Ga0373947_0030651
1641 Ga0373947_0065021
1642 Ga0373947_0128343
1643 Ga0373937_0001634
1644 Ga0373937_0022580
1645 Ga0373937_0106626
1646 Ga0373937_0109859
1647 Ga0373937_0141967
1648 Ga0373925_0005454
1649 Ga0373925_0007437
1650 Ga0373925_0021225
1651 Ga0373925_0062762
1652 Ga0373925_0255154
1653 Ga0373925_0299506
1654 Ga0395898_0004690
1655 Ga0395898_0068565
1656 Ga0395898_0189341
1657 Ga0436364_0201885
1658 Ga0436364_0704698
1659 Ga0436364_0888788
1660 Ga0436364_1231391
1661 Ga0436364_1294101
1662 Ga0436364_1376954
1663 Ga0395901_0009504
1664 Ga0395901_0353653
1665 Ga0395901_0369029
1666 Ga0395901_0612173
1667 Ga0436365_1836282
1668 Ga0436365_1894323
1669 Ga0439461_0032856
1670 Ga0439435_0008382
1671 Ga0439440_0077155
1672 Ga0466963_0132851
1673 Ga0466970_0013553
1674 Ga0466967_0000252
1675 Ga0466967_0017716
1676 Ga0495592_0001091
1677 Ga0495592_0004625
1678 Ga0495592_0021701
1679 Ga0495603_0001487
1680 Ga0495603_0006041
1681 Ga0495603_0067781
1682 Ga0495603_0072262
1683 Ga0495590_0062259
1684 Ga0495629_0001438
1685 Ga0495629_0007247
1686 Ga0495629_0015074
1687 Ga0495629_0025175
1688 Ga0495629_0053887
1689 Ga0495641_0004177
1690 Ga0495641_0006974
1691 Ga0495641_0022107
1692 Ga0495651_0001242
1693 Ga0495651_0001382
1694 Ga0495651_0002417
1695 Ga0495651_0008758
1696 Ga0495651_0026018
1697 Ga0495651_0046897
1698 Ga0495651_0122790
1699 Ga0495651_0253160
1700 Ga0495653_0005648
1701 Ga0495653_0032694
1702 Ga0495653_0033362
1703 Ga0495653_0073614
1704 Ga0495653_0081242
1705 Ga0495650_0051096
1706 Ga0495580_0006138
1707 Ga0495580_0010059
1708 Ga0495580_0041068
1709 Ga0495580_0193771
1710 Ga0495582_0002383
1711 Ga0495582_0002725
1712 Ga0495639_0001976
1713 Ga0495639_0003351
1714 Ga0495662_0000330
1715 Ga0495662_0006861
1716 Ga0495662_0008455
1717 Ga0495664_0020515
1718 Ga0495664_0048087
1719 Ga0495664_0049767
1720 Ga0495664_0054693
1721 Ga0495664_0060503
1722 Ga0495664_0111367
1723 Ga0495664_0138957
1724 Ga0495664_0200408
1725 Ga0495585_0009296
1726 Ga0495585_0063373
1727 Ga0495594_0004876
1728 Ga0495594_0037441
1729 Ga0495594_0088422
1730 Ga0495606_0011938
1731 Ga0495608_0001140
1732 Ga0495608_0003658
1733 Ga0495608_0013593
1734 Ga0495608_0014739
1735 Ga0495608_0022442
1736 Ga0495608_0094111
1737 Ga0495618_0018212
1738 Ga0495618_0037478
1739 Ga0495618_0041896
1740 Ga0495618_0108502
1741 Ga0495618_0264481
1742 Ga0495628_0003233
1743 Ga0495628_0035979
1744 Ga0495628_0099515
1745 Ga0495628_0151228
1746 Ga0495628_0186037
1747 Ga0495630_0002131
1748 Ga0495630_0006764
1749 Ga0495630_0025631
1750 Ga0495630_0071538
1751 Ga0495630_0136671
1752 Ga0495632_0024171
1753 Ga0495666_0009740
1754 Ga0495666_0024094
1755 Ga0495666_0032388
1756 Ga0495652_0002465
1757 Ga0495652_0003372
1758 Ga0495652_0029805
1759 Ga0495652_0037314
1760 Ga0495652_0049236
1761 Ga0495652_0066384
1762 Ga0495652_0098822
1763 Ga0495652_0130103
1764 Ga0495652_0244529
1765 Ga0495665_0001654
1766 Ga0495665_0006498
1767 Ga0495665_0027844
1768 Ga0495640_0010082
1769 Ga0495640_0012364
1770 Ga0495640_0045563
1771 Ga0495640_0056164
1772 Ga0495586_0002716
1773 Ga0495586_0029450
1774 Ga0495586_0084540
1775 Ga0495586_0201730
1776 Ga0495587_0000981
1777 Ga0495587_0003495
1778 Ga0495587_0004441
1779 Ga0495587_0006362
1780 Ga0495587_0007982
1781 Ga0495587_0028386
1782 Ga0495587_0105812
1783 Ga0495587_0172229
1784 Ga0495645_0009004
1785 Ga0495645_0010626
1786 Ga0495645_0019978
1787 Ga0495645_0024211
1788 Ga0495645_0042062
1789 Ga0495645_0047547
1790 Ga0495645_0066131
1791 Ga0495622_0008244
1792 Ga0495667_0000915
1793 Ga0495667_0002764
1794 Ga0495667_0021348
1795 Ga0495667_0024975
1796 Ga0495667_0027919
1797 Ga0495667_0030094
1798 Ga0495667_0067710
1799 Ga0495667_0074358
1800 Ga0495667_0271274
1801 Ga0495668_0000471
1802 Ga0495634_0010231
1803 Ga0495634_0033585
1804 Ga0495634_0048512
1805 Ga0495634_0079379
1806 Ga0495625_0000265
1807 Ga0495635_0003166
1808 Ga0495635_0015603
1809 Ga0495635_0042933
1810 Ga0495635_0056040
1811 Ga0495635_0063473
1812 Ga0495635_0076696
1813 Ga0495635_0078945
1814 Ga0495635_0248119
1815 Ga0495588_0031007
1816 Ga0495588_0069391
1817 Ga0495657_0001708
1818 Ga0495657_0003275
1819 Ga0495657_0008776
1820 Ga0495657_0050083
1821 Ga0495657_0069770
1822 Ga0495657_0120633
1823 Ga0495657_0253238
1824 Ga0495599_0000707
1825 Ga0495599_0004490
1826 Ga0495599_0005475
1827 Ga0495599_0009019
1828 Ga0495599_0036382
1829 Ga0495599_0055863
1830 Ga0495599_0139439
1831 Ga0495599_0155234
1832 Ga0495623_0003451
1833 Ga0495623_0009059
1834 Ga0495623_0048352
1835 Ga0495623_0054886
1836 Ga0495646_0009048
1837 Ga0495646_0011589
1838 Ga0495646_0024844
1839 Ga0495646_0042680
1840 Ga0495646_0148696
1841 Ga0495647_0016297
1842 Ga0495658_0001712
1843 Ga0495613_0001810
1844 Ga0495613_0003215
1845 Ga0495613_0157478
1846 Ga0495624_0003275
1847 Ga0495624_0051537
1848 Ga0495624_0070413
1849 Ga0495624_0081677
1850 Ga0495589_0023238
1851 Ga0495600_0001389
1852 Ga0495600_0024841
1853 Ga0495600_0041437
1854 Ga0495600_0119138
1855 Ga0495581_0001801
1856 Ga0495581_0007583
1857 Ga0495581_0066284
1858 Ga0495581_0243336
1859 Ga0495604_0001527
1860 Ga0495604_0003616
1861 Ga0495604_0013167
1862 Ga0495604_0018582
1863 Ga0495604_0022488
1864 Ga0495604_0023139
1865 Ga0495604_0031191
1866 Ga0495604_0031382
1867 Ga0495604_0092888
1868 Ga0495604_0104589
1869 Ga0495636_0009336
1870 Ga0495674_0010201
1871 Ga0495674_0013582
1872 Ga0495674_0017794
1873 Ga0495674_0018498
1874 Ga0495674_0099222
1875 Ga0495674_0102234
1876 Ga0495674_0125621
1877 Ga0495674_0212832
1878 Ga0495676_0002061
1879 Ga0495676_0016825
1880 Ga0495676_0022504
1881 Ga0495680_0002494
1882 Ga0495680_0004087
1883 Ga0495680_0013124
1884 Ga0495680_0017482
1885 Ga0495680_0024075
1886 Ga0495680_0025613
1887 Ga0495680_0058447
1888 Ga0495680_0069090
1889 Ga0495687_005985
1890 Ga0495675_0000440
1891 Ga0495675_0001608
1892 Ga0495675_0019850
1893 Ga0495675_0021821
1894 Ga0495675_0055500
1895 Ga0495675_0084364
1896 Ga0495675_0132355
1897 Ga0495684_0009270
1898 Ga0495684_0012323
1899 Ga0495684_0066981
1900 Ga0495684_0143107
1901 Ga0495684_0191565
1902 Ga0495686_0109153
1903 Ga0495593_0002356
1904 Ga0495593_0002885
1905 Ga0495602_0002471
1906 Ga0495602_0010201
1907 Ga0495602_0013999
1908 Ga0495602_0037969
1909 Ga0495602_0042251
1910 Ga0495602_0083881
1911 Ga0495602_0085388
1912 Ga0495602_0244590
1913 Ga0495614_0010426
1914 Ga0495626_0000509
1915 Ga0496100_0226858
1916 Ga0496101_0153065
1917 Ga0496102_0020030
1918 Ga0496102_0025368
1919 Ga0496102_0135800
1920 Ga0496102_0397021
1921 Ga0496103_0070107
1922 Ga0496104_0001455
1923 Ga0496104_0006424
1924 Ga0496104_0021408
1925 Ga0496104_0042179
1926 Ga0496104_0103253
1927 Ga0496104_0168199
1928 Ga0496105_0004910
1929 Ga0496105_0025548
1930 Ga0496105_0051608
1931 Ga0496105_0084414
1932 Ga0496105_0103161
1933 Ga0496105_0117019
1934 Ga0496105_0126660
1935 Ga0496106_0002362
1936 Ga0496106_0091822
1937 Ga0496106_0212902
1938 Ga0496106_0300118
1939 Ga0496107_0050839
1940 Ga0496107_0062591
1941 Ga0496108_0005696
1942 Ga0496108_0008118
1943 Ga0496108_0010587
1944 Ga0496108_0017005
1945 Ga0496108_0067962
1946 Ga0496108_0222307
1947 Ga0496108_0249282
1948 Ga0496108_0265937
1949 Ga0496109_0021940
1950 Ga0496109_0042177
1951 Ga0496109_0051182
1952 Ga0496110_0006941
1953 Ga0496110_0011473
1954 Ga0496110_0015992
1955 Ga0496111_0001546
1956 Ga0496111_0002777
1957 Ga0496111_0027944
1958 Ga0496111_0060266
1959 Ga0496111_0074794
1960 Ga0496111_0129268
1961 Ga0496112_0011884
1962 Ga0496112_0117384
1963 Ga0496112_0247493
1964 Ga0496112_0550786
1965 Ga0496113_0003244
1966 Ga0496113_0018560
1967 Ga0496113_0062099
1968 Ga0496113_0156486
1969 Ga0496114_0287409
1970 Ga0496114_0354023
1971 Ga0496114_0381281
1972 Ga0496115_0011638
1973 Ga0496115_0139962
1974 Ga0496115_0146114
1975 Ga0496115_0232422
1976 Ga0496119_0030341
1977 Ga0496119_0041464
1978 Ga0496126_0007060
1979 Ga0496126_0015348
1980 Ga0496126_0384897
1981 Ga0501039_0077001
1982 Ga0501046_0008733
1983 Ga0501047_0057673
1984 Ga0501047_0059036
1985 Ga0501047_0107421
1986 Ga0501047_0328485
1987 Ga0501047_0622297
1988 Ga0501069_0184588
1989 Ga0501070_0098816
1990 Ga0501073_0151262
1991 Ga0501075_0227663
1992 Ga0501080_0090184
1993 Ga0501081_0355748
1994 Ga0501035_0052514
1995 Ga0501044_0112962
1996 Ga0501044_0160038
1997 nmdc:mga0yw44_185995_c1
1998 nmdc:mga0yw44_91953_c1
1999 nmdc:mga0yw44_94197_c1
2000 nmdc:mga05p37_108791_c1
2001 nmdc:mga08y16_12180_c1
2002 nmdc:mga08y16_13697_c1
2003 nmdc:mga08y16_38321_c1
2004 nmdc:mga0n895_20419_c1
2005 nmdc:mga0n895_345860_c1
2006 nmdc:mga0n895_45065_c1
2007 nmdc:mga0rr50_389063_c1
2008 nmdc:mga08x19_119112_c1
2009 nmdc:mga08x19_25122_c1
2010 nmdc:mga08x19_67768_c1
2011 nmdc:mga08x19_98864_c1
2012 nmdc:mga0a205_10813_c1
2013 nmdc:mga0a205_2165_c1
2014 nmdc:mga0a205_26974_c1
2015 nmdc:mga0sz30_4301_c1
2016 Ga0495601_0010558
2017 Ga0495601_0057308
2018 Ga0495601_0070754
2019 Ga0495601_0181182
2020 Ga0495612_0001401
2021 Ga0495612_0007573
2022 Ga0495612_0094193
2023 Ga0495612_0131641
2024 Ga0495595_0000359
2025 Ga0495595_0004553
2026 Ga0495595_0035424
2027 Ga0495619_0003203
2028 Ga0495619_0052202
2029 Ga0495619_0286502
2030 Ga0500554_068352
2031 Ga0500594_0021175
2032 Ga0500616_0012339
2033 Ga0500630_134088
2034 Ga0500633_0034268
2035 2547410688
2036 2548693720
2037 2552110534
2038 2558911402
2039 2586059882
2040 2643901504
2041 2643942289
2042 2644387059
2043 2644407650
2044 2644429372
2045 2676474053
2046 2676484290
2047 2676487866
2048 2784592660
2049 2804848638
2050 2809236293
2051 2816504320
2052 2816504414
2053 2827628944
2054 2837270622
2055 2856741854
2056 2862291851
2057 2867305986
2058 2873157968
2059 2880491552
2060 2884696441
2061 2891554420
2062 2891563975
2063 2891567336
2064 2895446987
2065 2895449794
2066 2919473268
2067 2919717766
2068 2946046389
2069 2954381067
2070 3006327278
2071 8001786713
2072 8023630922
2073 8025419095
2074 8054165890
2075 8054731203
2076 8054735934
2077 8056062673
2078 8056063261

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08281

Sigma70_r4_2

Sigma-70, region 4

110

163

0.95

PF04542

Sigma70_r2

Sigma-70 region 2

1

68

0.88

Map