F488643
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1032 | 421 | 1023 | 413 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0117384|Ga0501034_0117384_96_1451 |
| Length | 451 |
| Sequence | MRQICIRLARNRTLDVHAHAALHPNAPGFPPQQEHLMILADDRGLSEEQRMMRDTCRAFVNEHVIPFTRQHWKREWIMTPEERLPAKILEIADAIGIRTIGIPEEFGGITLDPKTEVQTLALIAEEIARGDSGLADKLVQVWKISKLLKVIAPRHLQEYWFPRIVADPSFLLAHCSTEPRGASDRWLGYDTPETAFQTKAVLKGDEWIINGRKQFVSNGYDAQLYVVYANSRPGVKMAEGTSSFLIPRGTPGFSIARCNETMGGRFMNNGEMVFEDCRVPRDHCLVENEALARRAGHYALPGRIIQTSKNIGIGIAAFERTADYVQNYVQGGRILIKHQVVASRLADMATRICAVRSILKDASRAVDEGSPDADYLCSMAKLFASEEILKVCQNAVELHGGNGTMLDFGIEKLYRDAMMFLHMDGTVDITRFKIIKNLFPQTAGKYAGPEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 3 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 4 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 5 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 6 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 7 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 8 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 9 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 10 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 11 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 12 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 13 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 14 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 15 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 16 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 17 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 18 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 19 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 20 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 21 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 22 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 23 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 24 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 25 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 26 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 27 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 28 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 31 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 80 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 86 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 88 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 89 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 91 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 92 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 93 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 94 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 95 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 96 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 97 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 98 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 99 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 100 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 101 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 102 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 104 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 105 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 106 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 110 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 111 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 112 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 113 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 114 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 115 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 116 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 117 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 118 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 119 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 120 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 121 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 122 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 123 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 125 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 126 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 139 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 153 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 233 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 237 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 239 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 240 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 241 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 242 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 243 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 244 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 245 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 246 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 247 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 248 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 249 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 250 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 251 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 252 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 253 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 254 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 255 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 256 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 257 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 259 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 260 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 262 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 263 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 265 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 266 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 268 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 269 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 270 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 271 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 272 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 273 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 274 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 276 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 278 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 279 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 280 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 281 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 282 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 283 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 284 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 286 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 287 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 288 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 289 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 290 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 291 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 292 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 293 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 294 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 295 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 296 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 297 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 298 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 299 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 300 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 301 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 362 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 363 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 364 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 365 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 366 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 367 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 370 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 371 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 372 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 373 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 374 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 375 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 376 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 397 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 398 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 399 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 400 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 401 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 415 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 416 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 417 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 418 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 419 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.13 |
| Metatranscriptomes | 0 |
| Isolates | 0.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.33 |
| Nodule | 0 |
| Rhizoplane | 7.36 |
| Rhizosphere | 89.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214856314 | 2209111006 | Bacteria | 8020 |
| 2 | ARcpr5oldR_c000046 | 3300000041 | Bacteria | 22854 |
| 3 | ARSoilYngRDRAFT_c00078 | 3300000042 | Bacteria | 16119 |
| 4 | ARcpr5yngRDRAFT_c000072 | 3300000043 | Bacteria | 16816 |
| 5 | ARSoilOldRDRAFT_c000019 | 3300000044 | Bacteria | 37577 |
| 6 | ARCol0oldRDRAFT_c00019 | 3300000045 | Bacteria | 12070 |
| 7 | ARCol0yngRDRAFT_1000004 | 3300000652 | Bacteria | 52222 |
| 8 | JGI24746J21847_1000147 | 3300001977 | Bacteria | 8859 |
| 9 | JGI24746J21847_1003854 | 3300001977 | Bacteria | 2369 |
| 10 | JGI24747J21853_1000217 | 3300001978 | Bacteria | 3101 |
| 11 | JGI24739J22299_10010699 | 3300001989 | Bacteria | 3402 |
| 12 | JGI24737J22298_10002058 | 3300001990 | Bacteria | 7196 |
| 13 | JGI24737J22298_10003740 | 3300001990 | Bacteria | 5356 |
| 14 | JGI24737J22298_10023198 | 3300001990 | Bacteria | 1969 |
| 15 | JGI24743J22301_10003718 | 3300001991 | Bacteria | 2435 |
| 16 | JGI24750J21931_1000430 | 3300002070 | Bacteria | 6827 |
| 17 | JGI24750J21931_1002146 | 3300002070 | Bacteria | 2393 |
| 18 | JGI24745J21846_1001132 | 3300002073 | Bacteria | 2537 |
| 19 | JGI24748J21848_1000555 | 3300002074 | Bacteria | 4040 |
| 20 | JGI24738J21930_10004182 | 3300002075 | Bacteria | 3559 |
| 21 | JGI24744J21845_10000132 | 3300002077 | Bacteria | 10427 |
| 22 | JGI24034J26672_10002921 | 3300002239 | Bacteria | 2366 |
| 23 | JGI24034J26672_10005798 | 3300002239 | Bacteria | 1775 |
| 24 | JGI24742J22300_10000106 | 3300002244 | Bacteria | 11917 |
| 25 | JGI24742J22300_10000483 | 3300002244 | Bacteria | 5928 |
| 26 | Ga0055524_1001448 | 3300003775 | Bacteria | 13592 |
| 27 | JGI25405J52794_10000722 | 3300003911 | Bacteria | 5036 |
| 28 | JGI25405J52794_10002175 | 3300003911 | Bacteria | 3340 |
| 29 | JGI25405J52794_10009788 | 3300003911 | Bacteria | 1815 |
| 30 | Ga0065704_10075977 | 3300005289 | Bacteria | 5320 |
| 31 | Ga0065715_10091019 | 3300005293 | Bacteria | 6205 |
| 32 | Ga0070658_10022611 | 3300005327 | Bacteria | 5045 |
| 33 | Ga0070658_10042393 | 3300005327 | Bacteria | 3676 |
| 34 | Ga0070658_10145210 | 3300005327 | Bacteria | 1983 |
| 35 | Ga0070676_10102718 | 3300005328 | Bacteria | 1769 |
| 36 | Ga0070683_100001872 | 3300005329 | Bacteria | 16425 |
| 37 | Ga0070683_100110942 | 3300005329 | Bacteria | 2588 |
| 38 | Ga0070683_100329083 | 3300005329 | Bacteria | 1455 |
| 39 | Ga0070690_100027115 | 3300005330 | Bacteria | 3540 |
| 40 | Ga0070670_100005524 | 3300005331 | Bacteria | 10669 |
| 41 | Ga0070670_100040546 | 3300005331 | Bacteria | 4002 |
| 42 | Ga0070670_100138127 | 3300005331 | Bacteria | 2107 |
| 43 | Ga0070677_10000429 | 3300005333 | Bacteria | 14486 |
| 44 | Ga0068869_100004944 | 3300005334 | Bacteria | 8338 |
| 45 | Ga0068869_100113167 | 3300005334 | Bacteria | 2067 |
| 46 | Ga0070680_100016120 | 3300005336 | Bacteria | 5873 |
| 47 | Ga0070680_100018787 | 3300005336 | Bacteria | 5470 |
| 48 | Ga0070680_100076342 | 3300005336 | Bacteria | 2758 |
| 49 | Ga0070680_100258243 | 3300005336 | Bacteria | 1473 |
| 50 | Ga0070680_100284952 | 3300005336 | Bacteria | 1400 |
| 51 | Ga0070682_100000695 | 3300005337 | Bacteria | 20200 |
| 52 | Ga0068868_100004036 | 3300005338 | Bacteria | 10230 |
| 53 | Ga0068868_100087923 | 3300005338 | Bacteria | 2500 |
| 54 | Ga0070660_100001014 | 3300005339 | Bacteria | 18890 |
| 55 | Ga0070660_100046044 | 3300005339 | Bacteria | 3342 |
| 56 | Ga0070660_100072432 | 3300005339 | Bacteria | 2693 |
| 57 | Ga0070660_100116389 | 3300005339 | Bacteria | 2132 |
| 58 | Ga0070689_100012268 | 3300005340 | Bacteria | 6167 |
| 59 | Ga0070689_100114941 | 3300005340 | Bacteria | 2144 |
| 60 | Ga0070691_10011581 | 3300005341 | Bacteria | 4030 |
| 61 | Ga0070691_10065025 | 3300005341 | Bacteria | 1761 |
| 62 | Ga0070687_100112257 | 3300005343 | Bacteria | 1545 |
| 63 | Ga0070661_100011491 | 3300005344 | Bacteria | 6167 |
| 64 | Ga0070692_10002719 | 3300005345 | Bacteria | 6941 |
| 65 | Ga0070668_100058985 | 3300005347 | Bacteria | 2970 |
| 66 | Ga0070668_100128540 | 3300005347 | Bacteria | 2031 |
| 67 | Ga0070669_100015276 | 3300005353 | Bacteria | 5470 |
| 68 | Ga0070675_100000240 | 3300005354 | Bacteria | 35499 |
| 69 | Ga0070675_100014864 | 3300005354 | Bacteria | 6144 |
| 70 | Ga0070671_100015801 | 3300005355 | Bacteria | 6098 |
| 71 | Ga0070671_100094737 | 3300005355 | Bacteria | 2503 |
| 72 | Ga0070674_100013342 | 3300005356 | Bacteria | 5076 |
| 73 | Ga0070674_100013446 | 3300005356 | Bacteria | 5062 |
| 74 | Ga0070673_100007045 | 3300005364 | Bacteria | 7375 |
| 75 | Ga0070688_100001905 | 3300005365 | Bacteria | 10468 |
| 76 | Ga0070688_100049110 | 3300005365 | Bacteria | 2624 |
| 77 | Ga0070659_100007610 | 3300005366 | Bacteria | 7873 |
| 78 | Ga0070659_100010913 | 3300005366 | Bacteria | 6703 |
| 79 | Ga0070667_100005456 | 3300005367 | Bacteria | 10623 |
| 80 | Ga0070667_100020849 | 3300005367 | Bacteria | 5443 |
| 81 | Ga0070667_100159811 | 3300005367 | Bacteria | 1984 |
| 82 | Ga0070709_10000363 | 3300005434 | Bacteria | 28041 |
| 83 | Ga0070709_10033820 | 3300005434 | Bacteria | 3094 |
| 84 | Ga0070714_100000833 | 3300005435 | Bacteria | 21830 |
| 85 | Ga0070714_100056156 | 3300005435 | Bacteria | 3367 |
| 86 | Ga0070714_100094014 | 3300005435 | Bacteria | 2631 |
| 87 | Ga0070713_100000381 | 3300005436 | Bacteria | 28351 |
| 88 | Ga0070713_100003768 | 3300005436 | Bacteria | 10039 |
| 89 | Ga0070713_100019401 | 3300005436 | Bacteria | 5190 |
| 90 | Ga0070713_100097676 | 3300005436 | Bacteria | 2538 |
| 91 | Ga0070710_10000226 | 3300005437 | Bacteria | 26288 |
| 92 | Ga0070710_10004588 | 3300005437 | Bacteria | 6527 |
| 93 | Ga0070710_10076967 | 3300005437 | Bacteria | 1937 |
| 94 | Ga0070711_100001128 | 3300005439 | Bacteria | 14280 |
| 95 | Ga0070705_100000612 | 3300005440 | Bacteria | 20651 |
| 96 | Ga0070705_100027104 | 3300005440 | Bacteria | 3125 |
| 97 | Ga0070700_100009080 | 3300005441 | Bacteria | 5449 |
| 98 | Ga0070700_100027831 | 3300005441 | Bacteria | 3356 |
| 99 | Ga0070694_100001207 | 3300005444 | Bacteria | 14909 |
| 100 | Ga0070694_100002780 | 3300005444 | Bacteria | 10387 |
| 101 | Ga0070694_100065749 | 3300005444 | Bacteria | 2485 |
| 102 | Ga0070708_100074687 | 3300005445 | Bacteria | 3058 |
| 103 | Ga0070708_100141210 | 3300005445 | Bacteria | 2233 |
| 104 | Ga0070663_100015442 | 3300005455 | Bacteria | 4930 |
| 105 | Ga0070663_100025552 | 3300005455 | Bacteria | 3989 |
| 106 | Ga0070663_100040436 | 3300005455 | Bacteria | 3264 |
| 107 | Ga0070662_100013532 | 3300005457 | Bacteria | 5430 |
| 108 | Ga0070662_100028585 | 3300005457 | Bacteria | 3881 |
| 109 | Ga0070662_100080215 | 3300005457 | Bacteria | 2429 |
| 110 | Ga0070662_100204883 | 3300005457 | Bacteria | 1567 |
| 111 | Ga0070662_100261831 | 3300005457 | Bacteria | 1393 |
| 112 | Ga0070681_10011673 | 3300005458 | Bacteria | 8700 |
| 113 | Ga0070681_10019315 | 3300005458 | Bacteria | 6820 |
| 114 | Ga0070681_10096828 | 3300005458 | Bacteria | 2899 |
| 115 | Ga0070681_10146679 | 3300005458 | Bacteria | 2288 |
| 116 | Ga0070681_10244126 | 3300005458 | Bacteria | 1709 |
| 117 | Ga0070681_10252357 | 3300005458 | Bacteria | 1676 |
| 118 | Ga0068867_100132721 | 3300005459 | Bacteria | 1937 |
| 119 | Ga0070685_10014546 | 3300005466 | Bacteria | 4171 |
| 120 | Ga0070685_10040164 | 3300005466 | Bacteria | 2662 |
| 121 | Ga0070685_10051505 | 3300005466 | Bacteria | 2380 |
| 122 | Ga0070706_100040997 | 3300005467 | Bacteria | 4274 |
| 123 | Ga0070707_100053998 | 3300005468 | Bacteria | 3852 |
| 124 | Ga0070707_100193638 | 3300005468 | Bacteria | 1982 |
| 125 | Ga0070698_100185928 | 3300005471 | Bacteria | 2015 |
| 126 | Ga0070699_100002532 | 3300005518 | Bacteria | 16418 |
| 127 | Ga0070699_100073539 | 3300005518 | Bacteria | 2974 |
| 128 | Ga0070679_100023238 | 3300005530 | Bacteria | 6066 |
| 129 | Ga0070679_100034205 | 3300005530 | Bacteria | 5036 |
| 130 | Ga0070679_100040675 | 3300005530 | Bacteria | 4625 |
| 131 | Ga0070679_100063861 | 3300005530 | Bacteria | 3670 |
| 132 | Ga0070679_100084499 | 3300005530 | Bacteria | 3162 |
| 133 | Ga0070684_100009261 | 3300005535 | Bacteria | 7750 |
| 134 | Ga0070684_100062206 | 3300005535 | Bacteria | 3269 |
| 135 | Ga0070684_100118724 | 3300005535 | Bacteria | 2378 |
| 136 | Ga0070697_100039102 | 3300005536 | Bacteria | 3835 |
| 137 | Ga0070697_100091058 | 3300005536 | Bacteria | 2521 |
| 138 | Ga0068853_100009694 | 3300005539 | Bacteria | 7766 |
| 139 | Ga0068853_100069407 | 3300005539 | Bacteria | 3065 |
| 140 | Ga0070672_100001847 | 3300005543 | Bacteria | 13222 |
| 141 | Ga0070672_100068241 | 3300005543 | Bacteria | 2820 |
| 142 | Ga0070686_100008725 | 3300005544 | Bacteria | 5681 |
| 143 | Ga0070686_100010163 | 3300005544 | Bacteria | 5296 |
| 144 | Ga0070686_100038773 | 3300005544 | Bacteria | 2964 |
| 145 | Ga0070695_100000054 | 3300005545 | Bacteria | 45999 |
| 146 | Ga0070695_100029614 | 3300005545 | Bacteria | 3402 |
| 147 | Ga0070695_100039414 | 3300005545 | Bacteria | 2986 |
| 148 | Ga0070696_100000931 | 3300005546 | Bacteria | 18952 |
| 149 | Ga0070696_100004350 | 3300005546 | Bacteria | 9440 |
| 150 | Ga0070696_100038185 | 3300005546 | Bacteria | 3314 |
| 151 | Ga0070704_100000180 | 3300005549 | Bacteria | 25489 |
| 152 | Ga0070704_100004531 | 3300005549 | Bacteria | 8025 |
| 153 | Ga0068855_100014855 | 3300005563 | Bacteria | 9377 |
| 154 | Ga0068855_100017390 | 3300005563 | Bacteria | 8651 |
| 155 | Ga0068855_100045702 | 3300005563 | Bacteria | 5178 |
| 156 | Ga0068855_100091933 | 3300005563 | Bacteria | 3500 |
| 157 | Ga0068855_100215519 | 3300005563 | Bacteria | 2155 |
| 158 | Ga0070664_100001002 | 3300005564 | Bacteria | 22163 |
| 159 | Ga0070664_100058640 | 3300005564 | Bacteria | 3274 |
| 160 | Ga0068857_100131016 | 3300005577 | Bacteria | 2262 |
| 161 | Ga0068857_100229267 | 3300005577 | Bacteria | 1698 |
| 162 | Ga0068856_100023460 | 3300005614 | Bacteria | 5998 |
| 163 | Ga0070702_100019293 | 3300005615 | Bacteria | 3554 |
| 164 | Ga0070702_100096972 | 3300005615 | Bacteria | 1801 |
| 165 | Ga0068852_100004985 | 3300005616 | Bacteria | 9446 |
| 166 | Ga0068852_100047574 | 3300005616 | Bacteria | 3659 |
| 167 | Ga0068859_100000494 | 3300005617 | Bacteria | 38849 |
| 168 | Ga0068859_100010808 | 3300005617 | Bacteria | 9190 |
| 169 | Ga0068859_100075191 | 3300005617 | Bacteria | 3418 |
| 170 | Ga0068864_100003922 | 3300005618 | Bacteria | 12254 |
| 171 | Ga0068864_100075630 | 3300005618 | Bacteria | 2941 |
| 172 | Ga0068864_100105666 | 3300005618 | Bacteria | 2502 |
| 173 | Ga0068861_100003710 | 3300005719 | Bacteria | 10192 |
| 174 | Ga0068861_100014951 | 3300005719 | Bacteria | 5458 |
| 175 | Ga0068861_100023937 | 3300005719 | Bacteria | 4410 |
| 176 | Ga0068870_10000157 | 3300005840 | Bacteria | 23872 |
| 177 | Ga0068870_10072506 | 3300005840 | Bacteria | 1882 |
| 178 | Ga0068863_100000674 | 3300005841 | Bacteria | 34508 |
| 179 | Ga0068858_100091776 | 3300005842 | Bacteria | 2826 |
| 180 | Ga0068860_100001274 | 3300005843 | Bacteria | 27410 |
| 181 | Ga0068860_100012435 | 3300005843 | Bacteria | 8381 |
| 182 | Ga0068860_100045880 | 3300005843 | Bacteria | 4167 |
| 183 | Ga0068860_100130650 | 3300005843 | Bacteria | 2409 |
| 184 | Ga0068860_100188969 | 3300005843 | Bacteria | 1993 |
| 185 | Ga0068862_100000795 | 3300005844 | Bacteria | 31295 |
| 186 | Ga0068862_100070320 | 3300005844 | Bacteria | 3021 |
| 187 | Ga0081455_10000059 | 3300005937 | Bacteria | 119148 |
| 188 | Ga0081455_10002427 | 3300005937 | Bacteria | 22238 |
| 189 | Ga0081455_10003542 | 3300005937 | Bacteria | 17909 |
| 190 | Ga0081455_10004480 | 3300005937 | Bacteria | 15632 |
| 191 | Ga0081455_10006602 | 3300005937 | Bacteria | 12413 |
| 192 | Ga0081455_10169619 | 3300005937 | Bacteria | 1664 |
| 193 | Ga0081538_10007110 | 3300005981 | Bacteria | 9723 |
| 194 | Ga0081538_10051140 | 3300005981 | Bacteria | 2485 |
| 195 | Ga0081538_10070167 | 3300005981 | Bacteria | 1936 |
| 196 | Ga0081540_1002311 | 3300005983 | Bacteria | 15633 |
| 197 | Ga0081540_1003101 | 3300005983 | Bacteria | 13314 |
| 198 | Ga0081540_1008452 | 3300005983 | Bacteria | 7190 |
| 199 | Ga0081540_1012205 | 3300005983 | Bacteria | 5681 |
| 200 | Ga0081540_1014938 | 3300005983 | Bacteria | 4939 |
| 201 | Ga0081540_1021121 | 3300005983 | Bacteria | 3890 |
| 202 | Ga0070717_10000161 | 3300006028 | Bacteria | 50633 |
| 203 | Ga0070717_10002481 | 3300006028 | Bacteria | 13029 |
| 204 | Ga0070717_10063658 | 3300006028 | Bacteria | 3062 |
| 205 | Ga0070717_10080835 | 3300006028 | Bacteria | 2728 |
| 206 | Ga0070717_10115314 | 3300006028 | Bacteria | 2296 |
| 207 | Ga0075365_10065661 | 3300006038 | Bacteria | 2432 |
| 208 | Ga0075368_10025334 | 3300006042 | Bacteria | 2276 |
| 209 | Ga0075432_10032964 | 3300006058 | Bacteria | 1795 |
| 210 | Ga0070715_10014168 | 3300006163 | Bacteria | 2946 |
| 211 | Ga0070715_10041416 | 3300006163 | Bacteria | 1930 |
| 212 | Ga0070716_100000149 | 3300006173 | Bacteria | 28054 |
| 213 | Ga0070716_100011064 | 3300006173 | Bacteria | 4538 |
| 214 | Ga0070716_100045195 | 3300006173 | Bacteria | 2471 |
| 215 | Ga0070712_100000413 | 3300006175 | Bacteria | 24419 |
| 216 | Ga0070712_100022489 | 3300006175 | Bacteria | 4154 |
| 217 | Ga0070712_100140207 | 3300006175 | Bacteria | 1844 |
| 218 | Ga0075362_10026782 | 3300006177 | Bacteria | 2465 |
| 219 | Ga0075367_10010139 | 3300006178 | Bacteria | 4941 |
| 220 | Ga0075367_10026188 | 3300006178 | Bacteria | 3305 |
| 221 | Ga0075367_10068531 | 3300006178 | Bacteria | 2128 |
| 222 | Ga0075369_10017707 | 3300006186 | Bacteria | 2893 |
| 223 | Ga0075366_10021275 | 3300006195 | Bacteria | 3770 |
| 224 | Ga0075370_10072975 | 3300006353 | Bacteria | 1965 |
| 225 | Ga0068871_100001066 | 3300006358 | Bacteria | 18401 |
| 226 | Ga0075428_100038761 | 3300006844 | Bacteria | 5244 |
| 227 | Ga0075428_100049877 | 3300006844 | Bacteria | 4592 |
| 228 | Ga0075428_100088746 | 3300006844 | Bacteria | 3373 |
| 229 | Ga0075428_100157176 | 3300006844 | Bacteria | 2469 |
| 230 | Ga0075430_100000015 | 3300006846 | Bacteria | 89952 |
| 231 | Ga0075430_100000070 | 3300006846 | Bacteria | 55805 |
| 232 | Ga0075430_100001098 | 3300006846 | Bacteria | 21488 |
| 233 | Ga0075430_100002472 | 3300006846 | Bacteria | 15389 |
| 234 | Ga0075430_100006043 | 3300006846 | Bacteria | 10210 |
| 235 | Ga0075430_100031115 | 3300006846 | Bacteria | 4530 |
| 236 | Ga0075431_100001221 | 3300006847 | Bacteria | 23276 |
| 237 | Ga0075431_100004759 | 3300006847 | Bacteria | 13347 |
| 238 | Ga0075431_100011228 | 3300006847 | Bacteria | 9022 |
| 239 | Ga0075431_100018201 | 3300006847 | Bacteria | 7149 |
| 240 | Ga0075431_100098881 | 3300006847 | Bacteria | 3011 |
| 241 | Ga0075433_10008464 | 3300006852 | Bacteria | 8210 |
| 242 | Ga0075433_10010476 | 3300006852 | Bacteria | 7442 |
| 243 | Ga0075433_10109013 | 3300006852 | Unclassified | 2456 |
| 244 | Ga0075434_100000212 | 3300006871 | Bacteria | 39628 |
| 245 | Ga0075434_100016655 | 3300006871 | Bacteria | 7069 |
| 246 | Ga0075434_100037805 | 3300006871 | Bacteria | 4778 |
| 247 | Ga0075434_100048636 | 3300006871 | Bacteria | 4208 |
| 248 | Ga0075434_100060574 | 3300006871 | Bacteria | 3765 |
| 249 | Ga0075434_100084707 | 3300006871 | Bacteria | 3168 |
| 250 | Ga0075434_100090220 | 3300006871 | Bacteria | 3067 |
| 251 | Ga0075434_100090704 | 3300006871 | Bacteria | 3057 |
| 252 | Ga0075429_100003999 | 3300006880 | Bacteria | 12622 |
| 253 | Ga0075429_100021829 | 3300006880 | Bacteria | 5550 |
| 254 | Ga0075429_100250984 | 3300006880 | Bacteria | 1549 |
| 255 | Ga0068865_100000131 | 3300006881 | Bacteria | 38862 |
| 256 | Ga0075436_100143097 | 3300006914 | Bacteria | 1681 |
| 257 | Ga0097620_100000494 | 3300006931 | Bacteria | 38849 |
| 258 | Ga0097620_100010810 | 3300006931 | Bacteria | 9190 |
| 259 | Ga0097620_100075191 | 3300006931 | Bacteria | 3418 |
| 260 | Ga0075435_100034976 | 3300007076 | Bacteria | 3985 |
| 261 | Ga0075435_100065898 | 3300007076 | Bacteria | 2945 |
| 262 | Ga0075435_100077055 | 3300007076 | Bacteria | 2733 |
| 263 | Ga0075435_100121660 | 3300007076 | Bacteria | 2178 |
| 264 | Ga0099794_10008099 | 3300007265 | Bacteria | 4352 |
| 265 | Ga0099794_10014325 | 3300007265 | Bacteria | 3472 |
| 266 | Ga0099794_10043551 | 3300007265 | Bacteria | 2143 |
| 267 | Ga0105240_10054986 | 3300009093 | Bacteria | 4985 |
| 268 | Ga0111539_10000138 | 3300009094 | Bacteria | 82968 |
| 269 | Ga0111539_10028951 | 3300009094 | Bacteria | 6755 |
| 270 | Ga0111539_10039247 | 3300009094 | Bacteria | 5708 |
| 271 | Ga0111539_10058878 | 3300009094 | Bacteria | 4557 |
| 272 | Ga0111539_10064307 | 3300009094 | Bacteria | 4340 |
| 273 | Ga0111539_10245411 | 3300009094 | Bacteria | 2085 |
| 274 | Ga0105245_10011704 | 3300009098 | Bacteria | 7635 |
| 275 | Ga0105245_10045266 | 3300009098 | Bacteria | 3930 |
| 276 | Ga0105245_10059696 | 3300009098 | Bacteria | 3434 |
| 277 | Ga0105245_10122401 | 3300009098 | Bacteria | 2431 |
| 278 | Ga0105245_10175167 | 3300009098 | Bacteria | 2045 |
| 279 | Ga0105247_10042379 | 3300009101 | Bacteria | 2788 |
| 280 | Ga0105247_10042433 | 3300009101 | Bacteria | 2786 |
| 281 | Ga0114129_10002312 | 3300009147 | Bacteria | 26434 |
| 282 | Ga0114129_10003950 | 3300009147 | Bacteria | 20934 |
| 283 | Ga0114129_10027223 | 3300009147 | Bacteria | 8094 |
| 284 | Ga0114129_10102152 | 3300009147 | Bacteria | 3966 |
| 285 | Ga0114129_10110227 | 3300009147 | Bacteria | 3799 |
| 286 | Ga0114129_10110393 | 3300009147 | Bacteria | 3796 |
| 287 | Ga0114129_10330175 | 3300009147 | Bacteria | 2025 |
| 288 | Ga0105243_10006299 | 3300009148 | Bacteria | 9170 |
| 289 | Ga0105243_10032492 | 3300009148 | Bacteria | 4033 |
| 290 | Ga0105243_10091087 | 3300009148 | Bacteria | 2511 |
| 291 | Ga0105243_10127230 | 3300009148 | Bacteria | 2157 |
| 292 | Ga0105243_10176009 | 3300009148 | Bacteria | 1857 |
| 293 | Ga0105243_10184399 | 3300009148 | Bacteria | 1817 |
| 294 | Ga0105241_10056240 | 3300009174 | Bacteria | 3016 |
| 295 | Ga0105241_10064613 | 3300009174 | Bacteria | 2826 |
| 296 | Ga0105242_10078215 | 3300009176 | Bacteria | 2761 |
| 297 | Ga0105242_10177574 | 3300009176 | Bacteria | 1876 |
| 298 | Ga0105248_10002392 | 3300009177 | Bacteria | 20840 |
| 299 | Ga0105248_10012777 | 3300009177 | Bacteria | 9265 |
| 300 | Ga0105248_10013552 | 3300009177 | Bacteria | 8976 |
| 301 | Ga0105237_10018866 | 3300009545 | Bacteria | 7132 |
| 302 | Ga0105237_10042427 | 3300009545 | Bacteria | 4587 |
| 303 | Ga0105238_10060021 | 3300009551 | Bacteria | 3809 |
| 304 | Ga0105249_10001029 | 3300009553 | Bacteria | 24663 |
| 305 | Ga0105249_10017439 | 3300009553 | Bacteria | 6373 |
| 306 | Ga0105249_10024785 | 3300009553 | Bacteria | 5394 |
| 307 | Ga0099796_10001372 | 3300010159 | Bacteria | 4859 |
| 308 | Ga0105239_10043450 | 3300010375 | Bacteria | 4926 |
| 309 | Ga0105239_10112207 | 3300010375 | Bacteria | 3023 |
| 310 | Ga0105246_10022164 | 3300011119 | Bacteria | 4097 |
| 311 | Ga0105246_10027151 | 3300011119 | Bacteria | 3748 |
| 312 | Ga0157371_10030802 | 3300013102 | Bacteria | 3867 |
| 313 | Ga0157374_10000671 | 3300013296 | Bacteria | 30150 |
| 314 | Ga0157378_10088364 | 3300013297 | Bacteria | 2812 |
| 315 | Ga0157378_10150135 | 3300013297 | Bacteria | 2171 |
| 316 | Ga0157378_10411027 | 3300013297 | Bacteria | 1336 |
| 317 | Ga0163162_10177606 | 3300013306 | Bacteria | 2255 |
| 318 | Ga0157375_10002908 | 3300013308 | Bacteria | 14847 |
| 319 | Ga0157375_10028268 | 3300013308 | Bacteria | 5254 |
| 320 | Ga0157375_10110039 | 3300013308 | Bacteria | 2852 |
| 321 | Ga0163163_10004312 | 3300014325 | Bacteria | 12118 |
| 322 | Ga0163163_10010637 | 3300014325 | Bacteria | 8290 |
| 323 | Ga0163163_10033625 | 3300014325 | Bacteria | 4961 |
| 324 | Ga0157380_10005886 | 3300014326 | Bacteria | 8579 |
| 325 | Ga0157380_10132662 | 3300014326 | Bacteria | 2127 |
| 326 | Ga0157377_10000570 | 3300014745 | Bacteria | 15436 |
| 327 | Ga0157379_10000345 | 3300014968 | Bacteria | 37352 |
| 328 | Ga0157379_10033827 | 3300014968 | Bacteria | 4558 |
| 329 | Ga0157379_10133620 | 3300014968 | Bacteria | 2235 |
| 330 | Ga0157376_10025542 | 3300014969 | Bacteria | 4654 |
| 331 | Ga0157376_10039773 | 3300014969 | Bacteria | 3838 |
| 332 | Ga0157376_10098105 | 3300014969 | Bacteria | 2554 |
| 333 | Ga0163161_10004669 | 3300017792 | Bacteria | 9525 |
| 334 | Ga0163161_10037669 | 3300017792 | Bacteria | 3467 |
| 335 | Ga0213875_10080492 | 3300021388 | Bacteria | 1520 |
| 336 | Ga0207666_1000069 | 3300025271 | Bacteria | 17953 |
| 337 | Ga0207666_1001040 | 3300025271 | Bacteria | 3294 |
| 338 | Ga0207673_1007066 | 3300025290 | Bacteria | 1401 |
| 339 | Ga0209256_1000073 | 3300025299 | Bacteria | 237553 |
| 340 | Ga0207697_10000390 | 3300025315 | Bacteria | 24639 |
| 341 | Ga0207697_10006568 | 3300025315 | Bacteria | 5248 |
| 342 | Ga0207713_1036708 | 3300025735 | Bacteria | 2099 |
| 343 | Ga0207653_10024508 | 3300025885 | Bacteria | 1926 |
| 344 | Ga0207682_10000048 | 3300025893 | Bacteria | 50998 |
| 345 | Ga0207682_10008138 | 3300025893 | Bacteria | 4157 |
| 346 | Ga0207692_10000966 | 3300025898 | Bacteria | 10455 |
| 347 | Ga0207692_10005320 | 3300025898 | Bacteria | 5150 |
| 348 | Ga0207710_10022873 | 3300025900 | Bacteria | 2683 |
| 349 | Ga0207688_10001496 | 3300025901 | Bacteria | 12264 |
| 350 | Ga0207688_10004951 | 3300025901 | Bacteria | 7249 |
| 351 | Ga0207680_10045613 | 3300025903 | Bacteria | 2585 |
| 352 | Ga0207647_10013329 | 3300025904 | Bacteria | 5705 |
| 353 | Ga0207647_10014742 | 3300025904 | Bacteria | 5380 |
| 354 | Ga0207685_10004104 | 3300025905 | Bacteria | 3651 |
| 355 | Ga0207699_10000366 | 3300025906 | Bacteria | 23940 |
| 356 | Ga0207699_10074768 | 3300025906 | Bacteria | 2082 |
| 357 | Ga0207645_10012526 | 3300025907 | Bacteria | 5751 |
| 358 | Ga0207645_10030390 | 3300025907 | Bacteria | 3480 |
| 359 | Ga0207643_10000581 | 3300025908 | Bacteria | 23180 |
| 360 | Ga0207643_10007658 | 3300025908 | Bacteria | 5800 |
| 361 | Ga0207705_10024062 | 3300025909 | Bacteria | 4345 |
| 362 | Ga0207684_10023396 | 3300025910 | Bacteria | 5276 |
| 363 | Ga0207684_10117905 | 3300025910 | Bacteria | 2274 |
| 364 | Ga0207654_10004716 | 3300025911 | Bacteria | 6899 |
| 365 | Ga0207707_10007064 | 3300025912 | Bacteria | 9788 |
| 366 | Ga0207707_10016616 | 3300025912 | Bacteria | 6416 |
| 367 | Ga0207707_10018671 | 3300025912 | Bacteria | 6047 |
| 368 | Ga0207707_10048473 | 3300025912 | Bacteria | 3700 |
| 369 | Ga0207707_10150622 | 3300025912 | Bacteria | 2034 |
| 370 | Ga0207707_10169353 | 3300025912 | Bacteria | 1909 |
| 371 | Ga0207695_10037025 | 3300025913 | Bacteria | 5267 |
| 372 | Ga0207671_10011618 | 3300025914 | Bacteria | 7146 |
| 373 | Ga0207693_10002752 | 3300025915 | Bacteria | 15229 |
| 374 | Ga0207693_10010010 | 3300025915 | Bacteria | 7706 |
| 375 | Ga0207693_10011653 | 3300025915 | Bacteria | 7112 |
| 376 | Ga0207693_10072370 | 3300025915 | Bacteria | 2699 |
| 377 | Ga0207663_10006969 | 3300025916 | Bacteria | 5827 |
| 378 | Ga0207663_10058549 | 3300025916 | Bacteria | 2432 |
| 379 | Ga0207663_10070026 | 3300025916 | Bacteria | 2259 |
| 380 | Ga0207663_10127598 | 3300025916 | Bacteria | 1752 |
| 381 | Ga0207660_10000192 | 3300025917 | Bacteria | 38947 |
| 382 | Ga0207660_10009267 | 3300025917 | Bacteria | 6372 |
| 383 | Ga0207662_10000647 | 3300025918 | Bacteria | 15732 |
| 384 | Ga0207657_10038177 | 3300025919 | Bacteria | 4279 |
| 385 | Ga0207657_10091226 | 3300025919 | Bacteria | 2541 |
| 386 | Ga0207657_10094982 | 3300025919 | Bacteria | 2481 |
| 387 | Ga0207649_10000141 | 3300025920 | Bacteria | 60047 |
| 388 | Ga0207649_10045728 | 3300025920 | Bacteria | 2685 |
| 389 | Ga0207649_10083443 | 3300025920 | Bacteria | 2074 |
| 390 | Ga0207649_10163154 | 3300025920 | Bacteria | 1546 |
| 391 | Ga0207652_10004519 | 3300025921 | Bacteria | 11293 |
| 392 | Ga0207652_10151345 | 3300025921 | Bacteria | 2077 |
| 393 | Ga0207652_10253216 | 3300025921 | Bacteria | 1588 |
| 394 | Ga0207646_10057861 | 3300025922 | Bacteria | 3464 |
| 395 | Ga0207646_10068130 | 3300025922 | Bacteria | 3178 |
| 396 | Ga0207681_10000359 | 3300025923 | Bacteria | 32485 |
| 397 | Ga0207681_10159118 | 3300025923 | Bacteria | 1700 |
| 398 | Ga0207694_10035789 | 3300025924 | Bacteria | 3809 |
| 399 | Ga0207650_10004853 | 3300025925 | Bacteria | 9185 |
| 400 | Ga0207650_10006280 | 3300025925 | Bacteria | 8096 |
| 401 | Ga0207650_10105022 | 3300025925 | Bacteria | 2180 |
| 402 | Ga0207659_10000052 | 3300025926 | Bacteria | 79692 |
| 403 | Ga0207659_10023639 | 3300025926 | Bacteria | 4105 |
| 404 | Ga0207659_10249098 | 3300025926 | Bacteria | 1441 |
| 405 | Ga0207687_10000097 | 3300025927 | Bacteria | 64441 |
| 406 | Ga0207687_10069568 | 3300025927 | Bacteria | 2511 |
| 407 | Ga0207687_10082051 | 3300025927 | Bacteria | 2332 |
| 408 | Ga0207700_10000437 | 3300025928 | Bacteria | 24528 |
| 409 | Ga0207700_10000673 | 3300025928 | Bacteria | 19951 |
| 410 | Ga0207700_10032842 | 3300025928 | Bacteria | 3707 |
| 411 | Ga0207664_10000416 | 3300025929 | Bacteria | 30401 |
| 412 | Ga0207664_10137780 | 3300025929 | Bacteria | 2061 |
| 413 | Ga0207664_10235823 | 3300025929 | Bacteria | 1592 |
| 414 | Ga0207644_10002956 | 3300025931 | Bacteria | 10949 |
| 415 | Ga0207644_10033370 | 3300025931 | Bacteria | 3596 |
| 416 | Ga0207690_10000278 | 3300025932 | Bacteria | 36244 |
| 417 | Ga0207706_10003979 | 3300025933 | Bacteria | 14003 |
| 418 | Ga0207706_10036851 | 3300025933 | Bacteria | 4344 |
| 419 | Ga0207706_10136791 | 3300025933 | Bacteria | 2155 |
| 420 | Ga0207686_10000850 | 3300025934 | Bacteria | 18532 |
| 421 | Ga0207686_10008904 | 3300025934 | Bacteria | 5430 |
| 422 | Ga0207686_10210075 | 3300025934 | Bacteria | 1399 |
| 423 | Ga0207709_10000349 | 3300025935 | Bacteria | 47453 |
| 424 | Ga0207709_10014956 | 3300025935 | Bacteria | 4295 |
| 425 | Ga0207709_10067541 | 3300025935 | Bacteria | 2256 |
| 426 | Ga0207670_10000781 | 3300025936 | Bacteria | 16732 |
| 427 | Ga0207670_10075180 | 3300025936 | Bacteria | 2347 |
| 428 | Ga0207669_10000168 | 3300025937 | Bacteria | 30867 |
| 429 | Ga0207704_10000704 | 3300025938 | Bacteria | 14739 |
| 430 | Ga0207704_10153219 | 3300025938 | Bacteria | 1629 |
| 431 | Ga0207665_10000234 | 3300025939 | Bacteria | 37889 |
| 432 | Ga0207665_10000248 | 3300025939 | Bacteria | 37228 |
| 433 | Ga0207665_10011501 | 3300025939 | Bacteria | 5814 |
| 434 | Ga0207665_10074219 | 3300025939 | Bacteria | 2328 |
| 435 | Ga0207691_10003348 | 3300025940 | Bacteria | 15596 |
| 436 | Ga0207691_10006839 | 3300025940 | Bacteria | 11004 |
| 437 | Ga0207711_10006180 | 3300025941 | Bacteria | 10120 |
| 438 | Ga0207711_10012455 | 3300025941 | Bacteria | 7068 |
| 439 | Ga0207711_10042109 | 3300025941 | Bacteria | 3890 |
| 440 | Ga0207711_10119131 | 3300025941 | Bacteria | 2355 |
| 441 | Ga0207711_10172471 | 3300025941 | Bacteria | 1963 |
| 442 | Ga0207689_10012368 | 3300025942 | Bacteria | 7300 |
| 443 | Ga0207689_10030358 | 3300025942 | Bacteria | 4504 |
| 444 | Ga0207689_10117472 | 3300025942 | Bacteria | 2187 |
| 445 | Ga0207661_10000143 | 3300025944 | Bacteria | 45329 |
| 446 | Ga0207661_10049496 | 3300025944 | Bacteria | 3345 |
| 447 | Ga0207661_10076338 | 3300025944 | Bacteria | 2752 |
| 448 | Ga0207661_10110264 | 3300025944 | Bacteria | 2326 |
| 449 | Ga0207661_10250242 | 3300025944 | Bacteria | 1575 |
| 450 | Ga0207679_10000035 | 3300025945 | Bacteria | 144173 |
| 451 | Ga0207679_10022285 | 3300025945 | Bacteria | 4311 |
| 452 | Ga0207679_10179254 | 3300025945 | Bacteria | 1751 |
| 453 | Ga0207667_10031667 | 3300025949 | Bacteria | 5707 |
| 454 | Ga0207667_10043263 | 3300025949 | Bacteria | 4780 |
| 455 | Ga0207651_10000080 | 3300025960 | Bacteria | 42826 |
| 456 | Ga0207651_10018003 | 3300025960 | Bacteria | 4191 |
| 457 | Ga0207712_10003380 | 3300025961 | Bacteria | 10087 |
| 458 | Ga0207712_10065930 | 3300025961 | Bacteria | 2587 |
| 459 | Ga0207668_10007588 | 3300025972 | Bacteria | 6457 |
| 460 | Ga0207668_10109764 | 3300025972 | Bacteria | 2067 |
| 461 | Ga0207640_10015424 | 3300025981 | Bacteria | 4422 |
| 462 | Ga0207640_10092226 | 3300025981 | Bacteria | 2101 |
| 463 | Ga0207658_10022910 | 3300025986 | Bacteria | 4352 |
| 464 | Ga0207658_10137366 | 3300025986 | Bacteria | 1973 |
| 465 | Ga0207677_10000614 | 3300026023 | Bacteria | 21876 |
| 466 | Ga0207677_10033362 | 3300026023 | Bacteria | 3321 |
| 467 | Ga0207703_10022821 | 3300026035 | Bacteria | 4915 |
| 468 | Ga0207703_10033869 | 3300026035 | Bacteria | 4051 |
| 469 | Ga0207703_10063034 | 3300026035 | Bacteria | 3038 |
| 470 | Ga0207678_10005116 | 3300026067 | Bacteria | 11764 |
| 471 | Ga0207678_10010214 | 3300026067 | Bacteria | 8241 |
| 472 | Ga0207678_10044487 | 3300026067 | Bacteria | 3840 |
| 473 | Ga0207678_10045206 | 3300026067 | Bacteria | 3808 |
| 474 | Ga0207708_10008117 | 3300026075 | Bacteria | 7775 |
| 475 | Ga0207708_10013232 | 3300026075 | Bacteria | 6160 |
| 476 | Ga0207702_10001956 | 3300026078 | Bacteria | 20052 |
| 477 | Ga0207702_10106726 | 3300026078 | Bacteria | 2482 |
| 478 | Ga0207702_10116525 | 3300026078 | Bacteria | 2384 |
| 479 | Ga0207702_10121704 | 3300026078 | Bacteria | 2336 |
| 480 | Ga0207641_10009143 | 3300026088 | Bacteria | 8183 |
| 481 | Ga0207641_10010400 | 3300026088 | Bacteria | 7646 |
| 482 | Ga0207641_10276984 | 3300026088 | Bacteria | 1576 |
| 483 | Ga0207648_10234244 | 3300026089 | Bacteria | 1634 |
| 484 | Ga0207676_10001840 | 3300026095 | Bacteria | 15541 |
| 485 | Ga0207676_10066563 | 3300026095 | Bacteria | 2874 |
| 486 | Ga0207674_10002206 | 3300026116 | Bacteria | 24670 |
| 487 | Ga0207674_10014002 | 3300026116 | Bacteria | 8866 |
| 488 | Ga0207674_10139845 | 3300026116 | Bacteria | 2381 |
| 489 | Ga0207675_100003721 | 3300026118 | Bacteria | 14854 |
| 490 | Ga0207675_100012148 | 3300026118 | Bacteria | 8044 |
| 491 | Ga0207675_100103227 | 3300026118 | Bacteria | 2686 |
| 492 | Ga0207683_10002096 | 3300026121 | Bacteria | 17563 |
| 493 | Ga0207683_10003030 | 3300026121 | Bacteria | 14680 |
| 494 | Ga0207683_10013315 | 3300026121 | Bacteria | 7013 |
| 495 | Ga0207683_10031288 | 3300026121 | Bacteria | 4618 |
| 496 | Ga0207683_10047844 | 3300026121 | Bacteria | 3745 |
| 497 | Ga0207698_10003387 | 3300026142 | Bacteria | 9597 |
| 498 | Ga0207698_10006421 | 3300026142 | Bacteria | 7336 |
| 499 | Ga0207698_10027888 | 3300026142 | Bacteria | 4017 |
| 500 | Ga0209969_1000387 | 3300027360 | Bacteria | 5867 |
| 501 | Ga0209981_1001997 | 3300027378 | Bacteria | 2610 |
| 502 | Ga0210000_1001517 | 3300027462 | Bacteria | 3275 |
| 503 | Ga0209999_1003848 | 3300027543 | Bacteria | 2698 |
| 504 | Ga0209999_1006386 | 3300027543 | Bacteria | 2118 |
| 505 | Ga0210002_1000400 | 3300027617 | Bacteria | 5929 |
| 506 | Ga0209983_1005796 | 3300027665 | Bacteria | 2551 |
| 507 | Ga0209588_1001621 | 3300027671 | Bacteria | 5917 |
| 508 | Ga0209966_1002841 | 3300027695 | Bacteria | 2906 |
| 509 | Ga0209998_10000497 | 3300027717 | Bacteria | 10801 |
| 510 | Ga0209998_10001108 | 3300027717 | Bacteria | 6727 |
| 511 | Ga0209974_10002609 | 3300027876 | Bacteria | 6539 |
| 512 | Ga0209974_10003968 | 3300027876 | Bacteria | 5296 |
| 513 | Ga0209974_10005545 | 3300027876 | Bacteria | 4432 |
| 514 | Ga0207428_10000075 | 3300027907 | Bacteria | 137887 |
| 515 | Ga0207428_10000428 | 3300027907 | Bacteria | 51964 |
| 516 | Ga0207428_10001396 | 3300027907 | Bacteria | 25497 |
| 517 | Ga0268266_10024188 | 3300028379 | Bacteria | 5169 |
| 518 | Ga0268266_10159053 | 3300028379 | Bacteria | 2042 |
| 519 | Ga0268265_10000528 | 3300028380 | Bacteria | 39003 |
| 520 | Ga0268265_10003048 | 3300028380 | Bacteria | 12223 |
| 521 | Ga0268265_10017602 | 3300028380 | Bacteria | 4936 |
| 522 | Ga0268264_10001145 | 3300028381 | Bacteria | 25934 |
| 523 | Ga0268264_10001265 | 3300028381 | Bacteria | 24009 |
| 524 | Ga0268264_10045961 | 3300028381 | Bacteria | 3626 |
| 525 | Ga0268264_10159119 | 3300028381 | Bacteria | 2033 |
| 526 | Ga0265337_1000182 | 3300028556 | Bacteria | 33103 |
| 527 | Ga0265338_10030715 | 3300028800 | Bacteria | 5283 |
| 528 | Ga0265338_10056170 | 3300028800 | Bacteria | 3494 |
| 529 | Ga0265332_10002169 | 3300031238 | Bacteria | 10111 |
| 530 | Ga0265325_10000034 | 3300031241 | Bacteria | 99371 |
| 531 | Ga0265325_10001708 | 3300031241 | Bacteria | 15269 |
| 532 | Ga0265325_10008595 | 3300031241 | Bacteria | 6015 |
| 533 | Ga0265325_10038458 | 3300031241 | Bacteria | 2525 |
| 534 | Ga0265340_10009089 | 3300031247 | Bacteria | 5343 |
| 535 | Ga0265340_10039523 | 3300031247 | Bacteria | 2328 |
| 536 | Ga0265339_10000091 | 3300031249 | Bacteria | 75937 |
| 537 | Ga0265339_10001994 | 3300031249 | Bacteria | 14995 |
| 538 | Ga0265339_10019021 | 3300031249 | Bacteria | 4038 |
| 539 | Ga0265339_10037911 | 3300031249 | Bacteria | 2691 |
| 540 | Ga0265331_10075347 | 3300031250 | Bacteria | 1573 |
| 541 | Ga0265316_10043894 | 3300031344 | Bacteria | 3559 |
| 542 | Ga0265316_10108022 | 3300031344 | Bacteria | 2109 |
| 543 | Ga0307408_100035017 | 3300031548 | Bacteria | 3521 |
| 544 | Ga0265313_10000176 | 3300031595 | Bacteria | 68037 |
| 545 | Ga0265313_10000260 | 3300031595 | Bacteria | 57581 |
| 546 | Ga0265313_10004374 | 3300031595 | Bacteria | 10905 |
| 547 | Ga0265313_10006492 | 3300031595 | Bacteria | 8266 |
| 548 | Ga0265313_10014189 | 3300031595 | Bacteria | 4724 |
| 549 | Ga0265314_10118885 | 3300031711 | Bacteria | 1667 |
| 550 | Ga0265342_10000175 | 3300031712 | Bacteria | 71083 |
| 551 | Ga0265342_10000203 | 3300031712 | Bacteria | 66540 |
| 552 | Ga0265342_10029297 | 3300031712 | Bacteria | 3419 |
| 553 | Ga0265342_10081644 | 3300031712 | Bacteria | 1866 |
| 554 | Ga0307413_10031388 | 3300031824 | Bacteria | 2998 |
| 555 | Ga0307409_100195505 | 3300031995 | Bacteria | 1805 |
| 556 | Ga0373930_0001646 | 3300034816 | Bacteria | 3373 |
| 557 | Ga0373948_0000065 | 3300034817 | Bacteria | 11046 |
| 558 | Ga0373950_0003576 | 3300034818 | Bacteria | 2229 |
| 559 | Ga0373938_0004428 | 3300034957 | Bacteria | 2347 |
| 560 | Ga0373928_0000172 | 3300035084 | Bacteria | 12512 |
| 561 | Ga0373929_0000721 | 3300035085 | Bacteria | 6391 |
| 562 | Ga0373929_0002547 | 3300035085 | Bacteria | 3349 |
| 563 | Ga0373929_0011884 | 3300035085 | Bacteria | 1647 |
| 564 | Ga0373934_0018951 | 3300035086 | Bacteria | 2637 |
| 565 | Ga0373934_0026576 | 3300035086 | Bacteria | 2246 |
| 566 | Ga0373934_0061335 | 3300035086 | Bacteria | 1498 |
| 567 | Ga0373940_0002918 | 3300035088 | Bacteria | 3409 |
| 568 | Ga0373940_0007065 | 3300035088 | Bacteria | 2519 |
| 569 | Ga0373944_0000062 | 3300035089 | Bacteria | 17879 |
| 570 | Ga0373949_0001909 | 3300035090 | Bacteria | 5630 |
| 571 | Ga0373949_0002539 | 3300035090 | Bacteria | 4645 |
| 572 | Ga0373951_0003492 | 3300035091 | Bacteria | 3801 |
| 573 | Ga0373951_0013765 | 3300035091 | Bacteria | 1817 |
| 574 | Ga0373952_0010979 | 3300035092 | Bacteria | 1759 |
| 575 | Ga0373923_0000277 | 3300035111 | Bacteria | 11228 |
| 576 | Ga0373932_0002445 | 3300035112 | Bacteria | 4704 |
| 577 | Ga0373932_0004031 | 3300035112 | Bacteria | 3497 |
| 578 | Ga0373932_0006012 | 3300035112 | Bacteria | 2863 |
| 579 | Ga0373936_0000954 | 3300035113 | Bacteria | 10327 |
| 580 | Ga0373936_0017031 | 3300035113 | Bacteria | 2795 |
| 581 | Ga0373936_0079517 | 3300035113 | Bacteria | 1363 |
| 582 | Ga0373939_0001215 | 3300035114 | Bacteria | 6289 |
| 583 | Ga0373939_0004375 | 3300035114 | Bacteria | 3337 |
| 584 | Ga0373941_0000106 | 3300035115 | Bacteria | 14078 |
| 585 | Ga0373941_0000814 | 3300035115 | Bacteria | 6401 |
| 586 | Ga0373945_0000711 | 3300035116 | Bacteria | 9681 |
| 587 | Ga0373945_0000835 | 3300035116 | Bacteria | 9062 |
| 588 | Ga0373953_0000627 | 3300035117 | Bacteria | 9775 |
| 589 | Ga0373953_0001395 | 3300035117 | Bacteria | 6962 |
| 590 | Ga0373954_0001186 | 3300035118 | Bacteria | 10453 |
| 591 | Ga0373954_0009787 | 3300035118 | Bacteria | 4219 |
| 592 | Ga0373954_0013490 | 3300035118 | Bacteria | 3642 |
| 593 | Ga0373956_0001511 | 3300035119 | Bacteria | 9610 |
| 594 | Ga0373956_0035086 | 3300035119 | Bacteria | 2211 |
| 595 | Ga0373957_0006048 | 3300035120 | Bacteria | 3791 |
| 596 | Ga0373957_0053769 | 3300035120 | Bacteria | 1545 |
| 597 | Ga0373960_0001001 | 3300035121 | Bacteria | 6073 |
| 598 | Ga0373960_0001059 | 3300035121 | Bacteria | 5930 |
| 599 | Ga0373960_0001694 | 3300035121 | Bacteria | 4938 |
| 600 | Ga0373943_0050497 | 3300035170 | Bacteria | 2044 |
| 601 | Ga0373946_0006149 | 3300035171 | Bacteria | 4349 |
| 602 | Ga0373946_0026717 | 3300035171 | Bacteria | 2279 |
| 603 | Ga0373955_0000171 | 3300035172 | Bacteria | 26571 |
| 604 | Ga0373955_0000366 | 3300035172 | Bacteria | 19051 |
| 605 | Ga0373955_0002392 | 3300035172 | Bacteria | 8177 |
| 606 | Ga0373955_0005170 | 3300035172 | Bacteria | 5838 |
| 607 | Ga0373955_0007870 | 3300035172 | Bacteria | 4917 |
| 608 | Ga0373955_0019223 | 3300035172 | Bacteria | 3410 |
| 609 | Ga0373955_0049790 | 3300035172 | Bacteria | 2276 |
| 610 | Ga0373942_0001640 | 3300035207 | Bacteria | 5693 |
| 611 | Ga0373942_0007471 | 3300035207 | Bacteria | 2535 |
| 612 | Ga0373961_0002190 | 3300035241 | Bacteria | 5183 |
| 613 | Ga0373961_0002208 | 3300035241 | Bacteria | 5150 |
| 614 | Ga0373961_0003616 | 3300035241 | Bacteria | 3805 |
| 615 | Ga0373924_0004372 | 3300035410 | Bacteria | 4933 |
| 616 | Ga0373924_0006448 | 3300035410 | Bacteria | 4205 |
| 617 | Ga0373931_0002810 | 3300035691 | Bacteria | 7754 |
| 618 | Ga0373931_0015349 | 3300035691 | Bacteria | 3755 |
| 619 | Ga0373931_0023899 | 3300035691 | Bacteria | 3089 |
| 620 | Ga0373935_0000218 | 3300035692 | Bacteria | 27678 |
| 621 | Ga0373935_0046824 | 3300035692 | Bacteria | 2732 |
| 622 | Ga0373927_0005034 | 3300035695 | Bacteria | 9145 |
| 623 | Ga0373927_0006149 | 3300035695 | Bacteria | 8208 |
| 624 | Ga0373927_0024309 | 3300035695 | Bacteria | 3964 |
| 625 | Ga0373927_0030075 | 3300035695 | Bacteria | 3543 |
| 626 | Ga0373927_0059760 | 3300035695 | Bacteria | 2465 |
| 627 | Ga0373933_0002037 | 3300035724 | Bacteria | 11624 |
| 628 | Ga0373933_0004945 | 3300035724 | Bacteria | 7264 |
| 629 | Ga0373933_0005704 | 3300035724 | Bacteria | 6775 |
| 630 | Ga0373933_0007851 | 3300035724 | Bacteria | 5828 |
| 631 | Ga0373933_0018662 | 3300035724 | Bacteria | 3903 |
| 632 | Ga0373933_0026475 | 3300035724 | Bacteria | 3330 |
| 633 | Ga0373947_0000364 | 3300035725 | Bacteria | 25577 |
| 634 | Ga0373947_0008074 | 3300035725 | Bacteria | 6069 |
| 635 | Ga0373947_0041308 | 3300035725 | Bacteria | 2749 |
| 636 | Ga0373947_0044583 | 3300035725 | Bacteria | 2652 |
| 637 | Ga0373937_0000009 | 3300036401 | Bacteria | 169521 |
| 638 | Ga0373937_0002001 | 3300036401 | Bacteria | 17037 |
| 639 | Ga0373937_0028762 | 3300036401 | Bacteria | 5031 |
| 640 | Ga0373937_0042381 | 3300036401 | Bacteria | 4152 |
| 641 | Ga0373937_0046498 | 3300036401 | Bacteria | 3969 |
| 642 | Ga0373925_0011407 | 3300037068 | Bacteria | 6440 |
| 643 | Ga0373925_0025151 | 3300037068 | Bacteria | 4347 |
| 644 | Ga0395899_0008445 | 3300037312 | Bacteria | 7934 |
| 645 | Ga0395900_0085702 | 3300037418 | Bacteria | 3237 |
| 646 | Ga0395900_0208999 | 3300037418 | Bacteria | 1971 |
| 647 | Ga0395898_0009233 | 3300037466 | Bacteria | 10375 |
| 648 | Ga0395898_0018005 | 3300037466 | Bacteria | 7207 |
| 649 | Ga0436364_1509239 | 3300037853 | Bacteria | 3583 |
| 650 | Ga0395901_0102406 | 3300038443 | Bacteria | 3005 |
| 651 | Ga0436365_0394656 | 3300039437 | Bacteria | 2210 |
| 652 | Ga0436363_1044488 | 3300039450 | Bacteria | 1996 |
| 653 | Ga0439455_0011454 | 3300042012 | Bacteria | 1971 |
| 654 | Ga0439435_0021157 | 3300042436 | Bacteria | 1686 |
| 655 | Ga0451577_0158790 | 3300042876 | Bacteria | 2036 |
| 656 | Ga0453683_0000494 | 3300044673 | Bacteria | 45120 |
| 657 | Ga0466961_0043875 | 3300044693 | Bacteria | 2863 |
| 658 | Ga0466963_0037241 | 3300044694 | Bacteria | 3175 |
| 659 | Ga0466963_0088567 | 3300044694 | Bacteria | 2106 |
| 660 | Ga0466963_0144356 | 3300044694 | Bacteria | 1650 |
| 661 | Ga0466957_0109914 | 3300044842 | Bacteria | 1747 |
| 662 | Ga0451576_0001638 | 3300045051 | Bacteria | 37426 |
| 663 | Ga0451576_0077714 | 3300045051 | Bacteria | 3454 |
| 664 | Ga0495592_0000422 | 3300046454 | Bacteria | 32126 |
| 665 | Ga0495592_0004523 | 3300046454 | Bacteria | 10182 |
| 666 | Ga0495592_0007319 | 3300046454 | Bacteria | 8256 |
| 667 | Ga0495603_0010842 | 3300046455 | Bacteria | 5529 |
| 668 | Ga0495603_0072826 | 3300046455 | Bacteria | 2018 |
| 669 | Ga0495629_0002524 | 3300046459 | Bacteria | 14035 |
| 670 | Ga0495629_0016178 | 3300046459 | Bacteria | 5354 |
| 671 | Ga0495629_0018816 | 3300046459 | Bacteria | 4937 |
| 672 | Ga0495629_0079774 | 3300046459 | Bacteria | 2285 |
| 673 | Ga0495641_0076011 | 3300046461 | Bacteria | 1505 |
| 674 | Ga0495651_0000300 | 3300046462 | Bacteria | 38562 |
| 675 | Ga0495651_0000764 | 3300046462 | Bacteria | 24894 |
| 676 | Ga0495651_0001150 | 3300046462 | Bacteria | 20444 |
| 677 | Ga0495651_0003637 | 3300046462 | Bacteria | 11807 |
| 678 | Ga0495651_0032821 | 3300046462 | Bacteria | 4049 |
| 679 | Ga0495653_0000032 | 3300046463 | Bacteria | 132763 |
| 680 | Ga0495653_0001957 | 3300046463 | Bacteria | 16221 |
| 681 | Ga0495653_0031725 | 3300046463 | Bacteria | 4198 |
| 682 | Ga0495580_0001416 | 3300046472 | Bacteria | 21075 |
| 683 | Ga0495580_0021728 | 3300046472 | Bacteria | 4733 |
| 684 | Ga0495580_0179816 | 3300046472 | Bacteria | 1461 |
| 685 | Ga0495582_0029211 | 3300046473 | Bacteria | 3026 |
| 686 | Ga0495582_0083985 | 3300046473 | Bacteria | 1769 |
| 687 | Ga0495582_0163013 | 3300046473 | Bacteria | 1268 |
| 688 | Ga0495639_0006262 | 3300046475 | Bacteria | 5111 |
| 689 | Ga0495662_0002039 | 3300046476 | Bacteria | 10119 |
| 690 | Ga0495662_0038622 | 3300046476 | Bacteria | 2308 |
| 691 | Ga0495662_0097550 | 3300046476 | Bacteria | 1437 |
| 692 | Ga0495664_0000010 | 3300046477 | Bacteria | 268381 |
| 693 | Ga0495664_0000178 | 3300046477 | Bacteria | 31382 |
| 694 | Ga0495664_0034739 | 3300046477 | Bacteria | 2966 |
| 695 | Ga0495584_0006106 | 3300046491 | Bacteria | 6339 |
| 696 | Ga0495584_0022637 | 3300046491 | Bacteria | 3188 |
| 697 | Ga0495584_0112931 | 3300046491 | Bacteria | 1375 |
| 698 | Ga0495585_0015366 | 3300046492 | Bacteria | 4448 |
| 699 | Ga0495594_0010424 | 3300046499 | Bacteria | 4820 |
| 700 | Ga0495594_0052866 | 3300046499 | Bacteria | 2236 |
| 701 | Ga0495608_0000008 | 3300046511 | Bacteria | 268629 |
| 702 | Ga0495608_0001671 | 3300046511 | Bacteria | 15955 |
| 703 | Ga0495608_0025139 | 3300046511 | Bacteria | 4066 |
| 704 | Ga0495608_0041070 | 3300046511 | Bacteria | 3097 |
| 705 | Ga0495618_0000002 | 3300046514 | Bacteria | 271353 |
| 706 | Ga0495618_0003686 | 3300046514 | Bacteria | 9495 |
| 707 | Ga0495618_0025323 | 3300046514 | Bacteria | 3681 |
| 708 | Ga0495628_0000009 | 3300046516 | Bacteria | 237611 |
| 709 | Ga0495628_0001448 | 3300046516 | Bacteria | 21780 |
| 710 | Ga0495628_0007599 | 3300046516 | Bacteria | 9369 |
| 711 | Ga0495628_0020094 | 3300046516 | Bacteria | 5512 |
| 712 | Ga0495630_0002397 | 3300046517 | Bacteria | 13021 |
| 713 | Ga0495630_0242314 | 3300046517 | Bacteria | 1377 |
| 714 | Ga0495644_0012384 | 3300046523 | Bacteria | 3280 |
| 715 | Ga0495666_0000187 | 3300046526 | Bacteria | 26576 |
| 716 | Ga0495666_0035568 | 3300046526 | Bacteria | 2428 |
| 717 | Ga0495666_0087444 | 3300046526 | Bacteria | 1472 |
| 718 | Ga0495652_0000011 | 3300046529 | Bacteria | 255329 |
| 719 | Ga0495652_0032696 | 3300046529 | Bacteria | 4547 |
| 720 | Ga0495652_0090939 | 3300046529 | Bacteria | 2496 |
| 721 | Ga0495652_0091221 | 3300046529 | Bacteria | 2491 |
| 722 | Ga0495665_0006213 | 3300046531 | Bacteria | 6450 |
| 723 | Ga0495640_0000094 | 3300046533 | Bacteria | 51238 |
| 724 | Ga0495640_0023352 | 3300046533 | Bacteria | 4506 |
| 725 | Ga0495586_0002551 | 3300046535 | Bacteria | 9858 |
| 726 | Ga0495587_0000086 | 3300046536 | Bacteria | 72022 |
| 727 | Ga0495587_0002720 | 3300046536 | Bacteria | 11797 |
| 728 | Ga0495598_0008090 | 3300046537 | Bacteria | 2438 |
| 729 | Ga0495598_0043017 | 3300046537 | Bacteria | 1328 |
| 730 | Ga0495645_0000010 | 3300046543 | Bacteria | 238337 |
| 731 | Ga0495622_0001697 | 3300046557 | Bacteria | 10892 |
| 732 | Ga0495633_0018667 | 3300046558 | Bacteria | 3519 |
| 733 | Ga0495667_0000005 | 3300046559 | Bacteria | 268252 |
| 734 | Ga0495667_0002931 | 3300046559 | Bacteria | 11450 |
| 735 | Ga0495667_0004110 | 3300046559 | Bacteria | 9783 |
| 736 | Ga0495667_0048018 | 3300046559 | Bacteria | 2819 |
| 737 | Ga0495667_0063532 | 3300046559 | Bacteria | 2416 |
| 738 | Ga0495667_0085337 | 3300046559 | Bacteria | 2049 |
| 739 | Ga0495634_0000936 | 3300046642 | Bacteria | 27662 |
| 740 | Ga0495634_0042214 | 3300046642 | Bacteria | 3094 |
| 741 | Ga0495634_0048272 | 3300046642 | Bacteria | 2866 |
| 742 | Ga0495611_0006806 | 3300046648 | Bacteria | 4857 |
| 743 | Ga0495635_0000008 | 3300046663 | Bacteria | 268349 |
| 744 | Ga0495635_0001359 | 3300046663 | Bacteria | 16270 |
| 745 | Ga0495635_0011040 | 3300046663 | Bacteria | 6333 |
| 746 | Ga0495635_0123563 | 3300046663 | Bacteria | 1765 |
| 747 | Ga0495659_0005492 | 3300046664 | Bacteria | 3987 |
| 748 | Ga0495659_0006098 | 3300046664 | Bacteria | 3810 |
| 749 | Ga0495588_0001695 | 3300046674 | Bacteria | 9374 |
| 750 | Ga0495657_0000296 | 3300046675 | Bacteria | 45380 |
| 751 | Ga0495657_0003184 | 3300046675 | Bacteria | 13516 |
| 752 | Ga0495657_0027472 | 3300046675 | Bacteria | 4015 |
| 753 | Ga0495599_0000007 | 3300046678 | Bacteria | 236638 |
| 754 | Ga0495599_0000806 | 3300046678 | Bacteria | 17617 |
| 755 | Ga0495599_0085910 | 3300046678 | Bacteria | 1964 |
| 756 | Ga0495623_0000085 | 3300046679 | Bacteria | 55527 |
| 757 | Ga0495623_0010359 | 3300046679 | Bacteria | 6036 |
| 758 | Ga0495623_0015361 | 3300046679 | Bacteria | 4948 |
| 759 | Ga0495646_0000021 | 3300046680 | Bacteria | 115358 |
| 760 | Ga0495646_0033722 | 3300046680 | Bacteria | 3182 |
| 761 | Ga0495647_0000638 | 3300046681 | Bacteria | 10362 |
| 762 | Ga0495647_0036177 | 3300046681 | Bacteria | 1857 |
| 763 | Ga0495658_0004284 | 3300046683 | Bacteria | 7024 |
| 764 | Ga0495658_0035163 | 3300046683 | Bacteria | 2754 |
| 765 | Ga0495613_0012243 | 3300046689 | Bacteria | 6376 |
| 766 | Ga0495613_0023597 | 3300046689 | Bacteria | 4584 |
| 767 | Ga0495613_0057153 | 3300046689 | Bacteria | 2864 |
| 768 | Ga0495624_0015494 | 3300046690 | Bacteria | 5144 |
| 769 | Ga0495624_0109220 | 3300046690 | Bacteria | 1701 |
| 770 | Ga0495600_0000001 | 3300046809 | Bacteria | 214870 |
| 771 | Ga0495600_0001998 | 3300046809 | Bacteria | 11466 |
| 772 | Ga0495600_0006193 | 3300046809 | Bacteria | 7256 |
| 773 | Ga0495600_0006357 | 3300046809 | Bacteria | 7187 |
| 774 | Ga0495581_0014671 | 3300047315 | Bacteria | 4543 |
| 775 | Ga0495581_0039846 | 3300047315 | Bacteria | 2720 |
| 776 | Ga0495604_0000012 | 3300047317 | Bacteria | 268341 |
| 777 | Ga0495604_0001423 | 3300047317 | Bacteria | 19641 |
| 778 | Ga0495604_0005209 | 3300047317 | Bacteria | 10301 |
| 779 | Ga0495604_0016854 | 3300047317 | Bacteria | 5844 |
| 780 | Ga0495604_0023581 | 3300047317 | Bacteria | 4909 |
| 781 | Ga0495604_0039078 | 3300047317 | Bacteria | 3731 |
| 782 | Ga0495604_0094830 | 3300047317 | Bacteria | 2205 |
| 783 | Ga0495636_0057011 | 3300047318 | Bacteria | 1645 |
| 784 | Ga0495674_0000011 | 3300047319 | Bacteria | 270911 |
| 785 | Ga0495674_0042009 | 3300047319 | Bacteria | 4081 |
| 786 | Ga0495674_0081140 | 3300047319 | Bacteria | 2782 |
| 787 | Ga0495674_0209301 | 3300047319 | Bacteria | 1616 |
| 788 | Ga0495676_0011575 | 3300047321 | Bacteria | 7958 |
| 789 | Ga0495676_0098773 | 3300047321 | Bacteria | 2165 |
| 790 | Ga0495680_0000245 | 3300047322 | Bacteria | 59987 |
| 791 | Ga0495680_0001491 | 3300047322 | Bacteria | 25179 |
| 792 | Ga0495680_0007295 | 3300047322 | Bacteria | 10175 |
| 793 | Ga0495680_0013705 | 3300047322 | Bacteria | 7058 |
| 794 | Ga0495680_0028576 | 3300047322 | Bacteria | 4571 |
| 795 | Ga0495680_0032027 | 3300047322 | Bacteria | 4272 |
| 796 | Ga0495680_0209411 | 3300047322 | Bacteria | 1396 |
| 797 | Ga0495675_0000657 | 3300047444 | Bacteria | 21846 |
| 798 | Ga0495677_0080450 | 3300047445 | Bacteria | 1221 |
| 799 | Ga0495679_031124 | 3300047446 | Bacteria | 1724 |
| 800 | Ga0495685_027707 | 3300047447 | Bacteria | 1949 |
| 801 | Ga0495684_0000084 | 3300047471 | Bacteria | 65600 |
| 802 | Ga0495684_0000711 | 3300047471 | Bacteria | 26762 |
| 803 | Ga0495684_0040689 | 3300047471 | Bacteria | 3563 |
| 804 | Ga0495684_0072546 | 3300047471 | Bacteria | 2616 |
| 805 | Ga0495593_0000309 | 3300047673 | Bacteria | 26737 |
| 806 | Ga0495593_0018863 | 3300047673 | Bacteria | 3871 |
| 807 | Ga0495593_0036157 | 3300047673 | Bacteria | 2679 |
| 808 | Ga0495602_0000073 | 3300048088 | Bacteria | 98745 |
| 809 | Ga0495602_0029432 | 3300048088 | Bacteria | 5229 |
| 810 | Ga0495602_0202511 | 3300048088 | Bacteria | 1513 |
| 811 | Ga0495614_0003292 | 3300048089 | Bacteria | 7220 |
| 812 | Ga0495614_0033747 | 3300048089 | Bacteria | 2201 |
| 813 | Ga0496100_0000203 | 3300048903 | Bacteria | 32744 |
| 814 | Ga0496100_0016419 | 3300048903 | Bacteria | 4348 |
| 815 | Ga0496100_0033208 | 3300048903 | Bacteria | 3227 |
| 816 | Ga0496100_0072383 | 3300048903 | Bacteria | 2304 |
| 817 | Ga0496101_0002812 | 3300048904 | Bacteria | 10691 |
| 818 | Ga0496101_0013528 | 3300048904 | Bacteria | 5470 |
| 819 | Ga0496102_0000871 | 3300048905 | Bacteria | 28857 |
| 820 | Ga0496102_0004838 | 3300048905 | Bacteria | 11387 |
| 821 | Ga0496102_0006598 | 3300048905 | Bacteria | 9912 |
| 822 | Ga0496102_0051348 | 3300048905 | Bacteria | 3757 |
| 823 | Ga0496102_0106206 | 3300048905 | Bacteria | 2613 |
| 824 | Ga0496102_0118468 | 3300048905 | Bacteria | 2471 |
| 825 | Ga0496103_0001365 | 3300048906 | Bacteria | 16458 |
| 826 | Ga0496103_0001529 | 3300048906 | Bacteria | 15450 |
| 827 | Ga0496103_0002881 | 3300048906 | Bacteria | 10676 |
| 828 | Ga0496103_0009792 | 3300048906 | Bacteria | 5675 |
| 829 | Ga0496104_0000317 | 3300048907 | Bacteria | 42918 |
| 830 | Ga0496104_0000709 | 3300048907 | Bacteria | 28655 |
| 831 | Ga0496104_0000873 | 3300048907 | Bacteria | 25934 |
| 832 | Ga0496104_0026931 | 3300048907 | Bacteria | 5315 |
| 833 | Ga0496104_0050532 | 3300048907 | Bacteria | 3922 |
| 834 | Ga0496104_0063751 | 3300048907 | Bacteria | 3496 |
| 835 | Ga0496104_0099435 | 3300048907 | Bacteria | 2785 |
| 836 | Ga0496104_0110898 | 3300048907 | Bacteria | 2630 |
| 837 | Ga0496105_0000485 | 3300048908 | Bacteria | 26121 |
| 838 | Ga0496105_0000514 | 3300048908 | Bacteria | 25562 |
| 839 | Ga0496105_0070606 | 3300048908 | Bacteria | 2887 |
| 840 | Ga0496105_0118973 | 3300048908 | Bacteria | 2179 |
| 841 | Ga0496105_0124352 | 3300048908 | Bacteria | 2126 |
| 842 | Ga0496105_0178987 | 3300048908 | Bacteria | 1736 |
| 843 | Ga0496106_0002909 | 3300048909 | Bacteria | 12739 |
| 844 | Ga0496106_0035978 | 3300048909 | Bacteria | 3703 |
| 845 | Ga0496106_0037687 | 3300048909 | Bacteria | 3617 |
| 846 | Ga0496106_0065636 | 3300048909 | Bacteria | 2763 |
| 847 | Ga0496106_0086525 | 3300048909 | Bacteria | 2414 |
| 848 | Ga0496106_0146967 | 3300048909 | Bacteria | 1857 |
| 849 | Ga0496107_0000268 | 3300048910 | Bacteria | 27611 |
| 850 | Ga0496107_0002119 | 3300048910 | Bacteria | 12722 |
| 851 | Ga0496107_0027599 | 3300048910 | Bacteria | 4031 |
| 852 | Ga0496107_0046893 | 3300048910 | Bacteria | 3111 |
| 853 | Ga0496107_0053932 | 3300048910 | Bacteria | 2900 |
| 854 | Ga0496107_0126850 | 3300048910 | Bacteria | 1882 |
| 855 | Ga0496108_0010827 | 3300048911 | Bacteria | 7404 |
| 856 | Ga0496108_0012976 | 3300048911 | Bacteria | 6788 |
| 857 | Ga0496108_0019125 | 3300048911 | Bacteria | 5620 |
| 858 | Ga0496108_0089330 | 3300048911 | Bacteria | 2618 |
| 859 | Ga0496108_0263702 | 3300048911 | Bacteria | 1499 |
| 860 | Ga0496109_0000836 | 3300048912 | Bacteria | 25684 |
| 861 | Ga0496109_0006654 | 3300048912 | Bacteria | 9730 |
| 862 | Ga0496109_0033888 | 3300048912 | Bacteria | 4597 |
| 863 | Ga0496109_0074422 | 3300048912 | Bacteria | 3122 |
| 864 | Ga0496109_0118772 | 3300048912 | Bacteria | 2461 |
| 865 | Ga0496110_0001539 | 3300048913 | Bacteria | 16772 |
| 866 | Ga0496110_0006117 | 3300048913 | Bacteria | 9487 |
| 867 | Ga0496110_0016005 | 3300048913 | Bacteria | 6254 |
| 868 | Ga0496110_0035409 | 3300048913 | Bacteria | 4330 |
| 869 | Ga0496111_0000072 | 3300048914 | Bacteria | 41891 |
| 870 | Ga0496111_0000657 | 3300048914 | Bacteria | 18179 |
| 871 | Ga0496111_0092260 | 3300048914 | Bacteria | 2219 |
| 872 | Ga0496111_0114447 | 3300048914 | Bacteria | 1988 |
| 873 | Ga0496111_0256702 | 3300048914 | Bacteria | 1297 |
| 874 | Ga0496112_0000112 | 3300048915 | Bacteria | 50370 |
| 875 | Ga0496112_0028569 | 3300048915 | Bacteria | 5385 |
| 876 | Ga0496112_0032191 | 3300048915 | Bacteria | 5090 |
| 877 | Ga0496112_0115043 | 3300048915 | Bacteria | 2660 |
| 878 | Ga0496113_0000058 | 3300048916 | Bacteria | 47947 |
| 879 | Ga0496113_0004401 | 3300048916 | Bacteria | 8645 |
| 880 | Ga0496113_0050519 | 3300048916 | Bacteria | 3100 |
| 881 | Ga0496113_0060873 | 3300048916 | Bacteria | 2847 |
| 882 | Ga0496114_0019587 | 3300048917 | Bacteria | 5483 |
| 883 | Ga0496114_0021043 | 3300048917 | Bacteria | 5302 |
| 884 | Ga0496114_0075626 | 3300048917 | Bacteria | 2837 |
| 885 | Ga0496114_0115053 | 3300048917 | Bacteria | 2307 |
| 886 | Ga0496114_0190865 | 3300048917 | Bacteria | 1792 |
| 887 | Ga0496115_0015922 | 3300048918 | Bacteria | 5715 |
| 888 | Ga0496121_0094938 | 3300048924 | Bacteria | 2319 |
| 889 | Ga0501032_0052536 | 3300049569 | Bacteria | 2746 |
| 890 | Ga0501032_0108458 | 3300049569 | Bacteria | 1838 |
| 891 | Ga0501033_0054431 | 3300049570 | Bacteria | 2960 |
| 892 | Ga0501034_0001131 | 3300049571 | Bacteria | 37119 |
| 893 | Ga0501034_0020143 | 3300049571 | Bacteria | 6810 |
| 894 | Ga0501034_0117384 | 3300049571 | Unclassified | 2648 |
| 895 | Ga0501037_0050195 | 3300049573 | Bacteria | 3054 |
| 896 | Ga0501038_0069228 | 3300049574 | Bacteria | 2998 |
| 897 | Ga0501038_0079380 | 3300049574 | Bacteria | 2767 |
| 898 | Ga0501041_0137266 | 3300049577 | Bacteria | 1524 |
| 899 | Ga0501042_0013021 | 3300049578 | Bacteria | 5652 |
| 900 | Ga0501042_0094044 | 3300049578 | Bacteria | 2153 |
| 901 | Ga0501042_0131480 | 3300049578 | Bacteria | 1804 |
| 902 | Ga0501046_0040702 | 3300049580 | Bacteria | 3712 |
| 903 | Ga0501046_0105009 | 3300049580 | Bacteria | 2164 |
| 904 | Ga0501047_0042592 | 3300049581 | Bacteria | 4387 |
| 905 | Ga0501047_0181929 | 3300049581 | Bacteria | 1968 |
| 906 | Ga0501070_0015997 | 3300049586 | Bacteria | 6304 |
| 907 | Ga0501070_0035326 | 3300049586 | Bacteria | 4177 |
| 908 | Ga0501070_0221956 | 3300049586 | Bacteria | 1549 |
| 909 | Ga0501072_0026826 | 3300049588 | Bacteria | 4494 |
| 910 | Ga0501072_0064450 | 3300049588 | Bacteria | 2890 |
| 911 | Ga0501074_0173560 | 3300049590 | Bacteria | 1538 |
| 912 | Ga0501075_0036972 | 3300049591 | Bacteria | 3645 |
| 913 | Ga0501075_0087388 | 3300049591 | Bacteria | 2363 |
| 914 | Ga0501075_0098582 | 3300049591 | Bacteria | 2219 |
| 915 | Ga0501076_0006327 | 3300049592 | Bacteria | 8581 |
| 916 | Ga0501076_0194418 | 3300049592 | Bacteria | 1656 |
| 917 | Ga0501076_0239822 | 3300049592 | Bacteria | 1483 |
| 918 | Ga0501077_0005796 | 3300049593 | Bacteria | 7525 |
| 919 | Ga0501077_0009236 | 3300049593 | Bacteria | 6121 |
| 920 | Ga0501077_0023243 | 3300049593 | Bacteria | 3930 |
| 921 | Ga0501077_0121159 | 3300049593 | Bacteria | 1658 |
| 922 | Ga0501079_0045484 | 3300049741 | Bacteria | 3388 |
| 923 | Ga0501079_0074222 | 3300049741 | Bacteria | 2629 |
| 924 | Ga0501079_0090839 | 3300049741 | Bacteria | 2366 |
| 925 | Ga0501081_0003672 | 3300049743 | Bacteria | 9825 |
| 926 | Ga0501081_0021499 | 3300049743 | Bacteria | 4307 |
| 927 | Ga0501081_0035300 | 3300049743 | Bacteria | 3404 |
| 928 | Ga0501081_0042931 | 3300049743 | Bacteria | 3100 |
| 929 | Ga0501081_0043775 | 3300049743 | Bacteria | 3072 |
| 930 | Ga0501035_0080515 | 3300049822 | Bacteria | 2875 |
| 931 | Ga0501044_0071243 | 3300049823 | Bacteria | 3535 |
| 932 | Ga0501045_0128811 | 3300049824 | Bacteria | 1881 |
| 933 | nmdc:mga03683_20430_c1 | 3300050489 | Bacteria | 2541 |
| 934 | nmdc:mga03n38_77818_c1 | 3300050490 | Bacteria | 1551 |
| 935 | nmdc:mga03n38_99201_c1 | 3300050490 | Bacteria | 1402 |
| 936 | nmdc:mga0yw44_35704_c1 | 3300050492 | Bacteria | 2924 |
| 937 | nmdc:mga0k408_173380_c1 | 3300050493 | Bacteria | 1286 |
| 938 | nmdc:mga0k408_80396_c1 | 3300050493 | Bacteria | 1908 |
| 939 | nmdc:mga06z11_51201_c1 | 3300050494 | Bacteria | 2114 |
| 940 | nmdc:mga05p37_17539_c1 | 3300050507 | Bacteria | 8643 |
| 941 | nmdc:mga05p37_32_c1 | 3300050507 | Bacteria | 112982 |
| 942 | nmdc:mga05p37_34120_c1 | 3300050507 | Bacteria | 6233 |
| 943 | nmdc:mga05p37_4606_c1 | 3300050507 | Bacteria | 16121 |
| 944 | nmdc:mga05p37_66833_c1 | 3300050507 | Bacteria | 4422 |
| 945 | nmdc:mga05p37_89534_c1 | 3300050507 | Bacteria | 3793 |
| 946 | nmdc:mga05p37_90816_c1 | 3300050507 | Bacteria | 3764 |
| 947 | nmdc:mga09592_37123_c1 | 3300050508 | Bacteria | 4085 |
| 948 | nmdc:mga09592_6535_c1 | 3300050508 | Bacteria | 9497 |
| 949 | nmdc:mga0qj67_110767_c1 | 3300050509 | Bacteria | 2216 |
| 950 | nmdc:mga0qj67_157763_c1 | 3300050509 | Bacteria | 1842 |
| 951 | nmdc:mga0qj67_168_c1 | 3300050509 | Bacteria | 43793 |
| 952 | nmdc:mga0qj67_29510_c1 | 3300050509 | Bacteria | 4260 |
| 953 | nmdc:mga0qj67_355_c1 | 3300050509 | Bacteria | 31660 |
| 954 | nmdc:mga0qj67_733_c1 | 3300050509 | Bacteria | 22325 |
| 955 | nmdc:mga0qj67_74589_c1 | 3300050509 | Bacteria | 2711 |
| 956 | nmdc:mga06r32_13222_c1 | 3300050510 | Bacteria | 7474 |
| 957 | nmdc:mga06r32_16922_c1 | 3300050510 | Bacteria | 6652 |
| 958 | nmdc:mga06r32_21130_c1 | 3300050510 | Bacteria | 6006 |
| 959 | nmdc:mga06r32_5297_c1 | 3300050510 | Bacteria | 11609 |
| 960 | nmdc:mga06r32_57806_c1 | 3300050510 | Bacteria | 3726 |
| 961 | nmdc:mga06r32_68764_c1 | 3300050510 | Bacteria | 3422 |
| 962 | nmdc:mga06r32_91319_c1 | 3300050510 | Bacteria | 2976 |
| 963 | nmdc:mga08y16_102392_c1 | 3300050511 | Bacteria | 2981 |
| 964 | nmdc:mga08y16_132898_c1 | 3300050511 | Bacteria | 2587 |
| 965 | nmdc:mga08y16_171996_c1 | 3300050511 | Bacteria | 2250 |
| 966 | nmdc:mga08y16_19018_c1 | 3300050511 | Bacteria | 7235 |
| 967 | nmdc:mga08y16_2238_c1 | 3300050511 | Bacteria | 19836 |
| 968 | nmdc:mga08y16_424126_c1 | 3300050511 | Bacteria | 1359 |
| 969 | nmdc:mga08y16_58180_c1 | 3300050511 | Bacteria | 4038 |
| 970 | nmdc:mga08y16_6098_c1 | 3300050511 | Bacteria | 12643 |
| 971 | nmdc:mga0n895_121400_c1 | 3300050512 | Bacteria | 2634 |
| 972 | nmdc:mga0n895_14134_c1 | 3300050512 | Bacteria | 7238 |
| 973 | nmdc:mga0n895_15498_c1 | 3300050512 | Bacteria | 6953 |
| 974 | nmdc:mga0n895_547_c1 | 3300050512 | Bacteria | 25755 |
| 975 | nmdc:mga0n895_55820_c1 | 3300050512 | Bacteria | 3888 |
| 976 | nmdc:mga0n895_77179_c1 | 3300050512 | Bacteria | 3313 |
| 977 | nmdc:mga0n895_79500_c1 | 3300050512 | Bacteria | 3266 |
| 978 | nmdc:mga0n895_8451_c1 | 3300050512 | Bacteria | 8914 |
| 979 | nmdc:mga0n895_88591_c1 | 3300050512 | Bacteria | 3095 |
| 980 | nmdc:mga0n895_91342_c1 | 3300050512 | Bacteria | 3047 |
| 981 | nmdc:mga0rr50_148620_c1 | 3300050513 | Bacteria | 1891 |
| 982 | nmdc:mga0rr50_21144_c1 | 3300050513 | Bacteria | 4436 |
| 983 | nmdc:mga0rr50_73282_c1 | 3300050513 | Bacteria | 2618 |
| 984 | nmdc:mga0rr50_78412_c1 | 3300050513 | Bacteria | 2542 |
| 985 | nmdc:mga08x19_54912_c1 | 3300050514 | Bacteria | 2565 |
| 986 | nmdc:mga08x19_76395_c1 | 3300050514 | Bacteria | 2191 |
| 987 | nmdc:mga0a205_117187_c1 | 3300050515 | Bacteria | 2562 |
| 988 | nmdc:mga0a205_12457_c1 | 3300050515 | Bacteria | 7868 |
| 989 | nmdc:mga0a205_53544_c1 | 3300050515 | Bacteria | 3895 |
| 990 | nmdc:mga0a205_6205_c1 | 3300050515 | Bacteria | 10788 |
| 991 | nmdc:mga0a205_629_c1 | 3300050515 | Bacteria | 28029 |
| 992 | nmdc:mga0a205_71570_c1 | 3300050515 | Bacteria | 3349 |
| 993 | Ga0495601_0000009 | 3300053077 | Bacteria | 270622 |
| 994 | Ga0495601_0000521 | 3300053077 | Bacteria | 20312 |
| 995 | Ga0495601_0014254 | 3300053077 | Bacteria | 4789 |
| 996 | Ga0495601_0031312 | 3300053077 | Bacteria | 3305 |
| 997 | Ga0495601_0073246 | 3300053077 | Bacteria | 2189 |
| 998 | Ga0495601_0077801 | 3300053077 | Bacteria | 2124 |
| 999 | Ga0495612_0000019 | 3300053078 | Bacteria | 137844 |
| 1000 | Ga0495612_0001070 | 3300053078 | Bacteria | 11208 |
| 1001 | Ga0495612_0002143 | 3300053078 | Bacteria | 8120 |
| 1002 | Ga0495612_0008371 | 3300053078 | Bacteria | 4195 |
| 1003 | Ga0495595_0000015 | 3300053084 | Bacteria | 144946 |
| 1004 | Ga0495595_0001827 | 3300053084 | Bacteria | 8280 |
| 1005 | Ga0495595_0002555 | 3300053084 | Bacteria | 7144 |
| 1006 | Ga0495595_0013740 | 3300053084 | Bacteria | 3424 |
| 1007 | Ga0495619_0000012 | 3300053085 | Bacteria | 268349 |
| 1008 | Ga0495619_0000016 | 3300053085 | Bacteria | 231442 |
| 1009 | Ga0495619_0000670 | 3300053085 | Bacteria | 22463 |
| 1010 | Ga0495619_0002830 | 3300053085 | Bacteria | 11300 |
| 1011 | Ga0495619_0022668 | 3300053085 | Bacteria | 4021 |
| 1012 | Ga0495619_0078577 | 3300053085 | Bacteria | 2218 |
| 1013 | Ga0500644_0001393 | 3300053088 | Bacteria | 6442 |
| 1014 | Ga0500641_0004145 | 3300053096 | Bacteria | 5119 |
| 1015 | Ga0500595_000010 | 3300053119 | Bacteria | 275806 |
| 1016 | Ga0500595_039632 | 3300053119 | Bacteria | 1523 |
| 1017 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 1018 | Ga0500645_000051 | 3300053730 | Bacteria | 98521 |
| 1019 | Ga0501084_0009054 | 3300054114 | Bacteria | 8236 |
| 1020 | Ga0501082_0044681 | 3300060353 | Bacteria | 3821 |
| 1021 | Ga0501082_0046745 | 3300060353 | Bacteria | 3730 |
| 1022 | Ga0501082_0164976 | 3300060353 | Bacteria | 1925 |
| 1023 | Ga0530510_0055169 | 3300061734 | Bacteria | 2871 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035172 | Ga0373955_0049790 | Ga0373955_0049790_1134_2252 | 372 |
| 2 | 3300044694 | Ga0466963_0144356 | Ga0466963_0144356_506_1624 | 372 |
| 3 | 3300005457 | Ga0070662_100204883 | Ga0070662_1002048831 | 373 |
| 4 | 3300035725 | Ga0373947_0008074 | Ga0373947_0008074_4916_6037 | 373 |
| 5 | 3300046461 | Ga0495641_0076011 | Ga0495641_0076011_13_1134 | 373 |
| 6 | 3300046517 | Ga0495630_0242314 | Ga0495630_0242314_13_1134 | 373 |
| 7 | 3300046529 | Ga0495652_0091221 | Ga0495652_0091221_1358_2479 | 373 |
| 8 | 3300047445 | Ga0495677_0080450 | Ga0495677_0080450_20_1141 | 373 |
| 9 | 3300047471 | Ga0495684_0000711 | Ga0495684_0000711_25629_26750 | 373 |
| 10 | 3300060353 | Ga0501082_0164976 | Ga0501082_0164976_50_1171 | 373 |
| 11 | 3300005983 | Ga0081540_1002311 | Ga0081540_10023112 | 374 |
| 12 | 3300048905 | Ga0496102_0106206 | Ga0496102_0106206_855_2084 | 381 |
| 13 | 3300048914 | Ga0496111_0256702 | Ga0496111_0256702_36_1265 | 381 |
| 14 | 3300046491 | Ga0495584_0112931 | Ga0495584_0112931_85_1314 | 386 |
| 15 | 3300035695 | Ga0373927_0030075 | Ga0373927_0030075_1917_3164 | 391 |
| 16 | 3300005843 | Ga0068860_100188969 | Ga0068860_1001889692 | 394 |
| 17 | 3300026088 | Ga0207641_10276984 | Ga0207641_102769842 | 394 |
| 18 | 3300028381 | Ga0268264_10159119 | Ga0268264_101591192 | 394 |
| 19 | 3300048907 | Ga0496104_0099435 | Ga0496104_0099435_823_2052 | 394 |
| 20 | 3300048908 | Ga0496105_0118973 | Ga0496105_0118973_89_1318 | 394 |
| 21 | 3300005983 | Ga0081540_1014938 | Ga0081540_10149382 | 397 |
| 22 | 3300003911 | JGI25405J52794_10009788 | JGI25405J52794_100097881 | 398 |
| 23 | 3300005937 | Ga0081455_10004480 | Ga0081455_100044807 | 398 |
| 24 | 3300006847 | Ga0075431_100098881 | Ga0075431_1000988813 | 398 |
| 25 | 3300035170 | Ga0373943_0050497 | Ga0373943_0050497_29_1225 | 398 |
| 26 | 3300046462 | Ga0495651_0032821 | Ga0495651_0032821_563_1759 | 398 |
| 27 | 3300047322 | Ga0495680_0028576 | Ga0495680_0028576_1850_3046 | 398 |
| 28 | 3300050490 | nmdc:mga03n38_99201_c1 | nmdc:mga03n38_99201_c1_186_1382 | 398 |
| 29 | 3300005338 | Ga0068868_100087923 | Ga0068868_1000879232 | 399 |
| 30 | 3300005339 | Ga0070660_100001014 | Ga0070660_1000010141 | 399 |
| 31 | 3300009098 | Ga0105245_10045266 | Ga0105245_100452662 | 399 |
| 32 | 3300009176 | Ga0105242_10177574 | Ga0105242_101775741 | 399 |
| 33 | 3300025929 | Ga0207664_10137780 | Ga0207664_101377802 | 399 |
| 34 | 3300026023 | Ga0207677_10033362 | Ga0207677_100333622 | 399 |
| 35 | 3300044693 | Ga0466961_0043875 | Ga0466961_0043875_1636_2835 | 399 |
| 36 | 3300046472 | Ga0495580_0179816 | Ga0495580_0179816_99_1346 | 399 |
| 37 | 3300048914 | Ga0496111_0092260 | Ga0496111_0092260_18_1217 | 399 |
| 38 | 3300050490 | nmdc:mga03n38_77818_c1 | nmdc:mga03n38_77818_c1_16_1215 | 399 |
| 39 | 3300050512 | nmdc:mga0n895_79500_c1 | nmdc:mga0n895_79500_c1_2034_3233 | 399 |
| 40 | 3300053077 | Ga0495601_0073246 | Ga0495601_0073246_978_2177 | 399 |
| 41 | 3300007265 | Ga0099794_10014325 | Ga0099794_100143253 | 400 |
| 42 | 3300009094 | Ga0111539_10064307 | Ga0111539_100643075 | 400 |
| 43 | 3300009098 | Ga0105245_10175167 | Ga0105245_101751672 | 400 |
| 44 | 3300009148 | Ga0105243_10176009 | Ga0105243_101760092 | 400 |
| 45 | 3300009176 | Ga0105242_10078215 | Ga0105242_100782152 | 400 |
| 46 | 3300013308 | Ga0157375_10110039 | Ga0157375_101100392 | 400 |
| 47 | 3300025981 | Ga0207640_10015424 | Ga0207640_100154246 | 400 |
| 48 | 3300046473 | Ga0495582_0163013 | Ga0495582_0163013_46_1248 | 400 |
| 49 | 3300048910 | Ga0496107_0027599 | Ga0496107_0027599_15_1217 | 400 |
| 50 | 3300048911 | Ga0496108_0089330 | Ga0496108_0089330_957_2159 | 400 |
| 51 | 3300048914 | Ga0496111_0114447 | Ga0496111_0114447_373_1575 | 400 |
| 52 | 3300048915 | Ga0496112_0115043 | Ga0496112_0115043_971_2173 | 400 |
| 53 | 3300050511 | nmdc:mga08y16_102392_c1 | nmdc:mga08y16_102392_c1_387_1631 | 400 |
| 54 | 3300053077 | Ga0495601_0077801 | Ga0495601_0077801_22_1224 | 400 |
| 55 | 3300006028 | Ga0070717_10080835 | Ga0070717_100808351 | 401 |
| 56 | 3300005467 | Ga0070706_100040997 | Ga0070706_1000409975 | 402 |
| 57 | 3300006846 | Ga0075430_100000015 | Ga0075430_10000001545 | 402 |
| 58 | 3300006852 | Ga0075433_10008464 | Ga0075433_100084643 | 402 |
| 59 | 3300006871 | Ga0075434_100090220 | Ga0075434_1000902202 | 402 |
| 60 | 3300009094 | Ga0111539_10058878 | Ga0111539_100588782 | 402 |
| 61 | 3300009147 | Ga0114129_10027223 | Ga0114129_100272232 | 402 |
| 62 | 3300025910 | Ga0207684_10023396 | Ga0207684_100233965 | 402 |
| 63 | 3300050509 | nmdc:mga0qj67_168_c1 | nmdc:mga0qj67_168_c1_484_1713 | 402 |
| 64 | 3300050511 | nmdc:mga08y16_132898_c1 | nmdc:mga08y16_132898_c1_471_1700 | 402 |
| 65 | 3300050512 | nmdc:mga0n895_14134_c1 | nmdc:mga0n895_14134_c1_3947_5176 | 402 |
| 66 | 3300050515 | nmdc:mga0a205_12457_c1 | nmdc:mga0a205_12457_c1_5497_6726 | 402 |
| 67 | 3300002239 | JGI24034J26672_10005798 | JGI24034J26672_100057982 | 403 |
| 68 | 3300005981 | Ga0081538_10070167 | Ga0081538_100701671 | 404 |
| 69 | 3300006844 | Ga0075428_100157176 | Ga0075428_1001571761 | 404 |
| 70 | 3300006846 | Ga0075430_100002472 | Ga0075430_1000024723 | 404 |
| 71 | 3300006846 | Ga0075430_100031115 | Ga0075430_1000311154 | 404 |
| 72 | 3300006847 | Ga0075431_100018201 | Ga0075431_1000182018 | 404 |
| 73 | 3300006880 | Ga0075429_100021829 | Ga0075429_1000218292 | 404 |
| 74 | 3300006880 | Ga0075429_100250984 | Ga0075429_1002509841 | 404 |
| 75 | 3300006914 | Ga0075436_100143097 | Ga0075436_1001430971 | 404 |
| 76 | 3300007076 | Ga0075435_100065898 | Ga0075435_1000658983 | 404 |
| 77 | 3300050507 | nmdc:mga05p37_66833_c1 | nmdc:mga05p37_66833_c1_2366_3601 | 404 |
| 78 | 3300050507 | nmdc:mga05p37_89534_c1 | nmdc:mga05p37_89534_c1_1342_2583 | 404 |
| 79 | 3300050508 | nmdc:mga09592_37123_c1 | nmdc:mga09592_37123_c1_2508_3752 | 404 |
| 80 | 3300050510 | nmdc:mga06r32_91319_c1 | nmdc:mga06r32_91319_c1_1308_2552 | 404 |
| 81 | 3300050513 | nmdc:mga0rr50_21144_c1 | nmdc:mga0rr50_21144_c1_2864_4105 | 404 |
| 82 | 3300050515 | nmdc:mga0a205_117187_c1 | nmdc:mga0a205_117187_c1_586_1827 | 404 |
| 83 | 3300025939 | Ga0207665_10074219 | Ga0207665_100742192 | 405 |
| 84 | 3300049822 | Ga0501035_0080515 | Ga0501035_0080515_118_1461 | 405 |
| 85 | 3300005518 | Ga0070699_100073539 | Ga0070699_1000735392 | 406 |
| 86 | 3300005937 | Ga0081455_10006602 | Ga0081455_100066024 | 406 |
| 87 | 3300005981 | Ga0081538_10051140 | Ga0081538_100511404 | 406 |
| 88 | 3300005983 | Ga0081540_1021121 | Ga0081540_10211212 | 406 |
| 89 | 3300009147 | Ga0114129_10330175 | Ga0114129_103301752 | 406 |
| 90 | 3300025922 | Ga0207646_10057861 | Ga0207646_100578612 | 406 |
| 91 | 3300046664 | Ga0495659_0006098 | Ga0495659_0006098_48_1292 | 406 |
| 92 | 3300049569 | Ga0501032_0052536 | Ga0501032_0052536_839_2059 | 406 |
| 93 | 3300049573 | Ga0501037_0050195 | Ga0501037_0050195_525_1745 | 406 |
| 94 | 3300049580 | Ga0501046_0105009 | Ga0501046_0105009_564_1784 | 406 |
| 95 | 3300049581 | Ga0501047_0042592 | Ga0501047_0042592_1126_2346 | 406 |
| 96 | 3300049588 | Ga0501072_0064450 | Ga0501072_0064450_972_2192 | 406 |
| 97 | 3300049590 | Ga0501074_0173560 | Ga0501074_0173560_308_1528 | 406 |
| 98 | 3300049592 | Ga0501076_0239822 | Ga0501076_0239822_206_1426 | 406 |
| 99 | 3300049741 | Ga0501079_0090839 | Ga0501079_0090839_832_2052 | 406 |
| 100 | 3300049743 | Ga0501081_0043775 | Ga0501081_0043775_93_1313 | 406 |
| 101 | 3300050510 | nmdc:mga06r32_16922_c1 | nmdc:mga06r32_16922_c1_4505_5725 | 406 |
| 102 | 3300060353 | Ga0501082_0046745 | Ga0501082_0046745_1837_3057 | 406 |
| 103 | 3300061734 | Ga0530510_0055169 | Ga0530510_0055169_876_2096 | 406 |
| 104 | 3300005356 | Ga0070674_100013342 | Ga0070674_1000133424 | 407 |
| 105 | 3300005617 | Ga0068859_100075191 | Ga0068859_1000751912 | 407 |
| 106 | 3300005618 | Ga0068864_100105666 | Ga0068864_1001056663 | 407 |
| 107 | 3300006177 | Ga0075362_10026782 | Ga0075362_100267823 | 407 |
| 108 | 3300006178 | Ga0075367_10010139 | Ga0075367_100101393 | 407 |
| 109 | 3300006186 | Ga0075369_10017707 | Ga0075369_100177072 | 407 |
| 110 | 3300006195 | Ga0075366_10021275 | Ga0075366_100212753 | 407 |
| 111 | 3300006353 | Ga0075370_10072975 | Ga0075370_100729751 | 407 |
| 112 | 3300006931 | Ga0097620_100075191 | Ga0097620_1000751914 | 407 |
| 113 | 3300009101 | Ga0105247_10042379 | Ga0105247_100423791 | 407 |
| 114 | 3300009148 | Ga0105243_10184399 | Ga0105243_101843992 | 407 |
| 115 | 3300013297 | Ga0157378_10150135 | Ga0157378_101501351 | 407 |
| 116 | 3300025893 | Ga0207682_10008138 | Ga0207682_100081383 | 407 |
| 117 | 3300025907 | Ga0207645_10030390 | Ga0207645_100303902 | 407 |
| 118 | 3300025925 | Ga0207650_10105022 | Ga0207650_101050222 | 407 |
| 119 | 3300025934 | Ga0207686_10210075 | Ga0207686_102100751 | 407 |
| 120 | 3300025935 | Ga0207709_10067541 | Ga0207709_100675411 | 407 |
| 121 | 3300025942 | Ga0207689_10117472 | Ga0207689_101174722 | 407 |
| 122 | 3300026121 | Ga0207683_10047844 | Ga0207683_100478442 | 407 |
| 123 | 3300031250 | Ga0265331_10075347 | Ga0265331_100753472 | 407 |
| 124 | 3300031711 | Ga0265314_10118885 | Ga0265314_101188851 | 407 |
| 125 | 3300031712 | Ga0265342_10081644 | Ga0265342_100816442 | 407 |
| 126 | 3300046537 | Ga0495598_0043017 | Ga0495598_0043017_68_1291 | 407 |
| 127 | 3300047447 | Ga0495685_027707 | Ga0495685_027707_70_1299 | 407 |
| 128 | 3300048907 | Ga0496104_0000709 | Ga0496104_0000709_824_2047 | 407 |
| 129 | 3300048907 | Ga0496104_0110898 | Ga0496104_0110898_146_1369 | 407 |
| 130 | 3300048908 | Ga0496105_0070606 | Ga0496105_0070606_415_1638 | 407 |
| 131 | 3300048911 | Ga0496108_0263702 | Ga0496108_0263702_198_1421 | 407 |
| 132 | 3300048912 | Ga0496109_0033888 | Ga0496109_0033888_737_1960 | 407 |
| 133 | 3300048917 | Ga0496114_0075626 | Ga0496114_0075626_52_1275 | 407 |
| 134 | 3300048918 | Ga0496115_0015922 | Ga0496115_0015922_1412_2635 | 407 |
| 135 | 3300050489 | nmdc:mga03683_20430_c1 | nmdc:mga03683_20430_c1_783_2006 | 407 |
| 136 | 3300050492 | nmdc:mga0yw44_35704_c1 | nmdc:mga0yw44_35704_c1_619_1842 | 407 |
| 137 | 3300050493 | nmdc:mga0k408_173380_c1 | nmdc:mga0k408_173380_c1_12_1235 | 407 |
| 138 | 3300050493 | nmdc:mga0k408_80396_c1 | nmdc:mga0k408_80396_c1_640_1863 | 407 |
| 139 | 3300050494 | nmdc:mga06z11_51201_c1 | nmdc:mga06z11_51201_c1_545_1768 | 407 |
| 140 | 3300001977 | JGI24746J21847_1003854 | JGI24746J21847_10038542 | 408 |
| 141 | 3300001990 | JGI24737J22298_10023198 | JGI24737J22298_100231982 | 408 |
| 142 | 3300001991 | JGI24743J22301_10003718 | JGI24743J22301_100037182 | 408 |
| 143 | 3300002070 | JGI24750J21931_1002146 | JGI24750J21931_10021462 | 408 |
| 144 | 3300002073 | JGI24745J21846_1001132 | JGI24745J21846_10011322 | 408 |
| 145 | 3300002077 | JGI24744J21845_10000132 | JGI24744J21845_100001329 | 408 |
| 146 | 3300002239 | JGI24034J26672_10002921 | JGI24034J26672_100029212 | 408 |
| 147 | 3300005331 | Ga0070670_100005524 | Ga0070670_1000055246 | 408 |
| 148 | 3300005331 | Ga0070670_100138127 | Ga0070670_1001381272 | 408 |
| 149 | 3300005339 | Ga0070660_100116389 | Ga0070660_1001163891 | 408 |
| 150 | 3300005340 | Ga0070689_100114941 | Ga0070689_1001149412 | 408 |
| 151 | 3300005343 | Ga0070687_100112257 | Ga0070687_1001122572 | 408 |
| 152 | 3300005354 | Ga0070675_100014864 | Ga0070675_1000148643 | 408 |
| 153 | 3300005355 | Ga0070671_100094737 | Ga0070671_1000947373 | 408 |
| 154 | 3300005356 | Ga0070674_100013446 | Ga0070674_1000134463 | 408 |
| 155 | 3300005365 | Ga0070688_100049110 | Ga0070688_1000491102 | 408 |
| 156 | 3300005367 | Ga0070667_100005456 | Ga0070667_1000054568 | 408 |
| 157 | 3300005441 | Ga0070700_100009080 | Ga0070700_1000090803 | 408 |
| 158 | 3300005455 | Ga0070663_100015442 | Ga0070663_1000154423 | 408 |
| 159 | 3300005457 | Ga0070662_100028585 | Ga0070662_1000285853 | 408 |
| 160 | 3300005458 | Ga0070681_10019315 | Ga0070681_100193153 | 408 |
| 161 | 3300005466 | Ga0070685_10040164 | Ga0070685_100401643 | 408 |
| 162 | 3300005535 | Ga0070684_100118724 | Ga0070684_1001187242 | 408 |
| 163 | 3300005543 | Ga0070672_100068241 | Ga0070672_1000682412 | 408 |
| 164 | 3300005544 | Ga0070686_100008725 | Ga0070686_1000087253 | 408 |
| 165 | 3300005564 | Ga0070664_100058640 | Ga0070664_1000586402 | 408 |
| 166 | 3300005577 | Ga0068857_100131016 | Ga0068857_1001310162 | 408 |
| 167 | 3300005840 | Ga0068870_10072506 | Ga0068870_100725062 | 408 |
| 168 | 3300005843 | Ga0068860_100045880 | Ga0068860_1000458802 | 408 |
| 169 | 3300005844 | Ga0068862_100070320 | Ga0068862_1000703202 | 408 |
| 170 | 3300006038 | Ga0075365_10065661 | Ga0075365_100656612 | 408 |
| 171 | 3300006178 | Ga0075367_10026188 | Ga0075367_100261882 | 408 |
| 172 | 3300006178 | Ga0075367_10068531 | Ga0075367_100685312 | 408 |
| 173 | 3300006844 | Ga0075428_100088746 | Ga0075428_1000887462 | 408 |
| 174 | 3300006871 | Ga0075434_100016655 | Ga0075434_1000166552 | 408 |
| 175 | 3300007265 | Ga0099794_10008099 | Ga0099794_100080991 | 408 |
| 176 | 3300009098 | Ga0105245_10122401 | Ga0105245_101224012 | 408 |
| 177 | 3300009101 | Ga0105247_10042433 | Ga0105247_100424332 | 408 |
| 178 | 3300009147 | Ga0114129_10110393 | Ga0114129_101103933 | 408 |
| 179 | 3300009148 | Ga0105243_10091087 | Ga0105243_100910872 | 408 |
| 180 | 3300009177 | Ga0105248_10002392 | Ga0105248_100023928 | 408 |
| 181 | 3300010375 | Ga0105239_10043450 | Ga0105239_100434505 | 408 |
| 182 | 3300011119 | Ga0105246_10027151 | Ga0105246_100271511 | 408 |
| 183 | 3300013306 | Ga0163162_10177606 | Ga0163162_101776062 | 408 |
| 184 | 3300013308 | Ga0157375_10028268 | Ga0157375_100282684 | 408 |
| 185 | 3300014325 | Ga0163163_10010637 | Ga0163163_100106373 | 408 |
| 186 | 3300014968 | Ga0157379_10033827 | Ga0157379_100338273 | 408 |
| 187 | 3300014969 | Ga0157376_10025542 | Ga0157376_100255423 | 408 |
| 188 | 3300017792 | Ga0163161_10037669 | Ga0163161_100376693 | 408 |
| 189 | 3300025900 | Ga0207710_10022873 | Ga0207710_100228732 | 408 |
| 190 | 3300025901 | Ga0207688_10004951 | Ga0207688_100049512 | 408 |
| 191 | 3300025904 | Ga0207647_10014742 | Ga0207647_100147422 | 408 |
| 192 | 3300025908 | Ga0207643_10007658 | Ga0207643_100076582 | 408 |
| 193 | 3300025916 | Ga0207663_10127598 | Ga0207663_101275982 | 408 |
| 194 | 3300025920 | Ga0207649_10163154 | Ga0207649_101631542 | 408 |
| 195 | 3300025925 | Ga0207650_10006280 | Ga0207650_100062803 | 408 |
| 196 | 3300025926 | Ga0207659_10023639 | Ga0207659_100236392 | 408 |
| 197 | 3300025927 | Ga0207687_10082051 | Ga0207687_100820512 | 408 |
| 198 | 3300025928 | Ga0207700_10032842 | Ga0207700_100328423 | 408 |
| 199 | 3300025933 | Ga0207706_10003979 | Ga0207706_100039793 | 408 |
| 200 | 3300025936 | Ga0207670_10075180 | Ga0207670_100751803 | 408 |
| 201 | 3300025940 | Ga0207691_10006839 | Ga0207691_100068392 | 408 |
| 202 | 3300025941 | Ga0207711_10012455 | Ga0207711_100124552 | 408 |
| 203 | 3300025942 | Ga0207689_10030358 | Ga0207689_100303581 | 408 |
| 204 | 3300025944 | Ga0207661_10049496 | Ga0207661_100494963 | 408 |
| 205 | 3300025945 | Ga0207679_10022285 | Ga0207679_100222852 | 408 |
| 206 | 3300025960 | Ga0207651_10018003 | Ga0207651_100180032 | 408 |
| 207 | 3300025961 | Ga0207712_10065930 | Ga0207712_100659303 | 408 |
| 208 | 3300025972 | Ga0207668_10007588 | Ga0207668_100075885 | 408 |
| 209 | 3300026067 | Ga0207678_10010214 | Ga0207678_100102147 | 408 |
| 210 | 3300026078 | Ga0207702_10106726 | Ga0207702_101067262 | 408 |
| 211 | 3300026088 | Ga0207641_10010400 | Ga0207641_100104002 | 408 |
| 212 | 3300026089 | Ga0207648_10234244 | Ga0207648_102342442 | 408 |
| 213 | 3300026116 | Ga0207674_10139845 | Ga0207674_101398452 | 408 |
| 214 | 3300026118 | Ga0207675_100012148 | Ga0207675_1000121483 | 408 |
| 215 | 3300026121 | Ga0207683_10031288 | Ga0207683_100312883 | 408 |
| 216 | 3300026142 | Ga0207698_10006421 | Ga0207698_100064213 | 408 |
| 217 | 3300028380 | Ga0268265_10017602 | Ga0268265_100176021 | 408 |
| 218 | 3300031344 | Ga0265316_10108022 | Ga0265316_101080221 | 408 |
| 219 | 3300031995 | Ga0307409_100195505 | Ga0307409_1001955052 | 408 |
| 220 | 3300035113 | Ga0373936_0079517 | Ga0373936_0079517_41_1267 | 408 |
| 221 | 3300035118 | Ga0373954_0013490 | Ga0373954_0013490_420_1673 | 408 |
| 222 | 3300042436 | Ga0439435_0021157 | Ga0439435_0021157_45_1271 | 408 |
| 223 | 3300046455 | Ga0495603_0072826 | Ga0495603_0072826_171_1499 | 408 |
| 224 | 3300046472 | Ga0495580_0021728 | Ga0495580_0021728_2712_4040 | 408 |
| 225 | 3300046476 | Ga0495662_0038622 | Ga0495662_0038622_203_1495 | 408 |
| 226 | 3300046476 | Ga0495662_0097550 | Ga0495662_0097550_105_1352 | 408 |
| 227 | 3300046491 | Ga0495584_0006106 | Ga0495584_0006106_594_1820 | 408 |
| 228 | 3300046526 | Ga0495666_0087444 | Ga0495666_0087444_58_1350 | 408 |
| 229 | 3300046690 | Ga0495624_0109220 | Ga0495624_0109220_120_1448 | 408 |
| 230 | 3300047321 | Ga0495676_0098773 | Ga0495676_0098773_332_1564 | 408 |
| 231 | 3300048905 | Ga0496102_0000871 | Ga0496102_0000871_25121_26368 | 408 |
| 232 | 3300048906 | Ga0496103_0001365 | Ga0496103_0001365_3406_4632 | 408 |
| 233 | 3300048906 | Ga0496103_0002881 | Ga0496103_0002881_3294_4541 | 408 |
| 234 | 3300048907 | Ga0496104_0000873 | Ga0496104_0000873_4475_5722 | 408 |
| 235 | 3300048907 | Ga0496104_0050532 | Ga0496104_0050532_1583_2809 | 408 |
| 236 | 3300048908 | Ga0496105_0000514 | Ga0496105_0000514_8024_9271 | 408 |
| 237 | 3300048908 | Ga0496105_0178987 | Ga0496105_0178987_478_1704 | 408 |
| 238 | 3300048909 | Ga0496106_0146967 | Ga0496106_0146967_288_1535 | 408 |
| 239 | 3300048910 | Ga0496107_0002119 | Ga0496107_0002119_4447_5694 | 408 |
| 240 | 3300048910 | Ga0496107_0053932 | Ga0496107_0053932_1498_2724 | 408 |
| 241 | 3300048911 | Ga0496108_0012976 | Ga0496108_0012976_177_1403 | 408 |
| 242 | 3300048911 | Ga0496108_0019125 | Ga0496108_0019125_235_1482 | 408 |
| 243 | 3300048912 | Ga0496109_0000836 | Ga0496109_0000836_5240_6487 | 408 |
| 244 | 3300048912 | Ga0496109_0118772 | Ga0496109_0118772_122_1348 | 408 |
| 245 | 3300048913 | Ga0496110_0001539 | Ga0496110_0001539_7697_8944 | 408 |
| 246 | 3300048913 | Ga0496110_0006117 | Ga0496110_0006117_4430_5656 | 408 |
| 247 | 3300048914 | Ga0496111_0000072 | Ga0496111_0000072_27145_28392 | 408 |
| 248 | 3300048914 | Ga0496111_0000657 | Ga0496111_0000657_15525_16751 | 408 |
| 249 | 3300048915 | Ga0496112_0000112 | Ga0496112_0000112_24642_25889 | 408 |
| 250 | 3300048916 | Ga0496113_0000058 | Ga0496113_0000058_16007_17254 | 408 |
| 251 | 3300048916 | Ga0496113_0050519 | Ga0496113_0050519_934_2160 | 408 |
| 252 | 3300048917 | Ga0496114_0021043 | Ga0496114_0021043_2501_3727 | 408 |
| 253 | 3300050507 | nmdc:mga05p37_4606_c1 | nmdc:mga05p37_4606_c1_5434_6681 | 408 |
| 254 | 3300050512 | nmdc:mga0n895_121400_c1 | nmdc:mga0n895_121400_c1_575_1822 | 408 |
| 255 | 3300050513 | nmdc:mga0rr50_148620_c1 | nmdc:mga0rr50_148620_c1_522_1853 | 408 |
| 256 | 3300053085 | Ga0495619_0078577 | Ga0495619_0078577_355_1602 | 408 |
| 257 | 3300053088 | Ga0500644_0001393 | Ga0500644_0001393_2691_3917 | 408 |
| 258 | 3300053119 | Ga0500595_000010 | Ga0500595_000010_120394_121620 | 408 |
| 259 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_701684_702910 | 408 |
| 260 | 3300053730 | Ga0500645_000051 | Ga0500645_000051_50847_52073 | 408 |
| 261 | 3300006871 | Ga0075434_100060574 | Ga0075434_1000605742 | 409 |
| 262 | 3300028800 | Ga0265338_10030715 | Ga0265338_100307152 | 409 |
| 263 | 3300031238 | Ga0265332_10002169 | Ga0265332_100021699 | 409 |
| 264 | 3300031241 | Ga0265325_10008595 | Ga0265325_100085953 | 409 |
| 265 | 3300031247 | Ga0265340_10039523 | Ga0265340_100395232 | 409 |
| 266 | 3300031249 | Ga0265339_10000091 | Ga0265339_1000009159 | 409 |
| 267 | 3300031249 | Ga0265339_10001994 | Ga0265339_1000199415 | 409 |
| 268 | 3300031595 | Ga0265313_10000260 | Ga0265313_1000026021 | 409 |
| 269 | 3300031712 | Ga0265342_10000175 | Ga0265342_1000017515 | 409 |
| 270 | 3300031712 | Ga0265342_10029297 | Ga0265342_100292972 | 409 |
| 271 | 3300035116 | Ga0373945_0000711 | Ga0373945_0000711_2244_3479 | 409 |
| 272 | 3300035117 | Ga0373953_0000627 | Ga0373953_0000627_557_1792 | 409 |
| 273 | 3300035118 | Ga0373954_0001186 | Ga0373954_0001186_1069_2304 | 409 |
| 274 | 3300035172 | Ga0373955_0000171 | Ga0373955_0000171_4512_5747 | 409 |
| 275 | 3300035410 | Ga0373924_0004372 | Ga0373924_0004372_364_1599 | 409 |
| 276 | 3300035692 | Ga0373935_0000218 | Ga0373935_0000218_19807_21042 | 409 |
| 277 | 3300035695 | Ga0373927_0006149 | Ga0373927_0006149_2667_3902 | 409 |
| 278 | 3300035724 | Ga0373933_0004945 | Ga0373933_0004945_1228_2463 | 409 |
| 279 | 3300035725 | Ga0373947_0000364 | Ga0373947_0000364_18032_19267 | 409 |
| 280 | 3300036401 | Ga0373937_0000009 | Ga0373937_0000009_39709_40944 | 409 |
| 281 | 3300044694 | Ga0466963_0037241 | Ga0466963_0037241_1914_3143 | 409 |
| 282 | 3300044842 | Ga0466957_0109914 | Ga0466957_0109914_344_1573 | 409 |
| 283 | 3300046454 | Ga0495592_0000422 | Ga0495592_0000422_22110_23345 | 409 |
| 284 | 3300046459 | Ga0495629_0018816 | Ga0495629_0018816_3516_4751 | 409 |
| 285 | 3300046462 | Ga0495651_0000300 | Ga0495651_0000300_31212_32447 | 409 |
| 286 | 3300046463 | Ga0495653_0000032 | Ga0495653_0000032_8910_10145 | 409 |
| 287 | 3300046477 | Ga0495664_0000010 | Ga0495664_0000010_227567_228802 | 409 |
| 288 | 3300046511 | Ga0495608_0000008 | Ga0495608_0000008_39847_41082 | 409 |
| 289 | 3300046514 | Ga0495618_0000002 | Ga0495618_0000002_229840_231075 | 409 |
| 290 | 3300046516 | Ga0495628_0000009 | Ga0495628_0000009_227595_228830 | 409 |
| 291 | 3300046517 | Ga0495630_0002397 | Ga0495630_0002397_211_1446 | 409 |
| 292 | 3300046529 | Ga0495652_0000011 | Ga0495652_0000011_39537_40772 | 409 |
| 293 | 3300046533 | Ga0495640_0000094 | Ga0495640_0000094_39537_40772 | 409 |
| 294 | 3300046536 | Ga0495587_0000086 | Ga0495587_0000086_31258_32493 | 409 |
| 295 | 3300046543 | Ga0495645_0000010 | Ga0495645_0000010_8910_10145 | 409 |
| 296 | 3300046559 | Ga0495667_0000005 | Ga0495667_0000005_227595_228830 | 409 |
| 297 | 3300046642 | Ga0495634_0000936 | Ga0495634_0000936_22849_24084 | 409 |
| 298 | 3300046663 | Ga0495635_0000008 | Ga0495635_0000008_39520_40755 | 409 |
| 299 | 3300046675 | Ga0495657_0000296 | Ga0495657_0000296_39650_40885 | 409 |
| 300 | 3300046678 | Ga0495599_0000007 | Ga0495599_0000007_39537_40772 | 409 |
| 301 | 3300046679 | Ga0495623_0000085 | Ga0495623_0000085_48667_49902 | 409 |
| 302 | 3300046680 | Ga0495646_0000021 | Ga0495646_0000021_39492_40727 | 409 |
| 303 | 3300046689 | Ga0495613_0023597 | Ga0495613_0023597_1700_2935 | 409 |
| 304 | 3300046809 | Ga0495600_0000001 | Ga0495600_0000001_39537_40772 | 409 |
| 305 | 3300047317 | Ga0495604_0000012 | Ga0495604_0000012_227582_228817 | 409 |
| 306 | 3300047319 | Ga0495674_0000011 | Ga0495674_0000011_229868_231103 | 409 |
| 307 | 3300047322 | Ga0495680_0000245 | Ga0495680_0000245_31286_32521 | 409 |
| 308 | 3300047471 | Ga0495684_0000084 | Ga0495684_0000084_55456_56691 | 409 |
| 309 | 3300047471 | Ga0495684_0040689 | Ga0495684_0040689_1128_2375 | 409 |
| 310 | 3300048088 | Ga0495602_0000073 | Ga0495602_0000073_39520_40755 | 409 |
| 311 | 3300050509 | nmdc:mga0qj67_29510_c1 | nmdc:mga0qj67_29510_c1_2120_3349 | 409 |
| 312 | 3300050512 | nmdc:mga0n895_88591_c1 | nmdc:mga0n895_88591_c1_1222_2457 | 409 |
| 313 | 3300053077 | Ga0495601_0000009 | Ga0495601_0000009_39520_40755 | 409 |
| 314 | 3300053078 | Ga0495612_0000019 | Ga0495612_0000019_97073_98308 | 409 |
| 315 | 3300053084 | Ga0495595_0000015 | Ga0495595_0000015_20775_22010 | 409 |
| 316 | 3300053085 | Ga0495619_0000012 | Ga0495619_0000012_39520_40755 | 409 |
| 317 | 3300053119 | Ga0500595_039632 | Ga0500595_039632_209_1438 | 409 |
| 318 | 3300005327 | Ga0070658_10022611 | Ga0070658_100226113 | 410 |
| 319 | 3300005327 | Ga0070658_10042393 | Ga0070658_100423932 | 410 |
| 320 | 3300005327 | Ga0070658_10145210 | Ga0070658_101452102 | 410 |
| 321 | 3300005336 | Ga0070680_100016120 | Ga0070680_1000161203 | 410 |
| 322 | 3300005336 | Ga0070680_100258243 | Ga0070680_1002582431 | 410 |
| 323 | 3300005339 | Ga0070660_100046044 | Ga0070660_1000460443 | 410 |
| 324 | 3300005339 | Ga0070660_100072432 | Ga0070660_1000724322 | 410 |
| 325 | 3300005435 | Ga0070714_100094014 | Ga0070714_1000940142 | 410 |
| 326 | 3300005458 | Ga0070681_10146679 | Ga0070681_101466792 | 410 |
| 327 | 3300005459 | Ga0068867_100132721 | Ga0068867_1001327211 | 410 |
| 328 | 3300005530 | Ga0070679_100034205 | Ga0070679_1000342054 | 410 |
| 329 | 3300005530 | Ga0070679_100040675 | Ga0070679_1000406754 | 410 |
| 330 | 3300005563 | Ga0068855_100014855 | Ga0068855_1000148557 | 410 |
| 331 | 3300005563 | Ga0068855_100045702 | Ga0068855_1000457024 | 410 |
| 332 | 3300005563 | Ga0068855_100215519 | Ga0068855_1002155192 | 410 |
| 333 | 3300005616 | Ga0068852_100047574 | Ga0068852_1000475743 | 410 |
| 334 | 3300009093 | Ga0105240_10054986 | Ga0105240_100549863 | 410 |
| 335 | 3300009551 | Ga0105238_10060021 | Ga0105238_100600212 | 410 |
| 336 | 3300010159 | Ga0099796_10001372 | Ga0099796_100013722 | 410 |
| 337 | 3300013102 | Ga0157371_10030802 | Ga0157371_100308021 | 410 |
| 338 | 3300025909 | Ga0207705_10024062 | Ga0207705_100240623 | 410 |
| 339 | 3300025912 | Ga0207707_10018671 | Ga0207707_100186713 | 410 |
| 340 | 3300025913 | Ga0207695_10037025 | Ga0207695_100370253 | 410 |
| 341 | 3300025919 | Ga0207657_10091226 | Ga0207657_100912262 | 410 |
| 342 | 3300025919 | Ga0207657_10094982 | Ga0207657_100949822 | 410 |
| 343 | 3300025921 | Ga0207652_10151345 | Ga0207652_101513452 | 410 |
| 344 | 3300025924 | Ga0207694_10035789 | Ga0207694_100357892 | 410 |
| 345 | 3300025929 | Ga0207664_10235823 | Ga0207664_102358232 | 410 |
| 346 | 3300025949 | Ga0207667_10031667 | Ga0207667_100316675 | 410 |
| 347 | 3300025949 | Ga0207667_10043263 | Ga0207667_100432633 | 410 |
| 348 | 3300026142 | Ga0207698_10027888 | Ga0207698_100278884 | 410 |
| 349 | 3300031712 | Ga0265342_10000203 | Ga0265342_1000020317 | 410 |
| 350 | 3300037312 | Ga0395899_0008445 | Ga0395899_0008445_1539_2771 | 410 |
| 351 | 3300037418 | Ga0395900_0085702 | Ga0395900_0085702_1264_2496 | 410 |
| 352 | 3300037418 | Ga0395900_0208999 | Ga0395900_0208999_64_1296 | 410 |
| 353 | 3300037466 | Ga0395898_0009233 | Ga0395898_0009233_170_1402 | 410 |
| 354 | 3300037466 | Ga0395898_0018005 | Ga0395898_0018005_2147_3379 | 410 |
| 355 | 3300038443 | Ga0395901_0102406 | Ga0395901_0102406_1503_2735 | 410 |
| 356 | 3300046529 | Ga0495652_0032696 | Ga0495652_0032696_59_1291 | 410 |
| 357 | 3300046559 | Ga0495667_0048018 | Ga0495667_0048018_754_1986 | 410 |
| 358 | 3300049574 | Ga0501038_0079380 | Ga0501038_0079380_524_1756 | 410 |
| 359 | 3300049578 | Ga0501042_0131480 | Ga0501042_0131480_264_1496 | 410 |
| 360 | 3300049581 | Ga0501047_0181929 | Ga0501047_0181929_331_1563 | 410 |
| 361 | 3300049588 | Ga0501072_0026826 | Ga0501072_0026826_714_1946 | 410 |
| 362 | 3300049591 | Ga0501075_0087388 | Ga0501075_0087388_61_1293 | 410 |
| 363 | 3300049592 | Ga0501076_0194418 | Ga0501076_0194418_410_1642 | 410 |
| 364 | 3300049593 | Ga0501077_0121159 | Ga0501077_0121159_203_1435 | 410 |
| 365 | 3300049743 | Ga0501081_0042931 | Ga0501081_0042931_1534_2766 | 410 |
| 366 | 3300049823 | Ga0501044_0071243 | Ga0501044_0071243_1161_2393 | 410 |
| 367 | 3300053096 | Ga0500641_0004145 | Ga0500641_0004145_101_1333 | 410 |
| 368 | iso_pu_bacteria | 2599185352 | 2600197099 | 410 |
| 369 | iso_pu_bacteria | 2643221557 | 2643804639 | 410 |
| 370 | iso_pu_bacteria | 2643221610 | 2644064002 | 410 |
| 371 | iso_pu_bacteria | 2643221623 | 2644133472 | 410 |
| 372 | iso_pu_bacteria | 2643221668 | 2644375608 | 410 |
| 373 | iso_pu_bacteria | 2643221675 | 2644415834 | 410 |
| 374 | iso_pu_bacteria | 2643221680 | 2644448874 | 410 |
| 375 | iso_pu_bacteria | 2643221726 | 2644686601 | 410 |
| 376 | iso_pu_bacteria | 2989349275 | 2989352684 | 410 |
| 377 | 3300005336 | Ga0070680_100284952 | Ga0070680_1002849521 | 411 |
| 378 | 3300005458 | Ga0070681_10096828 | Ga0070681_100968282 | 411 |
| 379 | 3300005981 | Ga0081538_10007110 | Ga0081538_100071104 | 411 |
| 380 | 3300006871 | Ga0075434_100048636 | Ga0075434_1000486363 | 411 |
| 381 | 3300009147 | Ga0114129_10110227 | Ga0114129_101102273 | 411 |
| 382 | 3300025912 | Ga0207707_10169353 | Ga0207707_101693532 | 411 |
| 383 | 3300027360 | Ga0209969_1000387 | Ga0209969_10003875 | 411 |
| 384 | 3300027543 | Ga0209999_1003848 | Ga0209999_10038483 | 411 |
| 385 | 3300027876 | Ga0209974_10003968 | Ga0209974_100039682 | 411 |
| 386 | 3300031247 | Ga0265340_10009089 | Ga0265340_100090891 | 411 |
| 387 | 3300039437 | Ga0436365_0394656 | Ga0436365_0394656_127_1362 | 411 |
| 388 | 3300044694 | Ga0466963_0088567 | Ga0466963_0088567_145_1449 | 411 |
| 389 | 3300049569 | Ga0501032_0108458 | Ga0501032_0108458_495_1730 | 411 |
| 390 | 3300049570 | Ga0501033_0054431 | Ga0501033_0054431_394_1629 | 411 |
| 391 | 3300049586 | Ga0501070_0015997 | Ga0501070_0015997_4649_5884 | 411 |
| 392 | 3300050511 | nmdc:mga08y16_171996_c1 | nmdc:mga08y16_171996_c1_345_1580 | 411 |
| 393 | 3300050512 | nmdc:mga0n895_55820_c1 | nmdc:mga0n895_55820_c1_1543_2778 | 411 |
| 394 | 3300050515 | nmdc:mga0a205_71570_c1 | nmdc:mga0a205_71570_c1_1231_2466 | 411 |
| 395 | 3300005546 | Ga0070696_100004350 | Ga0070696_10000435010 | 412 |
| 396 | 3300031595 | Ga0265313_10006492 | Ga0265313_100064923 | 412 |
| 397 | 3300046537 | Ga0495598_0008090 | Ga0495598_0008090_940_2178 | 412 |
| 398 | 3300049571 | Ga0501034_0001131 | Ga0501034_0001131_27927_29165 | 412 |
| 399 | 3300005336 | Ga0070680_100076342 | Ga0070680_1000763422 | 413 |
| 400 | 3300005434 | Ga0070709_10033820 | Ga0070709_100338201 | 413 |
| 401 | 3300005435 | Ga0070714_100056156 | Ga0070714_1000561562 | 413 |
| 402 | 3300005436 | Ga0070713_100019401 | Ga0070713_1000194013 | 413 |
| 403 | 3300005436 | Ga0070713_100097676 | Ga0070713_1000976762 | 413 |
| 404 | 3300005437 | Ga0070710_10004588 | Ga0070710_100045882 | 413 |
| 405 | 3300005440 | Ga0070705_100000612 | Ga0070705_10000061224 | 413 |
| 406 | 3300005444 | Ga0070694_100001207 | Ga0070694_10000120713 | 413 |
| 407 | 3300005444 | Ga0070694_100065749 | Ga0070694_1000657492 | 413 |
| 408 | 3300005445 | Ga0070708_100074687 | Ga0070708_1000746872 | 413 |
| 409 | 3300005445 | Ga0070708_100141210 | Ga0070708_1001412102 | 413 |
| 410 | 3300005455 | Ga0070663_100025552 | Ga0070663_1000255523 | 413 |
| 411 | 3300005457 | Ga0070662_100080215 | Ga0070662_1000802153 | 413 |
| 412 | 3300005458 | Ga0070681_10011673 | Ga0070681_100116731 | 413 |
| 413 | 3300005458 | Ga0070681_10244126 | Ga0070681_102441261 | 413 |
| 414 | 3300005468 | Ga0070707_100053998 | Ga0070707_1000539982 | 413 |
| 415 | 3300005468 | Ga0070707_100193638 | Ga0070707_1001936382 | 413 |
| 416 | 3300005471 | Ga0070698_100185928 | Ga0070698_1001859281 | 413 |
| 417 | 3300005518 | Ga0070699_100002532 | Ga0070699_10000253215 | 413 |
| 418 | 3300005530 | Ga0070679_100063861 | Ga0070679_1000638611 | 413 |
| 419 | 3300005536 | Ga0070697_100039102 | Ga0070697_1000391023 | 413 |
| 420 | 3300005536 | Ga0070697_100091058 | Ga0070697_1000910584 | 413 |
| 421 | 3300005545 | Ga0070695_100000054 | Ga0070695_10000005411 | 413 |
| 422 | 3300005545 | Ga0070695_100029614 | Ga0070695_1000296143 | 413 |
| 423 | 3300005546 | Ga0070696_100000931 | Ga0070696_1000009312 | 413 |
| 424 | 3300005549 | Ga0070704_100000180 | Ga0070704_1000001806 | 413 |
| 425 | 3300005617 | Ga0068859_100000494 | Ga0068859_1000004947 | 413 |
| 426 | 3300005618 | Ga0068864_100075630 | Ga0068864_1000756303 | 413 |
| 427 | 3300005719 | Ga0068861_100014951 | Ga0068861_1000149517 | 413 |
| 428 | 3300005843 | Ga0068860_100001274 | Ga0068860_10000127416 | 413 |
| 429 | 3300005844 | Ga0068862_100000795 | Ga0068862_10000079530 | 413 |
| 430 | 3300005937 | Ga0081455_10003542 | Ga0081455_1000354210 | 413 |
| 431 | 3300005937 | Ga0081455_10169619 | Ga0081455_101696191 | 413 |
| 432 | 3300006028 | Ga0070717_10063658 | Ga0070717_100636583 | 413 |
| 433 | 3300006163 | Ga0070715_10014168 | Ga0070715_100141683 | 413 |
| 434 | 3300006173 | Ga0070716_100011064 | Ga0070716_1000110643 | 413 |
| 435 | 3300006844 | Ga0075428_100049877 | Ga0075428_1000498773 | 413 |
| 436 | 3300006846 | Ga0075430_100001098 | Ga0075430_10000109816 | 413 |
| 437 | 3300006847 | Ga0075431_100004759 | Ga0075431_10000475915 | 413 |
| 438 | 3300006847 | Ga0075431_100011228 | Ga0075431_1000112287 | 413 |
| 439 | 3300006871 | Ga0075434_100084707 | Ga0075434_1000847073 | 413 |
| 440 | 3300006931 | Ga0097620_100000494 | Ga0097620_1000004947 | 413 |
| 441 | 3300007265 | Ga0099794_10043551 | Ga0099794_100435512 | 413 |
| 442 | 3300009094 | Ga0111539_10245411 | Ga0111539_102454112 | 413 |
| 443 | 3300009147 | Ga0114129_10102152 | Ga0114129_101021523 | 413 |
| 444 | 3300009148 | Ga0105243_10127230 | Ga0105243_101272302 | 413 |
| 445 | 3300009553 | Ga0105249_10017439 | Ga0105249_100174393 | 413 |
| 446 | 3300011119 | Ga0105246_10022164 | Ga0105246_100221643 | 413 |
| 447 | 3300014326 | Ga0157380_10132662 | Ga0157380_101326621 | 413 |
| 448 | 3300025905 | Ga0207685_10004104 | Ga0207685_100041043 | 413 |
| 449 | 3300025910 | Ga0207684_10117905 | Ga0207684_101179052 | 413 |
| 450 | 3300025912 | Ga0207707_10007064 | Ga0207707_100070643 | 413 |
| 451 | 3300025912 | Ga0207707_10150622 | Ga0207707_101506222 | 413 |
| 452 | 3300025915 | Ga0207693_10072370 | Ga0207693_100723702 | 413 |
| 453 | 3300025916 | Ga0207663_10058549 | Ga0207663_100585491 | 413 |
| 454 | 3300025917 | Ga0207660_10009267 | Ga0207660_100092675 | 413 |
| 455 | 3300025921 | Ga0207652_10253216 | Ga0207652_102532161 | 413 |
| 456 | 3300025922 | Ga0207646_10068130 | Ga0207646_100681301 | 413 |
| 457 | 3300025939 | Ga0207665_10011501 | Ga0207665_100115014 | 413 |
| 458 | 3300026067 | Ga0207678_10045206 | Ga0207678_100452061 | 413 |
| 459 | 3300026095 | Ga0207676_10066563 | Ga0207676_100665633 | 413 |
| 460 | 3300026116 | Ga0207674_10014002 | Ga0207674_100140025 | 413 |
| 461 | 3300027671 | Ga0209588_1001621 | Ga0209588_10016213 | 413 |
| 462 | 3300028380 | Ga0268265_10000528 | Ga0268265_100005285 | 413 |
| 463 | 3300028381 | Ga0268264_10001265 | Ga0268264_1000126519 | 413 |
| 464 | 3300031824 | Ga0307413_10031388 | Ga0307413_100313883 | 413 |
| 465 | 3300035119 | Ga0373956_0001511 | Ga0373956_0001511_4973_6226 | 413 |
| 466 | 3300035120 | Ga0373957_0006048 | Ga0373957_0006048_891_2144 | 413 |
| 467 | 3300035172 | Ga0373955_0007870 | Ga0373955_0007870_1920_3173 | 413 |
| 468 | 3300035724 | Ga0373933_0018662 | Ga0373933_0018662_1705_2958 | 413 |
| 469 | 3300045051 | Ga0451576_0001638 | Ga0451576_0001638_4816_6057 | 413 |
| 470 | 3300046462 | Ga0495651_0000764 | Ga0495651_0000764_18533_19786 | 413 |
| 471 | 3300046559 | Ga0495667_0004110 | Ga0495667_0004110_4649_5890 | 413 |
| 472 | 3300047318 | Ga0495636_0057011 | Ga0495636_0057011_59_1300 | 413 |
| 473 | 3300047322 | Ga0495680_0209411 | Ga0495680_0209411_134_1375 | 413 |
| 474 | 3300048903 | Ga0496100_0072383 | Ga0496100_0072383_883_2124 | 413 |
| 475 | 3300048905 | Ga0496102_0006598 | Ga0496102_0006598_7724_8965 | 413 |
| 476 | 3300048905 | Ga0496102_0051348 | Ga0496102_0051348_1108_2352 | 413 |
| 477 | 3300048906 | Ga0496103_0009792 | Ga0496103_0009792_2737_3978 | 413 |
| 478 | 3300048909 | Ga0496106_0037687 | Ga0496106_0037687_1565_2806 | 413 |
| 479 | 3300048909 | Ga0496106_0065636 | Ga0496106_0065636_1299_2543 | 413 |
| 480 | 3300048909 | Ga0496106_0086525 | Ga0496106_0086525_114_1355 | 413 |
| 481 | 3300048910 | Ga0496107_0046893 | Ga0496107_0046893_53_1294 | 413 |
| 482 | 3300049574 | Ga0501038_0069228 | Ga0501038_0069228_824_2065 | 413 |
| 483 | 3300049577 | Ga0501041_0137266 | Ga0501041_0137266_164_1405 | 413 |
| 484 | 3300049578 | Ga0501042_0013021 | Ga0501042_0013021_1818_3059 | 413 |
| 485 | 3300049578 | Ga0501042_0094044 | Ga0501042_0094044_517_1758 | 413 |
| 486 | 3300049580 | Ga0501046_0040702 | Ga0501046_0040702_2004_3245 | 413 |
| 487 | 3300049591 | Ga0501075_0036972 | Ga0501075_0036972_622_1863 | 413 |
| 488 | 3300049591 | Ga0501075_0098582 | Ga0501075_0098582_164_1405 | 413 |
| 489 | 3300049592 | Ga0501076_0006327 | Ga0501076_0006327_6432_7673 | 413 |
| 490 | 3300049593 | Ga0501077_0005796 | Ga0501077_0005796_6216_7457 | 413 |
| 491 | 3300049593 | Ga0501077_0009236 | Ga0501077_0009236_1066_2307 | 413 |
| 492 | 3300049741 | Ga0501079_0074222 | Ga0501079_0074222_720_1961 | 413 |
| 493 | 3300049743 | Ga0501081_0003672 | Ga0501081_0003672_5534_6775 | 413 |
| 494 | 3300049743 | Ga0501081_0021499 | Ga0501081_0021499_813_2054 | 413 |
| 495 | 3300049743 | Ga0501081_0035300 | Ga0501081_0035300_1343_2584 | 413 |
| 496 | 3300049824 | Ga0501045_0128811 | Ga0501045_0128811_610_1851 | 413 |
| 497 | 3300050507 | nmdc:mga05p37_90816_c1 | nmdc:mga05p37_90816_c1_1311_2552 | 413 |
| 498 | 3300050509 | nmdc:mga0qj67_733_c1 | nmdc:mga0qj67_733_c1_7121_8362 | 413 |
| 499 | 3300050509 | nmdc:mga0qj67_74589_c1 | nmdc:mga0qj67_74589_c1_1097_2338 | 413 |
| 500 | 3300050510 | nmdc:mga06r32_13222_c1 | nmdc:mga06r32_13222_c1_1276_2517 | 413 |
| 501 | 3300050510 | nmdc:mga06r32_21130_c1 | nmdc:mga06r32_21130_c1_24_1265 | 413 |
| 502 | 3300050510 | nmdc:mga06r32_68764_c1 | nmdc:mga06r32_68764_c1_1458_2699 | 413 |
| 503 | 3300050511 | nmdc:mga08y16_58180_c1 | nmdc:mga08y16_58180_c1_2532_3779 | 413 |
| 504 | 3300050512 | nmdc:mga0n895_77179_c1 | nmdc:mga0n895_77179_c1_784_2028 | 413 |
| 505 | 3300050512 | nmdc:mga0n895_91342_c1 | nmdc:mga0n895_91342_c1_1387_2631 | 413 |
| 506 | 3300054114 | Ga0501084_0009054 | Ga0501084_0009054_2279_3520 | 413 |
| 507 | 3300060353 | Ga0501082_0044681 | Ga0501082_0044681_1520_2761 | 413 |
| 508 | 3300003775 | Ga0055524_1001448 | Ga0055524_10014486 | 414 |
| 509 | 3300005341 | Ga0070691_10065025 | Ga0070691_100650252 | 414 |
| 510 | 3300005434 | Ga0070709_10000363 | Ga0070709_1000036314 | 414 |
| 511 | 3300005435 | Ga0070714_100000833 | Ga0070714_10000083316 | 414 |
| 512 | 3300005436 | Ga0070713_100003768 | Ga0070713_1000037686 | 414 |
| 513 | 3300005437 | Ga0070710_10000226 | Ga0070710_1000022610 | 414 |
| 514 | 3300005439 | Ga0070711_100001128 | Ga0070711_1000011284 | 414 |
| 515 | 3300005545 | Ga0070695_100039414 | Ga0070695_1000394142 | 414 |
| 516 | 3300005983 | Ga0081540_1003101 | Ga0081540_100310111 | 414 |
| 517 | 3300006028 | Ga0070717_10002481 | Ga0070717_100024815 | 414 |
| 518 | 3300006163 | Ga0070715_10041416 | Ga0070715_100414162 | 414 |
| 519 | 3300006173 | Ga0070716_100000149 | Ga0070716_10000014913 | 414 |
| 520 | 3300006175 | Ga0070712_100000413 | Ga0070712_10000041315 | 414 |
| 521 | 3300006846 | Ga0075430_100006043 | Ga0075430_1000060436 | 414 |
| 522 | 3300009094 | Ga0111539_10028951 | Ga0111539_100289513 | 414 |
| 523 | 3300021388 | Ga0213875_10080492 | Ga0213875_100804921 | 414 |
| 524 | 3300025299 | Ga0209256_1000073 | Ga0209256_10000736 | 414 |
| 525 | 3300025898 | Ga0207692_10000966 | Ga0207692_100009665 | 414 |
| 526 | 3300025906 | Ga0207699_10000366 | Ga0207699_100003669 | 414 |
| 527 | 3300025915 | Ga0207693_10002752 | Ga0207693_100027522 | 414 |
| 528 | 3300025916 | Ga0207663_10006969 | Ga0207663_100069696 | 414 |
| 529 | 3300025928 | Ga0207700_10000437 | Ga0207700_1000043714 | 414 |
| 530 | 3300025929 | Ga0207664_10000416 | Ga0207664_1000041613 | 414 |
| 531 | 3300025939 | Ga0207665_10000234 | Ga0207665_1000023424 | 414 |
| 532 | 3300027378 | Ga0209981_1001997 | Ga0209981_10019973 | 414 |
| 533 | 3300027462 | Ga0210000_1001517 | Ga0210000_10015173 | 414 |
| 534 | 3300027543 | Ga0209999_1006386 | Ga0209999_10063863 | 414 |
| 535 | 3300027665 | Ga0209983_1005796 | Ga0209983_10057963 | 414 |
| 536 | 3300027876 | Ga0209974_10002609 | Ga0209974_100026093 | 414 |
| 537 | 3300031548 | Ga0307408_100035017 | Ga0307408_1000350172 | 414 |
| 538 | 3300035086 | Ga0373934_0026576 | Ga0373934_0026576_52_1302 | 414 |
| 539 | 3300035120 | Ga0373957_0053769 | Ga0373957_0053769_53_1303 | 414 |
| 540 | 3300035724 | Ga0373933_0007851 | Ga0373933_0007851_3699_4949 | 414 |
| 541 | 3300037853 | Ga0436364_1509239 | Ga0436364_1509239_1497_2744 | 414 |
| 542 | 3300039450 | Ga0436363_1044488 | Ga0436363_1044488_239_1486 | 414 |
| 543 | 3300042876 | Ga0451577_0158790 | Ga0451577_0158790_739_1983 | 414 |
| 544 | 3300044673 | Ga0453683_0000494 | Ga0453683_0000494_30111_31355 | 414 |
| 545 | 3300046511 | Ga0495608_0025139 | Ga0495608_0025139_2236_3486 | 414 |
| 546 | 3300046663 | Ga0495635_0123563 | Ga0495635_0123563_459_1709 | 414 |
| 547 | 3300046679 | Ga0495623_0015361 | Ga0495623_0015361_1883_3133 | 414 |
| 548 | 3300047317 | Ga0495604_0094830 | Ga0495604_0094830_39_1289 | 414 |
| 549 | 3300047471 | Ga0495684_0072546 | Ga0495684_0072546_1089_2339 | 414 |
| 550 | 3300048088 | Ga0495602_0029432 | Ga0495602_0029432_3171_4421 | 414 |
| 551 | 3300049571 | Ga0501034_0020143 | Ga0501034_0020143_3202_4446 | 414 |
| 552 | 3300049586 | Ga0501070_0221956 | Ga0501070_0221956_103_1347 | 414 |
| 553 | 3300049741 | Ga0501079_0045484 | Ga0501079_0045484_616_1866 | 414 |
| 554 | 3300050507 | nmdc:mga05p37_34120_c1 | nmdc:mga05p37_34120_c1_1383_2630 | 414 |
| 555 | 3300050509 | nmdc:mga0qj67_110767_c1 | nmdc:mga0qj67_110767_c1_750_2000 | 414 |
| 556 | 3300050509 | nmdc:mga0qj67_157763_c1 | nmdc:mga0qj67_157763_c1_72_1316 | 414 |
| 557 | 3300050510 | nmdc:mga06r32_57806_c1 | nmdc:mga06r32_57806_c1_1059_2306 | 414 |
| 558 | 3300050514 | nmdc:mga08x19_54912_c1 | nmdc:mga08x19_54912_c1_1158_2408 | 414 |
| 559 | 3300005458 | Ga0070681_10252357 | Ga0070681_102523571 | 415 |
| 560 | 3300006028 | Ga0070717_10115314 | Ga0070717_101153142 | 415 |
| 561 | 3300006175 | Ga0070712_100140207 | Ga0070712_1001402072 | 415 |
| 562 | 3300025916 | Ga0207663_10070026 | Ga0207663_100700261 | 415 |
| 563 | 3300028556 | Ga0265337_1000182 | Ga0265337_10001827 | 415 |
| 564 | 3300028800 | Ga0265338_10056170 | Ga0265338_100561703 | 415 |
| 565 | 3300031241 | Ga0265325_10000034 | Ga0265325_1000003442 | 415 |
| 566 | 3300031241 | Ga0265325_10001708 | Ga0265325_100017086 | 415 |
| 567 | 3300031241 | Ga0265325_10038458 | Ga0265325_100384582 | 415 |
| 568 | 3300031249 | Ga0265339_10019021 | Ga0265339_100190213 | 415 |
| 569 | 3300031249 | Ga0265339_10037911 | Ga0265339_100379111 | 415 |
| 570 | 3300031344 | Ga0265316_10043894 | Ga0265316_100438942 | 415 |
| 571 | 3300031595 | Ga0265313_10000176 | Ga0265313_1000017615 | 415 |
| 572 | 3300031595 | Ga0265313_10004374 | Ga0265313_100043748 | 415 |
| 573 | 3300031595 | Ga0265313_10014189 | Ga0265313_100141894 | 415 |
| 574 | 3300035118 | Ga0373954_0009787 | Ga0373954_0009787_2391_3638 | 415 |
| 575 | 3300035172 | Ga0373955_0002392 | Ga0373955_0002392_6018_7286 | 415 |
| 576 | 3300035172 | Ga0373955_0019223 | Ga0373955_0019223_1091_2338 | 415 |
| 577 | 3300035724 | Ga0373933_0002037 | Ga0373933_0002037_5607_6854 | 415 |
| 578 | 3300035725 | Ga0373947_0044583 | Ga0373947_0044583_123_1391 | 415 |
| 579 | 3300036401 | Ga0373937_0028762 | Ga0373937_0028762_1919_3187 | 415 |
| 580 | 3300036401 | Ga0373937_0046498 | Ga0373937_0046498_1117_2364 | 415 |
| 581 | 3300046454 | Ga0495592_0007319 | Ga0495592_0007319_2554_3822 | 415 |
| 582 | 3300046511 | Ga0495608_0041070 | Ga0495608_0041070_1605_2852 | 415 |
| 583 | 3300046516 | Ga0495628_0007599 | Ga0495628_0007599_6228_7496 | 415 |
| 584 | 3300046529 | Ga0495652_0090939 | Ga0495652_0090939_296_1543 | 415 |
| 585 | 3300046559 | Ga0495667_0063532 | Ga0495667_0063532_539_1807 | 415 |
| 586 | 3300046559 | Ga0495667_0085337 | Ga0495667_0085337_53_1300 | 415 |
| 587 | 3300046675 | Ga0495657_0027472 | Ga0495657_0027472_2723_3991 | 415 |
| 588 | 3300046679 | Ga0495623_0010359 | Ga0495623_0010359_3644_4912 | 415 |
| 589 | 3300046809 | Ga0495600_0006193 | Ga0495600_0006193_4070_5338 | 415 |
| 590 | 3300047317 | Ga0495604_0016854 | Ga0495604_0016854_1095_2342 | 415 |
| 591 | 3300047317 | Ga0495604_0039078 | Ga0495604_0039078_931_2199 | 415 |
| 592 | 3300047319 | Ga0495674_0209301 | Ga0495674_0209301_80_1348 | 415 |
| 593 | 3300047322 | Ga0495680_0032027 | Ga0495680_0032027_779_2047 | 415 |
| 594 | 3300048088 | Ga0495602_0202511 | Ga0495602_0202511_85_1332 | 415 |
| 595 | 3300048907 | Ga0496104_0000317 | Ga0496104_0000317_32165_33433 | 415 |
| 596 | 3300048908 | Ga0496105_0000485 | Ga0496105_0000485_14170_15438 | 415 |
| 597 | 3300049586 | Ga0501070_0035326 | Ga0501070_0035326_796_2046 | 415 |
| 598 | 3300053077 | Ga0495601_0000521 | Ga0495601_0000521_3767_5035 | 415 |
| 599 | 3300053078 | Ga0495612_0002143 | Ga0495612_0002143_5050_6318 | 415 |
| 600 | 3300053084 | Ga0495595_0001827 | Ga0495595_0001827_579_1826 | 415 |
| 601 | 3300053085 | Ga0495619_0022668 | Ga0495619_0022668_1245_2492 | 415 |
| 602 | 2209111006 | 2214856314 | 2213902559 | 416 |
| 603 | 3300000041 | ARcpr5oldR_c000046 | ARcpr5oldR_00004620 | 416 |
| 604 | 3300000042 | ARSoilYngRDRAFT_c00078 | ARSoilYngRDRAFT_0007816 | 416 |
| 605 | 3300000043 | ARcpr5yngRDRAFT_c000072 | ARcpr5yngRDRAFT_0000727 | 416 |
| 606 | 3300000044 | ARSoilOldRDRAFT_c000019 | ARSoilOldRDRAFT_0000194 | 416 |
| 607 | 3300000045 | ARCol0oldRDRAFT_c00019 | ARCol0oldRDRAFT_0001913 | 416 |
| 608 | 3300000652 | ARCol0yngRDRAFT_1000004 | ARCol0yngRDRAFT_100000441 | 416 |
| 609 | 3300001977 | JGI24746J21847_1000147 | JGI24746J21847_10001477 | 416 |
| 610 | 3300001978 | JGI24747J21853_1000217 | JGI24747J21853_10002173 | 416 |
| 611 | 3300001989 | JGI24739J22299_10010699 | JGI24739J22299_100106992 | 416 |
| 612 | 3300001990 | JGI24737J22298_10002058 | JGI24737J22298_100020583 | 416 |
| 613 | 3300001990 | JGI24737J22298_10003740 | JGI24737J22298_100037404 | 416 |
| 614 | 3300002070 | JGI24750J21931_1000430 | JGI24750J21931_10004304 | 416 |
| 615 | 3300002074 | JGI24748J21848_1000555 | JGI24748J21848_10005553 | 416 |
| 616 | 3300002075 | JGI24738J21930_10004182 | JGI24738J21930_100041823 | 416 |
| 617 | 3300002244 | JGI24742J22300_10000106 | JGI24742J22300_100001062 | 416 |
| 618 | 3300002244 | JGI24742J22300_10000483 | JGI24742J22300_100004832 | 416 |
| 619 | 3300003911 | JGI25405J52794_10000722 | JGI25405J52794_100007222 | 416 |
| 620 | 3300003911 | JGI25405J52794_10002175 | JGI25405J52794_100021751 | 416 |
| 621 | 3300005289 | Ga0065704_10075977 | Ga0065704_100759772 | 416 |
| 622 | 3300005293 | Ga0065715_10091019 | Ga0065715_100910196 | 416 |
| 623 | 3300005328 | Ga0070676_10102718 | Ga0070676_101027181 | 416 |
| 624 | 3300005329 | Ga0070683_100001872 | Ga0070683_10000187213 | 416 |
| 625 | 3300005329 | Ga0070683_100110942 | Ga0070683_1001109422 | 416 |
| 626 | 3300005329 | Ga0070683_100329083 | Ga0070683_1003290831 | 416 |
| 627 | 3300005330 | Ga0070690_100027115 | Ga0070690_1000271152 | 416 |
| 628 | 3300005331 | Ga0070670_100040546 | Ga0070670_1000405465 | 416 |
| 629 | 3300005333 | Ga0070677_10000429 | Ga0070677_1000042914 | 416 |
| 630 | 3300005334 | Ga0068869_100004944 | Ga0068869_1000049446 | 416 |
| 631 | 3300005334 | Ga0068869_100113167 | Ga0068869_1001131672 | 416 |
| 632 | 3300005336 | Ga0070680_100018787 | Ga0070680_1000187876 | 416 |
| 633 | 3300005337 | Ga0070682_100000695 | Ga0070682_10000069516 | 416 |
| 634 | 3300005338 | Ga0068868_100004036 | Ga0068868_1000040367 | 416 |
| 635 | 3300005340 | Ga0070689_100012268 | Ga0070689_1000122686 | 416 |
| 636 | 3300005341 | Ga0070691_10011581 | Ga0070691_100115812 | 416 |
| 637 | 3300005344 | Ga0070661_100011491 | Ga0070661_1000114916 | 416 |
| 638 | 3300005345 | Ga0070692_10002719 | Ga0070692_100027193 | 416 |
| 639 | 3300005347 | Ga0070668_100058985 | Ga0070668_1000589853 | 416 |
| 640 | 3300005347 | Ga0070668_100128540 | Ga0070668_1001285402 | 416 |
| 641 | 3300005353 | Ga0070669_100015276 | Ga0070669_1000152766 | 416 |
| 642 | 3300005354 | Ga0070675_100000240 | Ga0070675_10000024015 | 416 |
| 643 | 3300005355 | Ga0070671_100015801 | Ga0070671_1000158016 | 416 |
| 644 | 3300005364 | Ga0070673_100007045 | Ga0070673_1000070457 | 416 |
| 645 | 3300005365 | Ga0070688_100001905 | Ga0070688_1000019056 | 416 |
| 646 | 3300005366 | Ga0070659_100007610 | Ga0070659_1000076107 | 416 |
| 647 | 3300005366 | Ga0070659_100010913 | Ga0070659_1000109136 | 416 |
| 648 | 3300005367 | Ga0070667_100020849 | Ga0070667_1000208496 | 416 |
| 649 | 3300005367 | Ga0070667_100159811 | Ga0070667_1001598112 | 416 |
| 650 | 3300005436 | Ga0070713_100000381 | Ga0070713_10000038124 | 416 |
| 651 | 3300005437 | Ga0070710_10076967 | Ga0070710_100769672 | 416 |
| 652 | 3300005440 | Ga0070705_100027104 | Ga0070705_1000271044 | 416 |
| 653 | 3300005441 | Ga0070700_100027831 | Ga0070700_1000278313 | 416 |
| 654 | 3300005444 | Ga0070694_100002780 | Ga0070694_1000027804 | 416 |
| 655 | 3300005455 | Ga0070663_100040436 | Ga0070663_1000404364 | 416 |
| 656 | 3300005457 | Ga0070662_100013532 | Ga0070662_1000135324 | 416 |
| 657 | 3300005457 | Ga0070662_100261831 | Ga0070662_1002618311 | 416 |
| 658 | 3300005466 | Ga0070685_10014546 | Ga0070685_100145461 | 416 |
| 659 | 3300005466 | Ga0070685_10051505 | Ga0070685_100515052 | 416 |
| 660 | 3300005530 | Ga0070679_100023238 | Ga0070679_1000232386 | 416 |
| 661 | 3300005530 | Ga0070679_100084499 | Ga0070679_1000844993 | 416 |
| 662 | 3300005535 | Ga0070684_100009261 | Ga0070684_1000092614 | 416 |
| 663 | 3300005535 | Ga0070684_100062206 | Ga0070684_1000622062 | 416 |
| 664 | 3300005539 | Ga0068853_100009694 | Ga0068853_1000096944 | 416 |
| 665 | 3300005539 | Ga0068853_100069407 | Ga0068853_1000694073 | 416 |
| 666 | 3300005543 | Ga0070672_100001847 | Ga0070672_1000018479 | 416 |
| 667 | 3300005544 | Ga0070686_100010163 | Ga0070686_1000101636 | 416 |
| 668 | 3300005544 | Ga0070686_100038773 | Ga0070686_1000387732 | 416 |
| 669 | 3300005546 | Ga0070696_100038185 | Ga0070696_1000381853 | 416 |
| 670 | 3300005549 | Ga0070704_100004531 | Ga0070704_1000045318 | 416 |
| 671 | 3300005563 | Ga0068855_100017390 | Ga0068855_1000173906 | 416 |
| 672 | 3300005563 | Ga0068855_100091933 | Ga0068855_1000919333 | 416 |
| 673 | 3300005564 | Ga0070664_100001002 | Ga0070664_1000010029 | 416 |
| 674 | 3300005577 | Ga0068857_100229267 | Ga0068857_1002292671 | 416 |
| 675 | 3300005614 | Ga0068856_100023460 | Ga0068856_1000234607 | 416 |
| 676 | 3300005615 | Ga0070702_100019293 | Ga0070702_1000192933 | 416 |
| 677 | 3300005615 | Ga0070702_100096972 | Ga0070702_1000969722 | 416 |
| 678 | 3300005616 | Ga0068852_100004985 | Ga0068852_1000049855 | 416 |
| 679 | 3300005617 | Ga0068859_100010808 | Ga0068859_1000108086 | 416 |
| 680 | 3300005618 | Ga0068864_100003922 | Ga0068864_1000039227 | 416 |
| 681 | 3300005719 | Ga0068861_100003710 | Ga0068861_1000037107 | 416 |
| 682 | 3300005719 | Ga0068861_100023937 | Ga0068861_1000239374 | 416 |
| 683 | 3300005840 | Ga0068870_10000157 | Ga0068870_1000015720 | 416 |
| 684 | 3300005841 | Ga0068863_100000674 | Ga0068863_10000067415 | 416 |
| 685 | 3300005842 | Ga0068858_100091776 | Ga0068858_1000917762 | 416 |
| 686 | 3300005843 | Ga0068860_100012435 | Ga0068860_1000124355 | 416 |
| 687 | 3300005843 | Ga0068860_100130650 | Ga0068860_1001306502 | 416 |
| 688 | 3300005937 | Ga0081455_10000059 | Ga0081455_1000005941 | 416 |
| 689 | 3300005937 | Ga0081455_10002427 | Ga0081455_100024276 | 416 |
| 690 | 3300005983 | Ga0081540_1008452 | Ga0081540_10084522 | 416 |
| 691 | 3300005983 | Ga0081540_1012205 | Ga0081540_10122053 | 416 |
| 692 | 3300006028 | Ga0070717_10000161 | Ga0070717_100001614 | 416 |
| 693 | 3300006042 | Ga0075368_10025334 | Ga0075368_100253342 | 416 |
| 694 | 3300006058 | Ga0075432_10032964 | Ga0075432_100329642 | 416 |
| 695 | 3300006173 | Ga0070716_100045195 | Ga0070716_1000451953 | 416 |
| 696 | 3300006175 | Ga0070712_100022489 | Ga0070712_1000224895 | 416 |
| 697 | 3300006358 | Ga0068871_100001066 | Ga0068871_1000010665 | 416 |
| 698 | 3300006844 | Ga0075428_100038761 | Ga0075428_1000387612 | 416 |
| 699 | 3300006846 | Ga0075430_100000070 | Ga0075430_10000007032 | 416 |
| 700 | 3300006847 | Ga0075431_100001221 | Ga0075431_10000122123 | 416 |
| 701 | 3300006852 | Ga0075433_10010476 | Ga0075433_100104766 | 416 |
| 702 | 3300006852 | Ga0075433_10109013 | Ga0075433_101090132 | 416 |
| 703 | 3300006871 | Ga0075434_100000212 | Ga0075434_10000021235 | 416 |
| 704 | 3300006871 | Ga0075434_100037805 | Ga0075434_1000378054 | 416 |
| 705 | 3300006871 | Ga0075434_100090704 | Ga0075434_1000907043 | 416 |
| 706 | 3300006880 | Ga0075429_100003999 | Ga0075429_1000039992 | 416 |
| 707 | 3300006881 | Ga0068865_100000131 | Ga0068865_1000001317 | 416 |
| 708 | 3300006931 | Ga0097620_100010810 | Ga0097620_1000108107 | 416 |
| 709 | 3300007076 | Ga0075435_100034976 | Ga0075435_1000349764 | 416 |
| 710 | 3300007076 | Ga0075435_100077055 | Ga0075435_1000770552 | 416 |
| 711 | 3300007076 | Ga0075435_100121660 | Ga0075435_1001216603 | 416 |
| 712 | 3300009094 | Ga0111539_10000138 | Ga0111539_1000013825 | 416 |
| 713 | 3300009094 | Ga0111539_10039247 | Ga0111539_100392476 | 416 |
| 714 | 3300009098 | Ga0105245_10011704 | Ga0105245_100117043 | 416 |
| 715 | 3300009098 | Ga0105245_10059696 | Ga0105245_100596962 | 416 |
| 716 | 3300009147 | Ga0114129_10002312 | Ga0114129_1000231210 | 416 |
| 717 | 3300009147 | Ga0114129_10003950 | Ga0114129_100039505 | 416 |
| 718 | 3300009148 | Ga0105243_10006299 | Ga0105243_100062996 | 416 |
| 719 | 3300009148 | Ga0105243_10032492 | Ga0105243_100324924 | 416 |
| 720 | 3300009174 | Ga0105241_10056240 | Ga0105241_100562403 | 416 |
| 721 | 3300009174 | Ga0105241_10064613 | Ga0105241_100646132 | 416 |
| 722 | 3300009177 | Ga0105248_10012777 | Ga0105248_100127776 | 416 |
| 723 | 3300009177 | Ga0105248_10013552 | Ga0105248_100135526 | 416 |
| 724 | 3300009545 | Ga0105237_10018866 | Ga0105237_100188663 | 416 |
| 725 | 3300009545 | Ga0105237_10042427 | Ga0105237_100424275 | 416 |
| 726 | 3300009553 | Ga0105249_10001029 | Ga0105249_100010296 | 416 |
| 727 | 3300009553 | Ga0105249_10024785 | Ga0105249_100247853 | 416 |
| 728 | 3300010375 | Ga0105239_10112207 | Ga0105239_101122073 | 416 |
| 729 | 3300013296 | Ga0157374_10000671 | Ga0157374_100006718 | 416 |
| 730 | 3300013297 | Ga0157378_10088364 | Ga0157378_100883643 | 416 |
| 731 | 3300013297 | Ga0157378_10411027 | Ga0157378_104110271 | 416 |
| 732 | 3300013308 | Ga0157375_10002908 | Ga0157375_1000290813 | 416 |
| 733 | 3300014325 | Ga0163163_10004312 | Ga0163163_100043129 | 416 |
| 734 | 3300014325 | Ga0163163_10033625 | Ga0163163_100336253 | 416 |
| 735 | 3300014326 | Ga0157380_10005886 | Ga0157380_100058867 | 416 |
| 736 | 3300014745 | Ga0157377_10000570 | Ga0157377_1000057013 | 416 |
| 737 | 3300014968 | Ga0157379_10000345 | Ga0157379_1000034516 | 416 |
| 738 | 3300014968 | Ga0157379_10133620 | Ga0157379_101336202 | 416 |
| 739 | 3300014969 | Ga0157376_10039773 | Ga0157376_100397734 | 416 |
| 740 | 3300014969 | Ga0157376_10098105 | Ga0157376_100981053 | 416 |
| 741 | 3300017792 | Ga0163161_10004669 | Ga0163161_100046693 | 416 |
| 742 | 3300025271 | Ga0207666_1000069 | Ga0207666_100006915 | 416 |
| 743 | 3300025271 | Ga0207666_1001040 | Ga0207666_10010403 | 416 |
| 744 | 3300025290 | Ga0207673_1007066 | Ga0207673_10070661 | 416 |
| 745 | 3300025315 | Ga0207697_10000390 | Ga0207697_100003906 | 416 |
| 746 | 3300025315 | Ga0207697_10006568 | Ga0207697_100065685 | 416 |
| 747 | 3300025735 | Ga0207713_1036708 | Ga0207713_10367082 | 416 |
| 748 | 3300025885 | Ga0207653_10024508 | Ga0207653_100245082 | 416 |
| 749 | 3300025893 | Ga0207682_10000048 | Ga0207682_100000487 | 416 |
| 750 | 3300025898 | Ga0207692_10005320 | Ga0207692_100053205 | 416 |
| 751 | 3300025901 | Ga0207688_10001496 | Ga0207688_100014967 | 416 |
| 752 | 3300025903 | Ga0207680_10045613 | Ga0207680_100456132 | 416 |
| 753 | 3300025904 | Ga0207647_10013329 | Ga0207647_100133295 | 416 |
| 754 | 3300025906 | Ga0207699_10074768 | Ga0207699_100747682 | 416 |
| 755 | 3300025907 | Ga0207645_10012526 | Ga0207645_100125262 | 416 |
| 756 | 3300025908 | Ga0207643_10000581 | Ga0207643_100005816 | 416 |
| 757 | 3300025911 | Ga0207654_10004716 | Ga0207654_100047163 | 416 |
| 758 | 3300025912 | Ga0207707_10016616 | Ga0207707_100166163 | 416 |
| 759 | 3300025912 | Ga0207707_10048473 | Ga0207707_100484733 | 416 |
| 760 | 3300025914 | Ga0207671_10011618 | Ga0207671_100116185 | 416 |
| 761 | 3300025915 | Ga0207693_10010010 | Ga0207693_100100106 | 416 |
| 762 | 3300025915 | Ga0207693_10011653 | Ga0207693_100116537 | 416 |
| 763 | 3300025917 | Ga0207660_10000192 | Ga0207660_1000019232 | 416 |
| 764 | 3300025918 | Ga0207662_10000647 | Ga0207662_1000064713 | 416 |
| 765 | 3300025919 | Ga0207657_10038177 | Ga0207657_100381775 | 416 |
| 766 | 3300025920 | Ga0207649_10000141 | Ga0207649_1000014115 | 416 |
| 767 | 3300025920 | Ga0207649_10045728 | Ga0207649_100457282 | 416 |
| 768 | 3300025920 | Ga0207649_10083443 | Ga0207649_100834432 | 416 |
| 769 | 3300025921 | Ga0207652_10004519 | Ga0207652_1000451913 | 416 |
| 770 | 3300025923 | Ga0207681_10000359 | Ga0207681_1000035915 | 416 |
| 771 | 3300025923 | Ga0207681_10159118 | Ga0207681_101591182 | 416 |
| 772 | 3300025925 | Ga0207650_10004853 | Ga0207650_100048535 | 416 |
| 773 | 3300025926 | Ga0207659_10000052 | Ga0207659_1000005233 | 416 |
| 774 | 3300025926 | Ga0207659_10249098 | Ga0207659_102490981 | 416 |
| 775 | 3300025927 | Ga0207687_10000097 | Ga0207687_1000009742 | 416 |
| 776 | 3300025927 | Ga0207687_10069568 | Ga0207687_100695682 | 416 |
| 777 | 3300025928 | Ga0207700_10000673 | Ga0207700_1000067318 | 416 |
| 778 | 3300025931 | Ga0207644_10002956 | Ga0207644_100029569 | 416 |
| 779 | 3300025931 | Ga0207644_10033370 | Ga0207644_100333705 | 416 |
| 780 | 3300025932 | Ga0207690_10000278 | Ga0207690_1000027820 | 416 |
| 781 | 3300025933 | Ga0207706_10036851 | Ga0207706_100368514 | 416 |
| 782 | 3300025933 | Ga0207706_10136791 | Ga0207706_101367912 | 416 |
| 783 | 3300025934 | Ga0207686_10000850 | Ga0207686_1000085014 | 416 |
| 784 | 3300025934 | Ga0207686_10008904 | Ga0207686_100089046 | 416 |
| 785 | 3300025935 | Ga0207709_10000349 | Ga0207709_100003493 | 416 |
| 786 | 3300025935 | Ga0207709_10014956 | Ga0207709_100149563 | 416 |
| 787 | 3300025936 | Ga0207670_10000781 | Ga0207670_100007819 | 416 |
| 788 | 3300025937 | Ga0207669_10000168 | Ga0207669_1000016825 | 416 |
| 789 | 3300025938 | Ga0207704_10000704 | Ga0207704_100007047 | 416 |
| 790 | 3300025938 | Ga0207704_10153219 | Ga0207704_101532192 | 416 |
| 791 | 3300025939 | Ga0207665_10000248 | Ga0207665_1000024816 | 416 |
| 792 | 3300025940 | Ga0207691_10003348 | Ga0207691_1000334813 | 416 |
| 793 | 3300025941 | Ga0207711_10006180 | Ga0207711_100061807 | 416 |
| 794 | 3300025941 | Ga0207711_10042109 | Ga0207711_100421094 | 416 |
| 795 | 3300025941 | Ga0207711_10119131 | Ga0207711_101191312 | 416 |
| 796 | 3300025941 | Ga0207711_10172471 | Ga0207711_101724711 | 416 |
| 797 | 3300025942 | Ga0207689_10012368 | Ga0207689_100123684 | 416 |
| 798 | 3300025944 | Ga0207661_10000143 | Ga0207661_1000014315 | 416 |
| 799 | 3300025944 | Ga0207661_10076338 | Ga0207661_100763382 | 416 |
| 800 | 3300025944 | Ga0207661_10110264 | Ga0207661_101102641 | 416 |
| 801 | 3300025944 | Ga0207661_10250242 | Ga0207661_102502422 | 416 |
| 802 | 3300025945 | Ga0207679_10000035 | Ga0207679_100000359 | 416 |
| 803 | 3300025945 | Ga0207679_10179254 | Ga0207679_101792541 | 416 |
| 804 | 3300025960 | Ga0207651_10000080 | Ga0207651_1000008034 | 416 |
| 805 | 3300025961 | Ga0207712_10003380 | Ga0207712_100033807 | 416 |
| 806 | 3300025972 | Ga0207668_10109764 | Ga0207668_101097642 | 416 |
| 807 | 3300025981 | Ga0207640_10092226 | Ga0207640_100922261 | 416 |
| 808 | 3300025986 | Ga0207658_10022910 | Ga0207658_100229102 | 416 |
| 809 | 3300025986 | Ga0207658_10137366 | Ga0207658_101373662 | 416 |
| 810 | 3300026023 | Ga0207677_10000614 | Ga0207677_1000061422 | 416 |
| 811 | 3300026035 | Ga0207703_10022821 | Ga0207703_100228211 | 416 |
| 812 | 3300026035 | Ga0207703_10033869 | Ga0207703_100338692 | 416 |
| 813 | 3300026035 | Ga0207703_10063034 | Ga0207703_100630343 | 416 |
| 814 | 3300026067 | Ga0207678_10005116 | Ga0207678_100051166 | 416 |
| 815 | 3300026067 | Ga0207678_10044487 | Ga0207678_100444872 | 416 |
| 816 | 3300026075 | Ga0207708_10008117 | Ga0207708_100081174 | 416 |
| 817 | 3300026075 | Ga0207708_10013232 | Ga0207708_100132323 | 416 |
| 818 | 3300026078 | Ga0207702_10001956 | Ga0207702_100019564 | 416 |
| 819 | 3300026078 | Ga0207702_10116525 | Ga0207702_101165251 | 416 |
| 820 | 3300026078 | Ga0207702_10121704 | Ga0207702_101217043 | 416 |
| 821 | 3300026088 | Ga0207641_10009143 | Ga0207641_100091433 | 416 |
| 822 | 3300026095 | Ga0207676_10001840 | Ga0207676_100018402 | 416 |
| 823 | 3300026116 | Ga0207674_10002206 | Ga0207674_100022066 | 416 |
| 824 | 3300026118 | Ga0207675_100003721 | Ga0207675_10000372110 | 416 |
| 825 | 3300026118 | Ga0207675_100103227 | Ga0207675_1001032272 | 416 |
| 826 | 3300026121 | Ga0207683_10002096 | Ga0207683_100020967 | 416 |
| 827 | 3300026121 | Ga0207683_10003030 | Ga0207683_100030306 | 416 |
| 828 | 3300026121 | Ga0207683_10013315 | Ga0207683_100133152 | 416 |
| 829 | 3300026142 | Ga0207698_10003387 | Ga0207698_100033876 | 416 |
| 830 | 3300027617 | Ga0210002_1000400 | Ga0210002_10004007 | 416 |
| 831 | 3300027695 | Ga0209966_1002841 | Ga0209966_10028412 | 416 |
| 832 | 3300027717 | Ga0209998_10000497 | Ga0209998_100004977 | 416 |
| 833 | 3300027717 | Ga0209998_10001108 | Ga0209998_100011083 | 416 |
| 834 | 3300027876 | Ga0209974_10005545 | Ga0209974_100055452 | 416 |
| 835 | 3300027907 | Ga0207428_10000075 | Ga0207428_1000007563 | 416 |
| 836 | 3300027907 | Ga0207428_10000428 | Ga0207428_1000042842 | 416 |
| 837 | 3300027907 | Ga0207428_10001396 | Ga0207428_1000139613 | 416 |
| 838 | 3300028379 | Ga0268266_10024188 | Ga0268266_100241883 | 416 |
| 839 | 3300028379 | Ga0268266_10159053 | Ga0268266_101590532 | 416 |
| 840 | 3300028380 | Ga0268265_10003048 | Ga0268265_100030483 | 416 |
| 841 | 3300028381 | Ga0268264_10001145 | Ga0268264_100011457 | 416 |
| 842 | 3300028381 | Ga0268264_10045961 | Ga0268264_100459612 | 416 |
| 843 | 3300034816 | Ga0373930_0001646 | Ga0373930_0001646_423_1679 | 416 |
| 844 | 3300034817 | Ga0373948_0000065 | Ga0373948_0000065_6476_7732 | 416 |
| 845 | 3300034818 | Ga0373950_0003576 | Ga0373950_0003576_109_1365 | 416 |
| 846 | 3300034957 | Ga0373938_0004428 | Ga0373938_0004428_231_1487 | 416 |
| 847 | 3300035084 | Ga0373928_0000172 | Ga0373928_0000172_10828_12084 | 416 |
| 848 | 3300035085 | Ga0373929_0000721 | Ga0373929_0000721_1930_3186 | 416 |
| 849 | 3300035085 | Ga0373929_0002547 | Ga0373929_0002547_1727_2977 | 416 |
| 850 | 3300035085 | Ga0373929_0011884 | Ga0373929_0011884_166_1422 | 416 |
| 851 | 3300035086 | Ga0373934_0018951 | Ga0373934_0018951_1369_2619 | 416 |
| 852 | 3300035086 | Ga0373934_0061335 | Ga0373934_0061335_115_1365 | 416 |
| 853 | 3300035088 | Ga0373940_0002918 | Ga0373940_0002918_635_1891 | 416 |
| 854 | 3300035088 | Ga0373940_0007065 | Ga0373940_0007065_350_1600 | 416 |
| 855 | 3300035089 | Ga0373944_0000062 | Ga0373944_0000062_7269_8519 | 416 |
| 856 | 3300035090 | Ga0373949_0001909 | Ga0373949_0001909_631_1887 | 416 |
| 857 | 3300035090 | Ga0373949_0002539 | Ga0373949_0002539_232_1488 | 416 |
| 858 | 3300035091 | Ga0373951_0003492 | Ga0373951_0003492_552_1802 | 416 |
| 859 | 3300035091 | Ga0373951_0013765 | Ga0373951_0013765_524_1780 | 416 |
| 860 | 3300035092 | Ga0373952_0010979 | Ga0373952_0010979_142_1392 | 416 |
| 861 | 3300035111 | Ga0373923_0000277 | Ga0373923_0000277_7793_9043 | 416 |
| 862 | 3300035112 | Ga0373932_0002445 | Ga0373932_0002445_1919_3175 | 416 |
| 863 | 3300035112 | Ga0373932_0004031 | Ga0373932_0004031_401_1657 | 416 |
| 864 | 3300035112 | Ga0373932_0006012 | Ga0373932_0006012_108_1358 | 416 |
| 865 | 3300035113 | Ga0373936_0000954 | Ga0373936_0000954_7600_8850 | 416 |
| 866 | 3300035113 | Ga0373936_0017031 | Ga0373936_0017031_431_1681 | 416 |
| 867 | 3300035114 | Ga0373939_0001215 | Ga0373939_0001215_1875_3131 | 416 |
| 868 | 3300035114 | Ga0373939_0004375 | Ga0373939_0004375_363_1619 | 416 |
| 869 | 3300035115 | Ga0373941_0000106 | Ga0373941_0000106_5404_6660 | 416 |
| 870 | 3300035115 | Ga0373941_0000814 | Ga0373941_0000814_1166_2422 | 416 |
| 871 | 3300035116 | Ga0373945_0000835 | Ga0373945_0000835_4598_5848 | 416 |
| 872 | 3300035117 | Ga0373953_0001395 | Ga0373953_0001395_80_1330 | 416 |
| 873 | 3300035119 | Ga0373956_0035086 | Ga0373956_0035086_147_1397 | 416 |
| 874 | 3300035121 | Ga0373960_0001001 | Ga0373960_0001001_2034_3284 | 416 |
| 875 | 3300035121 | Ga0373960_0001059 | Ga0373960_0001059_610_1866 | 416 |
| 876 | 3300035121 | Ga0373960_0001694 | Ga0373960_0001694_1181_2437 | 416 |
| 877 | 3300035171 | Ga0373946_0006149 | Ga0373946_0006149_3088_4338 | 416 |
| 878 | 3300035171 | Ga0373946_0026717 | Ga0373946_0026717_286_1536 | 416 |
| 879 | 3300035172 | Ga0373955_0000366 | Ga0373955_0000366_6187_7437 | 416 |
| 880 | 3300035172 | Ga0373955_0005170 | Ga0373955_0005170_407_1657 | 416 |
| 881 | 3300035207 | Ga0373942_0001640 | Ga0373942_0001640_3092_4348 | 416 |
| 882 | 3300035207 | Ga0373942_0007471 | Ga0373942_0007471_1166_2422 | 416 |
| 883 | 3300035241 | Ga0373961_0002190 | Ga0373961_0002190_748_2004 | 416 |
| 884 | 3300035241 | Ga0373961_0002208 | Ga0373961_0002208_2052_3302 | 416 |
| 885 | 3300035241 | Ga0373961_0003616 | Ga0373961_0003616_1907_3163 | 416 |
| 886 | 3300035410 | Ga0373924_0006448 | Ga0373924_0006448_2085_3335 | 416 |
| 887 | 3300035691 | Ga0373931_0002810 | Ga0373931_0002810_1975_3231 | 416 |
| 888 | 3300035691 | Ga0373931_0015349 | Ga0373931_0015349_486_1736 | 416 |
| 889 | 3300035691 | Ga0373931_0023899 | Ga0373931_0023899_524_1780 | 416 |
| 890 | 3300035692 | Ga0373935_0046824 | Ga0373935_0046824_620_1870 | 416 |
| 891 | 3300035695 | Ga0373927_0005034 | Ga0373927_0005034_1055_2305 | 416 |
| 892 | 3300035695 | Ga0373927_0024309 | Ga0373927_0024309_610_1860 | 416 |
| 893 | 3300035695 | Ga0373927_0059760 | Ga0373927_0059760_490_1740 | 416 |
| 894 | 3300035724 | Ga0373933_0005704 | Ga0373933_0005704_3506_4756 | 416 |
| 895 | 3300035724 | Ga0373933_0026475 | Ga0373933_0026475_1978_3228 | 416 |
| 896 | 3300035725 | Ga0373947_0041308 | Ga0373947_0041308_859_2109 | 416 |
| 897 | 3300036401 | Ga0373937_0002001 | Ga0373937_0002001_13883_15133 | 416 |
| 898 | 3300036401 | Ga0373937_0042381 | Ga0373937_0042381_1697_2947 | 416 |
| 899 | 3300037068 | Ga0373925_0011407 | Ga0373925_0011407_795_2045 | 416 |
| 900 | 3300037068 | Ga0373925_0025151 | Ga0373925_0025151_2478_3728 | 416 |
| 901 | 3300042012 | Ga0439455_0011454 | Ga0439455_0011454_517_1767 | 416 |
| 902 | 3300045051 | Ga0451576_0077714 | Ga0451576_0077714_1089_2345 | 416 |
| 903 | 3300046454 | Ga0495592_0004523 | Ga0495592_0004523_1333_2583 | 416 |
| 904 | 3300046455 | Ga0495603_0010842 | Ga0495603_0010842_2236_3486 | 416 |
| 905 | 3300046459 | Ga0495629_0002524 | Ga0495629_0002524_3972_5222 | 416 |
| 906 | 3300046459 | Ga0495629_0016178 | Ga0495629_0016178_863_2113 | 416 |
| 907 | 3300046459 | Ga0495629_0079774 | Ga0495629_0079774_426_1676 | 416 |
| 908 | 3300046462 | Ga0495651_0001150 | Ga0495651_0001150_13362_14612 | 416 |
| 909 | 3300046462 | Ga0495651_0003637 | Ga0495651_0003637_689_1939 | 416 |
| 910 | 3300046463 | Ga0495653_0001957 | Ga0495653_0001957_9597_10847 | 416 |
| 911 | 3300046463 | Ga0495653_0031725 | Ga0495653_0031725_2905_4155 | 416 |
| 912 | 3300046472 | Ga0495580_0001416 | Ga0495580_0001416_12092_13342 | 416 |
| 913 | 3300046473 | Ga0495582_0029211 | Ga0495582_0029211_1521_2771 | 416 |
| 914 | 3300046473 | Ga0495582_0083985 | Ga0495582_0083985_148_1398 | 416 |
| 915 | 3300046475 | Ga0495639_0006262 | Ga0495639_0006262_863_2113 | 416 |
| 916 | 3300046476 | Ga0495662_0002039 | Ga0495662_0002039_5846_7096 | 416 |
| 917 | 3300046477 | Ga0495664_0000178 | Ga0495664_0000178_20636_21886 | 416 |
| 918 | 3300046477 | Ga0495664_0034739 | Ga0495664_0034739_1529_2779 | 416 |
| 919 | 3300046491 | Ga0495584_0022637 | Ga0495584_0022637_1443_2693 | 416 |
| 920 | 3300046492 | Ga0495585_0015366 | Ga0495585_0015366_2482_3732 | 416 |
| 921 | 3300046499 | Ga0495594_0010424 | Ga0495594_0010424_3113_4363 | 416 |
| 922 | 3300046499 | Ga0495594_0052866 | Ga0495594_0052866_927_2177 | 416 |
| 923 | 3300046511 | Ga0495608_0001671 | Ga0495608_0001671_11832_13082 | 416 |
| 924 | 3300046514 | Ga0495618_0003686 | Ga0495618_0003686_5375_6625 | 416 |
| 925 | 3300046514 | Ga0495618_0025323 | Ga0495618_0025323_665_1915 | 416 |
| 926 | 3300046516 | Ga0495628_0001448 | Ga0495628_0001448_11172_12422 | 416 |
| 927 | 3300046516 | Ga0495628_0020094 | Ga0495628_0020094_2427_3677 | 416 |
| 928 | 3300046523 | Ga0495644_0012384 | Ga0495644_0012384_1543_2793 | 416 |
| 929 | 3300046526 | Ga0495666_0000187 | Ga0495666_0000187_22053_23303 | 416 |
| 930 | 3300046526 | Ga0495666_0035568 | Ga0495666_0035568_872_2122 | 416 |
| 931 | 3300046531 | Ga0495665_0006213 | Ga0495665_0006213_4378_5628 | 416 |
| 932 | 3300046533 | Ga0495640_0023352 | Ga0495640_0023352_723_1973 | 416 |
| 933 | 3300046535 | Ga0495586_0002551 | Ga0495586_0002551_1767_3017 | 416 |
| 934 | 3300046536 | Ga0495587_0002720 | Ga0495587_0002720_1477_2727 | 416 |
| 935 | 3300046557 | Ga0495622_0001697 | Ga0495622_0001697_1613_2863 | 416 |
| 936 | 3300046558 | Ga0495633_0018667 | Ga0495633_0018667_931_2181 | 416 |
| 937 | 3300046559 | Ga0495667_0002931 | Ga0495667_0002931_2690_3940 | 416 |
| 938 | 3300046642 | Ga0495634_0042214 | Ga0495634_0042214_845_2095 | 416 |
| 939 | 3300046642 | Ga0495634_0048272 | Ga0495634_0048272_1440_2690 | 416 |
| 940 | 3300046648 | Ga0495611_0006806 | Ga0495611_0006806_908_2158 | 416 |
| 941 | 3300046663 | Ga0495635_0001359 | Ga0495635_0001359_11090_12340 | 416 |
| 942 | 3300046663 | Ga0495635_0011040 | Ga0495635_0011040_4583_5833 | 416 |
| 943 | 3300046664 | Ga0495659_0005492 | Ga0495659_0005492_1339_2589 | 416 |
| 944 | 3300046674 | Ga0495588_0001695 | Ga0495588_0001695_5907_7157 | 416 |
| 945 | 3300046675 | Ga0495657_0003184 | Ga0495657_0003184_1222_2472 | 416 |
| 946 | 3300046678 | Ga0495599_0000806 | Ga0495599_0000806_13891_15141 | 416 |
| 947 | 3300046678 | Ga0495599_0085910 | Ga0495599_0085910_213_1463 | 416 |
| 948 | 3300046680 | Ga0495646_0033722 | Ga0495646_0033722_1210_2460 | 416 |
| 949 | 3300046681 | Ga0495647_0000638 | Ga0495647_0000638_6025_7275 | 416 |
| 950 | 3300046681 | Ga0495647_0036177 | Ga0495647_0036177_322_1572 | 416 |
| 951 | 3300046683 | Ga0495658_0004284 | Ga0495658_0004284_3150_4400 | 416 |
| 952 | 3300046683 | Ga0495658_0035163 | Ga0495658_0035163_147_1397 | 416 |
| 953 | 3300046689 | Ga0495613_0012243 | Ga0495613_0012243_4181_5431 | 416 |
| 954 | 3300046689 | Ga0495613_0057153 | Ga0495613_0057153_688_1938 | 416 |
| 955 | 3300046690 | Ga0495624_0015494 | Ga0495624_0015494_999_2249 | 416 |
| 956 | 3300046809 | Ga0495600_0001998 | Ga0495600_0001998_747_1997 | 416 |
| 957 | 3300046809 | Ga0495600_0006357 | Ga0495600_0006357_3077_4327 | 416 |
| 958 | 3300047315 | Ga0495581_0014671 | Ga0495581_0014671_20_1270 | 416 |
| 959 | 3300047315 | Ga0495581_0039846 | Ga0495581_0039846_605_1855 | 416 |
| 960 | 3300047317 | Ga0495604_0001423 | Ga0495604_0001423_13557_14807 | 416 |
| 961 | 3300047317 | Ga0495604_0005209 | Ga0495604_0005209_2304_3554 | 416 |
| 962 | 3300047317 | Ga0495604_0023581 | Ga0495604_0023581_2845_4095 | 416 |
| 963 | 3300047319 | Ga0495674_0042009 | Ga0495674_0042009_1537_2787 | 416 |
| 964 | 3300047319 | Ga0495674_0081140 | Ga0495674_0081140_688_1938 | 416 |
| 965 | 3300047321 | Ga0495676_0011575 | Ga0495676_0011575_863_2113 | 416 |
| 966 | 3300047322 | Ga0495680_0001491 | Ga0495680_0001491_4827_6077 | 416 |
| 967 | 3300047322 | Ga0495680_0007295 | Ga0495680_0007295_8248_9498 | 416 |
| 968 | 3300047322 | Ga0495680_0013705 | Ga0495680_0013705_310_1560 | 416 |
| 969 | 3300047444 | Ga0495675_0000657 | Ga0495675_0000657_723_1973 | 416 |
| 970 | 3300047446 | Ga0495679_031124 | Ga0495679_031124_463_1713 | 416 |
| 971 | 3300047673 | Ga0495593_0000309 | Ga0495593_0000309_61_1311 | 416 |
| 972 | 3300047673 | Ga0495593_0018863 | Ga0495593_0018863_642_1892 | 416 |
| 973 | 3300047673 | Ga0495593_0036157 | Ga0495593_0036157_560_1810 | 416 |
| 974 | 3300048089 | Ga0495614_0003292 | Ga0495614_0003292_1495_2745 | 416 |
| 975 | 3300048089 | Ga0495614_0033747 | Ga0495614_0033747_815_2065 | 416 |
| 976 | 3300048903 | Ga0496100_0000203 | Ga0496100_0000203_6718_7974 | 416 |
| 977 | 3300048903 | Ga0496100_0016419 | Ga0496100_0016419_893_2143 | 416 |
| 978 | 3300048903 | Ga0496100_0033208 | Ga0496100_0033208_153_1403 | 416 |
| 979 | 3300048904 | Ga0496101_0002812 | Ga0496101_0002812_2546_3802 | 416 |
| 980 | 3300048904 | Ga0496101_0013528 | Ga0496101_0013528_3148_4398 | 416 |
| 981 | 3300048905 | Ga0496102_0004838 | Ga0496102_0004838_8742_9998 | 416 |
| 982 | 3300048905 | Ga0496102_0118468 | Ga0496102_0118468_837_2087 | 416 |
| 983 | 3300048906 | Ga0496103_0001529 | Ga0496103_0001529_7655_8911 | 416 |
| 984 | 3300048907 | Ga0496104_0026931 | Ga0496104_0026931_4014_5288 | 416 |
| 985 | 3300048907 | Ga0496104_0063751 | Ga0496104_0063751_2137_3387 | 416 |
| 986 | 3300048908 | Ga0496105_0124352 | Ga0496105_0124352_267_1517 | 416 |
| 987 | 3300048909 | Ga0496106_0002909 | Ga0496106_0002909_5070_6326 | 416 |
| 988 | 3300048909 | Ga0496106_0035978 | Ga0496106_0035978_1448_2698 | 416 |
| 989 | 3300048910 | Ga0496107_0000268 | Ga0496107_0000268_22560_23816 | 416 |
| 990 | 3300048910 | Ga0496107_0126850 | Ga0496107_0126850_501_1751 | 416 |
| 991 | 3300048911 | Ga0496108_0010827 | Ga0496108_0010827_5831_7087 | 416 |
| 992 | 3300048912 | Ga0496109_0006654 | Ga0496109_0006654_7655_8911 | 416 |
| 993 | 3300048912 | Ga0496109_0074422 | Ga0496109_0074422_937_2187 | 416 |
| 994 | 3300048913 | Ga0496110_0016005 | Ga0496110_0016005_3942_5198 | 416 |
| 995 | 3300048913 | Ga0496110_0035409 | Ga0496110_0035409_1333_2583 | 416 |
| 996 | 3300048915 | Ga0496112_0028569 | Ga0496112_0028569_1429_2685 | 416 |
| 997 | 3300048915 | Ga0496112_0032191 | Ga0496112_0032191_3676_4926 | 416 |
| 998 | 3300048916 | Ga0496113_0004401 | Ga0496113_0004401_3702_4952 | 416 |
| 999 | 3300048916 | Ga0496113_0060873 | Ga0496113_0060873_408_1658 | 416 |
| 1000 | 3300048917 | Ga0496114_0019587 | Ga0496114_0019587_1357_2607 | 416 |
| 1001 | 3300048917 | Ga0496114_0115053 | Ga0496114_0115053_147_1403 | 416 |
| 1002 | 3300048917 | Ga0496114_0190865 | Ga0496114_0190865_293_1543 | 416 |
| 1003 | 3300048924 | Ga0496121_0094938 | Ga0496121_0094938_974_2224 | 416 |
| 1004 | 3300049571 | Ga0501034_0117384 | Ga0501034_0117384_96_1451 | 416 |
| 1005 | 3300049593 | Ga0501077_0023243 | Ga0501077_0023243_926_2182 | 416 |
| 1006 | 3300050507 | nmdc:mga05p37_17539_c1 | nmdc:mga05p37_17539_c1_523_1773 | 416 |
| 1007 | 3300050507 | nmdc:mga05p37_32_c1 | nmdc:mga05p37_32_c1_55875_57125 | 416 |
| 1008 | 3300050508 | nmdc:mga09592_6535_c1 | nmdc:mga09592_6535_c1_7222_8472 | 416 |
| 1009 | 3300050509 | nmdc:mga0qj67_355_c1 | nmdc:mga0qj67_355_c1_2753_4003 | 416 |
| 1010 | 3300050510 | nmdc:mga06r32_5297_c1 | nmdc:mga06r32_5297_c1_3138_4388 | 416 |
| 1011 | 3300050511 | nmdc:mga08y16_19018_c1 | nmdc:mga08y16_19018_c1_1310_2566 | 416 |
| 1012 | 3300050511 | nmdc:mga08y16_2238_c1 | nmdc:mga08y16_2238_c1_9512_10762 | 416 |
| 1013 | 3300050511 | nmdc:mga08y16_424126_c1 | nmdc:mga08y16_424126_c1_81_1331 | 416 |
| 1014 | 3300050511 | nmdc:mga08y16_6098_c1 | nmdc:mga08y16_6098_c1_2794_4050 | 416 |
| 1015 | 3300050512 | nmdc:mga0n895_15498_c1 | nmdc:mga0n895_15498_c1_3747_4997 | 416 |
| 1016 | 3300050512 | nmdc:mga0n895_547_c1 | nmdc:mga0n895_547_c1_17286_18536 | 416 |
| 1017 | 3300050512 | nmdc:mga0n895_8451_c1 | nmdc:mga0n895_8451_c1_442_1698 | 416 |
| 1018 | 3300050513 | nmdc:mga0rr50_73282_c1 | nmdc:mga0rr50_73282_c1_1285_2535 | 416 |
| 1019 | 3300050513 | nmdc:mga0rr50_78412_c1 | nmdc:mga0rr50_78412_c1_1070_2320 | 416 |
| 1020 | 3300050514 | nmdc:mga08x19_76395_c1 | nmdc:mga08x19_76395_c1_881_2131 | 416 |
| 1021 | 3300050515 | nmdc:mga0a205_53544_c1 | nmdc:mga0a205_53544_c1_1726_2982 | 416 |
| 1022 | 3300050515 | nmdc:mga0a205_6205_c1 | nmdc:mga0a205_6205_c1_2853_4103 | 416 |
| 1023 | 3300050515 | nmdc:mga0a205_629_c1 | nmdc:mga0a205_629_c1_7059_8309 | 416 |
| 1024 | 3300053077 | Ga0495601_0014254 | Ga0495601_0014254_2805_4055 | 416 |
| 1025 | 3300053077 | Ga0495601_0031312 | Ga0495601_0031312_688_1938 | 416 |
| 1026 | 3300053078 | Ga0495612_0001070 | Ga0495612_0001070_7919_9169 | 416 |
| 1027 | 3300053078 | Ga0495612_0008371 | Ga0495612_0008371_177_1427 | 416 |
| 1028 | 3300053084 | Ga0495595_0002555 | Ga0495595_0002555_2896_4146 | 416 |
| 1029 | 3300053084 | Ga0495595_0013740 | Ga0495595_0013740_547_1797 | 416 |
| 1030 | 3300053085 | Ga0495619_0000016 | Ga0495619_0000016_99459_100709 | 416 |
| 1031 | 3300053085 | Ga0495619_0000670 | Ga0495619_0000670_287_1537 | 416 |
| 1032 | 3300053085 | Ga0495619_0002830 | Ga0495619_0002830_4916_6166 | 416 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4kto-assembly1.cif.gz_A | crystal structure of a putative isovaleryl-coa dehydrogenase (psi-nysgrc-012251) from sinorhizobium meliloti 1021 | 0.9347 | 11 | 406 |
| 4kto-assembly1.cif.gz_D | crystal structure of a putative isovaleryl-coa dehydrogenase (psi-nysgrc-012251) from sinorhizobium meliloti 1021 | 0.9328 | 11 | 404 |
| 3mdd-assembly1.cif.gz_A | crystal structures of medium chain acyl-coa dehydrogenase from pig liver mitochondria with and without substrate | 0.9303 | 11 | 405 |
| 7w0j-assembly1.cif.gz_F | acyl-coa dehydrogenase, tfu_1647 | 0.9288 | 12 | 403 |
| 7w0j-assembly1.cif.gz_A | acyl-coa dehydrogenase, tfu_1647 | 0.9282 | 12 | 403 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P96397_240_357_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9773 | 264 | 377 | 1.20.140.10 |
| af_I6Y0W5_249_394_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9667 | 265 | 403 | 1.20.140.10 |
| 1jqiA03 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9629 | 265 | 403 | 1.20.140.10 |
| 1jqiB03 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9624 | 265 | 403 | 1.20.140.10 |
| 1bucB03 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.962 | 265 | 403 | 1.20.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2R6I637-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9769 | 283 | 403 |
GO:0003995
|
| AF-A0A3S2AM29-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9602 | 239 | 404 |
GO:0003995
|
| AF-A0A5R2MXK0-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9568 | 241 | 356 |
GO:0016627
|
| AF-A0A3M1F165-F1-model_v4 | Acyl-CoA dehydrogenase | 0.952 | 162 | 403 |
GO:0003995
GO:0033539 GO:0046359 |
| AF-A0A7W0Y2I1-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9507 | 258 | 389 |
GO:0003995
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar