F488643

General Info

Members Datasets Scaffolds Average Seq Length
1032 421 1023 413

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0117384|Ga0501034_0117384_96_1451
Length 451
Sequence MRQICIRLARNRTLDVHAHAALHPNAPGFPPQQEHLMILADDRGLSEEQRMMRDTCRAFVNEHVIPFTRQHWKREWIMTPEERLPAKILEIADAIGIRTIGIPEEFGGITLDPKTEVQTLALIAEEIARGDSGLADKLVQVWKISKLLKVIAPRHLQEYWFPRIVADPSFLLAHCSTEPRGASDRWLGYDTPETAFQTKAVLKGDEWIINGRKQFVSNGYDAQLYVVYANSRPGVKMAEGTSSFLIPRGTPGFSIARCNETMGGRFMNNGEMVFEDCRVPRDHCLVENEALARRAGHYALPGRIIQTSKNIGIGIAAFERTADYVQNYVQGGRILIKHQVVASRLADMATRICAVRSILKDASRAVDEGSPDADYLCSMAKLFASEEILKVCQNAVELHGGNGTMLDFGIEKLYRDAMMFLHMDGTVDITRFKIIKNLFPQTAGKYAGPEA

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
3 2643221557 Ensifer sp. Root558 Isolate Unclassified
4 2643221610 Ensifer sp. Root74 Isolate Unclassified
5 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
6 2643221668 Ensifer sp. Root423 Isolate Unclassified
7 2643221675 Ensifer sp. Root1298 Isolate Unclassified
8 2643221680 Ensifer sp. Root1312 Isolate Unclassified
9 2643221726 Ensifer sp. Root954 Isolate Unclassified
10 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
11 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
12 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
13 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
14 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
15 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
16 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
17 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
18 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
19 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
20 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
21 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
22 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
23 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
24 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
25 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
26 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
27 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
28 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
46 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
59 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
60 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
61 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
62 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
63 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
64 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
65 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
66 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
73 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
74 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
75 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
76 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
77 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
78 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
81 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
82 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
83 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
84 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
85 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
86 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
87 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
88 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
89 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
99 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
100 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
101 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
102 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
103 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
104 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
105 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
106 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
107 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
108 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
109 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
110 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
111 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
112 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
115 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
116 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
117 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
118 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
119 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
120 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
121 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
122 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
123 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
125 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
134 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
135 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
136 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
137 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
138 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
139 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
140 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
141 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
142 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
143 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
144 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
153 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
155 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
233 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
237 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
238 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
239 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
240 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
241 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
242 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
243 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
244 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
245 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
246 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
247 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
248 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
249 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
250 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
251 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
252 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
253 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
254 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
255 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
256 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
257 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
258 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
259 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
260 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
261 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
262 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
263 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
264 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
265 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
266 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
267 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
268 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
269 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
270 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
271 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
272 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
273 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
274 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
275 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
276 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
277 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
278 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
279 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
280 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
281 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
282 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
283 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
284 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
285 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
286 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
287 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
288 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
289 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
290 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
291 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
292 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
293 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
294 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
295 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
296 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
297 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
298 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
299 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
300 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
301 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
302 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
303 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
304 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
305 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
306 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
307 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
308 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
309 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
310 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
311 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
312 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
313 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
314 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
315 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
316 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
317 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
318 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
319 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
320 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
321 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
322 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
323 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
324 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
325 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
326 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
327 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
328 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
329 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
330 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
331 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
332 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
333 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
334 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
335 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
336 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
337 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
338 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
339 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
340 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
341 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
342 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
343 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
344 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
345 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
346 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
347 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
348 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
349 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
350 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
351 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
352 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
353 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
354 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
355 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
356 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
357 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
358 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
359 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
360 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
361 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
362 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
363 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
364 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
365 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
366 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
367 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
368 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
369 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
370 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
371 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
372 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
373 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
374 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
375 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
376 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
386 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
387 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
388 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
389 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
390 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
391 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
392 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
393 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
396 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
397 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
398 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
399 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
400 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
401 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
402 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
403 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
404 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
405 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
406 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
407 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
408 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
409 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
410 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
411 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
412 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
413 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
414 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
415 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
416 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
417 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
418 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
419 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
420 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
421 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0
Isolates 0.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.33
Nodule 0
Rhizoplane 7.36
Rhizosphere 89.05
Stem 0
Stem Tuber 0
Unclassified 1.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214856314 2209111006 Bacteria 8020
2 ARcpr5oldR_c000046 3300000041 Bacteria 22854
3 ARSoilYngRDRAFT_c00078 3300000042 Bacteria 16119
4 ARcpr5yngRDRAFT_c000072 3300000043 Bacteria 16816
5 ARSoilOldRDRAFT_c000019 3300000044 Bacteria 37577
6 ARCol0oldRDRAFT_c00019 3300000045 Bacteria 12070
7 ARCol0yngRDRAFT_1000004 3300000652 Bacteria 52222
8 JGI24746J21847_1000147 3300001977 Bacteria 8859
9 JGI24746J21847_1003854 3300001977 Bacteria 2369
10 JGI24747J21853_1000217 3300001978 Bacteria 3101
11 JGI24739J22299_10010699 3300001989 Bacteria 3402
12 JGI24737J22298_10002058 3300001990 Bacteria 7196
13 JGI24737J22298_10003740 3300001990 Bacteria 5356
14 JGI24737J22298_10023198 3300001990 Bacteria 1969
15 JGI24743J22301_10003718 3300001991 Bacteria 2435
16 JGI24750J21931_1000430 3300002070 Bacteria 6827
17 JGI24750J21931_1002146 3300002070 Bacteria 2393
18 JGI24745J21846_1001132 3300002073 Bacteria 2537
19 JGI24748J21848_1000555 3300002074 Bacteria 4040
20 JGI24738J21930_10004182 3300002075 Bacteria 3559
21 JGI24744J21845_10000132 3300002077 Bacteria 10427
22 JGI24034J26672_10002921 3300002239 Bacteria 2366
23 JGI24034J26672_10005798 3300002239 Bacteria 1775
24 JGI24742J22300_10000106 3300002244 Bacteria 11917
25 JGI24742J22300_10000483 3300002244 Bacteria 5928
26 Ga0055524_1001448 3300003775 Bacteria 13592
27 JGI25405J52794_10000722 3300003911 Bacteria 5036
28 JGI25405J52794_10002175 3300003911 Bacteria 3340
29 JGI25405J52794_10009788 3300003911 Bacteria 1815
30 Ga0065704_10075977 3300005289 Bacteria 5320
31 Ga0065715_10091019 3300005293 Bacteria 6205
32 Ga0070658_10022611 3300005327 Bacteria 5045
33 Ga0070658_10042393 3300005327 Bacteria 3676
34 Ga0070658_10145210 3300005327 Bacteria 1983
35 Ga0070676_10102718 3300005328 Bacteria 1769
36 Ga0070683_100001872 3300005329 Bacteria 16425
37 Ga0070683_100110942 3300005329 Bacteria 2588
38 Ga0070683_100329083 3300005329 Bacteria 1455
39 Ga0070690_100027115 3300005330 Bacteria 3540
40 Ga0070670_100005524 3300005331 Bacteria 10669
41 Ga0070670_100040546 3300005331 Bacteria 4002
42 Ga0070670_100138127 3300005331 Bacteria 2107
43 Ga0070677_10000429 3300005333 Bacteria 14486
44 Ga0068869_100004944 3300005334 Bacteria 8338
45 Ga0068869_100113167 3300005334 Bacteria 2067
46 Ga0070680_100016120 3300005336 Bacteria 5873
47 Ga0070680_100018787 3300005336 Bacteria 5470
48 Ga0070680_100076342 3300005336 Bacteria 2758
49 Ga0070680_100258243 3300005336 Bacteria 1473
50 Ga0070680_100284952 3300005336 Bacteria 1400
51 Ga0070682_100000695 3300005337 Bacteria 20200
52 Ga0068868_100004036 3300005338 Bacteria 10230
53 Ga0068868_100087923 3300005338 Bacteria 2500
54 Ga0070660_100001014 3300005339 Bacteria 18890
55 Ga0070660_100046044 3300005339 Bacteria 3342
56 Ga0070660_100072432 3300005339 Bacteria 2693
57 Ga0070660_100116389 3300005339 Bacteria 2132
58 Ga0070689_100012268 3300005340 Bacteria 6167
59 Ga0070689_100114941 3300005340 Bacteria 2144
60 Ga0070691_10011581 3300005341 Bacteria 4030
61 Ga0070691_10065025 3300005341 Bacteria 1761
62 Ga0070687_100112257 3300005343 Bacteria 1545
63 Ga0070661_100011491 3300005344 Bacteria 6167
64 Ga0070692_10002719 3300005345 Bacteria 6941
65 Ga0070668_100058985 3300005347 Bacteria 2970
66 Ga0070668_100128540 3300005347 Bacteria 2031
67 Ga0070669_100015276 3300005353 Bacteria 5470
68 Ga0070675_100000240 3300005354 Bacteria 35499
69 Ga0070675_100014864 3300005354 Bacteria 6144
70 Ga0070671_100015801 3300005355 Bacteria 6098
71 Ga0070671_100094737 3300005355 Bacteria 2503
72 Ga0070674_100013342 3300005356 Bacteria 5076
73 Ga0070674_100013446 3300005356 Bacteria 5062
74 Ga0070673_100007045 3300005364 Bacteria 7375
75 Ga0070688_100001905 3300005365 Bacteria 10468
76 Ga0070688_100049110 3300005365 Bacteria 2624
77 Ga0070659_100007610 3300005366 Bacteria 7873
78 Ga0070659_100010913 3300005366 Bacteria 6703
79 Ga0070667_100005456 3300005367 Bacteria 10623
80 Ga0070667_100020849 3300005367 Bacteria 5443
81 Ga0070667_100159811 3300005367 Bacteria 1984
82 Ga0070709_10000363 3300005434 Bacteria 28041
83 Ga0070709_10033820 3300005434 Bacteria 3094
84 Ga0070714_100000833 3300005435 Bacteria 21830
85 Ga0070714_100056156 3300005435 Bacteria 3367
86 Ga0070714_100094014 3300005435 Bacteria 2631
87 Ga0070713_100000381 3300005436 Bacteria 28351
88 Ga0070713_100003768 3300005436 Bacteria 10039
89 Ga0070713_100019401 3300005436 Bacteria 5190
90 Ga0070713_100097676 3300005436 Bacteria 2538
91 Ga0070710_10000226 3300005437 Bacteria 26288
92 Ga0070710_10004588 3300005437 Bacteria 6527
93 Ga0070710_10076967 3300005437 Bacteria 1937
94 Ga0070711_100001128 3300005439 Bacteria 14280
95 Ga0070705_100000612 3300005440 Bacteria 20651
96 Ga0070705_100027104 3300005440 Bacteria 3125
97 Ga0070700_100009080 3300005441 Bacteria 5449
98 Ga0070700_100027831 3300005441 Bacteria 3356
99 Ga0070694_100001207 3300005444 Bacteria 14909
100 Ga0070694_100002780 3300005444 Bacteria 10387
101 Ga0070694_100065749 3300005444 Bacteria 2485
102 Ga0070708_100074687 3300005445 Bacteria 3058
103 Ga0070708_100141210 3300005445 Bacteria 2233
104 Ga0070663_100015442 3300005455 Bacteria 4930
105 Ga0070663_100025552 3300005455 Bacteria 3989
106 Ga0070663_100040436 3300005455 Bacteria 3264
107 Ga0070662_100013532 3300005457 Bacteria 5430
108 Ga0070662_100028585 3300005457 Bacteria 3881
109 Ga0070662_100080215 3300005457 Bacteria 2429
110 Ga0070662_100204883 3300005457 Bacteria 1567
111 Ga0070662_100261831 3300005457 Bacteria 1393
112 Ga0070681_10011673 3300005458 Bacteria 8700
113 Ga0070681_10019315 3300005458 Bacteria 6820
114 Ga0070681_10096828 3300005458 Bacteria 2899
115 Ga0070681_10146679 3300005458 Bacteria 2288
116 Ga0070681_10244126 3300005458 Bacteria 1709
117 Ga0070681_10252357 3300005458 Bacteria 1676
118 Ga0068867_100132721 3300005459 Bacteria 1937
119 Ga0070685_10014546 3300005466 Bacteria 4171
120 Ga0070685_10040164 3300005466 Bacteria 2662
121 Ga0070685_10051505 3300005466 Bacteria 2380
122 Ga0070706_100040997 3300005467 Bacteria 4274
123 Ga0070707_100053998 3300005468 Bacteria 3852
124 Ga0070707_100193638 3300005468 Bacteria 1982
125 Ga0070698_100185928 3300005471 Bacteria 2015
126 Ga0070699_100002532 3300005518 Bacteria 16418
127 Ga0070699_100073539 3300005518 Bacteria 2974
128 Ga0070679_100023238 3300005530 Bacteria 6066
129 Ga0070679_100034205 3300005530 Bacteria 5036
130 Ga0070679_100040675 3300005530 Bacteria 4625
131 Ga0070679_100063861 3300005530 Bacteria 3670
132 Ga0070679_100084499 3300005530 Bacteria 3162
133 Ga0070684_100009261 3300005535 Bacteria 7750
134 Ga0070684_100062206 3300005535 Bacteria 3269
135 Ga0070684_100118724 3300005535 Bacteria 2378
136 Ga0070697_100039102 3300005536 Bacteria 3835
137 Ga0070697_100091058 3300005536 Bacteria 2521
138 Ga0068853_100009694 3300005539 Bacteria 7766
139 Ga0068853_100069407 3300005539 Bacteria 3065
140 Ga0070672_100001847 3300005543 Bacteria 13222
141 Ga0070672_100068241 3300005543 Bacteria 2820
142 Ga0070686_100008725 3300005544 Bacteria 5681
143 Ga0070686_100010163 3300005544 Bacteria 5296
144 Ga0070686_100038773 3300005544 Bacteria 2964
145 Ga0070695_100000054 3300005545 Bacteria 45999
146 Ga0070695_100029614 3300005545 Bacteria 3402
147 Ga0070695_100039414 3300005545 Bacteria 2986
148 Ga0070696_100000931 3300005546 Bacteria 18952
149 Ga0070696_100004350 3300005546 Bacteria 9440
150 Ga0070696_100038185 3300005546 Bacteria 3314
151 Ga0070704_100000180 3300005549 Bacteria 25489
152 Ga0070704_100004531 3300005549 Bacteria 8025
153 Ga0068855_100014855 3300005563 Bacteria 9377
154 Ga0068855_100017390 3300005563 Bacteria 8651
155 Ga0068855_100045702 3300005563 Bacteria 5178
156 Ga0068855_100091933 3300005563 Bacteria 3500
157 Ga0068855_100215519 3300005563 Bacteria 2155
158 Ga0070664_100001002 3300005564 Bacteria 22163
159 Ga0070664_100058640 3300005564 Bacteria 3274
160 Ga0068857_100131016 3300005577 Bacteria 2262
161 Ga0068857_100229267 3300005577 Bacteria 1698
162 Ga0068856_100023460 3300005614 Bacteria 5998
163 Ga0070702_100019293 3300005615 Bacteria 3554
164 Ga0070702_100096972 3300005615 Bacteria 1801
165 Ga0068852_100004985 3300005616 Bacteria 9446
166 Ga0068852_100047574 3300005616 Bacteria 3659
167 Ga0068859_100000494 3300005617 Bacteria 38849
168 Ga0068859_100010808 3300005617 Bacteria 9190
169 Ga0068859_100075191 3300005617 Bacteria 3418
170 Ga0068864_100003922 3300005618 Bacteria 12254
171 Ga0068864_100075630 3300005618 Bacteria 2941
172 Ga0068864_100105666 3300005618 Bacteria 2502
173 Ga0068861_100003710 3300005719 Bacteria 10192
174 Ga0068861_100014951 3300005719 Bacteria 5458
175 Ga0068861_100023937 3300005719 Bacteria 4410
176 Ga0068870_10000157 3300005840 Bacteria 23872
177 Ga0068870_10072506 3300005840 Bacteria 1882
178 Ga0068863_100000674 3300005841 Bacteria 34508
179 Ga0068858_100091776 3300005842 Bacteria 2826
180 Ga0068860_100001274 3300005843 Bacteria 27410
181 Ga0068860_100012435 3300005843 Bacteria 8381
182 Ga0068860_100045880 3300005843 Bacteria 4167
183 Ga0068860_100130650 3300005843 Bacteria 2409
184 Ga0068860_100188969 3300005843 Bacteria 1993
185 Ga0068862_100000795 3300005844 Bacteria 31295
186 Ga0068862_100070320 3300005844 Bacteria 3021
187 Ga0081455_10000059 3300005937 Bacteria 119148
188 Ga0081455_10002427 3300005937 Bacteria 22238
189 Ga0081455_10003542 3300005937 Bacteria 17909
190 Ga0081455_10004480 3300005937 Bacteria 15632
191 Ga0081455_10006602 3300005937 Bacteria 12413
192 Ga0081455_10169619 3300005937 Bacteria 1664
193 Ga0081538_10007110 3300005981 Bacteria 9723
194 Ga0081538_10051140 3300005981 Bacteria 2485
195 Ga0081538_10070167 3300005981 Bacteria 1936
196 Ga0081540_1002311 3300005983 Bacteria 15633
197 Ga0081540_1003101 3300005983 Bacteria 13314
198 Ga0081540_1008452 3300005983 Bacteria 7190
199 Ga0081540_1012205 3300005983 Bacteria 5681
200 Ga0081540_1014938 3300005983 Bacteria 4939
201 Ga0081540_1021121 3300005983 Bacteria 3890
202 Ga0070717_10000161 3300006028 Bacteria 50633
203 Ga0070717_10002481 3300006028 Bacteria 13029
204 Ga0070717_10063658 3300006028 Bacteria 3062
205 Ga0070717_10080835 3300006028 Bacteria 2728
206 Ga0070717_10115314 3300006028 Bacteria 2296
207 Ga0075365_10065661 3300006038 Bacteria 2432
208 Ga0075368_10025334 3300006042 Bacteria 2276
209 Ga0075432_10032964 3300006058 Bacteria 1795
210 Ga0070715_10014168 3300006163 Bacteria 2946
211 Ga0070715_10041416 3300006163 Bacteria 1930
212 Ga0070716_100000149 3300006173 Bacteria 28054
213 Ga0070716_100011064 3300006173 Bacteria 4538
214 Ga0070716_100045195 3300006173 Bacteria 2471
215 Ga0070712_100000413 3300006175 Bacteria 24419
216 Ga0070712_100022489 3300006175 Bacteria 4154
217 Ga0070712_100140207 3300006175 Bacteria 1844
218 Ga0075362_10026782 3300006177 Bacteria 2465
219 Ga0075367_10010139 3300006178 Bacteria 4941
220 Ga0075367_10026188 3300006178 Bacteria 3305
221 Ga0075367_10068531 3300006178 Bacteria 2128
222 Ga0075369_10017707 3300006186 Bacteria 2893
223 Ga0075366_10021275 3300006195 Bacteria 3770
224 Ga0075370_10072975 3300006353 Bacteria 1965
225 Ga0068871_100001066 3300006358 Bacteria 18401
226 Ga0075428_100038761 3300006844 Bacteria 5244
227 Ga0075428_100049877 3300006844 Bacteria 4592
228 Ga0075428_100088746 3300006844 Bacteria 3373
229 Ga0075428_100157176 3300006844 Bacteria 2469
230 Ga0075430_100000015 3300006846 Bacteria 89952
231 Ga0075430_100000070 3300006846 Bacteria 55805
232 Ga0075430_100001098 3300006846 Bacteria 21488
233 Ga0075430_100002472 3300006846 Bacteria 15389
234 Ga0075430_100006043 3300006846 Bacteria 10210
235 Ga0075430_100031115 3300006846 Bacteria 4530
236 Ga0075431_100001221 3300006847 Bacteria 23276
237 Ga0075431_100004759 3300006847 Bacteria 13347
238 Ga0075431_100011228 3300006847 Bacteria 9022
239 Ga0075431_100018201 3300006847 Bacteria 7149
240 Ga0075431_100098881 3300006847 Bacteria 3011
241 Ga0075433_10008464 3300006852 Bacteria 8210
242 Ga0075433_10010476 3300006852 Bacteria 7442
243 Ga0075433_10109013 3300006852 Unclassified 2456
244 Ga0075434_100000212 3300006871 Bacteria 39628
245 Ga0075434_100016655 3300006871 Bacteria 7069
246 Ga0075434_100037805 3300006871 Bacteria 4778
247 Ga0075434_100048636 3300006871 Bacteria 4208
248 Ga0075434_100060574 3300006871 Bacteria 3765
249 Ga0075434_100084707 3300006871 Bacteria 3168
250 Ga0075434_100090220 3300006871 Bacteria 3067
251 Ga0075434_100090704 3300006871 Bacteria 3057
252 Ga0075429_100003999 3300006880 Bacteria 12622
253 Ga0075429_100021829 3300006880 Bacteria 5550
254 Ga0075429_100250984 3300006880 Bacteria 1549
255 Ga0068865_100000131 3300006881 Bacteria 38862
256 Ga0075436_100143097 3300006914 Bacteria 1681
257 Ga0097620_100000494 3300006931 Bacteria 38849
258 Ga0097620_100010810 3300006931 Bacteria 9190
259 Ga0097620_100075191 3300006931 Bacteria 3418
260 Ga0075435_100034976 3300007076 Bacteria 3985
261 Ga0075435_100065898 3300007076 Bacteria 2945
262 Ga0075435_100077055 3300007076 Bacteria 2733
263 Ga0075435_100121660 3300007076 Bacteria 2178
264 Ga0099794_10008099 3300007265 Bacteria 4352
265 Ga0099794_10014325 3300007265 Bacteria 3472
266 Ga0099794_10043551 3300007265 Bacteria 2143
267 Ga0105240_10054986 3300009093 Bacteria 4985
268 Ga0111539_10000138 3300009094 Bacteria 82968
269 Ga0111539_10028951 3300009094 Bacteria 6755
270 Ga0111539_10039247 3300009094 Bacteria 5708
271 Ga0111539_10058878 3300009094 Bacteria 4557
272 Ga0111539_10064307 3300009094 Bacteria 4340
273 Ga0111539_10245411 3300009094 Bacteria 2085
274 Ga0105245_10011704 3300009098 Bacteria 7635
275 Ga0105245_10045266 3300009098 Bacteria 3930
276 Ga0105245_10059696 3300009098 Bacteria 3434
277 Ga0105245_10122401 3300009098 Bacteria 2431
278 Ga0105245_10175167 3300009098 Bacteria 2045
279 Ga0105247_10042379 3300009101 Bacteria 2788
280 Ga0105247_10042433 3300009101 Bacteria 2786
281 Ga0114129_10002312 3300009147 Bacteria 26434
282 Ga0114129_10003950 3300009147 Bacteria 20934
283 Ga0114129_10027223 3300009147 Bacteria 8094
284 Ga0114129_10102152 3300009147 Bacteria 3966
285 Ga0114129_10110227 3300009147 Bacteria 3799
286 Ga0114129_10110393 3300009147 Bacteria 3796
287 Ga0114129_10330175 3300009147 Bacteria 2025
288 Ga0105243_10006299 3300009148 Bacteria 9170
289 Ga0105243_10032492 3300009148 Bacteria 4033
290 Ga0105243_10091087 3300009148 Bacteria 2511
291 Ga0105243_10127230 3300009148 Bacteria 2157
292 Ga0105243_10176009 3300009148 Bacteria 1857
293 Ga0105243_10184399 3300009148 Bacteria 1817
294 Ga0105241_10056240 3300009174 Bacteria 3016
295 Ga0105241_10064613 3300009174 Bacteria 2826
296 Ga0105242_10078215 3300009176 Bacteria 2761
297 Ga0105242_10177574 3300009176 Bacteria 1876
298 Ga0105248_10002392 3300009177 Bacteria 20840
299 Ga0105248_10012777 3300009177 Bacteria 9265
300 Ga0105248_10013552 3300009177 Bacteria 8976
301 Ga0105237_10018866 3300009545 Bacteria 7132
302 Ga0105237_10042427 3300009545 Bacteria 4587
303 Ga0105238_10060021 3300009551 Bacteria 3809
304 Ga0105249_10001029 3300009553 Bacteria 24663
305 Ga0105249_10017439 3300009553 Bacteria 6373
306 Ga0105249_10024785 3300009553 Bacteria 5394
307 Ga0099796_10001372 3300010159 Bacteria 4859
308 Ga0105239_10043450 3300010375 Bacteria 4926
309 Ga0105239_10112207 3300010375 Bacteria 3023
310 Ga0105246_10022164 3300011119 Bacteria 4097
311 Ga0105246_10027151 3300011119 Bacteria 3748
312 Ga0157371_10030802 3300013102 Bacteria 3867
313 Ga0157374_10000671 3300013296 Bacteria 30150
314 Ga0157378_10088364 3300013297 Bacteria 2812
315 Ga0157378_10150135 3300013297 Bacteria 2171
316 Ga0157378_10411027 3300013297 Bacteria 1336
317 Ga0163162_10177606 3300013306 Bacteria 2255
318 Ga0157375_10002908 3300013308 Bacteria 14847
319 Ga0157375_10028268 3300013308 Bacteria 5254
320 Ga0157375_10110039 3300013308 Bacteria 2852
321 Ga0163163_10004312 3300014325 Bacteria 12118
322 Ga0163163_10010637 3300014325 Bacteria 8290
323 Ga0163163_10033625 3300014325 Bacteria 4961
324 Ga0157380_10005886 3300014326 Bacteria 8579
325 Ga0157380_10132662 3300014326 Bacteria 2127
326 Ga0157377_10000570 3300014745 Bacteria 15436
327 Ga0157379_10000345 3300014968 Bacteria 37352
328 Ga0157379_10033827 3300014968 Bacteria 4558
329 Ga0157379_10133620 3300014968 Bacteria 2235
330 Ga0157376_10025542 3300014969 Bacteria 4654
331 Ga0157376_10039773 3300014969 Bacteria 3838
332 Ga0157376_10098105 3300014969 Bacteria 2554
333 Ga0163161_10004669 3300017792 Bacteria 9525
334 Ga0163161_10037669 3300017792 Bacteria 3467
335 Ga0213875_10080492 3300021388 Bacteria 1520
336 Ga0207666_1000069 3300025271 Bacteria 17953
337 Ga0207666_1001040 3300025271 Bacteria 3294
338 Ga0207673_1007066 3300025290 Bacteria 1401
339 Ga0209256_1000073 3300025299 Bacteria 237553
340 Ga0207697_10000390 3300025315 Bacteria 24639
341 Ga0207697_10006568 3300025315 Bacteria 5248
342 Ga0207713_1036708 3300025735 Bacteria 2099
343 Ga0207653_10024508 3300025885 Bacteria 1926
344 Ga0207682_10000048 3300025893 Bacteria 50998
345 Ga0207682_10008138 3300025893 Bacteria 4157
346 Ga0207692_10000966 3300025898 Bacteria 10455
347 Ga0207692_10005320 3300025898 Bacteria 5150
348 Ga0207710_10022873 3300025900 Bacteria 2683
349 Ga0207688_10001496 3300025901 Bacteria 12264
350 Ga0207688_10004951 3300025901 Bacteria 7249
351 Ga0207680_10045613 3300025903 Bacteria 2585
352 Ga0207647_10013329 3300025904 Bacteria 5705
353 Ga0207647_10014742 3300025904 Bacteria 5380
354 Ga0207685_10004104 3300025905 Bacteria 3651
355 Ga0207699_10000366 3300025906 Bacteria 23940
356 Ga0207699_10074768 3300025906 Bacteria 2082
357 Ga0207645_10012526 3300025907 Bacteria 5751
358 Ga0207645_10030390 3300025907 Bacteria 3480
359 Ga0207643_10000581 3300025908 Bacteria 23180
360 Ga0207643_10007658 3300025908 Bacteria 5800
361 Ga0207705_10024062 3300025909 Bacteria 4345
362 Ga0207684_10023396 3300025910 Bacteria 5276
363 Ga0207684_10117905 3300025910 Bacteria 2274
364 Ga0207654_10004716 3300025911 Bacteria 6899
365 Ga0207707_10007064 3300025912 Bacteria 9788
366 Ga0207707_10016616 3300025912 Bacteria 6416
367 Ga0207707_10018671 3300025912 Bacteria 6047
368 Ga0207707_10048473 3300025912 Bacteria 3700
369 Ga0207707_10150622 3300025912 Bacteria 2034
370 Ga0207707_10169353 3300025912 Bacteria 1909
371 Ga0207695_10037025 3300025913 Bacteria 5267
372 Ga0207671_10011618 3300025914 Bacteria 7146
373 Ga0207693_10002752 3300025915 Bacteria 15229
374 Ga0207693_10010010 3300025915 Bacteria 7706
375 Ga0207693_10011653 3300025915 Bacteria 7112
376 Ga0207693_10072370 3300025915 Bacteria 2699
377 Ga0207663_10006969 3300025916 Bacteria 5827
378 Ga0207663_10058549 3300025916 Bacteria 2432
379 Ga0207663_10070026 3300025916 Bacteria 2259
380 Ga0207663_10127598 3300025916 Bacteria 1752
381 Ga0207660_10000192 3300025917 Bacteria 38947
382 Ga0207660_10009267 3300025917 Bacteria 6372
383 Ga0207662_10000647 3300025918 Bacteria 15732
384 Ga0207657_10038177 3300025919 Bacteria 4279
385 Ga0207657_10091226 3300025919 Bacteria 2541
386 Ga0207657_10094982 3300025919 Bacteria 2481
387 Ga0207649_10000141 3300025920 Bacteria 60047
388 Ga0207649_10045728 3300025920 Bacteria 2685
389 Ga0207649_10083443 3300025920 Bacteria 2074
390 Ga0207649_10163154 3300025920 Bacteria 1546
391 Ga0207652_10004519 3300025921 Bacteria 11293
392 Ga0207652_10151345 3300025921 Bacteria 2077
393 Ga0207652_10253216 3300025921 Bacteria 1588
394 Ga0207646_10057861 3300025922 Bacteria 3464
395 Ga0207646_10068130 3300025922 Bacteria 3178
396 Ga0207681_10000359 3300025923 Bacteria 32485
397 Ga0207681_10159118 3300025923 Bacteria 1700
398 Ga0207694_10035789 3300025924 Bacteria 3809
399 Ga0207650_10004853 3300025925 Bacteria 9185
400 Ga0207650_10006280 3300025925 Bacteria 8096
401 Ga0207650_10105022 3300025925 Bacteria 2180
402 Ga0207659_10000052 3300025926 Bacteria 79692
403 Ga0207659_10023639 3300025926 Bacteria 4105
404 Ga0207659_10249098 3300025926 Bacteria 1441
405 Ga0207687_10000097 3300025927 Bacteria 64441
406 Ga0207687_10069568 3300025927 Bacteria 2511
407 Ga0207687_10082051 3300025927 Bacteria 2332
408 Ga0207700_10000437 3300025928 Bacteria 24528
409 Ga0207700_10000673 3300025928 Bacteria 19951
410 Ga0207700_10032842 3300025928 Bacteria 3707
411 Ga0207664_10000416 3300025929 Bacteria 30401
412 Ga0207664_10137780 3300025929 Bacteria 2061
413 Ga0207664_10235823 3300025929 Bacteria 1592
414 Ga0207644_10002956 3300025931 Bacteria 10949
415 Ga0207644_10033370 3300025931 Bacteria 3596
416 Ga0207690_10000278 3300025932 Bacteria 36244
417 Ga0207706_10003979 3300025933 Bacteria 14003
418 Ga0207706_10036851 3300025933 Bacteria 4344
419 Ga0207706_10136791 3300025933 Bacteria 2155
420 Ga0207686_10000850 3300025934 Bacteria 18532
421 Ga0207686_10008904 3300025934 Bacteria 5430
422 Ga0207686_10210075 3300025934 Bacteria 1399
423 Ga0207709_10000349 3300025935 Bacteria 47453
424 Ga0207709_10014956 3300025935 Bacteria 4295
425 Ga0207709_10067541 3300025935 Bacteria 2256
426 Ga0207670_10000781 3300025936 Bacteria 16732
427 Ga0207670_10075180 3300025936 Bacteria 2347
428 Ga0207669_10000168 3300025937 Bacteria 30867
429 Ga0207704_10000704 3300025938 Bacteria 14739
430 Ga0207704_10153219 3300025938 Bacteria 1629
431 Ga0207665_10000234 3300025939 Bacteria 37889
432 Ga0207665_10000248 3300025939 Bacteria 37228
433 Ga0207665_10011501 3300025939 Bacteria 5814
434 Ga0207665_10074219 3300025939 Bacteria 2328
435 Ga0207691_10003348 3300025940 Bacteria 15596
436 Ga0207691_10006839 3300025940 Bacteria 11004
437 Ga0207711_10006180 3300025941 Bacteria 10120
438 Ga0207711_10012455 3300025941 Bacteria 7068
439 Ga0207711_10042109 3300025941 Bacteria 3890
440 Ga0207711_10119131 3300025941 Bacteria 2355
441 Ga0207711_10172471 3300025941 Bacteria 1963
442 Ga0207689_10012368 3300025942 Bacteria 7300
443 Ga0207689_10030358 3300025942 Bacteria 4504
444 Ga0207689_10117472 3300025942 Bacteria 2187
445 Ga0207661_10000143 3300025944 Bacteria 45329
446 Ga0207661_10049496 3300025944 Bacteria 3345
447 Ga0207661_10076338 3300025944 Bacteria 2752
448 Ga0207661_10110264 3300025944 Bacteria 2326
449 Ga0207661_10250242 3300025944 Bacteria 1575
450 Ga0207679_10000035 3300025945 Bacteria 144173
451 Ga0207679_10022285 3300025945 Bacteria 4311
452 Ga0207679_10179254 3300025945 Bacteria 1751
453 Ga0207667_10031667 3300025949 Bacteria 5707
454 Ga0207667_10043263 3300025949 Bacteria 4780
455 Ga0207651_10000080 3300025960 Bacteria 42826
456 Ga0207651_10018003 3300025960 Bacteria 4191
457 Ga0207712_10003380 3300025961 Bacteria 10087
458 Ga0207712_10065930 3300025961 Bacteria 2587
459 Ga0207668_10007588 3300025972 Bacteria 6457
460 Ga0207668_10109764 3300025972 Bacteria 2067
461 Ga0207640_10015424 3300025981 Bacteria 4422
462 Ga0207640_10092226 3300025981 Bacteria 2101
463 Ga0207658_10022910 3300025986 Bacteria 4352
464 Ga0207658_10137366 3300025986 Bacteria 1973
465 Ga0207677_10000614 3300026023 Bacteria 21876
466 Ga0207677_10033362 3300026023 Bacteria 3321
467 Ga0207703_10022821 3300026035 Bacteria 4915
468 Ga0207703_10033869 3300026035 Bacteria 4051
469 Ga0207703_10063034 3300026035 Bacteria 3038
470 Ga0207678_10005116 3300026067 Bacteria 11764
471 Ga0207678_10010214 3300026067 Bacteria 8241
472 Ga0207678_10044487 3300026067 Bacteria 3840
473 Ga0207678_10045206 3300026067 Bacteria 3808
474 Ga0207708_10008117 3300026075 Bacteria 7775
475 Ga0207708_10013232 3300026075 Bacteria 6160
476 Ga0207702_10001956 3300026078 Bacteria 20052
477 Ga0207702_10106726 3300026078 Bacteria 2482
478 Ga0207702_10116525 3300026078 Bacteria 2384
479 Ga0207702_10121704 3300026078 Bacteria 2336
480 Ga0207641_10009143 3300026088 Bacteria 8183
481 Ga0207641_10010400 3300026088 Bacteria 7646
482 Ga0207641_10276984 3300026088 Bacteria 1576
483 Ga0207648_10234244 3300026089 Bacteria 1634
484 Ga0207676_10001840 3300026095 Bacteria 15541
485 Ga0207676_10066563 3300026095 Bacteria 2874
486 Ga0207674_10002206 3300026116 Bacteria 24670
487 Ga0207674_10014002 3300026116 Bacteria 8866
488 Ga0207674_10139845 3300026116 Bacteria 2381
489 Ga0207675_100003721 3300026118 Bacteria 14854
490 Ga0207675_100012148 3300026118 Bacteria 8044
491 Ga0207675_100103227 3300026118 Bacteria 2686
492 Ga0207683_10002096 3300026121 Bacteria 17563
493 Ga0207683_10003030 3300026121 Bacteria 14680
494 Ga0207683_10013315 3300026121 Bacteria 7013
495 Ga0207683_10031288 3300026121 Bacteria 4618
496 Ga0207683_10047844 3300026121 Bacteria 3745
497 Ga0207698_10003387 3300026142 Bacteria 9597
498 Ga0207698_10006421 3300026142 Bacteria 7336
499 Ga0207698_10027888 3300026142 Bacteria 4017
500 Ga0209969_1000387 3300027360 Bacteria 5867
501 Ga0209981_1001997 3300027378 Bacteria 2610
502 Ga0210000_1001517 3300027462 Bacteria 3275
503 Ga0209999_1003848 3300027543 Bacteria 2698
504 Ga0209999_1006386 3300027543 Bacteria 2118
505 Ga0210002_1000400 3300027617 Bacteria 5929
506 Ga0209983_1005796 3300027665 Bacteria 2551
507 Ga0209588_1001621 3300027671 Bacteria 5917
508 Ga0209966_1002841 3300027695 Bacteria 2906
509 Ga0209998_10000497 3300027717 Bacteria 10801
510 Ga0209998_10001108 3300027717 Bacteria 6727
511 Ga0209974_10002609 3300027876 Bacteria 6539
512 Ga0209974_10003968 3300027876 Bacteria 5296
513 Ga0209974_10005545 3300027876 Bacteria 4432
514 Ga0207428_10000075 3300027907 Bacteria 137887
515 Ga0207428_10000428 3300027907 Bacteria 51964
516 Ga0207428_10001396 3300027907 Bacteria 25497
517 Ga0268266_10024188 3300028379 Bacteria 5169
518 Ga0268266_10159053 3300028379 Bacteria 2042
519 Ga0268265_10000528 3300028380 Bacteria 39003
520 Ga0268265_10003048 3300028380 Bacteria 12223
521 Ga0268265_10017602 3300028380 Bacteria 4936
522 Ga0268264_10001145 3300028381 Bacteria 25934
523 Ga0268264_10001265 3300028381 Bacteria 24009
524 Ga0268264_10045961 3300028381 Bacteria 3626
525 Ga0268264_10159119 3300028381 Bacteria 2033
526 Ga0265337_1000182 3300028556 Bacteria 33103
527 Ga0265338_10030715 3300028800 Bacteria 5283
528 Ga0265338_10056170 3300028800 Bacteria 3494
529 Ga0265332_10002169 3300031238 Bacteria 10111
530 Ga0265325_10000034 3300031241 Bacteria 99371
531 Ga0265325_10001708 3300031241 Bacteria 15269
532 Ga0265325_10008595 3300031241 Bacteria 6015
533 Ga0265325_10038458 3300031241 Bacteria 2525
534 Ga0265340_10009089 3300031247 Bacteria 5343
535 Ga0265340_10039523 3300031247 Bacteria 2328
536 Ga0265339_10000091 3300031249 Bacteria 75937
537 Ga0265339_10001994 3300031249 Bacteria 14995
538 Ga0265339_10019021 3300031249 Bacteria 4038
539 Ga0265339_10037911 3300031249 Bacteria 2691
540 Ga0265331_10075347 3300031250 Bacteria 1573
541 Ga0265316_10043894 3300031344 Bacteria 3559
542 Ga0265316_10108022 3300031344 Bacteria 2109
543 Ga0307408_100035017 3300031548 Bacteria 3521
544 Ga0265313_10000176 3300031595 Bacteria 68037
545 Ga0265313_10000260 3300031595 Bacteria 57581
546 Ga0265313_10004374 3300031595 Bacteria 10905
547 Ga0265313_10006492 3300031595 Bacteria 8266
548 Ga0265313_10014189 3300031595 Bacteria 4724
549 Ga0265314_10118885 3300031711 Bacteria 1667
550 Ga0265342_10000175 3300031712 Bacteria 71083
551 Ga0265342_10000203 3300031712 Bacteria 66540
552 Ga0265342_10029297 3300031712 Bacteria 3419
553 Ga0265342_10081644 3300031712 Bacteria 1866
554 Ga0307413_10031388 3300031824 Bacteria 2998
555 Ga0307409_100195505 3300031995 Bacteria 1805
556 Ga0373930_0001646 3300034816 Bacteria 3373
557 Ga0373948_0000065 3300034817 Bacteria 11046
558 Ga0373950_0003576 3300034818 Bacteria 2229
559 Ga0373938_0004428 3300034957 Bacteria 2347
560 Ga0373928_0000172 3300035084 Bacteria 12512
561 Ga0373929_0000721 3300035085 Bacteria 6391
562 Ga0373929_0002547 3300035085 Bacteria 3349
563 Ga0373929_0011884 3300035085 Bacteria 1647
564 Ga0373934_0018951 3300035086 Bacteria 2637
565 Ga0373934_0026576 3300035086 Bacteria 2246
566 Ga0373934_0061335 3300035086 Bacteria 1498
567 Ga0373940_0002918 3300035088 Bacteria 3409
568 Ga0373940_0007065 3300035088 Bacteria 2519
569 Ga0373944_0000062 3300035089 Bacteria 17879
570 Ga0373949_0001909 3300035090 Bacteria 5630
571 Ga0373949_0002539 3300035090 Bacteria 4645
572 Ga0373951_0003492 3300035091 Bacteria 3801
573 Ga0373951_0013765 3300035091 Bacteria 1817
574 Ga0373952_0010979 3300035092 Bacteria 1759
575 Ga0373923_0000277 3300035111 Bacteria 11228
576 Ga0373932_0002445 3300035112 Bacteria 4704
577 Ga0373932_0004031 3300035112 Bacteria 3497
578 Ga0373932_0006012 3300035112 Bacteria 2863
579 Ga0373936_0000954 3300035113 Bacteria 10327
580 Ga0373936_0017031 3300035113 Bacteria 2795
581 Ga0373936_0079517 3300035113 Bacteria 1363
582 Ga0373939_0001215 3300035114 Bacteria 6289
583 Ga0373939_0004375 3300035114 Bacteria 3337
584 Ga0373941_0000106 3300035115 Bacteria 14078
585 Ga0373941_0000814 3300035115 Bacteria 6401
586 Ga0373945_0000711 3300035116 Bacteria 9681
587 Ga0373945_0000835 3300035116 Bacteria 9062
588 Ga0373953_0000627 3300035117 Bacteria 9775
589 Ga0373953_0001395 3300035117 Bacteria 6962
590 Ga0373954_0001186 3300035118 Bacteria 10453
591 Ga0373954_0009787 3300035118 Bacteria 4219
592 Ga0373954_0013490 3300035118 Bacteria 3642
593 Ga0373956_0001511 3300035119 Bacteria 9610
594 Ga0373956_0035086 3300035119 Bacteria 2211
595 Ga0373957_0006048 3300035120 Bacteria 3791
596 Ga0373957_0053769 3300035120 Bacteria 1545
597 Ga0373960_0001001 3300035121 Bacteria 6073
598 Ga0373960_0001059 3300035121 Bacteria 5930
599 Ga0373960_0001694 3300035121 Bacteria 4938
600 Ga0373943_0050497 3300035170 Bacteria 2044
601 Ga0373946_0006149 3300035171 Bacteria 4349
602 Ga0373946_0026717 3300035171 Bacteria 2279
603 Ga0373955_0000171 3300035172 Bacteria 26571
604 Ga0373955_0000366 3300035172 Bacteria 19051
605 Ga0373955_0002392 3300035172 Bacteria 8177
606 Ga0373955_0005170 3300035172 Bacteria 5838
607 Ga0373955_0007870 3300035172 Bacteria 4917
608 Ga0373955_0019223 3300035172 Bacteria 3410
609 Ga0373955_0049790 3300035172 Bacteria 2276
610 Ga0373942_0001640 3300035207 Bacteria 5693
611 Ga0373942_0007471 3300035207 Bacteria 2535
612 Ga0373961_0002190 3300035241 Bacteria 5183
613 Ga0373961_0002208 3300035241 Bacteria 5150
614 Ga0373961_0003616 3300035241 Bacteria 3805
615 Ga0373924_0004372 3300035410 Bacteria 4933
616 Ga0373924_0006448 3300035410 Bacteria 4205
617 Ga0373931_0002810 3300035691 Bacteria 7754
618 Ga0373931_0015349 3300035691 Bacteria 3755
619 Ga0373931_0023899 3300035691 Bacteria 3089
620 Ga0373935_0000218 3300035692 Bacteria 27678
621 Ga0373935_0046824 3300035692 Bacteria 2732
622 Ga0373927_0005034 3300035695 Bacteria 9145
623 Ga0373927_0006149 3300035695 Bacteria 8208
624 Ga0373927_0024309 3300035695 Bacteria 3964
625 Ga0373927_0030075 3300035695 Bacteria 3543
626 Ga0373927_0059760 3300035695 Bacteria 2465
627 Ga0373933_0002037 3300035724 Bacteria 11624
628 Ga0373933_0004945 3300035724 Bacteria 7264
629 Ga0373933_0005704 3300035724 Bacteria 6775
630 Ga0373933_0007851 3300035724 Bacteria 5828
631 Ga0373933_0018662 3300035724 Bacteria 3903
632 Ga0373933_0026475 3300035724 Bacteria 3330
633 Ga0373947_0000364 3300035725 Bacteria 25577
634 Ga0373947_0008074 3300035725 Bacteria 6069
635 Ga0373947_0041308 3300035725 Bacteria 2749
636 Ga0373947_0044583 3300035725 Bacteria 2652
637 Ga0373937_0000009 3300036401 Bacteria 169521
638 Ga0373937_0002001 3300036401 Bacteria 17037
639 Ga0373937_0028762 3300036401 Bacteria 5031
640 Ga0373937_0042381 3300036401 Bacteria 4152
641 Ga0373937_0046498 3300036401 Bacteria 3969
642 Ga0373925_0011407 3300037068 Bacteria 6440
643 Ga0373925_0025151 3300037068 Bacteria 4347
644 Ga0395899_0008445 3300037312 Bacteria 7934
645 Ga0395900_0085702 3300037418 Bacteria 3237
646 Ga0395900_0208999 3300037418 Bacteria 1971
647 Ga0395898_0009233 3300037466 Bacteria 10375
648 Ga0395898_0018005 3300037466 Bacteria 7207
649 Ga0436364_1509239 3300037853 Bacteria 3583
650 Ga0395901_0102406 3300038443 Bacteria 3005
651 Ga0436365_0394656 3300039437 Bacteria 2210
652 Ga0436363_1044488 3300039450 Bacteria 1996
653 Ga0439455_0011454 3300042012 Bacteria 1971
654 Ga0439435_0021157 3300042436 Bacteria 1686
655 Ga0451577_0158790 3300042876 Bacteria 2036
656 Ga0453683_0000494 3300044673 Bacteria 45120
657 Ga0466961_0043875 3300044693 Bacteria 2863
658 Ga0466963_0037241 3300044694 Bacteria 3175
659 Ga0466963_0088567 3300044694 Bacteria 2106
660 Ga0466963_0144356 3300044694 Bacteria 1650
661 Ga0466957_0109914 3300044842 Bacteria 1747
662 Ga0451576_0001638 3300045051 Bacteria 37426
663 Ga0451576_0077714 3300045051 Bacteria 3454
664 Ga0495592_0000422 3300046454 Bacteria 32126
665 Ga0495592_0004523 3300046454 Bacteria 10182
666 Ga0495592_0007319 3300046454 Bacteria 8256
667 Ga0495603_0010842 3300046455 Bacteria 5529
668 Ga0495603_0072826 3300046455 Bacteria 2018
669 Ga0495629_0002524 3300046459 Bacteria 14035
670 Ga0495629_0016178 3300046459 Bacteria 5354
671 Ga0495629_0018816 3300046459 Bacteria 4937
672 Ga0495629_0079774 3300046459 Bacteria 2285
673 Ga0495641_0076011 3300046461 Bacteria 1505
674 Ga0495651_0000300 3300046462 Bacteria 38562
675 Ga0495651_0000764 3300046462 Bacteria 24894
676 Ga0495651_0001150 3300046462 Bacteria 20444
677 Ga0495651_0003637 3300046462 Bacteria 11807
678 Ga0495651_0032821 3300046462 Bacteria 4049
679 Ga0495653_0000032 3300046463 Bacteria 132763
680 Ga0495653_0001957 3300046463 Bacteria 16221
681 Ga0495653_0031725 3300046463 Bacteria 4198
682 Ga0495580_0001416 3300046472 Bacteria 21075
683 Ga0495580_0021728 3300046472 Bacteria 4733
684 Ga0495580_0179816 3300046472 Bacteria 1461
685 Ga0495582_0029211 3300046473 Bacteria 3026
686 Ga0495582_0083985 3300046473 Bacteria 1769
687 Ga0495582_0163013 3300046473 Bacteria 1268
688 Ga0495639_0006262 3300046475 Bacteria 5111
689 Ga0495662_0002039 3300046476 Bacteria 10119
690 Ga0495662_0038622 3300046476 Bacteria 2308
691 Ga0495662_0097550 3300046476 Bacteria 1437
692 Ga0495664_0000010 3300046477 Bacteria 268381
693 Ga0495664_0000178 3300046477 Bacteria 31382
694 Ga0495664_0034739 3300046477 Bacteria 2966
695 Ga0495584_0006106 3300046491 Bacteria 6339
696 Ga0495584_0022637 3300046491 Bacteria 3188
697 Ga0495584_0112931 3300046491 Bacteria 1375
698 Ga0495585_0015366 3300046492 Bacteria 4448
699 Ga0495594_0010424 3300046499 Bacteria 4820
700 Ga0495594_0052866 3300046499 Bacteria 2236
701 Ga0495608_0000008 3300046511 Bacteria 268629
702 Ga0495608_0001671 3300046511 Bacteria 15955
703 Ga0495608_0025139 3300046511 Bacteria 4066
704 Ga0495608_0041070 3300046511 Bacteria 3097
705 Ga0495618_0000002 3300046514 Bacteria 271353
706 Ga0495618_0003686 3300046514 Bacteria 9495
707 Ga0495618_0025323 3300046514 Bacteria 3681
708 Ga0495628_0000009 3300046516 Bacteria 237611
709 Ga0495628_0001448 3300046516 Bacteria 21780
710 Ga0495628_0007599 3300046516 Bacteria 9369
711 Ga0495628_0020094 3300046516 Bacteria 5512
712 Ga0495630_0002397 3300046517 Bacteria 13021
713 Ga0495630_0242314 3300046517 Bacteria 1377
714 Ga0495644_0012384 3300046523 Bacteria 3280
715 Ga0495666_0000187 3300046526 Bacteria 26576
716 Ga0495666_0035568 3300046526 Bacteria 2428
717 Ga0495666_0087444 3300046526 Bacteria 1472
718 Ga0495652_0000011 3300046529 Bacteria 255329
719 Ga0495652_0032696 3300046529 Bacteria 4547
720 Ga0495652_0090939 3300046529 Bacteria 2496
721 Ga0495652_0091221 3300046529 Bacteria 2491
722 Ga0495665_0006213 3300046531 Bacteria 6450
723 Ga0495640_0000094 3300046533 Bacteria 51238
724 Ga0495640_0023352 3300046533 Bacteria 4506
725 Ga0495586_0002551 3300046535 Bacteria 9858
726 Ga0495587_0000086 3300046536 Bacteria 72022
727 Ga0495587_0002720 3300046536 Bacteria 11797
728 Ga0495598_0008090 3300046537 Bacteria 2438
729 Ga0495598_0043017 3300046537 Bacteria 1328
730 Ga0495645_0000010 3300046543 Bacteria 238337
731 Ga0495622_0001697 3300046557 Bacteria 10892
732 Ga0495633_0018667 3300046558 Bacteria 3519
733 Ga0495667_0000005 3300046559 Bacteria 268252
734 Ga0495667_0002931 3300046559 Bacteria 11450
735 Ga0495667_0004110 3300046559 Bacteria 9783
736 Ga0495667_0048018 3300046559 Bacteria 2819
737 Ga0495667_0063532 3300046559 Bacteria 2416
738 Ga0495667_0085337 3300046559 Bacteria 2049
739 Ga0495634_0000936 3300046642 Bacteria 27662
740 Ga0495634_0042214 3300046642 Bacteria 3094
741 Ga0495634_0048272 3300046642 Bacteria 2866
742 Ga0495611_0006806 3300046648 Bacteria 4857
743 Ga0495635_0000008 3300046663 Bacteria 268349
744 Ga0495635_0001359 3300046663 Bacteria 16270
745 Ga0495635_0011040 3300046663 Bacteria 6333
746 Ga0495635_0123563 3300046663 Bacteria 1765
747 Ga0495659_0005492 3300046664 Bacteria 3987
748 Ga0495659_0006098 3300046664 Bacteria 3810
749 Ga0495588_0001695 3300046674 Bacteria 9374
750 Ga0495657_0000296 3300046675 Bacteria 45380
751 Ga0495657_0003184 3300046675 Bacteria 13516
752 Ga0495657_0027472 3300046675 Bacteria 4015
753 Ga0495599_0000007 3300046678 Bacteria 236638
754 Ga0495599_0000806 3300046678 Bacteria 17617
755 Ga0495599_0085910 3300046678 Bacteria 1964
756 Ga0495623_0000085 3300046679 Bacteria 55527
757 Ga0495623_0010359 3300046679 Bacteria 6036
758 Ga0495623_0015361 3300046679 Bacteria 4948
759 Ga0495646_0000021 3300046680 Bacteria 115358
760 Ga0495646_0033722 3300046680 Bacteria 3182
761 Ga0495647_0000638 3300046681 Bacteria 10362
762 Ga0495647_0036177 3300046681 Bacteria 1857
763 Ga0495658_0004284 3300046683 Bacteria 7024
764 Ga0495658_0035163 3300046683 Bacteria 2754
765 Ga0495613_0012243 3300046689 Bacteria 6376
766 Ga0495613_0023597 3300046689 Bacteria 4584
767 Ga0495613_0057153 3300046689 Bacteria 2864
768 Ga0495624_0015494 3300046690 Bacteria 5144
769 Ga0495624_0109220 3300046690 Bacteria 1701
770 Ga0495600_0000001 3300046809 Bacteria 214870
771 Ga0495600_0001998 3300046809 Bacteria 11466
772 Ga0495600_0006193 3300046809 Bacteria 7256
773 Ga0495600_0006357 3300046809 Bacteria 7187
774 Ga0495581_0014671 3300047315 Bacteria 4543
775 Ga0495581_0039846 3300047315 Bacteria 2720
776 Ga0495604_0000012 3300047317 Bacteria 268341
777 Ga0495604_0001423 3300047317 Bacteria 19641
778 Ga0495604_0005209 3300047317 Bacteria 10301
779 Ga0495604_0016854 3300047317 Bacteria 5844
780 Ga0495604_0023581 3300047317 Bacteria 4909
781 Ga0495604_0039078 3300047317 Bacteria 3731
782 Ga0495604_0094830 3300047317 Bacteria 2205
783 Ga0495636_0057011 3300047318 Bacteria 1645
784 Ga0495674_0000011 3300047319 Bacteria 270911
785 Ga0495674_0042009 3300047319 Bacteria 4081
786 Ga0495674_0081140 3300047319 Bacteria 2782
787 Ga0495674_0209301 3300047319 Bacteria 1616
788 Ga0495676_0011575 3300047321 Bacteria 7958
789 Ga0495676_0098773 3300047321 Bacteria 2165
790 Ga0495680_0000245 3300047322 Bacteria 59987
791 Ga0495680_0001491 3300047322 Bacteria 25179
792 Ga0495680_0007295 3300047322 Bacteria 10175
793 Ga0495680_0013705 3300047322 Bacteria 7058
794 Ga0495680_0028576 3300047322 Bacteria 4571
795 Ga0495680_0032027 3300047322 Bacteria 4272
796 Ga0495680_0209411 3300047322 Bacteria 1396
797 Ga0495675_0000657 3300047444 Bacteria 21846
798 Ga0495677_0080450 3300047445 Bacteria 1221
799 Ga0495679_031124 3300047446 Bacteria 1724
800 Ga0495685_027707 3300047447 Bacteria 1949
801 Ga0495684_0000084 3300047471 Bacteria 65600
802 Ga0495684_0000711 3300047471 Bacteria 26762
803 Ga0495684_0040689 3300047471 Bacteria 3563
804 Ga0495684_0072546 3300047471 Bacteria 2616
805 Ga0495593_0000309 3300047673 Bacteria 26737
806 Ga0495593_0018863 3300047673 Bacteria 3871
807 Ga0495593_0036157 3300047673 Bacteria 2679
808 Ga0495602_0000073 3300048088 Bacteria 98745
809 Ga0495602_0029432 3300048088 Bacteria 5229
810 Ga0495602_0202511 3300048088 Bacteria 1513
811 Ga0495614_0003292 3300048089 Bacteria 7220
812 Ga0495614_0033747 3300048089 Bacteria 2201
813 Ga0496100_0000203 3300048903 Bacteria 32744
814 Ga0496100_0016419 3300048903 Bacteria 4348
815 Ga0496100_0033208 3300048903 Bacteria 3227
816 Ga0496100_0072383 3300048903 Bacteria 2304
817 Ga0496101_0002812 3300048904 Bacteria 10691
818 Ga0496101_0013528 3300048904 Bacteria 5470
819 Ga0496102_0000871 3300048905 Bacteria 28857
820 Ga0496102_0004838 3300048905 Bacteria 11387
821 Ga0496102_0006598 3300048905 Bacteria 9912
822 Ga0496102_0051348 3300048905 Bacteria 3757
823 Ga0496102_0106206 3300048905 Bacteria 2613
824 Ga0496102_0118468 3300048905 Bacteria 2471
825 Ga0496103_0001365 3300048906 Bacteria 16458
826 Ga0496103_0001529 3300048906 Bacteria 15450
827 Ga0496103_0002881 3300048906 Bacteria 10676
828 Ga0496103_0009792 3300048906 Bacteria 5675
829 Ga0496104_0000317 3300048907 Bacteria 42918
830 Ga0496104_0000709 3300048907 Bacteria 28655
831 Ga0496104_0000873 3300048907 Bacteria 25934
832 Ga0496104_0026931 3300048907 Bacteria 5315
833 Ga0496104_0050532 3300048907 Bacteria 3922
834 Ga0496104_0063751 3300048907 Bacteria 3496
835 Ga0496104_0099435 3300048907 Bacteria 2785
836 Ga0496104_0110898 3300048907 Bacteria 2630
837 Ga0496105_0000485 3300048908 Bacteria 26121
838 Ga0496105_0000514 3300048908 Bacteria 25562
839 Ga0496105_0070606 3300048908 Bacteria 2887
840 Ga0496105_0118973 3300048908 Bacteria 2179
841 Ga0496105_0124352 3300048908 Bacteria 2126
842 Ga0496105_0178987 3300048908 Bacteria 1736
843 Ga0496106_0002909 3300048909 Bacteria 12739
844 Ga0496106_0035978 3300048909 Bacteria 3703
845 Ga0496106_0037687 3300048909 Bacteria 3617
846 Ga0496106_0065636 3300048909 Bacteria 2763
847 Ga0496106_0086525 3300048909 Bacteria 2414
848 Ga0496106_0146967 3300048909 Bacteria 1857
849 Ga0496107_0000268 3300048910 Bacteria 27611
850 Ga0496107_0002119 3300048910 Bacteria 12722
851 Ga0496107_0027599 3300048910 Bacteria 4031
852 Ga0496107_0046893 3300048910 Bacteria 3111
853 Ga0496107_0053932 3300048910 Bacteria 2900
854 Ga0496107_0126850 3300048910 Bacteria 1882
855 Ga0496108_0010827 3300048911 Bacteria 7404
856 Ga0496108_0012976 3300048911 Bacteria 6788
857 Ga0496108_0019125 3300048911 Bacteria 5620
858 Ga0496108_0089330 3300048911 Bacteria 2618
859 Ga0496108_0263702 3300048911 Bacteria 1499
860 Ga0496109_0000836 3300048912 Bacteria 25684
861 Ga0496109_0006654 3300048912 Bacteria 9730
862 Ga0496109_0033888 3300048912 Bacteria 4597
863 Ga0496109_0074422 3300048912 Bacteria 3122
864 Ga0496109_0118772 3300048912 Bacteria 2461
865 Ga0496110_0001539 3300048913 Bacteria 16772
866 Ga0496110_0006117 3300048913 Bacteria 9487
867 Ga0496110_0016005 3300048913 Bacteria 6254
868 Ga0496110_0035409 3300048913 Bacteria 4330
869 Ga0496111_0000072 3300048914 Bacteria 41891
870 Ga0496111_0000657 3300048914 Bacteria 18179
871 Ga0496111_0092260 3300048914 Bacteria 2219
872 Ga0496111_0114447 3300048914 Bacteria 1988
873 Ga0496111_0256702 3300048914 Bacteria 1297
874 Ga0496112_0000112 3300048915 Bacteria 50370
875 Ga0496112_0028569 3300048915 Bacteria 5385
876 Ga0496112_0032191 3300048915 Bacteria 5090
877 Ga0496112_0115043 3300048915 Bacteria 2660
878 Ga0496113_0000058 3300048916 Bacteria 47947
879 Ga0496113_0004401 3300048916 Bacteria 8645
880 Ga0496113_0050519 3300048916 Bacteria 3100
881 Ga0496113_0060873 3300048916 Bacteria 2847
882 Ga0496114_0019587 3300048917 Bacteria 5483
883 Ga0496114_0021043 3300048917 Bacteria 5302
884 Ga0496114_0075626 3300048917 Bacteria 2837
885 Ga0496114_0115053 3300048917 Bacteria 2307
886 Ga0496114_0190865 3300048917 Bacteria 1792
887 Ga0496115_0015922 3300048918 Bacteria 5715
888 Ga0496121_0094938 3300048924 Bacteria 2319
889 Ga0501032_0052536 3300049569 Bacteria 2746
890 Ga0501032_0108458 3300049569 Bacteria 1838
891 Ga0501033_0054431 3300049570 Bacteria 2960
892 Ga0501034_0001131 3300049571 Bacteria 37119
893 Ga0501034_0020143 3300049571 Bacteria 6810
894 Ga0501034_0117384 3300049571 Unclassified 2648
895 Ga0501037_0050195 3300049573 Bacteria 3054
896 Ga0501038_0069228 3300049574 Bacteria 2998
897 Ga0501038_0079380 3300049574 Bacteria 2767
898 Ga0501041_0137266 3300049577 Bacteria 1524
899 Ga0501042_0013021 3300049578 Bacteria 5652
900 Ga0501042_0094044 3300049578 Bacteria 2153
901 Ga0501042_0131480 3300049578 Bacteria 1804
902 Ga0501046_0040702 3300049580 Bacteria 3712
903 Ga0501046_0105009 3300049580 Bacteria 2164
904 Ga0501047_0042592 3300049581 Bacteria 4387
905 Ga0501047_0181929 3300049581 Bacteria 1968
906 Ga0501070_0015997 3300049586 Bacteria 6304
907 Ga0501070_0035326 3300049586 Bacteria 4177
908 Ga0501070_0221956 3300049586 Bacteria 1549
909 Ga0501072_0026826 3300049588 Bacteria 4494
910 Ga0501072_0064450 3300049588 Bacteria 2890
911 Ga0501074_0173560 3300049590 Bacteria 1538
912 Ga0501075_0036972 3300049591 Bacteria 3645
913 Ga0501075_0087388 3300049591 Bacteria 2363
914 Ga0501075_0098582 3300049591 Bacteria 2219
915 Ga0501076_0006327 3300049592 Bacteria 8581
916 Ga0501076_0194418 3300049592 Bacteria 1656
917 Ga0501076_0239822 3300049592 Bacteria 1483
918 Ga0501077_0005796 3300049593 Bacteria 7525
919 Ga0501077_0009236 3300049593 Bacteria 6121
920 Ga0501077_0023243 3300049593 Bacteria 3930
921 Ga0501077_0121159 3300049593 Bacteria 1658
922 Ga0501079_0045484 3300049741 Bacteria 3388
923 Ga0501079_0074222 3300049741 Bacteria 2629
924 Ga0501079_0090839 3300049741 Bacteria 2366
925 Ga0501081_0003672 3300049743 Bacteria 9825
926 Ga0501081_0021499 3300049743 Bacteria 4307
927 Ga0501081_0035300 3300049743 Bacteria 3404
928 Ga0501081_0042931 3300049743 Bacteria 3100
929 Ga0501081_0043775 3300049743 Bacteria 3072
930 Ga0501035_0080515 3300049822 Bacteria 2875
931 Ga0501044_0071243 3300049823 Bacteria 3535
932 Ga0501045_0128811 3300049824 Bacteria 1881
933 nmdc:mga03683_20430_c1 3300050489 Bacteria 2541
934 nmdc:mga03n38_77818_c1 3300050490 Bacteria 1551
935 nmdc:mga03n38_99201_c1 3300050490 Bacteria 1402
936 nmdc:mga0yw44_35704_c1 3300050492 Bacteria 2924
937 nmdc:mga0k408_173380_c1 3300050493 Bacteria 1286
938 nmdc:mga0k408_80396_c1 3300050493 Bacteria 1908
939 nmdc:mga06z11_51201_c1 3300050494 Bacteria 2114
940 nmdc:mga05p37_17539_c1 3300050507 Bacteria 8643
941 nmdc:mga05p37_32_c1 3300050507 Bacteria 112982
942 nmdc:mga05p37_34120_c1 3300050507 Bacteria 6233
943 nmdc:mga05p37_4606_c1 3300050507 Bacteria 16121
944 nmdc:mga05p37_66833_c1 3300050507 Bacteria 4422
945 nmdc:mga05p37_89534_c1 3300050507 Bacteria 3793
946 nmdc:mga05p37_90816_c1 3300050507 Bacteria 3764
947 nmdc:mga09592_37123_c1 3300050508 Bacteria 4085
948 nmdc:mga09592_6535_c1 3300050508 Bacteria 9497
949 nmdc:mga0qj67_110767_c1 3300050509 Bacteria 2216
950 nmdc:mga0qj67_157763_c1 3300050509 Bacteria 1842
951 nmdc:mga0qj67_168_c1 3300050509 Bacteria 43793
952 nmdc:mga0qj67_29510_c1 3300050509 Bacteria 4260
953 nmdc:mga0qj67_355_c1 3300050509 Bacteria 31660
954 nmdc:mga0qj67_733_c1 3300050509 Bacteria 22325
955 nmdc:mga0qj67_74589_c1 3300050509 Bacteria 2711
956 nmdc:mga06r32_13222_c1 3300050510 Bacteria 7474
957 nmdc:mga06r32_16922_c1 3300050510 Bacteria 6652
958 nmdc:mga06r32_21130_c1 3300050510 Bacteria 6006
959 nmdc:mga06r32_5297_c1 3300050510 Bacteria 11609
960 nmdc:mga06r32_57806_c1 3300050510 Bacteria 3726
961 nmdc:mga06r32_68764_c1 3300050510 Bacteria 3422
962 nmdc:mga06r32_91319_c1 3300050510 Bacteria 2976
963 nmdc:mga08y16_102392_c1 3300050511 Bacteria 2981
964 nmdc:mga08y16_132898_c1 3300050511 Bacteria 2587
965 nmdc:mga08y16_171996_c1 3300050511 Bacteria 2250
966 nmdc:mga08y16_19018_c1 3300050511 Bacteria 7235
967 nmdc:mga08y16_2238_c1 3300050511 Bacteria 19836
968 nmdc:mga08y16_424126_c1 3300050511 Bacteria 1359
969 nmdc:mga08y16_58180_c1 3300050511 Bacteria 4038
970 nmdc:mga08y16_6098_c1 3300050511 Bacteria 12643
971 nmdc:mga0n895_121400_c1 3300050512 Bacteria 2634
972 nmdc:mga0n895_14134_c1 3300050512 Bacteria 7238
973 nmdc:mga0n895_15498_c1 3300050512 Bacteria 6953
974 nmdc:mga0n895_547_c1 3300050512 Bacteria 25755
975 nmdc:mga0n895_55820_c1 3300050512 Bacteria 3888
976 nmdc:mga0n895_77179_c1 3300050512 Bacteria 3313
977 nmdc:mga0n895_79500_c1 3300050512 Bacteria 3266
978 nmdc:mga0n895_8451_c1 3300050512 Bacteria 8914
979 nmdc:mga0n895_88591_c1 3300050512 Bacteria 3095
980 nmdc:mga0n895_91342_c1 3300050512 Bacteria 3047
981 nmdc:mga0rr50_148620_c1 3300050513 Bacteria 1891
982 nmdc:mga0rr50_21144_c1 3300050513 Bacteria 4436
983 nmdc:mga0rr50_73282_c1 3300050513 Bacteria 2618
984 nmdc:mga0rr50_78412_c1 3300050513 Bacteria 2542
985 nmdc:mga08x19_54912_c1 3300050514 Bacteria 2565
986 nmdc:mga08x19_76395_c1 3300050514 Bacteria 2191
987 nmdc:mga0a205_117187_c1 3300050515 Bacteria 2562
988 nmdc:mga0a205_12457_c1 3300050515 Bacteria 7868
989 nmdc:mga0a205_53544_c1 3300050515 Bacteria 3895
990 nmdc:mga0a205_6205_c1 3300050515 Bacteria 10788
991 nmdc:mga0a205_629_c1 3300050515 Bacteria 28029
992 nmdc:mga0a205_71570_c1 3300050515 Bacteria 3349
993 Ga0495601_0000009 3300053077 Bacteria 270622
994 Ga0495601_0000521 3300053077 Bacteria 20312
995 Ga0495601_0014254 3300053077 Bacteria 4789
996 Ga0495601_0031312 3300053077 Bacteria 3305
997 Ga0495601_0073246 3300053077 Bacteria 2189
998 Ga0495601_0077801 3300053077 Bacteria 2124
999 Ga0495612_0000019 3300053078 Bacteria 137844
1000 Ga0495612_0001070 3300053078 Bacteria 11208
1001 Ga0495612_0002143 3300053078 Bacteria 8120
1002 Ga0495612_0008371 3300053078 Bacteria 4195
1003 Ga0495595_0000015 3300053084 Bacteria 144946
1004 Ga0495595_0001827 3300053084 Bacteria 8280
1005 Ga0495595_0002555 3300053084 Bacteria 7144
1006 Ga0495595_0013740 3300053084 Bacteria 3424
1007 Ga0495619_0000012 3300053085 Bacteria 268349
1008 Ga0495619_0000016 3300053085 Bacteria 231442
1009 Ga0495619_0000670 3300053085 Bacteria 22463
1010 Ga0495619_0002830 3300053085 Bacteria 11300
1011 Ga0495619_0022668 3300053085 Bacteria 4021
1012 Ga0495619_0078577 3300053085 Bacteria 2218
1013 Ga0500644_0001393 3300053088 Bacteria 6442
1014 Ga0500641_0004145 3300053096 Bacteria 5119
1015 Ga0500595_000010 3300053119 Bacteria 275806
1016 Ga0500595_039632 3300053119 Bacteria 1523
1017 Ga0500616_0000001 3300053153 Bacteria 1986011
1018 Ga0500645_000051 3300053730 Bacteria 98521
1019 Ga0501084_0009054 3300054114 Bacteria 8236
1020 Ga0501082_0044681 3300060353 Bacteria 3821
1021 Ga0501082_0046745 3300060353 Bacteria 3730
1022 Ga0501082_0164976 3300060353 Bacteria 1925
1023 Ga0530510_0055169 3300061734 Bacteria 2871

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035172 Ga0373955_0049790 Ga0373955_0049790_1134_2252 372
2 3300044694 Ga0466963_0144356 Ga0466963_0144356_506_1624 372
3 3300005457 Ga0070662_100204883 Ga0070662_1002048831 373
4 3300035725 Ga0373947_0008074 Ga0373947_0008074_4916_6037 373
5 3300046461 Ga0495641_0076011 Ga0495641_0076011_13_1134 373
6 3300046517 Ga0495630_0242314 Ga0495630_0242314_13_1134 373
7 3300046529 Ga0495652_0091221 Ga0495652_0091221_1358_2479 373
8 3300047445 Ga0495677_0080450 Ga0495677_0080450_20_1141 373
9 3300047471 Ga0495684_0000711 Ga0495684_0000711_25629_26750 373
10 3300060353 Ga0501082_0164976 Ga0501082_0164976_50_1171 373
11 3300005983 Ga0081540_1002311 Ga0081540_10023112 374
12 3300048905 Ga0496102_0106206 Ga0496102_0106206_855_2084 381
13 3300048914 Ga0496111_0256702 Ga0496111_0256702_36_1265 381
14 3300046491 Ga0495584_0112931 Ga0495584_0112931_85_1314 386
15 3300035695 Ga0373927_0030075 Ga0373927_0030075_1917_3164 391
16 3300005843 Ga0068860_100188969 Ga0068860_1001889692 394
17 3300026088 Ga0207641_10276984 Ga0207641_102769842 394
18 3300028381 Ga0268264_10159119 Ga0268264_101591192 394
19 3300048907 Ga0496104_0099435 Ga0496104_0099435_823_2052 394
20 3300048908 Ga0496105_0118973 Ga0496105_0118973_89_1318 394
21 3300005983 Ga0081540_1014938 Ga0081540_10149382 397
22 3300003911 JGI25405J52794_10009788 JGI25405J52794_100097881 398
23 3300005937 Ga0081455_10004480 Ga0081455_100044807 398
24 3300006847 Ga0075431_100098881 Ga0075431_1000988813 398
25 3300035170 Ga0373943_0050497 Ga0373943_0050497_29_1225 398
26 3300046462 Ga0495651_0032821 Ga0495651_0032821_563_1759 398
27 3300047322 Ga0495680_0028576 Ga0495680_0028576_1850_3046 398
28 3300050490 nmdc:mga03n38_99201_c1 nmdc:mga03n38_99201_c1_186_1382 398
29 3300005338 Ga0068868_100087923 Ga0068868_1000879232 399
30 3300005339 Ga0070660_100001014 Ga0070660_1000010141 399
31 3300009098 Ga0105245_10045266 Ga0105245_100452662 399
32 3300009176 Ga0105242_10177574 Ga0105242_101775741 399
33 3300025929 Ga0207664_10137780 Ga0207664_101377802 399
34 3300026023 Ga0207677_10033362 Ga0207677_100333622 399
35 3300044693 Ga0466961_0043875 Ga0466961_0043875_1636_2835 399
36 3300046472 Ga0495580_0179816 Ga0495580_0179816_99_1346 399
37 3300048914 Ga0496111_0092260 Ga0496111_0092260_18_1217 399
38 3300050490 nmdc:mga03n38_77818_c1 nmdc:mga03n38_77818_c1_16_1215 399
39 3300050512 nmdc:mga0n895_79500_c1 nmdc:mga0n895_79500_c1_2034_3233 399
40 3300053077 Ga0495601_0073246 Ga0495601_0073246_978_2177 399
41 3300007265 Ga0099794_10014325 Ga0099794_100143253 400
42 3300009094 Ga0111539_10064307 Ga0111539_100643075 400
43 3300009098 Ga0105245_10175167 Ga0105245_101751672 400
44 3300009148 Ga0105243_10176009 Ga0105243_101760092 400
45 3300009176 Ga0105242_10078215 Ga0105242_100782152 400
46 3300013308 Ga0157375_10110039 Ga0157375_101100392 400
47 3300025981 Ga0207640_10015424 Ga0207640_100154246 400
48 3300046473 Ga0495582_0163013 Ga0495582_0163013_46_1248 400
49 3300048910 Ga0496107_0027599 Ga0496107_0027599_15_1217 400
50 3300048911 Ga0496108_0089330 Ga0496108_0089330_957_2159 400
51 3300048914 Ga0496111_0114447 Ga0496111_0114447_373_1575 400
52 3300048915 Ga0496112_0115043 Ga0496112_0115043_971_2173 400
53 3300050511 nmdc:mga08y16_102392_c1 nmdc:mga08y16_102392_c1_387_1631 400
54 3300053077 Ga0495601_0077801 Ga0495601_0077801_22_1224 400
55 3300006028 Ga0070717_10080835 Ga0070717_100808351 401
56 3300005467 Ga0070706_100040997 Ga0070706_1000409975 402
57 3300006846 Ga0075430_100000015 Ga0075430_10000001545 402
58 3300006852 Ga0075433_10008464 Ga0075433_100084643 402
59 3300006871 Ga0075434_100090220 Ga0075434_1000902202 402
60 3300009094 Ga0111539_10058878 Ga0111539_100588782 402
61 3300009147 Ga0114129_10027223 Ga0114129_100272232 402
62 3300025910 Ga0207684_10023396 Ga0207684_100233965 402
63 3300050509 nmdc:mga0qj67_168_c1 nmdc:mga0qj67_168_c1_484_1713 402
64 3300050511 nmdc:mga08y16_132898_c1 nmdc:mga08y16_132898_c1_471_1700 402
65 3300050512 nmdc:mga0n895_14134_c1 nmdc:mga0n895_14134_c1_3947_5176 402
66 3300050515 nmdc:mga0a205_12457_c1 nmdc:mga0a205_12457_c1_5497_6726 402
67 3300002239 JGI24034J26672_10005798 JGI24034J26672_100057982 403
68 3300005981 Ga0081538_10070167 Ga0081538_100701671 404
69 3300006844 Ga0075428_100157176 Ga0075428_1001571761 404
70 3300006846 Ga0075430_100002472 Ga0075430_1000024723 404
71 3300006846 Ga0075430_100031115 Ga0075430_1000311154 404
72 3300006847 Ga0075431_100018201 Ga0075431_1000182018 404
73 3300006880 Ga0075429_100021829 Ga0075429_1000218292 404
74 3300006880 Ga0075429_100250984 Ga0075429_1002509841 404
75 3300006914 Ga0075436_100143097 Ga0075436_1001430971 404
76 3300007076 Ga0075435_100065898 Ga0075435_1000658983 404
77 3300050507 nmdc:mga05p37_66833_c1 nmdc:mga05p37_66833_c1_2366_3601 404
78 3300050507 nmdc:mga05p37_89534_c1 nmdc:mga05p37_89534_c1_1342_2583 404
79 3300050508 nmdc:mga09592_37123_c1 nmdc:mga09592_37123_c1_2508_3752 404
80 3300050510 nmdc:mga06r32_91319_c1 nmdc:mga06r32_91319_c1_1308_2552 404
81 3300050513 nmdc:mga0rr50_21144_c1 nmdc:mga0rr50_21144_c1_2864_4105 404
82 3300050515 nmdc:mga0a205_117187_c1 nmdc:mga0a205_117187_c1_586_1827 404
83 3300025939 Ga0207665_10074219 Ga0207665_100742192 405
84 3300049822 Ga0501035_0080515 Ga0501035_0080515_118_1461 405
85 3300005518 Ga0070699_100073539 Ga0070699_1000735392 406
86 3300005937 Ga0081455_10006602 Ga0081455_100066024 406
87 3300005981 Ga0081538_10051140 Ga0081538_100511404 406
88 3300005983 Ga0081540_1021121 Ga0081540_10211212 406
89 3300009147 Ga0114129_10330175 Ga0114129_103301752 406
90 3300025922 Ga0207646_10057861 Ga0207646_100578612 406
91 3300046664 Ga0495659_0006098 Ga0495659_0006098_48_1292 406
92 3300049569 Ga0501032_0052536 Ga0501032_0052536_839_2059 406
93 3300049573 Ga0501037_0050195 Ga0501037_0050195_525_1745 406
94 3300049580 Ga0501046_0105009 Ga0501046_0105009_564_1784 406
95 3300049581 Ga0501047_0042592 Ga0501047_0042592_1126_2346 406
96 3300049588 Ga0501072_0064450 Ga0501072_0064450_972_2192 406
97 3300049590 Ga0501074_0173560 Ga0501074_0173560_308_1528 406
98 3300049592 Ga0501076_0239822 Ga0501076_0239822_206_1426 406
99 3300049741 Ga0501079_0090839 Ga0501079_0090839_832_2052 406
100 3300049743 Ga0501081_0043775 Ga0501081_0043775_93_1313 406
101 3300050510 nmdc:mga06r32_16922_c1 nmdc:mga06r32_16922_c1_4505_5725 406
102 3300060353 Ga0501082_0046745 Ga0501082_0046745_1837_3057 406
103 3300061734 Ga0530510_0055169 Ga0530510_0055169_876_2096 406
104 3300005356 Ga0070674_100013342 Ga0070674_1000133424 407
105 3300005617 Ga0068859_100075191 Ga0068859_1000751912 407
106 3300005618 Ga0068864_100105666 Ga0068864_1001056663 407
107 3300006177 Ga0075362_10026782 Ga0075362_100267823 407
108 3300006178 Ga0075367_10010139 Ga0075367_100101393 407
109 3300006186 Ga0075369_10017707 Ga0075369_100177072 407
110 3300006195 Ga0075366_10021275 Ga0075366_100212753 407
111 3300006353 Ga0075370_10072975 Ga0075370_100729751 407
112 3300006931 Ga0097620_100075191 Ga0097620_1000751914 407
113 3300009101 Ga0105247_10042379 Ga0105247_100423791 407
114 3300009148 Ga0105243_10184399 Ga0105243_101843992 407
115 3300013297 Ga0157378_10150135 Ga0157378_101501351 407
116 3300025893 Ga0207682_10008138 Ga0207682_100081383 407
117 3300025907 Ga0207645_10030390 Ga0207645_100303902 407
118 3300025925 Ga0207650_10105022 Ga0207650_101050222 407
119 3300025934 Ga0207686_10210075 Ga0207686_102100751 407
120 3300025935 Ga0207709_10067541 Ga0207709_100675411 407
121 3300025942 Ga0207689_10117472 Ga0207689_101174722 407
122 3300026121 Ga0207683_10047844 Ga0207683_100478442 407
123 3300031250 Ga0265331_10075347 Ga0265331_100753472 407
124 3300031711 Ga0265314_10118885 Ga0265314_101188851 407
125 3300031712 Ga0265342_10081644 Ga0265342_100816442 407
126 3300046537 Ga0495598_0043017 Ga0495598_0043017_68_1291 407
127 3300047447 Ga0495685_027707 Ga0495685_027707_70_1299 407
128 3300048907 Ga0496104_0000709 Ga0496104_0000709_824_2047 407
129 3300048907 Ga0496104_0110898 Ga0496104_0110898_146_1369 407
130 3300048908 Ga0496105_0070606 Ga0496105_0070606_415_1638 407
131 3300048911 Ga0496108_0263702 Ga0496108_0263702_198_1421 407
132 3300048912 Ga0496109_0033888 Ga0496109_0033888_737_1960 407
133 3300048917 Ga0496114_0075626 Ga0496114_0075626_52_1275 407
134 3300048918 Ga0496115_0015922 Ga0496115_0015922_1412_2635 407
135 3300050489 nmdc:mga03683_20430_c1 nmdc:mga03683_20430_c1_783_2006 407
136 3300050492 nmdc:mga0yw44_35704_c1 nmdc:mga0yw44_35704_c1_619_1842 407
137 3300050493 nmdc:mga0k408_173380_c1 nmdc:mga0k408_173380_c1_12_1235 407
138 3300050493 nmdc:mga0k408_80396_c1 nmdc:mga0k408_80396_c1_640_1863 407
139 3300050494 nmdc:mga06z11_51201_c1 nmdc:mga06z11_51201_c1_545_1768 407
140 3300001977 JGI24746J21847_1003854 JGI24746J21847_10038542 408
141 3300001990 JGI24737J22298_10023198 JGI24737J22298_100231982 408
142 3300001991 JGI24743J22301_10003718 JGI24743J22301_100037182 408
143 3300002070 JGI24750J21931_1002146 JGI24750J21931_10021462 408
144 3300002073 JGI24745J21846_1001132 JGI24745J21846_10011322 408
145 3300002077 JGI24744J21845_10000132 JGI24744J21845_100001329 408
146 3300002239 JGI24034J26672_10002921 JGI24034J26672_100029212 408
147 3300005331 Ga0070670_100005524 Ga0070670_1000055246 408
148 3300005331 Ga0070670_100138127 Ga0070670_1001381272 408
149 3300005339 Ga0070660_100116389 Ga0070660_1001163891 408
150 3300005340 Ga0070689_100114941 Ga0070689_1001149412 408
151 3300005343 Ga0070687_100112257 Ga0070687_1001122572 408
152 3300005354 Ga0070675_100014864 Ga0070675_1000148643 408
153 3300005355 Ga0070671_100094737 Ga0070671_1000947373 408
154 3300005356 Ga0070674_100013446 Ga0070674_1000134463 408
155 3300005365 Ga0070688_100049110 Ga0070688_1000491102 408
156 3300005367 Ga0070667_100005456 Ga0070667_1000054568 408
157 3300005441 Ga0070700_100009080 Ga0070700_1000090803 408
158 3300005455 Ga0070663_100015442 Ga0070663_1000154423 408
159 3300005457 Ga0070662_100028585 Ga0070662_1000285853 408
160 3300005458 Ga0070681_10019315 Ga0070681_100193153 408
161 3300005466 Ga0070685_10040164 Ga0070685_100401643 408
162 3300005535 Ga0070684_100118724 Ga0070684_1001187242 408
163 3300005543 Ga0070672_100068241 Ga0070672_1000682412 408
164 3300005544 Ga0070686_100008725 Ga0070686_1000087253 408
165 3300005564 Ga0070664_100058640 Ga0070664_1000586402 408
166 3300005577 Ga0068857_100131016 Ga0068857_1001310162 408
167 3300005840 Ga0068870_10072506 Ga0068870_100725062 408
168 3300005843 Ga0068860_100045880 Ga0068860_1000458802 408
169 3300005844 Ga0068862_100070320 Ga0068862_1000703202 408
170 3300006038 Ga0075365_10065661 Ga0075365_100656612 408
171 3300006178 Ga0075367_10026188 Ga0075367_100261882 408
172 3300006178 Ga0075367_10068531 Ga0075367_100685312 408
173 3300006844 Ga0075428_100088746 Ga0075428_1000887462 408
174 3300006871 Ga0075434_100016655 Ga0075434_1000166552 408
175 3300007265 Ga0099794_10008099 Ga0099794_100080991 408
176 3300009098 Ga0105245_10122401 Ga0105245_101224012 408
177 3300009101 Ga0105247_10042433 Ga0105247_100424332 408
178 3300009147 Ga0114129_10110393 Ga0114129_101103933 408
179 3300009148 Ga0105243_10091087 Ga0105243_100910872 408
180 3300009177 Ga0105248_10002392 Ga0105248_100023928 408
181 3300010375 Ga0105239_10043450 Ga0105239_100434505 408
182 3300011119 Ga0105246_10027151 Ga0105246_100271511 408
183 3300013306 Ga0163162_10177606 Ga0163162_101776062 408
184 3300013308 Ga0157375_10028268 Ga0157375_100282684 408
185 3300014325 Ga0163163_10010637 Ga0163163_100106373 408
186 3300014968 Ga0157379_10033827 Ga0157379_100338273 408
187 3300014969 Ga0157376_10025542 Ga0157376_100255423 408
188 3300017792 Ga0163161_10037669 Ga0163161_100376693 408
189 3300025900 Ga0207710_10022873 Ga0207710_100228732 408
190 3300025901 Ga0207688_10004951 Ga0207688_100049512 408
191 3300025904 Ga0207647_10014742 Ga0207647_100147422 408
192 3300025908 Ga0207643_10007658 Ga0207643_100076582 408
193 3300025916 Ga0207663_10127598 Ga0207663_101275982 408
194 3300025920 Ga0207649_10163154 Ga0207649_101631542 408
195 3300025925 Ga0207650_10006280 Ga0207650_100062803 408
196 3300025926 Ga0207659_10023639 Ga0207659_100236392 408
197 3300025927 Ga0207687_10082051 Ga0207687_100820512 408
198 3300025928 Ga0207700_10032842 Ga0207700_100328423 408
199 3300025933 Ga0207706_10003979 Ga0207706_100039793 408
200 3300025936 Ga0207670_10075180 Ga0207670_100751803 408
201 3300025940 Ga0207691_10006839 Ga0207691_100068392 408
202 3300025941 Ga0207711_10012455 Ga0207711_100124552 408
203 3300025942 Ga0207689_10030358 Ga0207689_100303581 408
204 3300025944 Ga0207661_10049496 Ga0207661_100494963 408
205 3300025945 Ga0207679_10022285 Ga0207679_100222852 408
206 3300025960 Ga0207651_10018003 Ga0207651_100180032 408
207 3300025961 Ga0207712_10065930 Ga0207712_100659303 408
208 3300025972 Ga0207668_10007588 Ga0207668_100075885 408
209 3300026067 Ga0207678_10010214 Ga0207678_100102147 408
210 3300026078 Ga0207702_10106726 Ga0207702_101067262 408
211 3300026088 Ga0207641_10010400 Ga0207641_100104002 408
212 3300026089 Ga0207648_10234244 Ga0207648_102342442 408
213 3300026116 Ga0207674_10139845 Ga0207674_101398452 408
214 3300026118 Ga0207675_100012148 Ga0207675_1000121483 408
215 3300026121 Ga0207683_10031288 Ga0207683_100312883 408
216 3300026142 Ga0207698_10006421 Ga0207698_100064213 408
217 3300028380 Ga0268265_10017602 Ga0268265_100176021 408
218 3300031344 Ga0265316_10108022 Ga0265316_101080221 408
219 3300031995 Ga0307409_100195505 Ga0307409_1001955052 408
220 3300035113 Ga0373936_0079517 Ga0373936_0079517_41_1267 408
221 3300035118 Ga0373954_0013490 Ga0373954_0013490_420_1673 408
222 3300042436 Ga0439435_0021157 Ga0439435_0021157_45_1271 408
223 3300046455 Ga0495603_0072826 Ga0495603_0072826_171_1499 408
224 3300046472 Ga0495580_0021728 Ga0495580_0021728_2712_4040 408
225 3300046476 Ga0495662_0038622 Ga0495662_0038622_203_1495 408
226 3300046476 Ga0495662_0097550 Ga0495662_0097550_105_1352 408
227 3300046491 Ga0495584_0006106 Ga0495584_0006106_594_1820 408
228 3300046526 Ga0495666_0087444 Ga0495666_0087444_58_1350 408
229 3300046690 Ga0495624_0109220 Ga0495624_0109220_120_1448 408
230 3300047321 Ga0495676_0098773 Ga0495676_0098773_332_1564 408
231 3300048905 Ga0496102_0000871 Ga0496102_0000871_25121_26368 408
232 3300048906 Ga0496103_0001365 Ga0496103_0001365_3406_4632 408
233 3300048906 Ga0496103_0002881 Ga0496103_0002881_3294_4541 408
234 3300048907 Ga0496104_0000873 Ga0496104_0000873_4475_5722 408
235 3300048907 Ga0496104_0050532 Ga0496104_0050532_1583_2809 408
236 3300048908 Ga0496105_0000514 Ga0496105_0000514_8024_9271 408
237 3300048908 Ga0496105_0178987 Ga0496105_0178987_478_1704 408
238 3300048909 Ga0496106_0146967 Ga0496106_0146967_288_1535 408
239 3300048910 Ga0496107_0002119 Ga0496107_0002119_4447_5694 408
240 3300048910 Ga0496107_0053932 Ga0496107_0053932_1498_2724 408
241 3300048911 Ga0496108_0012976 Ga0496108_0012976_177_1403 408
242 3300048911 Ga0496108_0019125 Ga0496108_0019125_235_1482 408
243 3300048912 Ga0496109_0000836 Ga0496109_0000836_5240_6487 408
244 3300048912 Ga0496109_0118772 Ga0496109_0118772_122_1348 408
245 3300048913 Ga0496110_0001539 Ga0496110_0001539_7697_8944 408
246 3300048913 Ga0496110_0006117 Ga0496110_0006117_4430_5656 408
247 3300048914 Ga0496111_0000072 Ga0496111_0000072_27145_28392 408
248 3300048914 Ga0496111_0000657 Ga0496111_0000657_15525_16751 408
249 3300048915 Ga0496112_0000112 Ga0496112_0000112_24642_25889 408
250 3300048916 Ga0496113_0000058 Ga0496113_0000058_16007_17254 408
251 3300048916 Ga0496113_0050519 Ga0496113_0050519_934_2160 408
252 3300048917 Ga0496114_0021043 Ga0496114_0021043_2501_3727 408
253 3300050507 nmdc:mga05p37_4606_c1 nmdc:mga05p37_4606_c1_5434_6681 408
254 3300050512 nmdc:mga0n895_121400_c1 nmdc:mga0n895_121400_c1_575_1822 408
255 3300050513 nmdc:mga0rr50_148620_c1 nmdc:mga0rr50_148620_c1_522_1853 408
256 3300053085 Ga0495619_0078577 Ga0495619_0078577_355_1602 408
257 3300053088 Ga0500644_0001393 Ga0500644_0001393_2691_3917 408
258 3300053119 Ga0500595_000010 Ga0500595_000010_120394_121620 408
259 3300053153 Ga0500616_0000001 Ga0500616_0000001_701684_702910 408
260 3300053730 Ga0500645_000051 Ga0500645_000051_50847_52073 408
261 3300006871 Ga0075434_100060574 Ga0075434_1000605742 409
262 3300028800 Ga0265338_10030715 Ga0265338_100307152 409
263 3300031238 Ga0265332_10002169 Ga0265332_100021699 409
264 3300031241 Ga0265325_10008595 Ga0265325_100085953 409
265 3300031247 Ga0265340_10039523 Ga0265340_100395232 409
266 3300031249 Ga0265339_10000091 Ga0265339_1000009159 409
267 3300031249 Ga0265339_10001994 Ga0265339_1000199415 409
268 3300031595 Ga0265313_10000260 Ga0265313_1000026021 409
269 3300031712 Ga0265342_10000175 Ga0265342_1000017515 409
270 3300031712 Ga0265342_10029297 Ga0265342_100292972 409
271 3300035116 Ga0373945_0000711 Ga0373945_0000711_2244_3479 409
272 3300035117 Ga0373953_0000627 Ga0373953_0000627_557_1792 409
273 3300035118 Ga0373954_0001186 Ga0373954_0001186_1069_2304 409
274 3300035172 Ga0373955_0000171 Ga0373955_0000171_4512_5747 409
275 3300035410 Ga0373924_0004372 Ga0373924_0004372_364_1599 409
276 3300035692 Ga0373935_0000218 Ga0373935_0000218_19807_21042 409
277 3300035695 Ga0373927_0006149 Ga0373927_0006149_2667_3902 409
278 3300035724 Ga0373933_0004945 Ga0373933_0004945_1228_2463 409
279 3300035725 Ga0373947_0000364 Ga0373947_0000364_18032_19267 409
280 3300036401 Ga0373937_0000009 Ga0373937_0000009_39709_40944 409
281 3300044694 Ga0466963_0037241 Ga0466963_0037241_1914_3143 409
282 3300044842 Ga0466957_0109914 Ga0466957_0109914_344_1573 409
283 3300046454 Ga0495592_0000422 Ga0495592_0000422_22110_23345 409
284 3300046459 Ga0495629_0018816 Ga0495629_0018816_3516_4751 409
285 3300046462 Ga0495651_0000300 Ga0495651_0000300_31212_32447 409
286 3300046463 Ga0495653_0000032 Ga0495653_0000032_8910_10145 409
287 3300046477 Ga0495664_0000010 Ga0495664_0000010_227567_228802 409
288 3300046511 Ga0495608_0000008 Ga0495608_0000008_39847_41082 409
289 3300046514 Ga0495618_0000002 Ga0495618_0000002_229840_231075 409
290 3300046516 Ga0495628_0000009 Ga0495628_0000009_227595_228830 409
291 3300046517 Ga0495630_0002397 Ga0495630_0002397_211_1446 409
292 3300046529 Ga0495652_0000011 Ga0495652_0000011_39537_40772 409
293 3300046533 Ga0495640_0000094 Ga0495640_0000094_39537_40772 409
294 3300046536 Ga0495587_0000086 Ga0495587_0000086_31258_32493 409
295 3300046543 Ga0495645_0000010 Ga0495645_0000010_8910_10145 409
296 3300046559 Ga0495667_0000005 Ga0495667_0000005_227595_228830 409
297 3300046642 Ga0495634_0000936 Ga0495634_0000936_22849_24084 409
298 3300046663 Ga0495635_0000008 Ga0495635_0000008_39520_40755 409
299 3300046675 Ga0495657_0000296 Ga0495657_0000296_39650_40885 409
300 3300046678 Ga0495599_0000007 Ga0495599_0000007_39537_40772 409
301 3300046679 Ga0495623_0000085 Ga0495623_0000085_48667_49902 409
302 3300046680 Ga0495646_0000021 Ga0495646_0000021_39492_40727 409
303 3300046689 Ga0495613_0023597 Ga0495613_0023597_1700_2935 409
304 3300046809 Ga0495600_0000001 Ga0495600_0000001_39537_40772 409
305 3300047317 Ga0495604_0000012 Ga0495604_0000012_227582_228817 409
306 3300047319 Ga0495674_0000011 Ga0495674_0000011_229868_231103 409
307 3300047322 Ga0495680_0000245 Ga0495680_0000245_31286_32521 409
308 3300047471 Ga0495684_0000084 Ga0495684_0000084_55456_56691 409
309 3300047471 Ga0495684_0040689 Ga0495684_0040689_1128_2375 409
310 3300048088 Ga0495602_0000073 Ga0495602_0000073_39520_40755 409
311 3300050509 nmdc:mga0qj67_29510_c1 nmdc:mga0qj67_29510_c1_2120_3349 409
312 3300050512 nmdc:mga0n895_88591_c1 nmdc:mga0n895_88591_c1_1222_2457 409
313 3300053077 Ga0495601_0000009 Ga0495601_0000009_39520_40755 409
314 3300053078 Ga0495612_0000019 Ga0495612_0000019_97073_98308 409
315 3300053084 Ga0495595_0000015 Ga0495595_0000015_20775_22010 409
316 3300053085 Ga0495619_0000012 Ga0495619_0000012_39520_40755 409
317 3300053119 Ga0500595_039632 Ga0500595_039632_209_1438 409
318 3300005327 Ga0070658_10022611 Ga0070658_100226113 410
319 3300005327 Ga0070658_10042393 Ga0070658_100423932 410
320 3300005327 Ga0070658_10145210 Ga0070658_101452102 410
321 3300005336 Ga0070680_100016120 Ga0070680_1000161203 410
322 3300005336 Ga0070680_100258243 Ga0070680_1002582431 410
323 3300005339 Ga0070660_100046044 Ga0070660_1000460443 410
324 3300005339 Ga0070660_100072432 Ga0070660_1000724322 410
325 3300005435 Ga0070714_100094014 Ga0070714_1000940142 410
326 3300005458 Ga0070681_10146679 Ga0070681_101466792 410
327 3300005459 Ga0068867_100132721 Ga0068867_1001327211 410
328 3300005530 Ga0070679_100034205 Ga0070679_1000342054 410
329 3300005530 Ga0070679_100040675 Ga0070679_1000406754 410
330 3300005563 Ga0068855_100014855 Ga0068855_1000148557 410
331 3300005563 Ga0068855_100045702 Ga0068855_1000457024 410
332 3300005563 Ga0068855_100215519 Ga0068855_1002155192 410
333 3300005616 Ga0068852_100047574 Ga0068852_1000475743 410
334 3300009093 Ga0105240_10054986 Ga0105240_100549863 410
335 3300009551 Ga0105238_10060021 Ga0105238_100600212 410
336 3300010159 Ga0099796_10001372 Ga0099796_100013722 410
337 3300013102 Ga0157371_10030802 Ga0157371_100308021 410
338 3300025909 Ga0207705_10024062 Ga0207705_100240623 410
339 3300025912 Ga0207707_10018671 Ga0207707_100186713 410
340 3300025913 Ga0207695_10037025 Ga0207695_100370253 410
341 3300025919 Ga0207657_10091226 Ga0207657_100912262 410
342 3300025919 Ga0207657_10094982 Ga0207657_100949822 410
343 3300025921 Ga0207652_10151345 Ga0207652_101513452 410
344 3300025924 Ga0207694_10035789 Ga0207694_100357892 410
345 3300025929 Ga0207664_10235823 Ga0207664_102358232 410
346 3300025949 Ga0207667_10031667 Ga0207667_100316675 410
347 3300025949 Ga0207667_10043263 Ga0207667_100432633 410
348 3300026142 Ga0207698_10027888 Ga0207698_100278884 410
349 3300031712 Ga0265342_10000203 Ga0265342_1000020317 410
350 3300037312 Ga0395899_0008445 Ga0395899_0008445_1539_2771 410
351 3300037418 Ga0395900_0085702 Ga0395900_0085702_1264_2496 410
352 3300037418 Ga0395900_0208999 Ga0395900_0208999_64_1296 410
353 3300037466 Ga0395898_0009233 Ga0395898_0009233_170_1402 410
354 3300037466 Ga0395898_0018005 Ga0395898_0018005_2147_3379 410
355 3300038443 Ga0395901_0102406 Ga0395901_0102406_1503_2735 410
356 3300046529 Ga0495652_0032696 Ga0495652_0032696_59_1291 410
357 3300046559 Ga0495667_0048018 Ga0495667_0048018_754_1986 410
358 3300049574 Ga0501038_0079380 Ga0501038_0079380_524_1756 410
359 3300049578 Ga0501042_0131480 Ga0501042_0131480_264_1496 410
360 3300049581 Ga0501047_0181929 Ga0501047_0181929_331_1563 410
361 3300049588 Ga0501072_0026826 Ga0501072_0026826_714_1946 410
362 3300049591 Ga0501075_0087388 Ga0501075_0087388_61_1293 410
363 3300049592 Ga0501076_0194418 Ga0501076_0194418_410_1642 410
364 3300049593 Ga0501077_0121159 Ga0501077_0121159_203_1435 410
365 3300049743 Ga0501081_0042931 Ga0501081_0042931_1534_2766 410
366 3300049823 Ga0501044_0071243 Ga0501044_0071243_1161_2393 410
367 3300053096 Ga0500641_0004145 Ga0500641_0004145_101_1333 410
368 iso_pu_bacteria 2599185352 2600197099 410
369 iso_pu_bacteria 2643221557 2643804639 410
370 iso_pu_bacteria 2643221610 2644064002 410
371 iso_pu_bacteria 2643221623 2644133472 410
372 iso_pu_bacteria 2643221668 2644375608 410
373 iso_pu_bacteria 2643221675 2644415834 410
374 iso_pu_bacteria 2643221680 2644448874 410
375 iso_pu_bacteria 2643221726 2644686601 410
376 iso_pu_bacteria 2989349275 2989352684 410
377 3300005336 Ga0070680_100284952 Ga0070680_1002849521 411
378 3300005458 Ga0070681_10096828 Ga0070681_100968282 411
379 3300005981 Ga0081538_10007110 Ga0081538_100071104 411
380 3300006871 Ga0075434_100048636 Ga0075434_1000486363 411
381 3300009147 Ga0114129_10110227 Ga0114129_101102273 411
382 3300025912 Ga0207707_10169353 Ga0207707_101693532 411
383 3300027360 Ga0209969_1000387 Ga0209969_10003875 411
384 3300027543 Ga0209999_1003848 Ga0209999_10038483 411
385 3300027876 Ga0209974_10003968 Ga0209974_100039682 411
386 3300031247 Ga0265340_10009089 Ga0265340_100090891 411
387 3300039437 Ga0436365_0394656 Ga0436365_0394656_127_1362 411
388 3300044694 Ga0466963_0088567 Ga0466963_0088567_145_1449 411
389 3300049569 Ga0501032_0108458 Ga0501032_0108458_495_1730 411
390 3300049570 Ga0501033_0054431 Ga0501033_0054431_394_1629 411
391 3300049586 Ga0501070_0015997 Ga0501070_0015997_4649_5884 411
392 3300050511 nmdc:mga08y16_171996_c1 nmdc:mga08y16_171996_c1_345_1580 411
393 3300050512 nmdc:mga0n895_55820_c1 nmdc:mga0n895_55820_c1_1543_2778 411
394 3300050515 nmdc:mga0a205_71570_c1 nmdc:mga0a205_71570_c1_1231_2466 411
395 3300005546 Ga0070696_100004350 Ga0070696_10000435010 412
396 3300031595 Ga0265313_10006492 Ga0265313_100064923 412
397 3300046537 Ga0495598_0008090 Ga0495598_0008090_940_2178 412
398 3300049571 Ga0501034_0001131 Ga0501034_0001131_27927_29165 412
399 3300005336 Ga0070680_100076342 Ga0070680_1000763422 413
400 3300005434 Ga0070709_10033820 Ga0070709_100338201 413
401 3300005435 Ga0070714_100056156 Ga0070714_1000561562 413
402 3300005436 Ga0070713_100019401 Ga0070713_1000194013 413
403 3300005436 Ga0070713_100097676 Ga0070713_1000976762 413
404 3300005437 Ga0070710_10004588 Ga0070710_100045882 413
405 3300005440 Ga0070705_100000612 Ga0070705_10000061224 413
406 3300005444 Ga0070694_100001207 Ga0070694_10000120713 413
407 3300005444 Ga0070694_100065749 Ga0070694_1000657492 413
408 3300005445 Ga0070708_100074687 Ga0070708_1000746872 413
409 3300005445 Ga0070708_100141210 Ga0070708_1001412102 413
410 3300005455 Ga0070663_100025552 Ga0070663_1000255523 413
411 3300005457 Ga0070662_100080215 Ga0070662_1000802153 413
412 3300005458 Ga0070681_10011673 Ga0070681_100116731 413
413 3300005458 Ga0070681_10244126 Ga0070681_102441261 413
414 3300005468 Ga0070707_100053998 Ga0070707_1000539982 413
415 3300005468 Ga0070707_100193638 Ga0070707_1001936382 413
416 3300005471 Ga0070698_100185928 Ga0070698_1001859281 413
417 3300005518 Ga0070699_100002532 Ga0070699_10000253215 413
418 3300005530 Ga0070679_100063861 Ga0070679_1000638611 413
419 3300005536 Ga0070697_100039102 Ga0070697_1000391023 413
420 3300005536 Ga0070697_100091058 Ga0070697_1000910584 413
421 3300005545 Ga0070695_100000054 Ga0070695_10000005411 413
422 3300005545 Ga0070695_100029614 Ga0070695_1000296143 413
423 3300005546 Ga0070696_100000931 Ga0070696_1000009312 413
424 3300005549 Ga0070704_100000180 Ga0070704_1000001806 413
425 3300005617 Ga0068859_100000494 Ga0068859_1000004947 413
426 3300005618 Ga0068864_100075630 Ga0068864_1000756303 413
427 3300005719 Ga0068861_100014951 Ga0068861_1000149517 413
428 3300005843 Ga0068860_100001274 Ga0068860_10000127416 413
429 3300005844 Ga0068862_100000795 Ga0068862_10000079530 413
430 3300005937 Ga0081455_10003542 Ga0081455_1000354210 413
431 3300005937 Ga0081455_10169619 Ga0081455_101696191 413
432 3300006028 Ga0070717_10063658 Ga0070717_100636583 413
433 3300006163 Ga0070715_10014168 Ga0070715_100141683 413
434 3300006173 Ga0070716_100011064 Ga0070716_1000110643 413
435 3300006844 Ga0075428_100049877 Ga0075428_1000498773 413
436 3300006846 Ga0075430_100001098 Ga0075430_10000109816 413
437 3300006847 Ga0075431_100004759 Ga0075431_10000475915 413
438 3300006847 Ga0075431_100011228 Ga0075431_1000112287 413
439 3300006871 Ga0075434_100084707 Ga0075434_1000847073 413
440 3300006931 Ga0097620_100000494 Ga0097620_1000004947 413
441 3300007265 Ga0099794_10043551 Ga0099794_100435512 413
442 3300009094 Ga0111539_10245411 Ga0111539_102454112 413
443 3300009147 Ga0114129_10102152 Ga0114129_101021523 413
444 3300009148 Ga0105243_10127230 Ga0105243_101272302 413
445 3300009553 Ga0105249_10017439 Ga0105249_100174393 413
446 3300011119 Ga0105246_10022164 Ga0105246_100221643 413
447 3300014326 Ga0157380_10132662 Ga0157380_101326621 413
448 3300025905 Ga0207685_10004104 Ga0207685_100041043 413
449 3300025910 Ga0207684_10117905 Ga0207684_101179052 413
450 3300025912 Ga0207707_10007064 Ga0207707_100070643 413
451 3300025912 Ga0207707_10150622 Ga0207707_101506222 413
452 3300025915 Ga0207693_10072370 Ga0207693_100723702 413
453 3300025916 Ga0207663_10058549 Ga0207663_100585491 413
454 3300025917 Ga0207660_10009267 Ga0207660_100092675 413
455 3300025921 Ga0207652_10253216 Ga0207652_102532161 413
456 3300025922 Ga0207646_10068130 Ga0207646_100681301 413
457 3300025939 Ga0207665_10011501 Ga0207665_100115014 413
458 3300026067 Ga0207678_10045206 Ga0207678_100452061 413
459 3300026095 Ga0207676_10066563 Ga0207676_100665633 413
460 3300026116 Ga0207674_10014002 Ga0207674_100140025 413
461 3300027671 Ga0209588_1001621 Ga0209588_10016213 413
462 3300028380 Ga0268265_10000528 Ga0268265_100005285 413
463 3300028381 Ga0268264_10001265 Ga0268264_1000126519 413
464 3300031824 Ga0307413_10031388 Ga0307413_100313883 413
465 3300035119 Ga0373956_0001511 Ga0373956_0001511_4973_6226 413
466 3300035120 Ga0373957_0006048 Ga0373957_0006048_891_2144 413
467 3300035172 Ga0373955_0007870 Ga0373955_0007870_1920_3173 413
468 3300035724 Ga0373933_0018662 Ga0373933_0018662_1705_2958 413
469 3300045051 Ga0451576_0001638 Ga0451576_0001638_4816_6057 413
470 3300046462 Ga0495651_0000764 Ga0495651_0000764_18533_19786 413
471 3300046559 Ga0495667_0004110 Ga0495667_0004110_4649_5890 413
472 3300047318 Ga0495636_0057011 Ga0495636_0057011_59_1300 413
473 3300047322 Ga0495680_0209411 Ga0495680_0209411_134_1375 413
474 3300048903 Ga0496100_0072383 Ga0496100_0072383_883_2124 413
475 3300048905 Ga0496102_0006598 Ga0496102_0006598_7724_8965 413
476 3300048905 Ga0496102_0051348 Ga0496102_0051348_1108_2352 413
477 3300048906 Ga0496103_0009792 Ga0496103_0009792_2737_3978 413
478 3300048909 Ga0496106_0037687 Ga0496106_0037687_1565_2806 413
479 3300048909 Ga0496106_0065636 Ga0496106_0065636_1299_2543 413
480 3300048909 Ga0496106_0086525 Ga0496106_0086525_114_1355 413
481 3300048910 Ga0496107_0046893 Ga0496107_0046893_53_1294 413
482 3300049574 Ga0501038_0069228 Ga0501038_0069228_824_2065 413
483 3300049577 Ga0501041_0137266 Ga0501041_0137266_164_1405 413
484 3300049578 Ga0501042_0013021 Ga0501042_0013021_1818_3059 413
485 3300049578 Ga0501042_0094044 Ga0501042_0094044_517_1758 413
486 3300049580 Ga0501046_0040702 Ga0501046_0040702_2004_3245 413
487 3300049591 Ga0501075_0036972 Ga0501075_0036972_622_1863 413
488 3300049591 Ga0501075_0098582 Ga0501075_0098582_164_1405 413
489 3300049592 Ga0501076_0006327 Ga0501076_0006327_6432_7673 413
490 3300049593 Ga0501077_0005796 Ga0501077_0005796_6216_7457 413
491 3300049593 Ga0501077_0009236 Ga0501077_0009236_1066_2307 413
492 3300049741 Ga0501079_0074222 Ga0501079_0074222_720_1961 413
493 3300049743 Ga0501081_0003672 Ga0501081_0003672_5534_6775 413
494 3300049743 Ga0501081_0021499 Ga0501081_0021499_813_2054 413
495 3300049743 Ga0501081_0035300 Ga0501081_0035300_1343_2584 413
496 3300049824 Ga0501045_0128811 Ga0501045_0128811_610_1851 413
497 3300050507 nmdc:mga05p37_90816_c1 nmdc:mga05p37_90816_c1_1311_2552 413
498 3300050509 nmdc:mga0qj67_733_c1 nmdc:mga0qj67_733_c1_7121_8362 413
499 3300050509 nmdc:mga0qj67_74589_c1 nmdc:mga0qj67_74589_c1_1097_2338 413
500 3300050510 nmdc:mga06r32_13222_c1 nmdc:mga06r32_13222_c1_1276_2517 413
501 3300050510 nmdc:mga06r32_21130_c1 nmdc:mga06r32_21130_c1_24_1265 413
502 3300050510 nmdc:mga06r32_68764_c1 nmdc:mga06r32_68764_c1_1458_2699 413
503 3300050511 nmdc:mga08y16_58180_c1 nmdc:mga08y16_58180_c1_2532_3779 413
504 3300050512 nmdc:mga0n895_77179_c1 nmdc:mga0n895_77179_c1_784_2028 413
505 3300050512 nmdc:mga0n895_91342_c1 nmdc:mga0n895_91342_c1_1387_2631 413
506 3300054114 Ga0501084_0009054 Ga0501084_0009054_2279_3520 413
507 3300060353 Ga0501082_0044681 Ga0501082_0044681_1520_2761 413
508 3300003775 Ga0055524_1001448 Ga0055524_10014486 414
509 3300005341 Ga0070691_10065025 Ga0070691_100650252 414
510 3300005434 Ga0070709_10000363 Ga0070709_1000036314 414
511 3300005435 Ga0070714_100000833 Ga0070714_10000083316 414
512 3300005436 Ga0070713_100003768 Ga0070713_1000037686 414
513 3300005437 Ga0070710_10000226 Ga0070710_1000022610 414
514 3300005439 Ga0070711_100001128 Ga0070711_1000011284 414
515 3300005545 Ga0070695_100039414 Ga0070695_1000394142 414
516 3300005983 Ga0081540_1003101 Ga0081540_100310111 414
517 3300006028 Ga0070717_10002481 Ga0070717_100024815 414
518 3300006163 Ga0070715_10041416 Ga0070715_100414162 414
519 3300006173 Ga0070716_100000149 Ga0070716_10000014913 414
520 3300006175 Ga0070712_100000413 Ga0070712_10000041315 414
521 3300006846 Ga0075430_100006043 Ga0075430_1000060436 414
522 3300009094 Ga0111539_10028951 Ga0111539_100289513 414
523 3300021388 Ga0213875_10080492 Ga0213875_100804921 414
524 3300025299 Ga0209256_1000073 Ga0209256_10000736 414
525 3300025898 Ga0207692_10000966 Ga0207692_100009665 414
526 3300025906 Ga0207699_10000366 Ga0207699_100003669 414
527 3300025915 Ga0207693_10002752 Ga0207693_100027522 414
528 3300025916 Ga0207663_10006969 Ga0207663_100069696 414
529 3300025928 Ga0207700_10000437 Ga0207700_1000043714 414
530 3300025929 Ga0207664_10000416 Ga0207664_1000041613 414
531 3300025939 Ga0207665_10000234 Ga0207665_1000023424 414
532 3300027378 Ga0209981_1001997 Ga0209981_10019973 414
533 3300027462 Ga0210000_1001517 Ga0210000_10015173 414
534 3300027543 Ga0209999_1006386 Ga0209999_10063863 414
535 3300027665 Ga0209983_1005796 Ga0209983_10057963 414
536 3300027876 Ga0209974_10002609 Ga0209974_100026093 414
537 3300031548 Ga0307408_100035017 Ga0307408_1000350172 414
538 3300035086 Ga0373934_0026576 Ga0373934_0026576_52_1302 414
539 3300035120 Ga0373957_0053769 Ga0373957_0053769_53_1303 414
540 3300035724 Ga0373933_0007851 Ga0373933_0007851_3699_4949 414
541 3300037853 Ga0436364_1509239 Ga0436364_1509239_1497_2744 414
542 3300039450 Ga0436363_1044488 Ga0436363_1044488_239_1486 414
543 3300042876 Ga0451577_0158790 Ga0451577_0158790_739_1983 414
544 3300044673 Ga0453683_0000494 Ga0453683_0000494_30111_31355 414
545 3300046511 Ga0495608_0025139 Ga0495608_0025139_2236_3486 414
546 3300046663 Ga0495635_0123563 Ga0495635_0123563_459_1709 414
547 3300046679 Ga0495623_0015361 Ga0495623_0015361_1883_3133 414
548 3300047317 Ga0495604_0094830 Ga0495604_0094830_39_1289 414
549 3300047471 Ga0495684_0072546 Ga0495684_0072546_1089_2339 414
550 3300048088 Ga0495602_0029432 Ga0495602_0029432_3171_4421 414
551 3300049571 Ga0501034_0020143 Ga0501034_0020143_3202_4446 414
552 3300049586 Ga0501070_0221956 Ga0501070_0221956_103_1347 414
553 3300049741 Ga0501079_0045484 Ga0501079_0045484_616_1866 414
554 3300050507 nmdc:mga05p37_34120_c1 nmdc:mga05p37_34120_c1_1383_2630 414
555 3300050509 nmdc:mga0qj67_110767_c1 nmdc:mga0qj67_110767_c1_750_2000 414
556 3300050509 nmdc:mga0qj67_157763_c1 nmdc:mga0qj67_157763_c1_72_1316 414
557 3300050510 nmdc:mga06r32_57806_c1 nmdc:mga06r32_57806_c1_1059_2306 414
558 3300050514 nmdc:mga08x19_54912_c1 nmdc:mga08x19_54912_c1_1158_2408 414
559 3300005458 Ga0070681_10252357 Ga0070681_102523571 415
560 3300006028 Ga0070717_10115314 Ga0070717_101153142 415
561 3300006175 Ga0070712_100140207 Ga0070712_1001402072 415
562 3300025916 Ga0207663_10070026 Ga0207663_100700261 415
563 3300028556 Ga0265337_1000182 Ga0265337_10001827 415
564 3300028800 Ga0265338_10056170 Ga0265338_100561703 415
565 3300031241 Ga0265325_10000034 Ga0265325_1000003442 415
566 3300031241 Ga0265325_10001708 Ga0265325_100017086 415
567 3300031241 Ga0265325_10038458 Ga0265325_100384582 415
568 3300031249 Ga0265339_10019021 Ga0265339_100190213 415
569 3300031249 Ga0265339_10037911 Ga0265339_100379111 415
570 3300031344 Ga0265316_10043894 Ga0265316_100438942 415
571 3300031595 Ga0265313_10000176 Ga0265313_1000017615 415
572 3300031595 Ga0265313_10004374 Ga0265313_100043748 415
573 3300031595 Ga0265313_10014189 Ga0265313_100141894 415
574 3300035118 Ga0373954_0009787 Ga0373954_0009787_2391_3638 415
575 3300035172 Ga0373955_0002392 Ga0373955_0002392_6018_7286 415
576 3300035172 Ga0373955_0019223 Ga0373955_0019223_1091_2338 415
577 3300035724 Ga0373933_0002037 Ga0373933_0002037_5607_6854 415
578 3300035725 Ga0373947_0044583 Ga0373947_0044583_123_1391 415
579 3300036401 Ga0373937_0028762 Ga0373937_0028762_1919_3187 415
580 3300036401 Ga0373937_0046498 Ga0373937_0046498_1117_2364 415
581 3300046454 Ga0495592_0007319 Ga0495592_0007319_2554_3822 415
582 3300046511 Ga0495608_0041070 Ga0495608_0041070_1605_2852 415
583 3300046516 Ga0495628_0007599 Ga0495628_0007599_6228_7496 415
584 3300046529 Ga0495652_0090939 Ga0495652_0090939_296_1543 415
585 3300046559 Ga0495667_0063532 Ga0495667_0063532_539_1807 415
586 3300046559 Ga0495667_0085337 Ga0495667_0085337_53_1300 415
587 3300046675 Ga0495657_0027472 Ga0495657_0027472_2723_3991 415
588 3300046679 Ga0495623_0010359 Ga0495623_0010359_3644_4912 415
589 3300046809 Ga0495600_0006193 Ga0495600_0006193_4070_5338 415
590 3300047317 Ga0495604_0016854 Ga0495604_0016854_1095_2342 415
591 3300047317 Ga0495604_0039078 Ga0495604_0039078_931_2199 415
592 3300047319 Ga0495674_0209301 Ga0495674_0209301_80_1348 415
593 3300047322 Ga0495680_0032027 Ga0495680_0032027_779_2047 415
594 3300048088 Ga0495602_0202511 Ga0495602_0202511_85_1332 415
595 3300048907 Ga0496104_0000317 Ga0496104_0000317_32165_33433 415
596 3300048908 Ga0496105_0000485 Ga0496105_0000485_14170_15438 415
597 3300049586 Ga0501070_0035326 Ga0501070_0035326_796_2046 415
598 3300053077 Ga0495601_0000521 Ga0495601_0000521_3767_5035 415
599 3300053078 Ga0495612_0002143 Ga0495612_0002143_5050_6318 415
600 3300053084 Ga0495595_0001827 Ga0495595_0001827_579_1826 415
601 3300053085 Ga0495619_0022668 Ga0495619_0022668_1245_2492 415
602 2209111006 2214856314 2213902559 416
603 3300000041 ARcpr5oldR_c000046 ARcpr5oldR_00004620 416
604 3300000042 ARSoilYngRDRAFT_c00078 ARSoilYngRDRAFT_0007816 416
605 3300000043 ARcpr5yngRDRAFT_c000072 ARcpr5yngRDRAFT_0000727 416
606 3300000044 ARSoilOldRDRAFT_c000019 ARSoilOldRDRAFT_0000194 416
607 3300000045 ARCol0oldRDRAFT_c00019 ARCol0oldRDRAFT_0001913 416
608 3300000652 ARCol0yngRDRAFT_1000004 ARCol0yngRDRAFT_100000441 416
609 3300001977 JGI24746J21847_1000147 JGI24746J21847_10001477 416
610 3300001978 JGI24747J21853_1000217 JGI24747J21853_10002173 416
611 3300001989 JGI24739J22299_10010699 JGI24739J22299_100106992 416
612 3300001990 JGI24737J22298_10002058 JGI24737J22298_100020583 416
613 3300001990 JGI24737J22298_10003740 JGI24737J22298_100037404 416
614 3300002070 JGI24750J21931_1000430 JGI24750J21931_10004304 416
615 3300002074 JGI24748J21848_1000555 JGI24748J21848_10005553 416
616 3300002075 JGI24738J21930_10004182 JGI24738J21930_100041823 416
617 3300002244 JGI24742J22300_10000106 JGI24742J22300_100001062 416
618 3300002244 JGI24742J22300_10000483 JGI24742J22300_100004832 416
619 3300003911 JGI25405J52794_10000722 JGI25405J52794_100007222 416
620 3300003911 JGI25405J52794_10002175 JGI25405J52794_100021751 416
621 3300005289 Ga0065704_10075977 Ga0065704_100759772 416
622 3300005293 Ga0065715_10091019 Ga0065715_100910196 416
623 3300005328 Ga0070676_10102718 Ga0070676_101027181 416
624 3300005329 Ga0070683_100001872 Ga0070683_10000187213 416
625 3300005329 Ga0070683_100110942 Ga0070683_1001109422 416
626 3300005329 Ga0070683_100329083 Ga0070683_1003290831 416
627 3300005330 Ga0070690_100027115 Ga0070690_1000271152 416
628 3300005331 Ga0070670_100040546 Ga0070670_1000405465 416
629 3300005333 Ga0070677_10000429 Ga0070677_1000042914 416
630 3300005334 Ga0068869_100004944 Ga0068869_1000049446 416
631 3300005334 Ga0068869_100113167 Ga0068869_1001131672 416
632 3300005336 Ga0070680_100018787 Ga0070680_1000187876 416
633 3300005337 Ga0070682_100000695 Ga0070682_10000069516 416
634 3300005338 Ga0068868_100004036 Ga0068868_1000040367 416
635 3300005340 Ga0070689_100012268 Ga0070689_1000122686 416
636 3300005341 Ga0070691_10011581 Ga0070691_100115812 416
637 3300005344 Ga0070661_100011491 Ga0070661_1000114916 416
638 3300005345 Ga0070692_10002719 Ga0070692_100027193 416
639 3300005347 Ga0070668_100058985 Ga0070668_1000589853 416
640 3300005347 Ga0070668_100128540 Ga0070668_1001285402 416
641 3300005353 Ga0070669_100015276 Ga0070669_1000152766 416
642 3300005354 Ga0070675_100000240 Ga0070675_10000024015 416
643 3300005355 Ga0070671_100015801 Ga0070671_1000158016 416
644 3300005364 Ga0070673_100007045 Ga0070673_1000070457 416
645 3300005365 Ga0070688_100001905 Ga0070688_1000019056 416
646 3300005366 Ga0070659_100007610 Ga0070659_1000076107 416
647 3300005366 Ga0070659_100010913 Ga0070659_1000109136 416
648 3300005367 Ga0070667_100020849 Ga0070667_1000208496 416
649 3300005367 Ga0070667_100159811 Ga0070667_1001598112 416
650 3300005436 Ga0070713_100000381 Ga0070713_10000038124 416
651 3300005437 Ga0070710_10076967 Ga0070710_100769672 416
652 3300005440 Ga0070705_100027104 Ga0070705_1000271044 416
653 3300005441 Ga0070700_100027831 Ga0070700_1000278313 416
654 3300005444 Ga0070694_100002780 Ga0070694_1000027804 416
655 3300005455 Ga0070663_100040436 Ga0070663_1000404364 416
656 3300005457 Ga0070662_100013532 Ga0070662_1000135324 416
657 3300005457 Ga0070662_100261831 Ga0070662_1002618311 416
658 3300005466 Ga0070685_10014546 Ga0070685_100145461 416
659 3300005466 Ga0070685_10051505 Ga0070685_100515052 416
660 3300005530 Ga0070679_100023238 Ga0070679_1000232386 416
661 3300005530 Ga0070679_100084499 Ga0070679_1000844993 416
662 3300005535 Ga0070684_100009261 Ga0070684_1000092614 416
663 3300005535 Ga0070684_100062206 Ga0070684_1000622062 416
664 3300005539 Ga0068853_100009694 Ga0068853_1000096944 416
665 3300005539 Ga0068853_100069407 Ga0068853_1000694073 416
666 3300005543 Ga0070672_100001847 Ga0070672_1000018479 416
667 3300005544 Ga0070686_100010163 Ga0070686_1000101636 416
668 3300005544 Ga0070686_100038773 Ga0070686_1000387732 416
669 3300005546 Ga0070696_100038185 Ga0070696_1000381853 416
670 3300005549 Ga0070704_100004531 Ga0070704_1000045318 416
671 3300005563 Ga0068855_100017390 Ga0068855_1000173906 416
672 3300005563 Ga0068855_100091933 Ga0068855_1000919333 416
673 3300005564 Ga0070664_100001002 Ga0070664_1000010029 416
674 3300005577 Ga0068857_100229267 Ga0068857_1002292671 416
675 3300005614 Ga0068856_100023460 Ga0068856_1000234607 416
676 3300005615 Ga0070702_100019293 Ga0070702_1000192933 416
677 3300005615 Ga0070702_100096972 Ga0070702_1000969722 416
678 3300005616 Ga0068852_100004985 Ga0068852_1000049855 416
679 3300005617 Ga0068859_100010808 Ga0068859_1000108086 416
680 3300005618 Ga0068864_100003922 Ga0068864_1000039227 416
681 3300005719 Ga0068861_100003710 Ga0068861_1000037107 416
682 3300005719 Ga0068861_100023937 Ga0068861_1000239374 416
683 3300005840 Ga0068870_10000157 Ga0068870_1000015720 416
684 3300005841 Ga0068863_100000674 Ga0068863_10000067415 416
685 3300005842 Ga0068858_100091776 Ga0068858_1000917762 416
686 3300005843 Ga0068860_100012435 Ga0068860_1000124355 416
687 3300005843 Ga0068860_100130650 Ga0068860_1001306502 416
688 3300005937 Ga0081455_10000059 Ga0081455_1000005941 416
689 3300005937 Ga0081455_10002427 Ga0081455_100024276 416
690 3300005983 Ga0081540_1008452 Ga0081540_10084522 416
691 3300005983 Ga0081540_1012205 Ga0081540_10122053 416
692 3300006028 Ga0070717_10000161 Ga0070717_100001614 416
693 3300006042 Ga0075368_10025334 Ga0075368_100253342 416
694 3300006058 Ga0075432_10032964 Ga0075432_100329642 416
695 3300006173 Ga0070716_100045195 Ga0070716_1000451953 416
696 3300006175 Ga0070712_100022489 Ga0070712_1000224895 416
697 3300006358 Ga0068871_100001066 Ga0068871_1000010665 416
698 3300006844 Ga0075428_100038761 Ga0075428_1000387612 416
699 3300006846 Ga0075430_100000070 Ga0075430_10000007032 416
700 3300006847 Ga0075431_100001221 Ga0075431_10000122123 416
701 3300006852 Ga0075433_10010476 Ga0075433_100104766 416
702 3300006852 Ga0075433_10109013 Ga0075433_101090132 416
703 3300006871 Ga0075434_100000212 Ga0075434_10000021235 416
704 3300006871 Ga0075434_100037805 Ga0075434_1000378054 416
705 3300006871 Ga0075434_100090704 Ga0075434_1000907043 416
706 3300006880 Ga0075429_100003999 Ga0075429_1000039992 416
707 3300006881 Ga0068865_100000131 Ga0068865_1000001317 416
708 3300006931 Ga0097620_100010810 Ga0097620_1000108107 416
709 3300007076 Ga0075435_100034976 Ga0075435_1000349764 416
710 3300007076 Ga0075435_100077055 Ga0075435_1000770552 416
711 3300007076 Ga0075435_100121660 Ga0075435_1001216603 416
712 3300009094 Ga0111539_10000138 Ga0111539_1000013825 416
713 3300009094 Ga0111539_10039247 Ga0111539_100392476 416
714 3300009098 Ga0105245_10011704 Ga0105245_100117043 416
715 3300009098 Ga0105245_10059696 Ga0105245_100596962 416
716 3300009147 Ga0114129_10002312 Ga0114129_1000231210 416
717 3300009147 Ga0114129_10003950 Ga0114129_100039505 416
718 3300009148 Ga0105243_10006299 Ga0105243_100062996 416
719 3300009148 Ga0105243_10032492 Ga0105243_100324924 416
720 3300009174 Ga0105241_10056240 Ga0105241_100562403 416
721 3300009174 Ga0105241_10064613 Ga0105241_100646132 416
722 3300009177 Ga0105248_10012777 Ga0105248_100127776 416
723 3300009177 Ga0105248_10013552 Ga0105248_100135526 416
724 3300009545 Ga0105237_10018866 Ga0105237_100188663 416
725 3300009545 Ga0105237_10042427 Ga0105237_100424275 416
726 3300009553 Ga0105249_10001029 Ga0105249_100010296 416
727 3300009553 Ga0105249_10024785 Ga0105249_100247853 416
728 3300010375 Ga0105239_10112207 Ga0105239_101122073 416
729 3300013296 Ga0157374_10000671 Ga0157374_100006718 416
730 3300013297 Ga0157378_10088364 Ga0157378_100883643 416
731 3300013297 Ga0157378_10411027 Ga0157378_104110271 416
732 3300013308 Ga0157375_10002908 Ga0157375_1000290813 416
733 3300014325 Ga0163163_10004312 Ga0163163_100043129 416
734 3300014325 Ga0163163_10033625 Ga0163163_100336253 416
735 3300014326 Ga0157380_10005886 Ga0157380_100058867 416
736 3300014745 Ga0157377_10000570 Ga0157377_1000057013 416
737 3300014968 Ga0157379_10000345 Ga0157379_1000034516 416
738 3300014968 Ga0157379_10133620 Ga0157379_101336202 416
739 3300014969 Ga0157376_10039773 Ga0157376_100397734 416
740 3300014969 Ga0157376_10098105 Ga0157376_100981053 416
741 3300017792 Ga0163161_10004669 Ga0163161_100046693 416
742 3300025271 Ga0207666_1000069 Ga0207666_100006915 416
743 3300025271 Ga0207666_1001040 Ga0207666_10010403 416
744 3300025290 Ga0207673_1007066 Ga0207673_10070661 416
745 3300025315 Ga0207697_10000390 Ga0207697_100003906 416
746 3300025315 Ga0207697_10006568 Ga0207697_100065685 416
747 3300025735 Ga0207713_1036708 Ga0207713_10367082 416
748 3300025885 Ga0207653_10024508 Ga0207653_100245082 416
749 3300025893 Ga0207682_10000048 Ga0207682_100000487 416
750 3300025898 Ga0207692_10005320 Ga0207692_100053205 416
751 3300025901 Ga0207688_10001496 Ga0207688_100014967 416
752 3300025903 Ga0207680_10045613 Ga0207680_100456132 416
753 3300025904 Ga0207647_10013329 Ga0207647_100133295 416
754 3300025906 Ga0207699_10074768 Ga0207699_100747682 416
755 3300025907 Ga0207645_10012526 Ga0207645_100125262 416
756 3300025908 Ga0207643_10000581 Ga0207643_100005816 416
757 3300025911 Ga0207654_10004716 Ga0207654_100047163 416
758 3300025912 Ga0207707_10016616 Ga0207707_100166163 416
759 3300025912 Ga0207707_10048473 Ga0207707_100484733 416
760 3300025914 Ga0207671_10011618 Ga0207671_100116185 416
761 3300025915 Ga0207693_10010010 Ga0207693_100100106 416
762 3300025915 Ga0207693_10011653 Ga0207693_100116537 416
763 3300025917 Ga0207660_10000192 Ga0207660_1000019232 416
764 3300025918 Ga0207662_10000647 Ga0207662_1000064713 416
765 3300025919 Ga0207657_10038177 Ga0207657_100381775 416
766 3300025920 Ga0207649_10000141 Ga0207649_1000014115 416
767 3300025920 Ga0207649_10045728 Ga0207649_100457282 416
768 3300025920 Ga0207649_10083443 Ga0207649_100834432 416
769 3300025921 Ga0207652_10004519 Ga0207652_1000451913 416
770 3300025923 Ga0207681_10000359 Ga0207681_1000035915 416
771 3300025923 Ga0207681_10159118 Ga0207681_101591182 416
772 3300025925 Ga0207650_10004853 Ga0207650_100048535 416
773 3300025926 Ga0207659_10000052 Ga0207659_1000005233 416
774 3300025926 Ga0207659_10249098 Ga0207659_102490981 416
775 3300025927 Ga0207687_10000097 Ga0207687_1000009742 416
776 3300025927 Ga0207687_10069568 Ga0207687_100695682 416
777 3300025928 Ga0207700_10000673 Ga0207700_1000067318 416
778 3300025931 Ga0207644_10002956 Ga0207644_100029569 416
779 3300025931 Ga0207644_10033370 Ga0207644_100333705 416
780 3300025932 Ga0207690_10000278 Ga0207690_1000027820 416
781 3300025933 Ga0207706_10036851 Ga0207706_100368514 416
782 3300025933 Ga0207706_10136791 Ga0207706_101367912 416
783 3300025934 Ga0207686_10000850 Ga0207686_1000085014 416
784 3300025934 Ga0207686_10008904 Ga0207686_100089046 416
785 3300025935 Ga0207709_10000349 Ga0207709_100003493 416
786 3300025935 Ga0207709_10014956 Ga0207709_100149563 416
787 3300025936 Ga0207670_10000781 Ga0207670_100007819 416
788 3300025937 Ga0207669_10000168 Ga0207669_1000016825 416
789 3300025938 Ga0207704_10000704 Ga0207704_100007047 416
790 3300025938 Ga0207704_10153219 Ga0207704_101532192 416
791 3300025939 Ga0207665_10000248 Ga0207665_1000024816 416
792 3300025940 Ga0207691_10003348 Ga0207691_1000334813 416
793 3300025941 Ga0207711_10006180 Ga0207711_100061807 416
794 3300025941 Ga0207711_10042109 Ga0207711_100421094 416
795 3300025941 Ga0207711_10119131 Ga0207711_101191312 416
796 3300025941 Ga0207711_10172471 Ga0207711_101724711 416
797 3300025942 Ga0207689_10012368 Ga0207689_100123684 416
798 3300025944 Ga0207661_10000143 Ga0207661_1000014315 416
799 3300025944 Ga0207661_10076338 Ga0207661_100763382 416
800 3300025944 Ga0207661_10110264 Ga0207661_101102641 416
801 3300025944 Ga0207661_10250242 Ga0207661_102502422 416
802 3300025945 Ga0207679_10000035 Ga0207679_100000359 416
803 3300025945 Ga0207679_10179254 Ga0207679_101792541 416
804 3300025960 Ga0207651_10000080 Ga0207651_1000008034 416
805 3300025961 Ga0207712_10003380 Ga0207712_100033807 416
806 3300025972 Ga0207668_10109764 Ga0207668_101097642 416
807 3300025981 Ga0207640_10092226 Ga0207640_100922261 416
808 3300025986 Ga0207658_10022910 Ga0207658_100229102 416
809 3300025986 Ga0207658_10137366 Ga0207658_101373662 416
810 3300026023 Ga0207677_10000614 Ga0207677_1000061422 416
811 3300026035 Ga0207703_10022821 Ga0207703_100228211 416
812 3300026035 Ga0207703_10033869 Ga0207703_100338692 416
813 3300026035 Ga0207703_10063034 Ga0207703_100630343 416
814 3300026067 Ga0207678_10005116 Ga0207678_100051166 416
815 3300026067 Ga0207678_10044487 Ga0207678_100444872 416
816 3300026075 Ga0207708_10008117 Ga0207708_100081174 416
817 3300026075 Ga0207708_10013232 Ga0207708_100132323 416
818 3300026078 Ga0207702_10001956 Ga0207702_100019564 416
819 3300026078 Ga0207702_10116525 Ga0207702_101165251 416
820 3300026078 Ga0207702_10121704 Ga0207702_101217043 416
821 3300026088 Ga0207641_10009143 Ga0207641_100091433 416
822 3300026095 Ga0207676_10001840 Ga0207676_100018402 416
823 3300026116 Ga0207674_10002206 Ga0207674_100022066 416
824 3300026118 Ga0207675_100003721 Ga0207675_10000372110 416
825 3300026118 Ga0207675_100103227 Ga0207675_1001032272 416
826 3300026121 Ga0207683_10002096 Ga0207683_100020967 416
827 3300026121 Ga0207683_10003030 Ga0207683_100030306 416
828 3300026121 Ga0207683_10013315 Ga0207683_100133152 416
829 3300026142 Ga0207698_10003387 Ga0207698_100033876 416
830 3300027617 Ga0210002_1000400 Ga0210002_10004007 416
831 3300027695 Ga0209966_1002841 Ga0209966_10028412 416
832 3300027717 Ga0209998_10000497 Ga0209998_100004977 416
833 3300027717 Ga0209998_10001108 Ga0209998_100011083 416
834 3300027876 Ga0209974_10005545 Ga0209974_100055452 416
835 3300027907 Ga0207428_10000075 Ga0207428_1000007563 416
836 3300027907 Ga0207428_10000428 Ga0207428_1000042842 416
837 3300027907 Ga0207428_10001396 Ga0207428_1000139613 416
838 3300028379 Ga0268266_10024188 Ga0268266_100241883 416
839 3300028379 Ga0268266_10159053 Ga0268266_101590532 416
840 3300028380 Ga0268265_10003048 Ga0268265_100030483 416
841 3300028381 Ga0268264_10001145 Ga0268264_100011457 416
842 3300028381 Ga0268264_10045961 Ga0268264_100459612 416
843 3300034816 Ga0373930_0001646 Ga0373930_0001646_423_1679 416
844 3300034817 Ga0373948_0000065 Ga0373948_0000065_6476_7732 416
845 3300034818 Ga0373950_0003576 Ga0373950_0003576_109_1365 416
846 3300034957 Ga0373938_0004428 Ga0373938_0004428_231_1487 416
847 3300035084 Ga0373928_0000172 Ga0373928_0000172_10828_12084 416
848 3300035085 Ga0373929_0000721 Ga0373929_0000721_1930_3186 416
849 3300035085 Ga0373929_0002547 Ga0373929_0002547_1727_2977 416
850 3300035085 Ga0373929_0011884 Ga0373929_0011884_166_1422 416
851 3300035086 Ga0373934_0018951 Ga0373934_0018951_1369_2619 416
852 3300035086 Ga0373934_0061335 Ga0373934_0061335_115_1365 416
853 3300035088 Ga0373940_0002918 Ga0373940_0002918_635_1891 416
854 3300035088 Ga0373940_0007065 Ga0373940_0007065_350_1600 416
855 3300035089 Ga0373944_0000062 Ga0373944_0000062_7269_8519 416
856 3300035090 Ga0373949_0001909 Ga0373949_0001909_631_1887 416
857 3300035090 Ga0373949_0002539 Ga0373949_0002539_232_1488 416
858 3300035091 Ga0373951_0003492 Ga0373951_0003492_552_1802 416
859 3300035091 Ga0373951_0013765 Ga0373951_0013765_524_1780 416
860 3300035092 Ga0373952_0010979 Ga0373952_0010979_142_1392 416
861 3300035111 Ga0373923_0000277 Ga0373923_0000277_7793_9043 416
862 3300035112 Ga0373932_0002445 Ga0373932_0002445_1919_3175 416
863 3300035112 Ga0373932_0004031 Ga0373932_0004031_401_1657 416
864 3300035112 Ga0373932_0006012 Ga0373932_0006012_108_1358 416
865 3300035113 Ga0373936_0000954 Ga0373936_0000954_7600_8850 416
866 3300035113 Ga0373936_0017031 Ga0373936_0017031_431_1681 416
867 3300035114 Ga0373939_0001215 Ga0373939_0001215_1875_3131 416
868 3300035114 Ga0373939_0004375 Ga0373939_0004375_363_1619 416
869 3300035115 Ga0373941_0000106 Ga0373941_0000106_5404_6660 416
870 3300035115 Ga0373941_0000814 Ga0373941_0000814_1166_2422 416
871 3300035116 Ga0373945_0000835 Ga0373945_0000835_4598_5848 416
872 3300035117 Ga0373953_0001395 Ga0373953_0001395_80_1330 416
873 3300035119 Ga0373956_0035086 Ga0373956_0035086_147_1397 416
874 3300035121 Ga0373960_0001001 Ga0373960_0001001_2034_3284 416
875 3300035121 Ga0373960_0001059 Ga0373960_0001059_610_1866 416
876 3300035121 Ga0373960_0001694 Ga0373960_0001694_1181_2437 416
877 3300035171 Ga0373946_0006149 Ga0373946_0006149_3088_4338 416
878 3300035171 Ga0373946_0026717 Ga0373946_0026717_286_1536 416
879 3300035172 Ga0373955_0000366 Ga0373955_0000366_6187_7437 416
880 3300035172 Ga0373955_0005170 Ga0373955_0005170_407_1657 416
881 3300035207 Ga0373942_0001640 Ga0373942_0001640_3092_4348 416
882 3300035207 Ga0373942_0007471 Ga0373942_0007471_1166_2422 416
883 3300035241 Ga0373961_0002190 Ga0373961_0002190_748_2004 416
884 3300035241 Ga0373961_0002208 Ga0373961_0002208_2052_3302 416
885 3300035241 Ga0373961_0003616 Ga0373961_0003616_1907_3163 416
886 3300035410 Ga0373924_0006448 Ga0373924_0006448_2085_3335 416
887 3300035691 Ga0373931_0002810 Ga0373931_0002810_1975_3231 416
888 3300035691 Ga0373931_0015349 Ga0373931_0015349_486_1736 416
889 3300035691 Ga0373931_0023899 Ga0373931_0023899_524_1780 416
890 3300035692 Ga0373935_0046824 Ga0373935_0046824_620_1870 416
891 3300035695 Ga0373927_0005034 Ga0373927_0005034_1055_2305 416
892 3300035695 Ga0373927_0024309 Ga0373927_0024309_610_1860 416
893 3300035695 Ga0373927_0059760 Ga0373927_0059760_490_1740 416
894 3300035724 Ga0373933_0005704 Ga0373933_0005704_3506_4756 416
895 3300035724 Ga0373933_0026475 Ga0373933_0026475_1978_3228 416
896 3300035725 Ga0373947_0041308 Ga0373947_0041308_859_2109 416
897 3300036401 Ga0373937_0002001 Ga0373937_0002001_13883_15133 416
898 3300036401 Ga0373937_0042381 Ga0373937_0042381_1697_2947 416
899 3300037068 Ga0373925_0011407 Ga0373925_0011407_795_2045 416
900 3300037068 Ga0373925_0025151 Ga0373925_0025151_2478_3728 416
901 3300042012 Ga0439455_0011454 Ga0439455_0011454_517_1767 416
902 3300045051 Ga0451576_0077714 Ga0451576_0077714_1089_2345 416
903 3300046454 Ga0495592_0004523 Ga0495592_0004523_1333_2583 416
904 3300046455 Ga0495603_0010842 Ga0495603_0010842_2236_3486 416
905 3300046459 Ga0495629_0002524 Ga0495629_0002524_3972_5222 416
906 3300046459 Ga0495629_0016178 Ga0495629_0016178_863_2113 416
907 3300046459 Ga0495629_0079774 Ga0495629_0079774_426_1676 416
908 3300046462 Ga0495651_0001150 Ga0495651_0001150_13362_14612 416
909 3300046462 Ga0495651_0003637 Ga0495651_0003637_689_1939 416
910 3300046463 Ga0495653_0001957 Ga0495653_0001957_9597_10847 416
911 3300046463 Ga0495653_0031725 Ga0495653_0031725_2905_4155 416
912 3300046472 Ga0495580_0001416 Ga0495580_0001416_12092_13342 416
913 3300046473 Ga0495582_0029211 Ga0495582_0029211_1521_2771 416
914 3300046473 Ga0495582_0083985 Ga0495582_0083985_148_1398 416
915 3300046475 Ga0495639_0006262 Ga0495639_0006262_863_2113 416
916 3300046476 Ga0495662_0002039 Ga0495662_0002039_5846_7096 416
917 3300046477 Ga0495664_0000178 Ga0495664_0000178_20636_21886 416
918 3300046477 Ga0495664_0034739 Ga0495664_0034739_1529_2779 416
919 3300046491 Ga0495584_0022637 Ga0495584_0022637_1443_2693 416
920 3300046492 Ga0495585_0015366 Ga0495585_0015366_2482_3732 416
921 3300046499 Ga0495594_0010424 Ga0495594_0010424_3113_4363 416
922 3300046499 Ga0495594_0052866 Ga0495594_0052866_927_2177 416
923 3300046511 Ga0495608_0001671 Ga0495608_0001671_11832_13082 416
924 3300046514 Ga0495618_0003686 Ga0495618_0003686_5375_6625 416
925 3300046514 Ga0495618_0025323 Ga0495618_0025323_665_1915 416
926 3300046516 Ga0495628_0001448 Ga0495628_0001448_11172_12422 416
927 3300046516 Ga0495628_0020094 Ga0495628_0020094_2427_3677 416
928 3300046523 Ga0495644_0012384 Ga0495644_0012384_1543_2793 416
929 3300046526 Ga0495666_0000187 Ga0495666_0000187_22053_23303 416
930 3300046526 Ga0495666_0035568 Ga0495666_0035568_872_2122 416
931 3300046531 Ga0495665_0006213 Ga0495665_0006213_4378_5628 416
932 3300046533 Ga0495640_0023352 Ga0495640_0023352_723_1973 416
933 3300046535 Ga0495586_0002551 Ga0495586_0002551_1767_3017 416
934 3300046536 Ga0495587_0002720 Ga0495587_0002720_1477_2727 416
935 3300046557 Ga0495622_0001697 Ga0495622_0001697_1613_2863 416
936 3300046558 Ga0495633_0018667 Ga0495633_0018667_931_2181 416
937 3300046559 Ga0495667_0002931 Ga0495667_0002931_2690_3940 416
938 3300046642 Ga0495634_0042214 Ga0495634_0042214_845_2095 416
939 3300046642 Ga0495634_0048272 Ga0495634_0048272_1440_2690 416
940 3300046648 Ga0495611_0006806 Ga0495611_0006806_908_2158 416
941 3300046663 Ga0495635_0001359 Ga0495635_0001359_11090_12340 416
942 3300046663 Ga0495635_0011040 Ga0495635_0011040_4583_5833 416
943 3300046664 Ga0495659_0005492 Ga0495659_0005492_1339_2589 416
944 3300046674 Ga0495588_0001695 Ga0495588_0001695_5907_7157 416
945 3300046675 Ga0495657_0003184 Ga0495657_0003184_1222_2472 416
946 3300046678 Ga0495599_0000806 Ga0495599_0000806_13891_15141 416
947 3300046678 Ga0495599_0085910 Ga0495599_0085910_213_1463 416
948 3300046680 Ga0495646_0033722 Ga0495646_0033722_1210_2460 416
949 3300046681 Ga0495647_0000638 Ga0495647_0000638_6025_7275 416
950 3300046681 Ga0495647_0036177 Ga0495647_0036177_322_1572 416
951 3300046683 Ga0495658_0004284 Ga0495658_0004284_3150_4400 416
952 3300046683 Ga0495658_0035163 Ga0495658_0035163_147_1397 416
953 3300046689 Ga0495613_0012243 Ga0495613_0012243_4181_5431 416
954 3300046689 Ga0495613_0057153 Ga0495613_0057153_688_1938 416
955 3300046690 Ga0495624_0015494 Ga0495624_0015494_999_2249 416
956 3300046809 Ga0495600_0001998 Ga0495600_0001998_747_1997 416
957 3300046809 Ga0495600_0006357 Ga0495600_0006357_3077_4327 416
958 3300047315 Ga0495581_0014671 Ga0495581_0014671_20_1270 416
959 3300047315 Ga0495581_0039846 Ga0495581_0039846_605_1855 416
960 3300047317 Ga0495604_0001423 Ga0495604_0001423_13557_14807 416
961 3300047317 Ga0495604_0005209 Ga0495604_0005209_2304_3554 416
962 3300047317 Ga0495604_0023581 Ga0495604_0023581_2845_4095 416
963 3300047319 Ga0495674_0042009 Ga0495674_0042009_1537_2787 416
964 3300047319 Ga0495674_0081140 Ga0495674_0081140_688_1938 416
965 3300047321 Ga0495676_0011575 Ga0495676_0011575_863_2113 416
966 3300047322 Ga0495680_0001491 Ga0495680_0001491_4827_6077 416
967 3300047322 Ga0495680_0007295 Ga0495680_0007295_8248_9498 416
968 3300047322 Ga0495680_0013705 Ga0495680_0013705_310_1560 416
969 3300047444 Ga0495675_0000657 Ga0495675_0000657_723_1973 416
970 3300047446 Ga0495679_031124 Ga0495679_031124_463_1713 416
971 3300047673 Ga0495593_0000309 Ga0495593_0000309_61_1311 416
972 3300047673 Ga0495593_0018863 Ga0495593_0018863_642_1892 416
973 3300047673 Ga0495593_0036157 Ga0495593_0036157_560_1810 416
974 3300048089 Ga0495614_0003292 Ga0495614_0003292_1495_2745 416
975 3300048089 Ga0495614_0033747 Ga0495614_0033747_815_2065 416
976 3300048903 Ga0496100_0000203 Ga0496100_0000203_6718_7974 416
977 3300048903 Ga0496100_0016419 Ga0496100_0016419_893_2143 416
978 3300048903 Ga0496100_0033208 Ga0496100_0033208_153_1403 416
979 3300048904 Ga0496101_0002812 Ga0496101_0002812_2546_3802 416
980 3300048904 Ga0496101_0013528 Ga0496101_0013528_3148_4398 416
981 3300048905 Ga0496102_0004838 Ga0496102_0004838_8742_9998 416
982 3300048905 Ga0496102_0118468 Ga0496102_0118468_837_2087 416
983 3300048906 Ga0496103_0001529 Ga0496103_0001529_7655_8911 416
984 3300048907 Ga0496104_0026931 Ga0496104_0026931_4014_5288 416
985 3300048907 Ga0496104_0063751 Ga0496104_0063751_2137_3387 416
986 3300048908 Ga0496105_0124352 Ga0496105_0124352_267_1517 416
987 3300048909 Ga0496106_0002909 Ga0496106_0002909_5070_6326 416
988 3300048909 Ga0496106_0035978 Ga0496106_0035978_1448_2698 416
989 3300048910 Ga0496107_0000268 Ga0496107_0000268_22560_23816 416
990 3300048910 Ga0496107_0126850 Ga0496107_0126850_501_1751 416
991 3300048911 Ga0496108_0010827 Ga0496108_0010827_5831_7087 416
992 3300048912 Ga0496109_0006654 Ga0496109_0006654_7655_8911 416
993 3300048912 Ga0496109_0074422 Ga0496109_0074422_937_2187 416
994 3300048913 Ga0496110_0016005 Ga0496110_0016005_3942_5198 416
995 3300048913 Ga0496110_0035409 Ga0496110_0035409_1333_2583 416
996 3300048915 Ga0496112_0028569 Ga0496112_0028569_1429_2685 416
997 3300048915 Ga0496112_0032191 Ga0496112_0032191_3676_4926 416
998 3300048916 Ga0496113_0004401 Ga0496113_0004401_3702_4952 416
999 3300048916 Ga0496113_0060873 Ga0496113_0060873_408_1658 416
1000 3300048917 Ga0496114_0019587 Ga0496114_0019587_1357_2607 416
1001 3300048917 Ga0496114_0115053 Ga0496114_0115053_147_1403 416
1002 3300048917 Ga0496114_0190865 Ga0496114_0190865_293_1543 416
1003 3300048924 Ga0496121_0094938 Ga0496121_0094938_974_2224 416
1004 3300049571 Ga0501034_0117384 Ga0501034_0117384_96_1451 416
1005 3300049593 Ga0501077_0023243 Ga0501077_0023243_926_2182 416
1006 3300050507 nmdc:mga05p37_17539_c1 nmdc:mga05p37_17539_c1_523_1773 416
1007 3300050507 nmdc:mga05p37_32_c1 nmdc:mga05p37_32_c1_55875_57125 416
1008 3300050508 nmdc:mga09592_6535_c1 nmdc:mga09592_6535_c1_7222_8472 416
1009 3300050509 nmdc:mga0qj67_355_c1 nmdc:mga0qj67_355_c1_2753_4003 416
1010 3300050510 nmdc:mga06r32_5297_c1 nmdc:mga06r32_5297_c1_3138_4388 416
1011 3300050511 nmdc:mga08y16_19018_c1 nmdc:mga08y16_19018_c1_1310_2566 416
1012 3300050511 nmdc:mga08y16_2238_c1 nmdc:mga08y16_2238_c1_9512_10762 416
1013 3300050511 nmdc:mga08y16_424126_c1 nmdc:mga08y16_424126_c1_81_1331 416
1014 3300050511 nmdc:mga08y16_6098_c1 nmdc:mga08y16_6098_c1_2794_4050 416
1015 3300050512 nmdc:mga0n895_15498_c1 nmdc:mga0n895_15498_c1_3747_4997 416
1016 3300050512 nmdc:mga0n895_547_c1 nmdc:mga0n895_547_c1_17286_18536 416
1017 3300050512 nmdc:mga0n895_8451_c1 nmdc:mga0n895_8451_c1_442_1698 416
1018 3300050513 nmdc:mga0rr50_73282_c1 nmdc:mga0rr50_73282_c1_1285_2535 416
1019 3300050513 nmdc:mga0rr50_78412_c1 nmdc:mga0rr50_78412_c1_1070_2320 416
1020 3300050514 nmdc:mga08x19_76395_c1 nmdc:mga08x19_76395_c1_881_2131 416
1021 3300050515 nmdc:mga0a205_53544_c1 nmdc:mga0a205_53544_c1_1726_2982 416
1022 3300050515 nmdc:mga0a205_6205_c1 nmdc:mga0a205_6205_c1_2853_4103 416
1023 3300050515 nmdc:mga0a205_629_c1 nmdc:mga0a205_629_c1_7059_8309 416
1024 3300053077 Ga0495601_0014254 Ga0495601_0014254_2805_4055 416
1025 3300053077 Ga0495601_0031312 Ga0495601_0031312_688_1938 416
1026 3300053078 Ga0495612_0001070 Ga0495612_0001070_7919_9169 416
1027 3300053078 Ga0495612_0008371 Ga0495612_0008371_177_1427 416
1028 3300053084 Ga0495595_0002555 Ga0495595_0002555_2896_4146 416
1029 3300053084 Ga0495595_0013740 Ga0495595_0013740_547_1797 416
1030 3300053085 Ga0495619_0000016 Ga0495619_0000016_99459_100709 416
1031 3300053085 Ga0495619_0000670 Ga0495619_0000670_287_1537 416
1032 3300053085 Ga0495619_0002830 Ga0495619_0002830_4916_6166 416

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

297

439

0.97

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

304

423

0.93

PF21343

ACAD9-ACADV_C

ACAD9/ACADV, C-terminal domain

306

412

0.86

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

173

277

0.81

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

46

167

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kto-assembly1.cif.gz_A crystal structure of a putative isovaleryl-coa dehydrogenase (psi-nysgrc-012251) from sinorhizobium meliloti 1021 0.9347 11 406
4kto-assembly1.cif.gz_D crystal structure of a putative isovaleryl-coa dehydrogenase (psi-nysgrc-012251) from sinorhizobium meliloti 1021 0.9328 11 404
3mdd-assembly1.cif.gz_A crystal structures of medium chain acyl-coa dehydrogenase from pig liver mitochondria with and without substrate 0.9303 11 405
7w0j-assembly1.cif.gz_F acyl-coa dehydrogenase, tfu_1647 0.9288 12 403
7w0j-assembly1.cif.gz_A acyl-coa dehydrogenase, tfu_1647 0.9282 12 403
ID Description Score Start End Superfamily
af_P96397_240_357_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9773 264 377 1.20.140.10
af_I6Y0W5_249_394_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9667 265 403 1.20.140.10
1jqiA03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9629 265 403 1.20.140.10
1jqiB03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9624 265 403 1.20.140.10
1bucB03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.962 265 403 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A2R6I637-F1-model_v4 Acyl-CoA dehydrogenase 0.9769 283 403 GO:0003995
AF-A0A3S2AM29-F1-model_v4 Acyl-CoA dehydrogenase 0.9602 239 404 GO:0003995
AF-A0A5R2MXK0-F1-model_v4 Acyl-CoA dehydrogenase 0.9568 241 356 GO:0016627
AF-A0A3M1F165-F1-model_v4 Acyl-CoA dehydrogenase 0.952 162 403 GO:0003995
GO:0033539
GO:0046359
AF-A0A7W0Y2I1-F1-model_v4 Acyl-CoA dehydrogenase 0.9507 258 389 GO:0003995

Feature Viewer

pLDDT pTM Quality
89.73 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map