F488611
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1031 | 468 | 2062 | 136 |
Family's Representative Sequence
| Representative Sequence | 3300006914|Ga0075436_100707403|Ga0075436_1007074032 |
| Length | 157 |
| Sequence | MEPARQSPGQAARSPARVRVLVAKPGLDGHDRGAKIVARALRDAGFEVIFTGIRQRVEAIVATALQEDVAVVGLSILSGAHVGLTTRVVEGLRKAGADDIAVVVGGTIPAADVPRLRAAGAAAVYPTGTPLDVIVPEIRALASAQPGRHEETPCASA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 7 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 12 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 80 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 85 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 86 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 124 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 125 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 126 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 127 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 189 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 190 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 191 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 192 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 193 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 194 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 195 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 196 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 197 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 198 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 200 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 201 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 202 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 203 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 204 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 205 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 206 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 207 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 208 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 209 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 210 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 211 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 212 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 213 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 219 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 224 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 230 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 231 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 234 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 235 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 236 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 240 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 241 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 242 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 243 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 244 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 245 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 246 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 247 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 248 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 253 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 254 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 255 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 256 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 257 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 258 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 259 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 260 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 261 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 262 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 263 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 264 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 265 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 266 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 267 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 268 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 269 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 270 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 271 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 272 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 273 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 274 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 275 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 276 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 344 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 345 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 346 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 347 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 348 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 349 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 352 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 353 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 354 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 355 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 356 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 357 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 358 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 359 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 360 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 361 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 362 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 363 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 364 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 365 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 366 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 367 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 368 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 389 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 390 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 391 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 392 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 393 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 394 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 395 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 396 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 402 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 405 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 406 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 410 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 411 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 412 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 413 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 414 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 415 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 416 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 417 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 418 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 419 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 420 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 421 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 422 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 423 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 424 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 425 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 426 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 427 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 428 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 429 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 430 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 431 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 432 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 433 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 434 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 435 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 436 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 437 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 438 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 439 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 440 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 441 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 442 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 443 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 444 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 445 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 446 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 447 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 448 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 449 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 450 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 451 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 452 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 453 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 454 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 455 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 456 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 457 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 458 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 459 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 460 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 461 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 462 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 463 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 464 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 465 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 466 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 467 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 468 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.58 |
| Metatranscriptomes | 0 |
| Isolates | 2.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.03 |
| Nodule | 0.58 |
| Rhizoplane | 6.69 |
| Rhizosphere | 72.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075436_100707403 | 3300006914 | Bacteria | 746 |
| 2 | JGI24739J22299_10034313 | 3300001989 | Bacteria | 1730 |
| 3 | JGI24737J22298_10065032 | 3300001990 | Bacteria | 1093 |
| 4 | JGI24743J22301_10003191 | 3300001991 | Bacteria | 2569 |
| 5 | JGI24735J21928_10146153 | 3300002067 | Bacteria | 682 |
| 6 | JGI24750J21931_1016460 | 3300002070 | Bacteria | 1004 |
| 7 | JGI24745J21846_1008346 | 3300002073 | Bacteria | 1166 |
| 8 | JGI24738J21930_10010731 | 3300002075 | Bacteria | 2031 |
| 9 | JGI24744J21845_10000043 | 3300002077 | Bacteria | 14405 |
| 10 | JGI24034J26672_10009171 | 3300002239 | Bacteria | 1457 |
| 11 | JGI24034J26672_10020396 | 3300002239 | Bacteria | 1039 |
| 12 | JGI24034J26672_10038115 | 3300002239 | Bacteria | 801 |
| 13 | JGI24742J22300_10001363 | 3300002244 | Bacteria | 3841 |
| 14 | Ga0055540_1000003 | 3300003792 | Bacteria | 428375 |
| 15 | Ga0070676_10039555 | 3300005328 | Bacteria | 2728 |
| 16 | Ga0070683_100159646 | 3300005329 | Bacteria | 2139 |
| 17 | Ga0070690_100179248 | 3300005330 | Bacteria | 1463 |
| 18 | Ga0070670_100776435 | 3300005331 | Bacteria | 864 |
| 19 | Ga0070670_102227393 | 3300005331 | Bacteria | 505 |
| 20 | Ga0068869_100045219 | 3300005334 | Bacteria | 3169 |
| 21 | Ga0068869_100091287 | 3300005334 | Bacteria | 2291 |
| 22 | Ga0070666_10060432 | 3300005335 | Bacteria | 2565 |
| 23 | Ga0070682_100070541 | 3300005337 | Bacteria | 2234 |
| 24 | Ga0068868_100000580 | 3300005338 | Bacteria | 24531 |
| 25 | Ga0068868_100007544 | 3300005338 | Bacteria | 7747 |
| 26 | Ga0070660_101253628 | 3300005339 | Bacteria | 629 |
| 27 | Ga0070689_100048034 | 3300005340 | Bacteria | 3291 |
| 28 | Ga0070691_10266803 | 3300005341 | Bacteria | 924 |
| 29 | Ga0070668_100004515 | 3300005347 | Bacteria | 10324 |
| 30 | Ga0070668_100006775 | 3300005347 | Bacteria | 8494 |
| 31 | Ga0070668_100737844 | 3300005347 | Bacteria | 871 |
| 32 | Ga0070668_101339050 | 3300005347 | Bacteria | 651 |
| 33 | Ga0070668_101862534 | 3300005347 | Bacteria | 554 |
| 34 | Ga0070669_100005855 | 3300005353 | Bacteria | 8867 |
| 35 | Ga0070669_100026800 | 3300005353 | Bacteria | 4147 |
| 36 | Ga0070675_100274857 | 3300005354 | Bacteria | 1479 |
| 37 | Ga0070675_101111593 | 3300005354 | Bacteria | 727 |
| 38 | Ga0070671_100045894 | 3300005355 | Bacteria | 3633 |
| 39 | Ga0070671_100187043 | 3300005355 | Bacteria | 1755 |
| 40 | Ga0070671_100419086 | 3300005355 | Bacteria | 1147 |
| 41 | Ga0070674_100014153 | 3300005356 | Bacteria | 4954 |
| 42 | Ga0070688_100040308 | 3300005365 | Bacteria | 2862 |
| 43 | Ga0070688_100537287 | 3300005365 | Bacteria | 887 |
| 44 | Ga0070659_101402698 | 3300005366 | Bacteria | 621 |
| 45 | Ga0070667_100001320 | 3300005367 | Bacteria | 22284 |
| 46 | Ga0070667_100075872 | 3300005367 | Bacteria | 2870 |
| 47 | Ga0070667_100160192 | 3300005367 | Bacteria | 1982 |
| 48 | Ga0070667_100577587 | 3300005367 | Bacteria | 1034 |
| 49 | Ga0070703_10069927 | 3300005406 | Bacteria | 1170 |
| 50 | Ga0070709_10120850 | 3300005434 | Bacteria | 1775 |
| 51 | Ga0070709_10171863 | 3300005434 | Bacteria | 1515 |
| 52 | Ga0070714_100056497 | 3300005435 | Bacteria | 3357 |
| 53 | Ga0070714_100132606 | 3300005435 | Bacteria | 2227 |
| 54 | Ga0070714_100177279 | 3300005435 | Bacteria | 1937 |
| 55 | Ga0070714_100858574 | 3300005435 | Bacteria | 880 |
| 56 | Ga0070714_100896399 | 3300005435 | Bacteria | 861 |
| 57 | Ga0070713_100992004 | 3300005436 | Bacteria | 810 |
| 58 | Ga0070710_10003360 | 3300005437 | Bacteria | 7588 |
| 59 | Ga0070710_10062929 | 3300005437 | Bacteria | 2118 |
| 60 | Ga0070701_10001388 | 3300005438 | Bacteria | 8955 |
| 61 | Ga0070701_10155643 | 3300005438 | Bacteria | 1320 |
| 62 | Ga0070711_100001084 | 3300005439 | Bacteria | 14542 |
| 63 | Ga0070711_100175535 | 3300005439 | Bacteria | 1636 |
| 64 | Ga0070711_101176060 | 3300005439 | Bacteria | 663 |
| 65 | Ga0070705_100021274 | 3300005440 | Bacteria | 3448 |
| 66 | Ga0070705_100026467 | 3300005440 | Bacteria | 3157 |
| 67 | Ga0070700_100001416 | 3300005441 | Bacteria | 11931 |
| 68 | Ga0070700_100079273 | 3300005441 | Bacteria | 2116 |
| 69 | Ga0070694_100001079 | 3300005444 | Bacteria | 15613 |
| 70 | Ga0070694_100218934 | 3300005444 | Bacteria | 1427 |
| 71 | Ga0070708_100110760 | 3300005445 | Bacteria | 2523 |
| 72 | Ga0070708_100157819 | 3300005445 | Bacteria | 2113 |
| 73 | Ga0070708_100311955 | 3300005445 | Bacteria | 1481 |
| 74 | Ga0070708_100338538 | 3300005445 | Bacteria | 1418 |
| 75 | Ga0070708_101589982 | 3300005445 | Bacteria | 608 |
| 76 | Ga0070663_100002330 | 3300005455 | Bacteria | 10671 |
| 77 | Ga0070663_100081568 | 3300005455 | Bacteria | 2378 |
| 78 | Ga0070663_100754489 | 3300005455 | Bacteria | 831 |
| 79 | Ga0070678_100000138 | 3300005456 | Bacteria | 29713 |
| 80 | Ga0070662_100067048 | 3300005457 | Bacteria | 2635 |
| 81 | Ga0070681_10003819 | 3300005458 | Bacteria | 14164 |
| 82 | Ga0068867_100000240 | 3300005459 | Bacteria | 36047 |
| 83 | Ga0068867_100475412 | 3300005459 | Bacteria | 1069 |
| 84 | Ga0070685_10080767 | 3300005466 | Bacteria | 1949 |
| 85 | Ga0070685_10093219 | 3300005466 | Bacteria | 1826 |
| 86 | Ga0070706_100036152 | 3300005467 | Bacteria | 4560 |
| 87 | Ga0070706_100167046 | 3300005467 | Bacteria | 2054 |
| 88 | Ga0070706_100263525 | 3300005467 | Bacteria | 1609 |
| 89 | Ga0070706_100427250 | 3300005467 | Bacteria | 1233 |
| 90 | Ga0070706_102129039 | 3300005467 | Bacteria | 507 |
| 91 | Ga0070707_100022444 | 3300005468 | Bacteria | 5967 |
| 92 | Ga0070707_100189830 | 3300005468 | Bacteria | 2003 |
| 93 | Ga0070707_101039022 | 3300005468 | Bacteria | 785 |
| 94 | Ga0070707_101086434 | 3300005468 | Bacteria | 766 |
| 95 | Ga0070698_100001547 | 3300005471 | Bacteria | 25515 |
| 96 | Ga0070698_100009052 | 3300005471 | Bacteria | 10704 |
| 97 | Ga0070698_100010657 | 3300005471 | Bacteria | 9794 |
| 98 | Ga0070699_100000166 | 3300005518 | Bacteria | 63242 |
| 99 | Ga0070699_100768345 | 3300005518 | Bacteria | 881 |
| 100 | Ga0070699_100950612 | 3300005518 | Bacteria | 787 |
| 101 | Ga0070699_102054327 | 3300005518 | Bacteria | 522 |
| 102 | Ga0070679_100484444 | 3300005530 | Bacteria | 1181 |
| 103 | Ga0070684_100029117 | 3300005535 | Bacteria | 4677 |
| 104 | Ga0070697_100191993 | 3300005536 | Bacteria | 1734 |
| 105 | Ga0070697_100335469 | 3300005536 | Bacteria | 1304 |
| 106 | Ga0068853_100201789 | 3300005539 | Bacteria | 1810 |
| 107 | Ga0068853_100891554 | 3300005539 | Bacteria | 854 |
| 108 | Ga0070672_100090152 | 3300005543 | Bacteria | 2472 |
| 109 | Ga0070695_100003648 | 3300005545 | Bacteria | 8975 |
| 110 | Ga0070695_100103769 | 3300005545 | Bacteria | 1919 |
| 111 | Ga0070696_100001790 | 3300005546 | Bacteria | 14084 |
| 112 | Ga0070696_100115302 | 3300005546 | Bacteria | 1939 |
| 113 | Ga0070696_100298131 | 3300005546 | Bacteria | 1234 |
| 114 | Ga0070693_100027793 | 3300005547 | Bacteria | 3070 |
| 115 | Ga0070693_100681664 | 3300005547 | Bacteria | 750 |
| 116 | Ga0070665_100014182 | 3300005548 | Bacteria | 8008 |
| 117 | Ga0070665_100016738 | 3300005548 | Bacteria | 7347 |
| 118 | Ga0070665_100054317 | 3300005548 | Bacteria | 4018 |
| 119 | Ga0070665_100093737 | 3300005548 | Bacteria | 3008 |
| 120 | Ga0070665_100507087 | 3300005548 | Bacteria | 1218 |
| 121 | Ga0070704_100013440 | 3300005549 | Bacteria | 5081 |
| 122 | Ga0070704_100061064 | 3300005549 | Bacteria | 2696 |
| 123 | Ga0068855_100149512 | 3300005563 | Bacteria | 2656 |
| 124 | Ga0068855_100569649 | 3300005563 | Bacteria | 1224 |
| 125 | Ga0068854_100004983 | 3300005578 | Bacteria | 8375 |
| 126 | Ga0070702_100000152 | 3300005615 | Bacteria | 21674 |
| 127 | Ga0068852_100236497 | 3300005616 | Bacteria | 1744 |
| 128 | Ga0068859_100002335 | 3300005617 | Bacteria | 19295 |
| 129 | Ga0068859_100009163 | 3300005617 | Bacteria | 9996 |
| 130 | Ga0068859_100412048 | 3300005617 | Bacteria | 1447 |
| 131 | Ga0068864_100099520 | 3300005618 | Bacteria | 2576 |
| 132 | Ga0068864_100324316 | 3300005618 | Bacteria | 1447 |
| 133 | Ga0068866_10002369 | 3300005718 | Bacteria | 7817 |
| 134 | Ga0068866_10371152 | 3300005718 | Bacteria | 915 |
| 135 | Ga0068861_100000258 | 3300005719 | Bacteria | 29459 |
| 136 | Ga0068861_100120885 | 3300005719 | Bacteria | 2113 |
| 137 | Ga0068863_100000768 | 3300005841 | Bacteria | 32211 |
| 138 | Ga0068863_101075306 | 3300005841 | Bacteria | 809 |
| 139 | Ga0068863_101808602 | 3300005841 | Bacteria | 621 |
| 140 | Ga0068863_102666454 | 3300005841 | Bacteria | 509 |
| 141 | Ga0068858_100005851 | 3300005842 | Bacteria | 12013 |
| 142 | Ga0068858_100034131 | 3300005842 | Bacteria | 4719 |
| 143 | Ga0068858_100039236 | 3300005842 | Bacteria | 4392 |
| 144 | Ga0068858_100616800 | 3300005842 | Bacteria | 1053 |
| 145 | Ga0068858_102177854 | 3300005842 | Bacteria | 548 |
| 146 | Ga0068858_102266828 | 3300005842 | Bacteria | 537 |
| 147 | Ga0068860_100000232 | 3300005843 | Bacteria | 85501 |
| 148 | Ga0068860_100001342 | 3300005843 | Bacteria | 26770 |
| 149 | Ga0068860_100920564 | 3300005843 | Bacteria | 891 |
| 150 | Ga0068860_102654548 | 3300005843 | Bacteria | 520 |
| 151 | Ga0068862_100000055 | 3300005844 | Bacteria | 142386 |
| 152 | Ga0068862_100002510 | 3300005844 | Bacteria | 16244 |
| 153 | Ga0068862_101089491 | 3300005844 | Bacteria | 793 |
| 154 | Ga0081455_10013458 | 3300005937 | Bacteria | 8083 |
| 155 | Ga0081455_10162039 | 3300005937 | Bacteria | 1713 |
| 156 | Ga0081455_10322399 | 3300005937 | Bacteria | 1100 |
| 157 | Ga0081455_10379792 | 3300005937 | Bacteria | 987 |
| 158 | Ga0081539_10065146 | 3300005985 | Bacteria | 1980 |
| 159 | Ga0070717_10000054 | 3300006028 | Bacteria | 99604 |
| 160 | Ga0070717_10342222 | 3300006028 | Bacteria | 1336 |
| 161 | Ga0075365_10009911 | 3300006038 | Bacteria | 5516 |
| 162 | Ga0075365_10141869 | 3300006038 | Bacteria | 1668 |
| 163 | Ga0075365_10187886 | 3300006038 | Bacteria | 1445 |
| 164 | Ga0075365_10411932 | 3300006038 | Bacteria | 954 |
| 165 | Ga0075365_10613158 | 3300006038 | Bacteria | 769 |
| 166 | Ga0075365_11171322 | 3300006038 | Bacteria | 541 |
| 167 | Ga0075363_100000371 | 3300006048 | Bacteria | 13560 |
| 168 | Ga0075363_100003550 | 3300006048 | Bacteria | 6662 |
| 169 | Ga0075363_100004379 | 3300006048 | Bacteria | 6167 |
| 170 | Ga0075363_100055318 | 3300006048 | Bacteria | 2125 |
| 171 | Ga0075363_100087477 | 3300006048 | Bacteria | 1712 |
| 172 | Ga0075363_100090652 | 3300006048 | Bacteria | 1682 |
| 173 | Ga0075363_100171730 | 3300006048 | Bacteria | 1231 |
| 174 | Ga0075364_10003774 | 3300006051 | Bacteria | 8661 |
| 175 | Ga0075364_10019329 | 3300006051 | Bacteria | 4275 |
| 176 | Ga0075364_10032999 | 3300006051 | Bacteria | 3330 |
| 177 | Ga0075364_10054358 | 3300006051 | Bacteria | 2618 |
| 178 | Ga0075364_10110574 | 3300006051 | Bacteria | 1833 |
| 179 | Ga0075364_10125099 | 3300006051 | Bacteria | 1723 |
| 180 | Ga0075364_10563205 | 3300006051 | Bacteria | 779 |
| 181 | Ga0075364_11121888 | 3300006051 | Bacteria | 534 |
| 182 | Ga0070715_10186419 | 3300006163 | Bacteria | 1044 |
| 183 | Ga0070716_100016337 | 3300006173 | Bacteria | 3827 |
| 184 | Ga0070716_100039299 | 3300006173 | Bacteria | 2626 |
| 185 | Ga0070716_100093808 | 3300006173 | Bacteria | 1823 |
| 186 | Ga0070716_101103407 | 3300006173 | Bacteria | 633 |
| 187 | Ga0070712_100000816 | 3300006175 | Bacteria | 18495 |
| 188 | Ga0070712_101874815 | 3300006175 | Bacteria | 525 |
| 189 | Ga0075362_10025626 | 3300006177 | Bacteria | 2513 |
| 190 | Ga0075362_10090353 | 3300006177 | Bacteria | 1421 |
| 191 | Ga0075362_10605422 | 3300006177 | Bacteria | 566 |
| 192 | Ga0075367_10012940 | 3300006178 | Bacteria | 4469 |
| 193 | Ga0075367_10186789 | 3300006178 | Bacteria | 1293 |
| 194 | Ga0075369_10012607 | 3300006186 | Bacteria | 3339 |
| 195 | Ga0075369_10040372 | 3300006186 | Bacteria | 1994 |
| 196 | Ga0075369_10226851 | 3300006186 | Bacteria | 865 |
| 197 | Ga0097621_101435735 | 3300006237 | Bacteria | 654 |
| 198 | Ga0075370_10000639 | 3300006353 | Bacteria | 13581 |
| 199 | Ga0075370_10044711 | 3300006353 | Bacteria | 2504 |
| 200 | Ga0075370_10056353 | 3300006353 | Bacteria | 2234 |
| 201 | Ga0075370_10079825 | 3300006353 | Bacteria | 1880 |
| 202 | Ga0075370_10159699 | 3300006353 | Bacteria | 1323 |
| 203 | Ga0068871_100054150 | 3300006358 | Bacteria | 3254 |
| 204 | Ga0075428_100004586 | 3300006844 | Bacteria | 15280 |
| 205 | Ga0075430_100010053 | 3300006846 | Bacteria | 8006 |
| 206 | Ga0075431_100132269 | 3300006847 | Bacteria | 2573 |
| 207 | Ga0075431_100318900 | 3300006847 | Bacteria | 1567 |
| 208 | Ga0068865_100000633 | 3300006881 | Bacteria | 19836 |
| 209 | Ga0097620_100002335 | 3300006931 | Bacteria | 19295 |
| 210 | Ga0097620_100009163 | 3300006931 | Bacteria | 9996 |
| 211 | Ga0097620_100412045 | 3300006931 | Bacteria | 1447 |
| 212 | Ga0105251_10500764 | 3300009011 | Bacteria | 568 |
| 213 | Ga0105250_10026058 | 3300009092 | Bacteria | 2355 |
| 214 | Ga0105250_10104637 | 3300009092 | Bacteria | 1156 |
| 215 | Ga0105250_10218450 | 3300009092 | Bacteria | 808 |
| 216 | Ga0105250_10393863 | 3300009092 | Bacteria | 613 |
| 217 | Ga0111539_10420782 | 3300009094 | Bacteria | 1556 |
| 218 | Ga0111539_10928764 | 3300009094 | Bacteria | 1012 |
| 219 | Ga0105245_10001210 | 3300009098 | Bacteria | 23346 |
| 220 | Ga0105245_10330236 | 3300009098 | Bacteria | 1505 |
| 221 | Ga0105245_10479518 | 3300009098 | Bacteria | 1257 |
| 222 | Ga0105245_11457504 | 3300009098 | Bacteria | 735 |
| 223 | Ga0105247_10000029 | 3300009101 | Bacteria | 198763 |
| 224 | Ga0105247_10000896 | 3300009101 | Bacteria | 22411 |
| 225 | Ga0105247_10033889 | 3300009101 | Bacteria | 3109 |
| 226 | Ga0105247_10043520 | 3300009101 | Bacteria | 2751 |
| 227 | Ga0105247_10441673 | 3300009101 | Bacteria | 936 |
| 228 | Ga0114129_10013266 | 3300009147 | Bacteria | 11737 |
| 229 | Ga0114129_10260191 | 3300009147 | Bacteria | 2326 |
| 230 | Ga0114129_10885381 | 3300009147 | Bacteria | 1132 |
| 231 | Ga0105243_10001403 | 3300009148 | Bacteria | 21306 |
| 232 | Ga0105243_10849040 | 3300009148 | Bacteria | 904 |
| 233 | Ga0105243_11149218 | 3300009148 | Bacteria | 787 |
| 234 | Ga0105241_10011773 | 3300009174 | Bacteria | 6424 |
| 235 | Ga0105242_10000154 | 3300009176 | Bacteria | 50757 |
| 236 | Ga0105248_10000136 | 3300009177 | Bacteria | 85507 |
| 237 | Ga0105248_10007026 | 3300009177 | Bacteria | 12332 |
| 238 | Ga0105248_10256849 | 3300009177 | Bacteria | 1967 |
| 239 | Ga0105248_11102217 | 3300009177 | Bacteria | 897 |
| 240 | Ga0105237_10037568 | 3300009545 | Bacteria | 4893 |
| 241 | Ga0105237_10043440 | 3300009545 | Bacteria | 4527 |
| 242 | Ga0105238_10091762 | 3300009551 | Bacteria | 3024 |
| 243 | Ga0105249_10000077 | 3300009553 | Bacteria | 141905 |
| 244 | Ga0105249_10003764 | 3300009553 | Bacteria | 13090 |
| 245 | Ga0105249_10040681 | 3300009553 | Bacteria | 4223 |
| 246 | Ga0105249_13559254 | 3300009553 | Bacteria | 502 |
| 247 | Ga0105239_10007085 | 3300010375 | Bacteria | 12907 |
| 248 | Ga0105239_10019726 | 3300010375 | Bacteria | 7441 |
| 249 | Ga0105239_10258462 | 3300010375 | Bacteria | 1957 |
| 250 | Ga0105239_10607608 | 3300010375 | Bacteria | 1248 |
| 251 | Ga0105239_12332402 | 3300010375 | Bacteria | 623 |
| 252 | Ga0105246_10178623 | 3300011119 | Bacteria | 1632 |
| 253 | Ga0157369_10105671 | 3300013105 | Bacteria | 2997 |
| 254 | Ga0157369_10307794 | 3300013105 | Bacteria | 1648 |
| 255 | Ga0157374_10254850 | 3300013296 | Bacteria | 1727 |
| 256 | Ga0157378_10004436 | 3300013297 | Bacteria | 12344 |
| 257 | Ga0163162_10009439 | 3300013306 | Bacteria | 9487 |
| 258 | Ga0163162_10011973 | 3300013306 | Bacteria | 8459 |
| 259 | Ga0163162_10332706 | 3300013306 | Bacteria | 1651 |
| 260 | Ga0163162_11272622 | 3300013306 | Bacteria | 835 |
| 261 | Ga0163162_11942832 | 3300013306 | Bacteria | 674 |
| 262 | Ga0157372_10002900 | 3300013307 | Bacteria | 18542 |
| 263 | Ga0157372_10996231 | 3300013307 | Bacteria | 971 |
| 264 | Ga0157375_10000360 | 3300013308 | Bacteria | 41433 |
| 265 | Ga0163163_10183606 | 3300014325 | Bacteria | 2139 |
| 266 | Ga0163163_10205907 | 3300014325 | Bacteria | 2015 |
| 267 | Ga0163163_11286160 | 3300014325 | Bacteria | 794 |
| 268 | Ga0157380_10000198 | 3300014326 | Bacteria | 35239 |
| 269 | Ga0157380_10229355 | 3300014326 | Bacteria | 1667 |
| 270 | Ga0182008_10165101 | 3300014497 | Bacteria | 1116 |
| 271 | Ga0157377_10052714 | 3300014745 | Bacteria | 2297 |
| 272 | Ga0157377_10696652 | 3300014745 | Bacteria | 737 |
| 273 | Ga0157379_10008626 | 3300014968 | Bacteria | 8872 |
| 274 | Ga0157376_10100854 | 3300014969 | Bacteria | 2522 |
| 275 | Ga0157376_10789160 | 3300014969 | Bacteria | 962 |
| 276 | Ga0163161_10000846 | 3300017792 | Bacteria | 23880 |
| 277 | Ga0163161_10610034 | 3300017792 | Bacteria | 900 |
| 278 | Ga0163161_11030078 | 3300017792 | Bacteria | 704 |
| 279 | Ga0213872_10150734 | 3300021361 | Bacteria | 1016 |
| 280 | Ga0213874_10054034 | 3300021377 | Bacteria | 1241 |
| 281 | Ga0213876_10032935 | 3300021384 | Bacteria | 2732 |
| 282 | Ga0213875_10041518 | 3300021388 | Bacteria | 2164 |
| 283 | Ga0213875_10111515 | 3300021388 | Bacteria | 1277 |
| 284 | Ga0213875_10535627 | 3300021388 | Bacteria | 564 |
| 285 | Ga0209051_1000011 | 3300025303 | Bacteria | 610828 |
| 286 | Ga0209051_1013590 | 3300025303 | Bacteria | 3862 |
| 287 | Ga0207653_10100283 | 3300025885 | Bacteria | 1023 |
| 288 | Ga0207692_10000300 | 3300025898 | Bacteria | 17124 |
| 289 | Ga0207692_10098828 | 3300025898 | Bacteria | 1598 |
| 290 | Ga0207642_10000206 | 3300025899 | Bacteria | 17368 |
| 291 | Ga0207642_10321724 | 3300025899 | Bacteria | 903 |
| 292 | Ga0207710_10000046 | 3300025900 | Bacteria | 198754 |
| 293 | Ga0207710_10000668 | 3300025900 | Bacteria | 19337 |
| 294 | Ga0207710_10028621 | 3300025900 | Bacteria | 2419 |
| 295 | Ga0207710_10226031 | 3300025900 | Bacteria | 930 |
| 296 | Ga0207688_10000804 | 3300025901 | Bacteria | 15706 |
| 297 | Ga0207688_10005289 | 3300025901 | Bacteria | 7014 |
| 298 | Ga0207688_10225724 | 3300025901 | Bacteria | 1129 |
| 299 | Ga0207680_10115767 | 3300025903 | Bacteria | 1746 |
| 300 | Ga0207647_10036067 | 3300025904 | Bacteria | 3145 |
| 301 | Ga0207647_10043712 | 3300025904 | Bacteria | 2801 |
| 302 | Ga0207685_10141363 | 3300025905 | Bacteria | 1079 |
| 303 | Ga0207699_10023276 | 3300025906 | Bacteria | 3369 |
| 304 | Ga0207699_10170002 | 3300025906 | Bacteria | 1458 |
| 305 | Ga0207645_10038787 | 3300025907 | Bacteria | 3053 |
| 306 | Ga0207643_10782750 | 3300025908 | Bacteria | 618 |
| 307 | Ga0207684_10000240 | 3300025910 | Bacteria | 82172 |
| 308 | Ga0207684_10037303 | 3300025910 | Bacteria | 4124 |
| 309 | Ga0207684_10049903 | 3300025910 | Bacteria | 3549 |
| 310 | Ga0207684_10366884 | 3300025910 | Bacteria | 1239 |
| 311 | Ga0207684_10477987 | 3300025910 | Bacteria | 1069 |
| 312 | Ga0207654_10020719 | 3300025911 | Bacteria | 3490 |
| 313 | Ga0207707_10002587 | 3300025912 | Bacteria | 16213 |
| 314 | Ga0207695_10554898 | 3300025913 | Bacteria | 1030 |
| 315 | Ga0207671_10294084 | 3300025914 | Bacteria | 1283 |
| 316 | Ga0207693_10000469 | 3300025915 | Bacteria | 36811 |
| 317 | Ga0207693_10119219 | 3300025915 | Bacteria | 2072 |
| 318 | Ga0207693_10540780 | 3300025915 | Bacteria | 909 |
| 319 | Ga0207663_10000663 | 3300025916 | Bacteria | 15195 |
| 320 | Ga0207646_10076375 | 3300025922 | Bacteria | 2993 |
| 321 | Ga0207646_10871717 | 3300025922 | Bacteria | 800 |
| 322 | Ga0207681_10006615 | 3300025923 | Bacteria | 7116 |
| 323 | Ga0207681_10012860 | 3300025923 | Bacteria | 5176 |
| 324 | Ga0207681_11117729 | 3300025923 | Bacteria | 662 |
| 325 | Ga0207650_10472279 | 3300025925 | Bacteria | 1046 |
| 326 | Ga0207650_10485734 | 3300025925 | Bacteria | 1031 |
| 327 | Ga0207659_10422379 | 3300025926 | Bacteria | 1118 |
| 328 | Ga0207687_10000480 | 3300025927 | Bacteria | 26933 |
| 329 | Ga0207687_10015541 | 3300025927 | Bacteria | 4993 |
| 330 | Ga0207700_10113297 | 3300025928 | Bacteria | 2186 |
| 331 | Ga0207700_10221370 | 3300025928 | Bacteria | 1604 |
| 332 | Ga0207664_10041054 | 3300025929 | Bacteria | 3602 |
| 333 | Ga0207664_10057951 | 3300025929 | Bacteria | 3080 |
| 334 | Ga0207664_10146477 | 3300025929 | Bacteria | 2003 |
| 335 | Ga0207664_10167531 | 3300025929 | Bacteria | 1878 |
| 336 | Ga0207664_10183889 | 3300025929 | Bacteria | 1795 |
| 337 | Ga0207664_10337404 | 3300025929 | Bacteria | 1332 |
| 338 | Ga0207664_10972560 | 3300025929 | Bacteria | 761 |
| 339 | Ga0207664_11113560 | 3300025929 | Bacteria | 706 |
| 340 | Ga0207644_10122327 | 3300025931 | Bacteria | 1982 |
| 341 | Ga0207644_10159769 | 3300025931 | Bacteria | 1751 |
| 342 | Ga0207644_10609688 | 3300025931 | Bacteria | 907 |
| 343 | Ga0207690_10651918 | 3300025932 | Bacteria | 863 |
| 344 | Ga0207690_11263447 | 3300025932 | Bacteria | 617 |
| 345 | Ga0207706_10012834 | 3300025933 | Bacteria | 7627 |
| 346 | Ga0207686_10002525 | 3300025934 | Bacteria | 9944 |
| 347 | Ga0207686_10336306 | 3300025934 | Bacteria | 1133 |
| 348 | Ga0207709_10004429 | 3300025935 | Bacteria | 8124 |
| 349 | Ga0207670_10034527 | 3300025936 | Bacteria | 3269 |
| 350 | Ga0207670_10681591 | 3300025936 | Bacteria | 850 |
| 351 | Ga0207669_10000085 | 3300025937 | Bacteria | 47505 |
| 352 | Ga0207669_10650248 | 3300025937 | Bacteria | 862 |
| 353 | Ga0207704_10000728 | 3300025938 | Bacteria | 14454 |
| 354 | Ga0207704_10051515 | 3300025938 | Bacteria | 2490 |
| 355 | Ga0207665_10006695 | 3300025939 | Bacteria | 7646 |
| 356 | Ga0207665_10008806 | 3300025939 | Bacteria | 6635 |
| 357 | Ga0207665_10037954 | 3300025939 | Bacteria | 3206 |
| 358 | Ga0207665_10054156 | 3300025939 | Bacteria | 2705 |
| 359 | Ga0207665_10596771 | 3300025939 | Bacteria | 862 |
| 360 | Ga0207691_10051181 | 3300025940 | Bacteria | 3777 |
| 361 | Ga0207711_10000111 | 3300025941 | Bacteria | 85466 |
| 362 | Ga0207711_10327933 | 3300025941 | Bacteria | 1415 |
| 363 | Ga0207689_10057651 | 3300025942 | Bacteria | 3195 |
| 364 | Ga0207689_10180169 | 3300025942 | Bacteria | 1743 |
| 365 | Ga0207661_10018406 | 3300025944 | Bacteria | 5190 |
| 366 | Ga0207679_10491487 | 3300025945 | Bacteria | 1094 |
| 367 | Ga0207667_10118673 | 3300025949 | Bacteria | 2726 |
| 368 | Ga0207667_10121309 | 3300025949 | Bacteria | 2693 |
| 369 | Ga0207651_10457642 | 3300025960 | Bacteria | 1096 |
| 370 | Ga0207712_10001008 | 3300025961 | Bacteria | 20072 |
| 371 | Ga0207712_10549515 | 3300025961 | Bacteria | 993 |
| 372 | Ga0207712_11749330 | 3300025961 | Bacteria | 557 |
| 373 | Ga0207668_10001761 | 3300025972 | Bacteria | 12655 |
| 374 | Ga0207668_10029319 | 3300025972 | Bacteria | 3606 |
| 375 | Ga0207668_10866909 | 3300025972 | Bacteria | 802 |
| 376 | Ga0207640_10004679 | 3300025981 | Bacteria | 7425 |
| 377 | Ga0207640_10585985 | 3300025981 | Bacteria | 942 |
| 378 | Ga0207658_10000271 | 3300025986 | Bacteria | 54216 |
| 379 | Ga0207658_10002257 | 3300025986 | Bacteria | 14254 |
| 380 | Ga0207658_10031502 | 3300025986 | Bacteria | 3766 |
| 381 | Ga0207658_10140535 | 3300025986 | Bacteria | 1953 |
| 382 | Ga0207658_10214569 | 3300025986 | Bacteria | 1615 |
| 383 | Ga0207658_10253240 | 3300025986 | Bacteria | 1497 |
| 384 | Ga0207677_10000820 | 3300026023 | Bacteria | 17783 |
| 385 | Ga0207677_10037503 | 3300026023 | Bacteria | 3169 |
| 386 | Ga0207703_10010089 | 3300026035 | Bacteria | 7403 |
| 387 | Ga0207703_10025994 | 3300026035 | Bacteria | 4607 |
| 388 | Ga0207703_10179360 | 3300026035 | Bacteria | 1868 |
| 389 | Ga0207703_10640739 | 3300026035 | Bacteria | 1008 |
| 390 | Ga0207703_11085303 | 3300026035 | Bacteria | 769 |
| 391 | Ga0207639_10251745 | 3300026041 | Bacteria | 1541 |
| 392 | Ga0207639_10409938 | 3300026041 | Bacteria | 1223 |
| 393 | Ga0207639_10491029 | 3300026041 | Bacteria | 1120 |
| 394 | Ga0207678_10011563 | 3300026067 | Bacteria | 7752 |
| 395 | Ga0207678_10377973 | 3300026067 | Bacteria | 1224 |
| 396 | Ga0207678_10438248 | 3300026067 | Bacteria | 1135 |
| 397 | Ga0207708_10000329 | 3300026075 | Bacteria | 37329 |
| 398 | Ga0207641_10000378 | 3300026088 | Bacteria | 53027 |
| 399 | Ga0207641_10099204 | 3300026088 | Bacteria | 2562 |
| 400 | Ga0207648_10000112 | 3300026089 | Bacteria | 78746 |
| 401 | Ga0207648_10391970 | 3300026089 | Bacteria | 1257 |
| 402 | Ga0207676_10384539 | 3300026095 | Bacteria | 1307 |
| 403 | Ga0207675_100000117 | 3300026118 | Bacteria | 64829 |
| 404 | Ga0207675_100732202 | 3300026118 | Bacteria | 999 |
| 405 | Ga0207683_10001010 | 3300026121 | Bacteria | 25655 |
| 406 | Ga0207683_10248143 | 3300026121 | Bacteria | 1624 |
| 407 | Ga0207683_11118971 | 3300026121 | Bacteria | 730 |
| 408 | Ga0207698_10023753 | 3300026142 | Bacteria | 4289 |
| 409 | Ga0209813_10109325 | 3300027866 | Bacteria | 950 |
| 410 | Ga0268266_10009370 | 3300028379 | Bacteria | 8629 |
| 411 | Ga0268266_10014627 | 3300028379 | Bacteria | 6744 |
| 412 | Ga0268266_10024527 | 3300028379 | Bacteria | 5129 |
| 413 | Ga0268266_10046488 | 3300028379 | Bacteria | 3716 |
| 414 | Ga0268266_10597297 | 3300028379 | Bacteria | 1060 |
| 415 | Ga0268265_10000067 | 3300028380 | Bacteria | 142389 |
| 416 | Ga0268265_10004318 | 3300028380 | Bacteria | 9903 |
| 417 | Ga0268265_10353773 | 3300028380 | Bacteria | 1342 |
| 418 | Ga0268264_10000146 | 3300028381 | Bacteria | 165733 |
| 419 | Ga0268264_10001796 | 3300028381 | Bacteria | 19621 |
| 420 | Ga0268264_10771575 | 3300028381 | Bacteria | 959 |
| 421 | Ga0307515_10011018 | 3300028794 | Bacteria | 17226 |
| 422 | Ga0307515_10023776 | 3300028794 | Bacteria | 10717 |
| 423 | Ga0307511_10003102 | 3300030521 | Bacteria | 17130 |
| 424 | Ga0307511_10064628 | 3300030521 | Bacteria | 2748 |
| 425 | Ga0307511_10123577 | 3300030521 | Bacteria | 1589 |
| 426 | Ga0307511_10137094 | 3300030521 | Bacteria | 1453 |
| 427 | Ga0307512_10006767 | 3300030522 | Bacteria | 11522 |
| 428 | Ga0307512_10006967 | 3300030522 | Bacteria | 11293 |
| 429 | Ga0307512_10019685 | 3300030522 | Bacteria | 6137 |
| 430 | Ga0265327_10002845 | 3300031251 | Bacteria | 17454 |
| 431 | Ga0265327_10071521 | 3300031251 | Bacteria | 1735 |
| 432 | Ga0307513_10010212 | 3300031456 | Bacteria | 11797 |
| 433 | Ga0307513_10041904 | 3300031456 | Bacteria | 5047 |
| 434 | Ga0307513_10183985 | 3300031456 | Bacteria | 1949 |
| 435 | Ga0307509_10011802 | 3300031507 | Bacteria | 10523 |
| 436 | Ga0307509_10028010 | 3300031507 | Bacteria | 6266 |
| 437 | Ga0307509_10169833 | 3300031507 | Bacteria | 2062 |
| 438 | Ga0307509_10207338 | 3300031507 | Bacteria | 1789 |
| 439 | Ga0307508_10016853 | 3300031616 | Bacteria | 6648 |
| 440 | Ga0307508_10693192 | 3300031616 | Bacteria | 627 |
| 441 | Ga0307508_10927013 | 3300031616 | Bacteria | 500 |
| 442 | Ga0307514_10297641 | 3300031649 | Bacteria | 907 |
| 443 | Ga0316578_10368718 | 3300031728 | Bacteria | 853 |
| 444 | Ga0307516_10018641 | 3300031730 | Bacteria | 7207 |
| 445 | Ga0307516_10019325 | 3300031730 | Bacteria | 7056 |
| 446 | Ga0307516_10058066 | 3300031730 | Bacteria | 3768 |
| 447 | Ga0307516_10106330 | 3300031730 | Bacteria | 2616 |
| 448 | Ga0307405_10845159 | 3300031731 | Bacteria | 770 |
| 449 | Ga0307413_10864661 | 3300031824 | Bacteria | 765 |
| 450 | Ga0307518_10024942 | 3300031838 | Bacteria | 4308 |
| 451 | Ga0307518_10169246 | 3300031838 | Bacteria | 1491 |
| 452 | Ga0307518_10187293 | 3300031838 | Bacteria | 1391 |
| 453 | Ga0307410_10009295 | 3300031852 | Bacteria | 5506 |
| 454 | Ga0307410_10173312 | 3300031852 | Bacteria | 1628 |
| 455 | Ga0307410_11655496 | 3300031852 | Bacteria | 566 |
| 456 | Ga0307406_10164617 | 3300031901 | Bacteria | 1598 |
| 457 | Ga0307407_10622514 | 3300031903 | Bacteria | 806 |
| 458 | Ga0307409_100148069 | 3300031995 | Bacteria | 2034 |
| 459 | Ga0307409_100393186 | 3300031995 | Bacteria | 1322 |
| 460 | Ga0307409_100919695 | 3300031995 | Bacteria | 889 |
| 461 | Ga0307409_101362961 | 3300031995 | Bacteria | 735 |
| 462 | Ga0307416_100034920 | 3300032002 | Bacteria | 3833 |
| 463 | Ga0307416_100396002 | 3300032002 | Bacteria | 1417 |
| 464 | Ga0307416_102867856 | 3300032002 | Bacteria | 577 |
| 465 | Ga0307415_100013668 | 3300032126 | Bacteria | 4746 |
| 466 | Ga0316583_10053639 | 3300032133 | Bacteria | 1418 |
| 467 | Ga0316580_10222089 | 3300032139 | Bacteria | 583 |
| 468 | Ga0307507_10000003 | 3300033179 | Bacteria | 371707 |
| 469 | Ga0307507_10005929 | 3300033179 | Bacteria | 19418 |
| 470 | Ga0307510_10014262 | 3300033180 | Bacteria | 9411 |
| 471 | Ga0307510_10063507 | 3300033180 | Bacteria | 3760 |
| 472 | Ga0307510_10117282 | 3300033180 | Bacteria | 2380 |
| 473 | Ga0373926_0004072 | 3300035083 | Bacteria | 4773 |
| 474 | Ga0373928_0018249 | 3300035084 | Bacteria | 1452 |
| 475 | Ga0373934_0032900 | 3300035086 | Bacteria | 2035 |
| 476 | Ga0373940_0005855 | 3300035088 | Bacteria | 2690 |
| 477 | Ga0373944_0010767 | 3300035089 | Bacteria | 2498 |
| 478 | Ga0373949_0297326 | 3300035090 | Bacteria | 511 |
| 479 | Ga0373932_0152236 | 3300035112 | Bacteria | 794 |
| 480 | Ga0373936_0004137 | 3300035113 | Bacteria | 5472 |
| 481 | Ga0373945_0002459 | 3300035116 | Bacteria | 5812 |
| 482 | Ga0373953_0025395 | 3300035117 | Bacteria | 2263 |
| 483 | Ga0373954_0035243 | 3300035118 | Bacteria | 2320 |
| 484 | Ga0373956_0012630 | 3300035119 | Bacteria | 3504 |
| 485 | Ga0373957_0016891 | 3300035120 | Bacteria | 2534 |
| 486 | Ga0373943_0002954 | 3300035170 | Bacteria | 7710 |
| 487 | Ga0373943_0579975 | 3300035170 | Bacteria | 659 |
| 488 | Ga0373946_0004678 | 3300035171 | Bacteria | 4914 |
| 489 | Ga0373955_0067620 | 3300035172 | Bacteria | 1989 |
| 490 | Ga0373955_0904011 | 3300035172 | Bacteria | 543 |
| 491 | Ga0373942_0000809 | 3300035207 | Bacteria | 8617 |
| 492 | Ga0373942_0020476 | 3300035207 | Bacteria | 1662 |
| 493 | Ga0373961_0065306 | 3300035241 | Bacteria | 1114 |
| 494 | Ga0373962_0005213 | 3300035242 | Bacteria | 3142 |
| 495 | Ga0373924_0456310 | 3300035410 | Bacteria | 573 |
| 496 | Ga0373931_0908129 | 3300035691 | Bacteria | 592 |
| 497 | Ga0373931_0948732 | 3300035691 | Bacteria | 580 |
| 498 | Ga0373935_0028451 | 3300035692 | Bacteria | 3455 |
| 499 | Ga0373935_0626336 | 3300035692 | Bacteria | 788 |
| 500 | Ga0373927_0002196 | 3300035695 | Bacteria | 14345 |
| 501 | Ga0373927_0876187 | 3300035695 | Bacteria | 593 |
| 502 | Ga0373933_0059700 | 3300035724 | Bacteria | 2297 |
| 503 | Ga0373947_0100232 | 3300035725 | Bacteria | 1819 |
| 504 | Ga0373937_0042264 | 3300036401 | Bacteria | 4157 |
| 505 | Ga0373937_0052232 | 3300036401 | Bacteria | 3747 |
| 506 | Ga0316584_0034896 | 3300036712 | Bacteria | 3730 |
| 507 | Ga0316584_0513307 | 3300036712 | Bacteria | 841 |
| 508 | Ga0373925_0065040 | 3300037068 | Bacteria | 2747 |
| 509 | Ga0373925_0072927 | 3300037068 | Bacteria | 2597 |
| 510 | Ga0373925_0139523 | 3300037068 | Bacteria | 1896 |
| 511 | Ga0436364_1059460 | 3300037853 | Bacteria | 4481 |
| 512 | Ga0436364_1154797 | 3300037853 | Bacteria | 2014 |
| 513 | Ga0436364_1482437 | 3300037853 | Bacteria | 4143 |
| 514 | Ga0436365_1051614 | 3300039437 | Bacteria | 670 |
| 515 | Ga0436365_1356761 | 3300039437 | Bacteria | 10416 |
| 516 | Ga0436365_1525818 | 3300039437 | Bacteria | 1300 |
| 517 | Ga0436365_1572675 | 3300039437 | Bacteria | 39347 |
| 518 | Ga0436365_1627569 | 3300039437 | Bacteria | 24179 |
| 519 | Ga0436360_0681582 | 3300039438 | Bacteria | 1100 |
| 520 | Ga0436361_0000693 | 3300039447 | Bacteria | 1484 |
| 521 | Ga0436363_1342054 | 3300039450 | Bacteria | 1534 |
| 522 | Ga0436363_1584934 | 3300039450 | Bacteria | 878 |
| 523 | Ga0439439_0182728 | 3300041406 | Bacteria | 605 |
| 524 | Ga0439461_0022794 | 3300041410 | Bacteria | 1257 |
| 525 | Ga0439461_0064573 | 3300041410 | Bacteria | 837 |
| 526 | Ga0439466_0001192 | 3300041411 | Bacteria | 10126 |
| 527 | Ga0439466_0022814 | 3300041411 | Bacteria | 2205 |
| 528 | Ga0439466_0084189 | 3300041411 | Bacteria | 1001 |
| 529 | Ga0439465_0007669 | 3300041413 | Bacteria | 3424 |
| 530 | Ga0439465_0041863 | 3300041413 | Bacteria | 1483 |
| 531 | Ga0439465_0229402 | 3300041413 | Bacteria | 682 |
| 532 | Ga0451789_0227657 | 3300041443 | Bacteria | 690 |
| 533 | Ga0451793_1004541 | 3300041452 | Bacteria | 612 |
| 534 | Ga0451793_1395669 | 3300041452 | Bacteria | 719 |
| 535 | Ga0451800_1404359 | 3300041459 | Bacteria | 568 |
| 536 | Ga0451802_0245828 | 3300041460 | Bacteria | 538 |
| 537 | Ga0451802_1608308 | 3300041460 | Bacteria | 583 |
| 538 | Ga0451845_0346134 | 3300041501 | Bacteria | 542 |
| 539 | Ga0451845_0749344 | 3300041501 | Bacteria | 558 |
| 540 | Ga0451843_0827849 | 3300041509 | Bacteria | 630 |
| 541 | Ga0451855_0837164 | 3300041511 | Bacteria | 633 |
| 542 | Ga0451853_2582717 | 3300041512 | Bacteria | 987 |
| 543 | Ga0451853_3508463 | 3300041512 | Bacteria | 2624 |
| 544 | Ga0451853_4074114 | 3300041512 | Bacteria | 1124 |
| 545 | Ga0439431_0009160 | 3300041997 | Bacteria | 2232 |
| 546 | Ga0439442_002613 | 3300042002 | Bacteria | 3536 |
| 547 | Ga0439442_162160 | 3300042002 | Bacteria | 500 |
| 548 | Ga0439448_0315163 | 3300042005 | Bacteria | 556 |
| 549 | Ga0439434_0012860 | 3300042435 | Bacteria | 2480 |
| 550 | Ga0439434_0021562 | 3300042435 | Bacteria | 1936 |
| 551 | Ga0439434_0083438 | 3300042435 | Bacteria | 1016 |
| 552 | Ga0439435_0088248 | 3300042436 | Bacteria | 939 |
| 553 | Ga0466969_0044470 | 3300044656 | Bacteria | 2208 |
| 554 | Ga0466972_0005873 | 3300044658 | Bacteria | 6155 |
| 555 | Ga0466972_0008049 | 3300044658 | Bacteria | 5284 |
| 556 | Ga0466972_0009641 | 3300044658 | Bacteria | 4846 |
| 557 | Ga0466972_0287281 | 3300044658 | Bacteria | 768 |
| 558 | Ga0466972_0321437 | 3300044658 | Bacteria | 723 |
| 559 | Ga0466965_0002928 | 3300044683 | Bacteria | 7379 |
| 560 | Ga0466965_0015530 | 3300044683 | Bacteria | 3617 |
| 561 | Ga0466965_0032505 | 3300044683 | Bacteria | 2548 |
| 562 | Ga0466965_0312176 | 3300044683 | Bacteria | 855 |
| 563 | Ga0466966_0012148 | 3300044684 | Bacteria | 5705 |
| 564 | Ga0466966_0021640 | 3300044684 | Bacteria | 4222 |
| 565 | Ga0466961_0002670 | 3300044693 | Bacteria | 11065 |
| 566 | Ga0466961_0011244 | 3300044693 | Bacteria | 5722 |
| 567 | Ga0466961_0691275 | 3300044693 | Bacteria | 611 |
| 568 | Ga0466963_0033970 | 3300044694 | Bacteria | 3316 |
| 569 | Ga0466963_0061065 | 3300044694 | Bacteria | 2519 |
| 570 | Ga0466963_0201025 | 3300044694 | Bacteria | 1394 |
| 571 | Ga0466963_0231127 | 3300044694 | Bacteria | 1296 |
| 572 | Ga0466963_0297242 | 3300044694 | Bacteria | 1135 |
| 573 | Ga0466963_1062259 | 3300044694 | Bacteria | 570 |
| 574 | Ga0466963_1122720 | 3300044694 | Bacteria | 553 |
| 575 | Ga0466964_0230287 | 3300044706 | Bacteria | 904 |
| 576 | Ga0466971_0032496 | 3300044719 | Bacteria | 2338 |
| 577 | Ga0466971_0039448 | 3300044719 | Bacteria | 2119 |
| 578 | Ga0466971_0094361 | 3300044719 | Bacteria | 1371 |
| 579 | Ga0466968_0012679 | 3300044735 | Bacteria | 3306 |
| 580 | Ga0466968_0015685 | 3300044735 | Bacteria | 3007 |
| 581 | Ga0466968_0137904 | 3300044735 | Bacteria | 1114 |
| 582 | Ga0466968_0177380 | 3300044735 | Bacteria | 989 |
| 583 | Ga0466968_0335297 | 3300044735 | Bacteria | 732 |
| 584 | Ga0466968_0466896 | 3300044735 | Bacteria | 625 |
| 585 | Ga0466970_0005008 | 3300044765 | Bacteria | 6545 |
| 586 | Ga0466970_0040781 | 3300044765 | Bacteria | 2465 |
| 587 | Ga0466957_0002976 | 3300044842 | Bacteria | 9200 |
| 588 | Ga0466957_0027976 | 3300044842 | Bacteria | 3353 |
| 589 | Ga0466957_0059996 | 3300044842 | Bacteria | 2332 |
| 590 | Ga0466957_0120472 | 3300044842 | Bacteria | 1672 |
| 591 | Ga0466957_0254148 | 3300044842 | Bacteria | 1169 |
| 592 | Ga0466957_0639383 | 3300044842 | Bacteria | 747 |
| 593 | Ga0466957_0693276 | 3300044842 | Bacteria | 718 |
| 594 | Ga0466960_0009811 | 3300044901 | Bacteria | 3958 |
| 595 | Ga0466960_0019392 | 3300044901 | Bacteria | 2996 |
| 596 | Ga0466960_0058461 | 3300044901 | Bacteria | 1883 |
| 597 | Ga0466960_0592363 | 3300044901 | Bacteria | 657 |
| 598 | Ga0466959_0027932 | 3300045049 | Bacteria | 4184 |
| 599 | Ga0466959_0034597 | 3300045049 | Bacteria | 3737 |
| 600 | Ga0466959_0034662 | 3300045049 | Bacteria | 3734 |
| 601 | Ga0466959_0042820 | 3300045049 | Bacteria | 3339 |
| 602 | Ga0466959_0087549 | 3300045049 | Bacteria | 2240 |
| 603 | Ga0466959_0201120 | 3300045049 | Bacteria | 1387 |
| 604 | Ga0466958_0007717 | 3300045836 | Bacteria | 5935 |
| 605 | Ga0466958_0099227 | 3300045836 | Bacteria | 1809 |
| 606 | Ga0466958_0180117 | 3300045836 | Bacteria | 1341 |
| 607 | Ga0466958_0377728 | 3300045836 | Bacteria | 913 |
| 608 | Ga0466967_0005746 | 3300045976 | Bacteria | 8662 |
| 609 | Ga0466967_0010937 | 3300045976 | Bacteria | 6840 |
| 610 | Ga0466967_0021377 | 3300045976 | Bacteria | 5254 |
| 611 | Ga0466967_0097303 | 3300045976 | Bacteria | 2686 |
| 612 | Ga0466967_0241578 | 3300045976 | Bacteria | 1723 |
| 613 | Ga0466967_0788934 | 3300045976 | Bacteria | 943 |
| 614 | Ga0466967_1056024 | 3300045976 | Bacteria | 809 |
| 615 | Ga0466967_1107965 | 3300045976 | Bacteria | 789 |
| 616 | Ga0466967_1124048 | 3300045976 | Bacteria | 783 |
| 617 | Ga0466967_1140412 | 3300045976 | Bacteria | 777 |
| 618 | Ga0466967_1229583 | 3300045976 | Bacteria | 746 |
| 619 | Ga0466967_1294174 | 3300045976 | Bacteria | 726 |
| 620 | Ga0466967_1429522 | 3300045976 | Bacteria | 689 |
| 621 | Ga0466967_1468976 | 3300045976 | Bacteria | 679 |
| 622 | Ga0495617_136624 | 3300046452 | Bacteria | 784 |
| 623 | Ga0495592_0085634 | 3300046454 | Bacteria | 2271 |
| 624 | Ga0495592_0394274 | 3300046454 | Bacteria | 878 |
| 625 | Ga0495603_0035080 | 3300046455 | Bacteria | 3014 |
| 626 | Ga0495603_0050844 | 3300046455 | Bacteria | 2464 |
| 627 | Ga0495629_0008706 | 3300046459 | Bacteria | 7468 |
| 628 | Ga0495629_0014814 | 3300046459 | Bacteria | 5607 |
| 629 | Ga0495629_0266460 | 3300046459 | Bacteria | 1177 |
| 630 | Ga0495638_0007953 | 3300046460 | Bacteria | 7563 |
| 631 | Ga0495638_0104391 | 3300046460 | Bacteria | 1690 |
| 632 | Ga0495638_0262701 | 3300046460 | Bacteria | 946 |
| 633 | Ga0495641_0070675 | 3300046461 | Bacteria | 1567 |
| 634 | Ga0495651_0006616 | 3300046462 | Bacteria | 8848 |
| 635 | Ga0495651_0194443 | 3300046462 | Bacteria | 1425 |
| 636 | Ga0495653_0053303 | 3300046463 | Bacteria | 3095 |
| 637 | Ga0495653_0202799 | 3300046463 | Bacteria | 1345 |
| 638 | Ga0495580_0346515 | 3300046472 | Bacteria | 1007 |
| 639 | Ga0495580_0522991 | 3300046472 | Bacteria | 790 |
| 640 | Ga0495582_0009515 | 3300046473 | Bacteria | 5353 |
| 641 | Ga0495639_0061184 | 3300046475 | Bacteria | 1726 |
| 642 | Ga0495639_0118013 | 3300046475 | Bacteria | 1264 |
| 643 | Ga0495662_0001407 | 3300046476 | Bacteria | 11933 |
| 644 | Ga0495662_0019440 | 3300046476 | Bacteria | 3285 |
| 645 | Ga0495662_0321112 | 3300046476 | Bacteria | 762 |
| 646 | Ga0495664_0004018 | 3300046477 | Bacteria | 8030 |
| 647 | Ga0495664_0005032 | 3300046477 | Bacteria | 7237 |
| 648 | Ga0495585_0386455 | 3300046492 | Bacteria | 675 |
| 649 | Ga0495594_0069148 | 3300046499 | Bacteria | 1961 |
| 650 | Ga0495594_0329078 | 3300046499 | Bacteria | 870 |
| 651 | Ga0495606_0007916 | 3300046507 | Bacteria | 9371 |
| 652 | Ga0495608_0032570 | 3300046511 | Bacteria | 3523 |
| 653 | Ga0495618_0013102 | 3300046514 | Bacteria | 5042 |
| 654 | Ga0495618_0036212 | 3300046514 | Bacteria | 3096 |
| 655 | Ga0495618_0039029 | 3300046514 | Bacteria | 2985 |
| 656 | Ga0495618_0058374 | 3300046514 | Bacteria | 2444 |
| 657 | Ga0495628_0043489 | 3300046516 | Bacteria | 3578 |
| 658 | Ga0495628_0054052 | 3300046516 | Bacteria | 3167 |
| 659 | Ga0495628_0136381 | 3300046516 | Bacteria | 1875 |
| 660 | Ga0495630_0011073 | 3300046517 | Bacteria | 6524 |
| 661 | Ga0495630_0020585 | 3300046517 | Bacteria | 4865 |
| 662 | Ga0495630_0198386 | 3300046517 | Bacteria | 1531 |
| 663 | Ga0495632_0173734 | 3300046519 | Bacteria | 989 |
| 664 | Ga0495648_0024211 | 3300046524 | Bacteria | 4141 |
| 665 | Ga0495648_0297639 | 3300046524 | Bacteria | 757 |
| 666 | Ga0495652_0024733 | 3300046529 | Bacteria | 5314 |
| 667 | Ga0495652_0063118 | 3300046529 | Bacteria | 3120 |
| 668 | Ga0495652_0119196 | 3300046529 | Bacteria | 2108 |
| 669 | Ga0495652_0160434 | 3300046529 | Bacteria | 1746 |
| 670 | Ga0495652_0823183 | 3300046529 | Bacteria | 617 |
| 671 | Ga0495652_0829931 | 3300046529 | Bacteria | 614 |
| 672 | Ga0495654_0170316 | 3300046530 | Bacteria | 950 |
| 673 | Ga0495665_0084879 | 3300046531 | Bacteria | 1664 |
| 674 | Ga0495665_0137584 | 3300046531 | Bacteria | 1277 |
| 675 | Ga0495640_0023248 | 3300046533 | Bacteria | 4522 |
| 676 | Ga0495640_0092582 | 3300046533 | Bacteria | 1993 |
| 677 | Ga0495640_0268385 | 3300046533 | Bacteria | 1065 |
| 678 | Ga0495640_0326620 | 3300046533 | Bacteria | 949 |
| 679 | Ga0495586_0074120 | 3300046535 | Bacteria | 1862 |
| 680 | Ga0495586_0431632 | 3300046535 | Bacteria | 759 |
| 681 | Ga0495587_0003071 | 3300046536 | Bacteria | 11155 |
| 682 | Ga0495587_0089819 | 3300046536 | Bacteria | 1775 |
| 683 | Ga0495609_0128854 | 3300046538 | Bacteria | 1084 |
| 684 | Ga0495645_0003254 | 3300046543 | Bacteria | 11027 |
| 685 | Ga0495645_0054441 | 3300046543 | Bacteria | 2907 |
| 686 | Ga0495622_0026873 | 3300046557 | Bacteria | 2686 |
| 687 | Ga0495622_0420223 | 3300046557 | Bacteria | 575 |
| 688 | Ga0495667_0002799 | 3300046559 | Bacteria | 11647 |
| 689 | Ga0495634_0012936 | 3300046642 | Bacteria | 6037 |
| 690 | Ga0495634_0092285 | 3300046642 | Bacteria | 1965 |
| 691 | Ga0495634_0158941 | 3300046642 | Bacteria | 1426 |
| 692 | Ga0495634_0233658 | 3300046642 | Bacteria | 1130 |
| 693 | Ga0495634_0523538 | 3300046642 | Bacteria | 693 |
| 694 | Ga0495611_0005901 | 3300046648 | Bacteria | 5223 |
| 695 | Ga0495611_0094202 | 3300046648 | Bacteria | 1385 |
| 696 | Ga0495611_0268347 | 3300046648 | Bacteria | 789 |
| 697 | Ga0495635_0018217 | 3300046663 | Bacteria | 4901 |
| 698 | Ga0495635_0024213 | 3300046663 | Bacteria | 4232 |
| 699 | Ga0495635_0025239 | 3300046663 | Bacteria | 4139 |
| 700 | Ga0495635_0025943 | 3300046663 | Bacteria | 4080 |
| 701 | Ga0495588_0018277 | 3300046674 | Bacteria | 3416 |
| 702 | Ga0495588_0406786 | 3300046674 | Bacteria | 714 |
| 703 | Ga0495657_0000085 | 3300046675 | Bacteria | 82569 |
| 704 | Ga0495657_0050714 | 3300046675 | Bacteria | 2789 |
| 705 | Ga0495599_0017527 | 3300046678 | Bacteria | 4451 |
| 706 | Ga0495599_0152412 | 3300046678 | Bacteria | 1431 |
| 707 | Ga0495599_0374070 | 3300046678 | Bacteria | 851 |
| 708 | Ga0495623_0057312 | 3300046679 | Bacteria | 2451 |
| 709 | Ga0495623_0284139 | 3300046679 | Bacteria | 919 |
| 710 | Ga0495623_0743119 | 3300046679 | Bacteria | 500 |
| 711 | Ga0495646_0001147 | 3300046680 | Bacteria | 15459 |
| 712 | Ga0495646_0335889 | 3300046680 | Bacteria | 793 |
| 713 | Ga0495647_0400847 | 3300046681 | Bacteria | 630 |
| 714 | Ga0495647_0497204 | 3300046681 | Bacteria | 567 |
| 715 | Ga0495658_0056632 | 3300046683 | Bacteria | 2236 |
| 716 | Ga0495658_0056930 | 3300046683 | Bacteria | 2231 |
| 717 | Ga0495613_0000396 | 3300046689 | Bacteria | 37260 |
| 718 | Ga0495613_0065685 | 3300046689 | Bacteria | 2651 |
| 719 | Ga0495613_0093484 | 3300046689 | Bacteria | 2177 |
| 720 | Ga0495624_0003954 | 3300046690 | Bacteria | 10909 |
| 721 | Ga0495624_0077397 | 3300046690 | Bacteria | 2063 |
| 722 | Ga0495624_0097773 | 3300046690 | Bacteria | 1808 |
| 723 | Ga0495671_0150454 | 3300046692 | Bacteria | 1133 |
| 724 | Ga0495649_0304937 | 3300046694 | Bacteria | 810 |
| 725 | Ga0495600_0041406 | 3300046809 | Bacteria | 3001 |
| 726 | Ga0495600_0132614 | 3300046809 | Bacteria | 1619 |
| 727 | Ga0495660_0062889 | 3300046810 | Bacteria | 1988 |
| 728 | Ga0495581_0003051 | 3300047315 | Bacteria | 9595 |
| 729 | Ga0495581_0068181 | 3300047315 | Bacteria | 2057 |
| 730 | Ga0495604_0000250 | 3300047317 | Bacteria | 47753 |
| 731 | Ga0495604_0186630 | 3300047317 | Bacteria | 1447 |
| 732 | Ga0495636_0141261 | 3300047318 | Bacteria | 1076 |
| 733 | Ga0495636_0385103 | 3300047318 | Bacteria | 666 |
| 734 | Ga0495674_0044648 | 3300047319 | Bacteria | 3939 |
| 735 | Ga0495674_0045673 | 3300047319 | Bacteria | 3889 |
| 736 | Ga0495674_0092092 | 3300047319 | Bacteria | 2589 |
| 737 | Ga0495674_0431808 | 3300047319 | Bacteria | 1060 |
| 738 | Ga0495674_0498351 | 3300047319 | Bacteria | 974 |
| 739 | Ga0495672_0036303 | 3300047320 | Bacteria | 3027 |
| 740 | Ga0495672_0151575 | 3300047320 | Bacteria | 1202 |
| 741 | Ga0495676_0010266 | 3300047321 | Bacteria | 8498 |
| 742 | Ga0495676_0013790 | 3300047321 | Bacteria | 7247 |
| 743 | Ga0495676_0067551 | 3300047321 | Bacteria | 2765 |
| 744 | Ga0495680_0005669 | 3300047322 | Bacteria | 11687 |
| 745 | Ga0495680_0007071 | 3300047322 | Bacteria | 10340 |
| 746 | Ga0495680_0041089 | 3300047322 | Bacteria | 3678 |
| 747 | Ga0495683_0020667 | 3300047323 | Bacteria | 3394 |
| 748 | Ga0495683_0310857 | 3300047323 | Bacteria | 674 |
| 749 | Ga0495687_001486 | 3300047443 | Bacteria | 21411 |
| 750 | Ga0495687_021483 | 3300047443 | Bacteria | 3120 |
| 751 | Ga0495687_034246 | 3300047443 | Bacteria | 2296 |
| 752 | Ga0495675_0027216 | 3300047444 | Bacteria | 3644 |
| 753 | Ga0495675_0087959 | 3300047444 | Bacteria | 1952 |
| 754 | Ga0495675_0131673 | 3300047444 | Bacteria | 1554 |
| 755 | Ga0495685_004080 | 3300047447 | Bacteria | 4697 |
| 756 | Ga0495673_0343707 | 3300047469 | Bacteria | 527 |
| 757 | Ga0495684_0028742 | 3300047471 | Bacteria | 4268 |
| 758 | Ga0495684_0128555 | 3300047471 | Bacteria | 1904 |
| 759 | Ga0495686_0002803 | 3300047472 | Bacteria | 15820 |
| 760 | Ga0495686_0099823 | 3300047472 | Bacteria | 1752 |
| 761 | Ga0495593_0000421 | 3300047673 | Bacteria | 23629 |
| 762 | Ga0495593_0012599 | 3300047673 | Bacteria | 4828 |
| 763 | Ga0495593_0013725 | 3300047673 | Bacteria | 4614 |
| 764 | Ga0495593_0095303 | 3300047673 | Bacteria | 1530 |
| 765 | Ga0495593_0185370 | 3300047673 | Bacteria | 1048 |
| 766 | Ga0495602_0034492 | 3300048088 | Bacteria | 4733 |
| 767 | Ga0495602_0133543 | 3300048088 | Bacteria | 1975 |
| 768 | Ga0495602_0411248 | 3300048088 | Bacteria | 963 |
| 769 | Ga0495602_0805879 | 3300048088 | Bacteria | 630 |
| 770 | Ga0495614_0001131 | 3300048089 | Bacteria | 11472 |
| 771 | Ga0496100_0109149 | 3300048903 | Bacteria | 1920 |
| 772 | Ga0496100_0131354 | 3300048903 | Bacteria | 1764 |
| 773 | Ga0496100_0428262 | 3300048903 | Bacteria | 1011 |
| 774 | Ga0496100_0968408 | 3300048903 | Bacteria | 669 |
| 775 | Ga0496101_0002286 | 3300048904 | Bacteria | 11703 |
| 776 | Ga0496101_0146198 | 3300048904 | Bacteria | 1805 |
| 777 | Ga0496101_0157950 | 3300048904 | Bacteria | 1738 |
| 778 | Ga0496101_0664747 | 3300048904 | Bacteria | 823 |
| 779 | Ga0496101_0930517 | 3300048904 | Bacteria | 684 |
| 780 | Ga0496102_0000268 | 3300048905 | Bacteria | 66717 |
| 781 | Ga0496102_0033616 | 3300048905 | Bacteria | 4609 |
| 782 | Ga0496102_0055519 | 3300048905 | Bacteria | 3611 |
| 783 | Ga0496102_0606039 | 3300048905 | Bacteria | 1018 |
| 784 | Ga0496102_0676072 | 3300048905 | Bacteria | 955 |
| 785 | Ga0496103_0001095 | 3300048906 | Bacteria | 18847 |
| 786 | Ga0496103_0013476 | 3300048906 | Bacteria | 4849 |
| 787 | Ga0496103_0157287 | 3300048906 | Bacteria | 1457 |
| 788 | Ga0496103_0879079 | 3300048906 | Bacteria | 562 |
| 789 | Ga0496104_0237623 | 3300048907 | Bacteria | 1734 |
| 790 | Ga0496104_0330840 | 3300048907 | Bacteria | 1437 |
| 791 | Ga0496104_0521768 | 3300048907 | Bacteria | 1099 |
| 792 | Ga0496105_0069901 | 3300048908 | Bacteria | 2902 |
| 793 | Ga0496105_0350064 | 3300048908 | Bacteria | 1180 |
| 794 | Ga0496105_1111358 | 3300048908 | Bacteria | 586 |
| 795 | Ga0496106_0000556 | 3300048909 | Bacteria | 26561 |
| 796 | Ga0496107_0008445 | 3300048910 | Bacteria | 7128 |
| 797 | Ga0496107_0686169 | 3300048910 | Bacteria | 754 |
| 798 | Ga0496107_1347578 | 3300048910 | Bacteria | 509 |
| 799 | Ga0496108_0000759 | 3300048911 | Bacteria | 25117 |
| 800 | Ga0496108_0005195 | 3300048911 | Bacteria | 10519 |
| 801 | Ga0496108_0131325 | 3300048911 | Bacteria | 2153 |
| 802 | Ga0496108_0544460 | 3300048911 | Bacteria | 1013 |
| 803 | Ga0496109_0012962 | 3300048912 | Bacteria | 7208 |
| 804 | Ga0496109_0129167 | 3300048912 | Bacteria | 2358 |
| 805 | Ga0496109_0253175 | 3300048912 | Bacteria | 1658 |
| 806 | Ga0496109_0253297 | 3300048912 | Bacteria | 1658 |
| 807 | Ga0496109_0383428 | 3300048912 | Bacteria | 1328 |
| 808 | Ga0496109_0689382 | 3300048912 | Bacteria | 959 |
| 809 | Ga0496110_0027246 | 3300048913 | Bacteria | 4898 |
| 810 | Ga0496110_0160318 | 3300048913 | Bacteria | 2039 |
| 811 | Ga0496110_0824427 | 3300048913 | Bacteria | 832 |
| 812 | Ga0496110_0896706 | 3300048913 | Bacteria | 793 |
| 813 | Ga0496110_0919106 | 3300048913 | Bacteria | 781 |
| 814 | Ga0496111_0048204 | 3300048914 | Bacteria | 3069 |
| 815 | Ga0496111_0851650 | 3300048914 | Bacteria | 658 |
| 816 | Ga0496111_1260259 | 3300048914 | Bacteria | 522 |
| 817 | Ga0496112_0006671 | 3300048915 | Bacteria | 10160 |
| 818 | Ga0496112_0082046 | 3300048915 | Bacteria | 3189 |
| 819 | Ga0496112_0095914 | 3300048915 | Bacteria | 2936 |
| 820 | Ga0496112_0178605 | 3300048915 | Bacteria | 2087 |
| 821 | Ga0496112_0341462 | 3300048915 | Bacteria | 1441 |
| 822 | Ga0496112_0537847 | 3300048915 | Bacteria | 1103 |
| 823 | Ga0496112_0706910 | 3300048915 | Bacteria | 935 |
| 824 | Ga0496112_1424537 | 3300048915 | Bacteria | 607 |
| 825 | Ga0496113_0013352 | 3300048916 | Bacteria | 5561 |
| 826 | Ga0496113_0068249 | 3300048916 | Bacteria | 2698 |
| 827 | Ga0496113_0081756 | 3300048916 | Bacteria | 2477 |
| 828 | Ga0496113_0649141 | 3300048916 | Bacteria | 844 |
| 829 | Ga0496113_0656615 | 3300048916 | Bacteria | 839 |
| 830 | Ga0496114_0001695 | 3300048917 | Bacteria | 16749 |
| 831 | Ga0496115_0002918 | 3300048918 | Bacteria | 12343 |
| 832 | Ga0496115_0737093 | 3300048918 | Bacteria | 772 |
| 833 | Ga0496115_1142893 | 3300048918 | Bacteria | 588 |
| 834 | Ga0496116_0015809 | 3300048919 | Bacteria | 5944 |
| 835 | Ga0496117_0001548 | 3300048920 | Bacteria | 32660 |
| 836 | Ga0496118_0000185 | 3300048921 | Bacteria | 109095 |
| 837 | Ga0496118_0001284 | 3300048921 | Bacteria | 38348 |
| 838 | Ga0496119_0003869 | 3300048922 | Bacteria | 15271 |
| 839 | Ga0496120_0013157 | 3300048923 | Bacteria | 5586 |
| 840 | Ga0496120_0089996 | 3300048923 | Bacteria | 1642 |
| 841 | Ga0496121_0017973 | 3300048924 | Bacteria | 7168 |
| 842 | Ga0496121_0270933 | 3300048924 | Bacteria | 1167 |
| 843 | Ga0496122_0049449 | 3300048925 | Bacteria | 3219 |
| 844 | Ga0496123_0035647 | 3300048926 | Bacteria | 3541 |
| 845 | Ga0496124_0009890 | 3300048927 | Bacteria | 9750 |
| 846 | Ga0496124_0301833 | 3300048927 | Bacteria | 1156 |
| 847 | Ga0496125_0007641 | 3300048928 | Bacteria | 11462 |
| 848 | Ga0496125_0158225 | 3300048928 | Bacteria | 1544 |
| 849 | Ga0496126_0002221 | 3300048929 | Bacteria | 26860 |
| 850 | Ga0496126_0004250 | 3300048929 | Bacteria | 17244 |
| 851 | Ga0496126_0010378 | 3300048929 | Bacteria | 9774 |
| 852 | Ga0496126_0506030 | 3300048929 | Bacteria | 964 |
| 853 | Ga0496126_0730238 | 3300048929 | Bacteria | 767 |
| 854 | Ga0495678_074925 | 3300049459 | Bacteria | 1230 |
| 855 | Ga0501032_0003441 | 3300049569 | Bacteria | 12120 |
| 856 | Ga0501032_0004434 | 3300049569 | Bacteria | 10581 |
| 857 | Ga0501033_0014667 | 3300049570 | Bacteria | 5949 |
| 858 | Ga0501033_0126491 | 3300049570 | Bacteria | 1853 |
| 859 | Ga0501033_0138652 | 3300049570 | Bacteria | 1759 |
| 860 | Ga0501034_0003163 | 3300049571 | Bacteria | 18924 |
| 861 | Ga0501034_0015265 | 3300049571 | Bacteria | 7894 |
| 862 | Ga0501034_0061592 | 3300049571 | Bacteria | 3768 |
| 863 | Ga0501034_0413224 | 3300049571 | Bacteria | 1271 |
| 864 | Ga0501034_0698453 | 3300049571 | Bacteria | 913 |
| 865 | Ga0501036_0027704 | 3300049572 | Bacteria | 4788 |
| 866 | Ga0501036_0204183 | 3300049572 | Bacteria | 1662 |
| 867 | Ga0501037_0006470 | 3300049573 | Bacteria | 8564 |
| 868 | Ga0501037_0016834 | 3300049573 | Bacteria | 5379 |
| 869 | Ga0501038_0009880 | 3300049574 | Bacteria | 8734 |
| 870 | Ga0501039_0004829 | 3300049575 | Bacteria | 10207 |
| 871 | Ga0501043_0009079 | 3300049579 | Bacteria | 7822 |
| 872 | Ga0501043_0890373 | 3300049579 | Bacteria | 639 |
| 873 | Ga0501046_0001136 | 3300049580 | Bacteria | 25942 |
| 874 | Ga0501047_1162890 | 3300049581 | Bacteria | 585 |
| 875 | Ga0501048_0001774 | 3300049582 | Bacteria | 16425 |
| 876 | Ga0501048_0959525 | 3300049582 | Bacteria | 615 |
| 877 | Ga0501067_0364704 | 3300049583 | Bacteria | 805 |
| 878 | Ga0501068_0374924 | 3300049584 | Bacteria | 916 |
| 879 | Ga0501069_0055072 | 3300049585 | Bacteria | 2215 |
| 880 | Ga0501069_0493551 | 3300049585 | Bacteria | 730 |
| 881 | Ga0501069_0834972 | 3300049585 | Bacteria | 559 |
| 882 | Ga0501070_0000448 | 3300049586 | Bacteria | 37506 |
| 883 | Ga0501070_0000622 | 3300049586 | Bacteria | 32559 |
| 884 | Ga0501070_0068563 | 3300049586 | Bacteria | 2936 |
| 885 | Ga0501070_0408599 | 3300049586 | Bacteria | 1097 |
| 886 | Ga0501073_0050920 | 3300049589 | Bacteria | 2901 |
| 887 | Ga0501073_0465899 | 3300049589 | Bacteria | 873 |
| 888 | Ga0501073_0576992 | 3300049589 | Bacteria | 777 |
| 889 | Ga0501080_0067062 | 3300049742 | Bacteria | 3338 |
| 890 | Ga0501080_0740245 | 3300049742 | Bacteria | 865 |
| 891 | Ga0501080_1763484 | 3300049742 | Bacteria | 521 |
| 892 | Ga0501035_0000147 | 3300049822 | Bacteria | 85803 |
| 893 | Ga0501035_0612853 | 3300049822 | Bacteria | 886 |
| 894 | Ga0501044_0000152 | 3300049823 | Bacteria | 85715 |
| 895 | Ga0501044_0001366 | 3300049823 | Bacteria | 28620 |
| 896 | Ga0501044_0092672 | 3300049823 | Bacteria | 3047 |
| 897 | Ga0501044_0621071 | 3300049823 | Bacteria | 972 |
| 898 | Ga0501044_0847679 | 3300049823 | Bacteria | 791 |
| 899 | nmdc:mga03683_18185_c1 | 3300050489 | Bacteria | 2668 |
| 900 | nmdc:mga03n38_10656_c1 | 3300050490 | Bacteria | 3391 |
| 901 | nmdc:mga03n38_167724_c1 | 3300050490 | Bacteria | 1116 |
| 902 | nmdc:mga03n38_185576_c1 | 3300050490 | Bacteria | 1068 |
| 903 | nmdc:mga03n38_18716_c1 | 3300050490 | Bacteria | 2739 |
| 904 | nmdc:mga03n38_267829_c1 | 3300050490 | Bacteria | 908 |
| 905 | nmdc:mga03n38_26814_c1 | 3300050490 | Bacteria | 2383 |
| 906 | nmdc:mga03n38_4631_c1 | 3300050490 | Bacteria | 4583 |
| 907 | nmdc:mga03n38_612016_c1 | 3300050490 | Bacteria | 621 |
| 908 | nmdc:mga00v17_170662_c1 | 3300050491 | Bacteria | 1402 |
| 909 | nmdc:mga00v17_22351_c1 | 3300050491 | Bacteria | 3649 |
| 910 | nmdc:mga00v17_359917_c1 | 3300050491 | Bacteria | 946 |
| 911 | nmdc:mga00v17_362112_c1 | 3300050491 | Bacteria | 943 |
| 912 | nmdc:mga00v17_3787_c1 | 3300050491 | Bacteria | 7807 |
| 913 | nmdc:mga00v17_438051_c1 | 3300050491 | Bacteria | 849 |
| 914 | nmdc:mga00v17_460168_c1 | 3300050491 | Bacteria | 826 |
| 915 | nmdc:mga00v17_64553_c1 | 3300050491 | Bacteria | 2256 |
| 916 | nmdc:mga0yw44_1087405_c1 | 3300050492 | Bacteria | 540 |
| 917 | nmdc:mga0yw44_1184878_c1 | 3300050492 | Bacteria | 515 |
| 918 | nmdc:mga0yw44_118587_c1 | 3300050492 | Bacteria | 1703 |
| 919 | nmdc:mga0yw44_12193_c1 | 3300050492 | Bacteria | 4470 |
| 920 | nmdc:mga0yw44_12999_c1 | 3300050492 | Bacteria | 2844 |
| 921 | nmdc:mga0yw44_293431_c1 | 3300050492 | Bacteria | 1088 |
| 922 | nmdc:mga0yw44_447565_c1 | 3300050492 | Bacteria | 875 |
| 923 | nmdc:mga0yw44_906705_c1 | 3300050492 | Bacteria | 598 |
| 924 | nmdc:mga0k408_415390_c1 | 3300050493 | Bacteria | 800 |
| 925 | nmdc:mga06z11_155263_c1 | 3300050494 | Bacteria | 1304 |
| 926 | nmdc:mga06z11_26161_c1 | 3300050494 | Bacteria | 2774 |
| 927 | nmdc:mga06z11_583253_c1 | 3300050494 | Bacteria | 680 |
| 928 | nmdc:mga04h51_128708_c1 | 3300050495 | Bacteria | 950 |
| 929 | nmdc:mga04h51_257603_c1 | 3300050495 | Bacteria | 701 |
| 930 | nmdc:mga07m45_22174_c1 | 3300050496 | Bacteria | 3466 |
| 931 | nmdc:mga07m45_44238_c1 | 3300050496 | Bacteria | 2498 |
| 932 | nmdc:mga07m45_637573_c1 | 3300050496 | Bacteria | 614 |
| 933 | nmdc:mga07m45_691363_c1 | 3300050496 | Bacteria | 587 |
| 934 | nmdc:mga05p37_11463_c2 | 3300050507 | Bacteria | 9020 |
| 935 | nmdc:mga05p37_300674_c1 | 3300050507 | Bacteria | 1907 |
| 936 | nmdc:mga05p37_918625_c1 | 3300050507 | Bacteria | 941 |
| 937 | nmdc:mga0qj67_1212111_c1 | 3300050509 | Bacteria | 587 |
| 938 | nmdc:mga06r32_202245_c1 | 3300050510 | Bacteria | 1974 |
| 939 | nmdc:mga06r32_570971_c1 | 3300050510 | Bacteria | 1104 |
| 940 | nmdc:mga06r32_572715_c1 | 3300050510 | Bacteria | 1102 |
| 941 | nmdc:mga08y16_930810_c1 | 3300050511 | Bacteria | 853 |
| 942 | nmdc:mga08x19_607061_c1 | 3300050514 | Bacteria | 775 |
| 943 | nmdc:mga0sz30_133341_c1 | 3300050516 | Bacteria | 1095 |
| 944 | nmdc:mga0sz30_22479_c1 | 3300050516 | Bacteria | 2560 |
| 945 | nmdc:mga0sz30_229844_c1 | 3300050516 | Bacteria | 825 |
| 946 | nmdc:mga0sz30_2402_c1 | 3300050516 | Bacteria | 6682 |
| 947 | nmdc:mga0sz30_296980_c1 | 3300050516 | Bacteria | 720 |
| 948 | nmdc:mga0sz30_5503_c1 | 3300050516 | Bacteria | 4651 |
| 949 | Ga0495601_0000403 | 3300053077 | Bacteria | 22823 |
| 950 | Ga0495601_0253644 | 3300053077 | Bacteria | 1149 |
| 951 | Ga0495601_0649184 | 3300053077 | Bacteria | 675 |
| 952 | Ga0495612_0065483 | 3300053078 | Bacteria | 1509 |
| 953 | Ga0500610_0011964 | 3300053079 | Bacteria | 3978 |
| 954 | Ga0500635_0001516 | 3300053080 | Bacteria | 5585 |
| 955 | Ga0495655_0002859 | 3300053083 | Bacteria | 2781 |
| 956 | Ga0495595_0027241 | 3300053084 | Bacteria | 2545 |
| 957 | Ga0495595_0159915 | 3300053084 | Bacteria | 1111 |
| 958 | Ga0495619_0260714 | 3300053085 | Bacteria | 1201 |
| 959 | Ga0495619_0571252 | 3300053085 | Bacteria | 775 |
| 960 | Ga0495619_0694329 | 3300053085 | Bacteria | 692 |
| 961 | Ga0500578_0133012 | 3300053086 | Bacteria | 1558 |
| 962 | Ga0500643_002800 | 3300053087 | Bacteria | 8719 |
| 963 | Ga0500643_006577 | 3300053087 | Bacteria | 4836 |
| 964 | Ga0500644_0036042 | 3300053088 | Bacteria | 1607 |
| 965 | Ga0500644_0383165 | 3300053088 | Bacteria | 611 |
| 966 | Ga0500581_252450 | 3300053089 | Bacteria | 739 |
| 967 | Ga0500647_0310302 | 3300053091 | Bacteria | 671 |
| 968 | Ga0500583_0338359 | 3300053092 | Bacteria | 731 |
| 969 | Ga0500651_0029222 | 3300053093 | Bacteria | 3466 |
| 970 | Ga0500651_0299557 | 3300053093 | Bacteria | 923 |
| 971 | Ga0500640_002440 | 3300053095 | Bacteria | 6146 |
| 972 | Ga0500641_0105099 | 3300053096 | Bacteria | 1213 |
| 973 | Ga0500650_0038585 | 3300053098 | Bacteria | 2199 |
| 974 | Ga0500553_094023 | 3300053101 | Bacteria | 1310 |
| 975 | Ga0500556_0283656 | 3300053104 | Bacteria | 649 |
| 976 | Ga0500558_123149 | 3300053106 | Bacteria | 1001 |
| 977 | Ga0500560_036713 | 3300053107 | Bacteria | 1515 |
| 978 | Ga0500562_023542 | 3300053108 | Bacteria | 1608 |
| 979 | Ga0500572_264550 | 3300053111 | Bacteria | 558 |
| 980 | Ga0500621_250891 | 3300053126 | Bacteria | 594 |
| 981 | Ga0500642_0064921 | 3300053130 | Bacteria | 1649 |
| 982 | Ga0500642_0262446 | 3300053130 | Bacteria | 790 |
| 983 | Ga0500652_005687 | 3300053131 | Bacteria | 3951 |
| 984 | Ga0500652_024918 | 3300053131 | Bacteria | 2288 |
| 985 | Ga0500561_0022595 | 3300053137 | Bacteria | 1497 |
| 986 | Ga0500564_201664 | 3300053138 | Bacteria | 817 |
| 987 | Ga0500568_0169053 | 3300053139 | Bacteria | 805 |
| 988 | Ga0500573_0033901 | 3300053140 | Bacteria | 2945 |
| 989 | Ga0500573_0206620 | 3300053140 | Bacteria | 1039 |
| 990 | Ga0500577_0064992 | 3300053142 | Bacteria | 1414 |
| 991 | Ga0500588_0031379 | 3300053146 | Bacteria | 1533 |
| 992 | Ga0500600_0073788 | 3300053149 | Bacteria | 1864 |
| 993 | Ga0500600_0169379 | 3300053149 | Bacteria | 1064 |
| 994 | Ga0500600_0298168 | 3300053149 | Bacteria | 692 |
| 995 | Ga0500616_0083657 | 3300053153 | Bacteria | 1598 |
| 996 | Ga0500624_012666 | 3300053157 | Bacteria | 1250 |
| 997 | Ga0500627_0004489 | 3300053158 | Bacteria | 4494 |
| 998 | Ga0500630_049169 | 3300053159 | Bacteria | 2041 |
| 999 | Ga0500633_0123223 | 3300053160 | Bacteria | 965 |
| 1000 | Ga0500634_0209487 | 3300053161 | Bacteria | 848 |
| 1001 | Ga0500645_000181 | 3300053730 | Bacteria | 49626 |
| 1002 | Ga0500645_009096 | 3300053730 | Bacteria | 3352 |
| 1003 | Ga0500552_103418 | 3300053733 | Bacteria | 543 |
| 1004 | Ga0466962_0001728 | 3300061719 | Bacteria | 10266 |
| 1005 | Ga0466962_0002480 | 3300061719 | Bacteria | 8746 |
| 1006 | Ga0466962_0494149 | 3300061719 | Bacteria | 619 |
| 1007 | 2517763235 | 2517572101 | Bacteria | 6884336 |
| 1008 | 2523382996 | 2523231044 | Bacteria | 6434991 |
| 1009 | 2585313811 | 2582581314 | Bacteria | 11452267 |
| 1010 | 2616697774 | 2616644814 | Bacteria | 11555299 |
| 1011 | 2644511745 | 2643221692 | Bacteria | 7282860 |
| 1012 | 2644635950 | 2643221715 | Bacteria | 6671032 |
| 1013 | 2671836171 | 2671180195 | Bacteria | 9757215 |
| 1014 | 2686539991 | 2684623035 | Bacteria | 8032739 |
| 1015 | 2689994279 | 2687453743 | Bacteria | 8361025 |
| 1016 | 2738666983 | 2738541264 | Bacteria | 5935393 |
| 1017 | 2738707845 | 2738541274 | Bacteria | 6909446 |
| 1018 | 2739145827 | 2738541356 | Bacteria | 5935017 |
| 1019 | 2739334184 | 2738543028 | Bacteria | 6917070 |
| 1020 | 2744955273 | 2744054611 | Bacteria | 5611514 |
| 1021 | 2774854327 | 2773857922 | Bacteria | 9757215 |
| 1022 | 2895888808 | 2895880812 | Bacteria | 11255272 |
| 1023 | 2902802014 | 2902799365 | Bacteria | 5419524 |
| 1024 | 2902811968 | 2902810491 | Bacteria | 6794147 |
| 1025 | 2929216850 | 2929212328 | Bacteria | 7708288 |
| 1026 | 2939588881 | 2939582691 | Bacteria | 7088898 |
| 1027 | 2954691561 | 2954691527 | Bacteria | 10720516 |
| 1028 | 2954706655 | 2954701450 | Bacteria | 10834262 |
| 1029 | 3003006619 | 3002998708 | Bacteria | 11715108 |
| 1030 | 8002776605 | 8002775197 | Bacteria | 10728764 |
| 1031 | 8002788457 | 8002784119 | Bacteria | 9788632 |
| 1032 | Ga0075436_100707403 | |||
| 1033 | JGI24739J22299_10034313 | |||
| 1034 | JGI24737J22298_10065032 | |||
| 1035 | JGI24743J22301_10003191 | |||
| 1036 | JGI24735J21928_10146153 | |||
| 1037 | JGI24750J21931_1016460 | |||
| 1038 | JGI24745J21846_1008346 | |||
| 1039 | JGI24738J21930_10010731 | |||
| 1040 | JGI24744J21845_10000043 | |||
| 1041 | JGI24034J26672_10009171 | |||
| 1042 | JGI24034J26672_10020396 | |||
| 1043 | JGI24034J26672_10038115 | |||
| 1044 | JGI24742J22300_10001363 | |||
| 1045 | Ga0055540_1000003 | |||
| 1046 | Ga0070676_10039555 | |||
| 1047 | Ga0070683_100159646 | |||
| 1048 | Ga0070690_100179248 | |||
| 1049 | Ga0070670_100776435 | |||
| 1050 | Ga0070670_102227393 | |||
| 1051 | Ga0068869_100045219 | |||
| 1052 | Ga0068869_100091287 | |||
| 1053 | Ga0070666_10060432 | |||
| 1054 | Ga0070682_100070541 | |||
| 1055 | Ga0068868_100000580 | |||
| 1056 | Ga0068868_100007544 | |||
| 1057 | Ga0070660_101253628 | |||
| 1058 | Ga0070689_100048034 | |||
| 1059 | Ga0070691_10266803 | |||
| 1060 | Ga0070668_100004515 | |||
| 1061 | Ga0070668_100006775 | |||
| 1062 | Ga0070668_100737844 | |||
| 1063 | Ga0070668_101339050 | |||
| 1064 | Ga0070668_101862534 | |||
| 1065 | Ga0070669_100005855 | |||
| 1066 | Ga0070669_100026800 | |||
| 1067 | Ga0070675_100274857 | |||
| 1068 | Ga0070675_101111593 | |||
| 1069 | Ga0070671_100045894 | |||
| 1070 | Ga0070671_100187043 | |||
| 1071 | Ga0070671_100419086 | |||
| 1072 | Ga0070674_100014153 | |||
| 1073 | Ga0070688_100040308 | |||
| 1074 | Ga0070688_100537287 | |||
| 1075 | Ga0070659_101402698 | |||
| 1076 | Ga0070667_100001320 | |||
| 1077 | Ga0070667_100075872 | |||
| 1078 | Ga0070667_100160192 | |||
| 1079 | Ga0070667_100577587 | |||
| 1080 | Ga0070703_10069927 | |||
| 1081 | Ga0070709_10120850 | |||
| 1082 | Ga0070709_10171863 | |||
| 1083 | Ga0070714_100056497 | |||
| 1084 | Ga0070714_100132606 | |||
| 1085 | Ga0070714_100177279 | |||
| 1086 | Ga0070714_100858574 | |||
| 1087 | Ga0070714_100896399 | |||
| 1088 | Ga0070713_100992004 | |||
| 1089 | Ga0070710_10003360 | |||
| 1090 | Ga0070710_10062929 | |||
| 1091 | Ga0070701_10001388 | |||
| 1092 | Ga0070701_10155643 | |||
| 1093 | Ga0070711_100001084 | |||
| 1094 | Ga0070711_100175535 | |||
| 1095 | Ga0070711_101176060 | |||
| 1096 | Ga0070705_100021274 | |||
| 1097 | Ga0070705_100026467 | |||
| 1098 | Ga0070700_100001416 | |||
| 1099 | Ga0070700_100079273 | |||
| 1100 | Ga0070694_100001079 | |||
| 1101 | Ga0070694_100218934 | |||
| 1102 | Ga0070708_100110760 | |||
| 1103 | Ga0070708_100157819 | |||
| 1104 | Ga0070708_100311955 | |||
| 1105 | Ga0070708_100338538 | |||
| 1106 | Ga0070708_101589982 | |||
| 1107 | Ga0070663_100002330 | |||
| 1108 | Ga0070663_100081568 | |||
| 1109 | Ga0070663_100754489 | |||
| 1110 | Ga0070678_100000138 | |||
| 1111 | Ga0070662_100067048 | |||
| 1112 | Ga0070681_10003819 | |||
| 1113 | Ga0068867_100000240 | |||
| 1114 | Ga0068867_100475412 | |||
| 1115 | Ga0070685_10080767 | |||
| 1116 | Ga0070685_10093219 | |||
| 1117 | Ga0070706_100036152 | |||
| 1118 | Ga0070706_100167046 | |||
| 1119 | Ga0070706_100263525 | |||
| 1120 | Ga0070706_100427250 | |||
| 1121 | Ga0070706_102129039 | |||
| 1122 | Ga0070707_100022444 | |||
| 1123 | Ga0070707_100189830 | |||
| 1124 | Ga0070707_101039022 | |||
| 1125 | Ga0070707_101086434 | |||
| 1126 | Ga0070698_100001547 | |||
| 1127 | Ga0070698_100009052 | |||
| 1128 | Ga0070698_100010657 | |||
| 1129 | Ga0070699_100000166 | |||
| 1130 | Ga0070699_100768345 | |||
| 1131 | Ga0070699_100950612 | |||
| 1132 | Ga0070699_102054327 | |||
| 1133 | Ga0070679_100484444 | |||
| 1134 | Ga0070684_100029117 | |||
| 1135 | Ga0070697_100191993 | |||
| 1136 | Ga0070697_100335469 | |||
| 1137 | Ga0068853_100201789 | |||
| 1138 | Ga0068853_100891554 | |||
| 1139 | Ga0070672_100090152 | |||
| 1140 | Ga0070695_100003648 | |||
| 1141 | Ga0070695_100103769 | |||
| 1142 | Ga0070696_100001790 | |||
| 1143 | Ga0070696_100115302 | |||
| 1144 | Ga0070696_100298131 | |||
| 1145 | Ga0070693_100027793 | |||
| 1146 | Ga0070693_100681664 | |||
| 1147 | Ga0070665_100014182 | |||
| 1148 | Ga0070665_100016738 | |||
| 1149 | Ga0070665_100054317 | |||
| 1150 | Ga0070665_100093737 | |||
| 1151 | Ga0070665_100507087 | |||
| 1152 | Ga0070704_100013440 | |||
| 1153 | Ga0070704_100061064 | |||
| 1154 | Ga0068855_100149512 | |||
| 1155 | Ga0068855_100569649 | |||
| 1156 | Ga0068854_100004983 | |||
| 1157 | Ga0070702_100000152 | |||
| 1158 | Ga0068852_100236497 | |||
| 1159 | Ga0068859_100002335 | |||
| 1160 | Ga0068859_100009163 | |||
| 1161 | Ga0068859_100412048 | |||
| 1162 | Ga0068864_100099520 | |||
| 1163 | Ga0068864_100324316 | |||
| 1164 | Ga0068866_10002369 | |||
| 1165 | Ga0068866_10371152 | |||
| 1166 | Ga0068861_100000258 | |||
| 1167 | Ga0068861_100120885 | |||
| 1168 | Ga0068863_100000768 | |||
| 1169 | Ga0068863_101075306 | |||
| 1170 | Ga0068863_101808602 | |||
| 1171 | Ga0068863_102666454 | |||
| 1172 | Ga0068858_100005851 | |||
| 1173 | Ga0068858_100034131 | |||
| 1174 | Ga0068858_100039236 | |||
| 1175 | Ga0068858_100616800 | |||
| 1176 | Ga0068858_102177854 | |||
| 1177 | Ga0068858_102266828 | |||
| 1178 | Ga0068860_100000232 | |||
| 1179 | Ga0068860_100001342 | |||
| 1180 | Ga0068860_100920564 | |||
| 1181 | Ga0068860_102654548 | |||
| 1182 | Ga0068862_100000055 | |||
| 1183 | Ga0068862_100002510 | |||
| 1184 | Ga0068862_101089491 | |||
| 1185 | Ga0081455_10013458 | |||
| 1186 | Ga0081455_10162039 | |||
| 1187 | Ga0081455_10322399 | |||
| 1188 | Ga0081455_10379792 | |||
| 1189 | Ga0081539_10065146 | |||
| 1190 | Ga0070717_10000054 | |||
| 1191 | Ga0070717_10342222 | |||
| 1192 | Ga0075365_10009911 | |||
| 1193 | Ga0075365_10141869 | |||
| 1194 | Ga0075365_10187886 | |||
| 1195 | Ga0075365_10411932 | |||
| 1196 | Ga0075365_10613158 | |||
| 1197 | Ga0075365_11171322 | |||
| 1198 | Ga0075363_100000371 | |||
| 1199 | Ga0075363_100003550 | |||
| 1200 | Ga0075363_100004379 | |||
| 1201 | Ga0075363_100055318 | |||
| 1202 | Ga0075363_100087477 | |||
| 1203 | Ga0075363_100090652 | |||
| 1204 | Ga0075363_100171730 | |||
| 1205 | Ga0075364_10003774 | |||
| 1206 | Ga0075364_10019329 | |||
| 1207 | Ga0075364_10032999 | |||
| 1208 | Ga0075364_10054358 | |||
| 1209 | Ga0075364_10110574 | |||
| 1210 | Ga0075364_10125099 | |||
| 1211 | Ga0075364_10563205 | |||
| 1212 | Ga0075364_11121888 | |||
| 1213 | Ga0070715_10186419 | |||
| 1214 | Ga0070716_100016337 | |||
| 1215 | Ga0070716_100039299 | |||
| 1216 | Ga0070716_100093808 | |||
| 1217 | Ga0070716_101103407 | |||
| 1218 | Ga0070712_100000816 | |||
| 1219 | Ga0070712_101874815 | |||
| 1220 | Ga0075362_10025626 | |||
| 1221 | Ga0075362_10090353 | |||
| 1222 | Ga0075362_10605422 | |||
| 1223 | Ga0075367_10012940 | |||
| 1224 | Ga0075367_10186789 | |||
| 1225 | Ga0075369_10012607 | |||
| 1226 | Ga0075369_10040372 | |||
| 1227 | Ga0075369_10226851 | |||
| 1228 | Ga0097621_101435735 | |||
| 1229 | Ga0075370_10000639 | |||
| 1230 | Ga0075370_10044711 | |||
| 1231 | Ga0075370_10056353 | |||
| 1232 | Ga0075370_10079825 | |||
| 1233 | Ga0075370_10159699 | |||
| 1234 | Ga0068871_100054150 | |||
| 1235 | Ga0075428_100004586 | |||
| 1236 | Ga0075430_100010053 | |||
| 1237 | Ga0075431_100132269 | |||
| 1238 | Ga0075431_100318900 | |||
| 1239 | Ga0068865_100000633 | |||
| 1240 | Ga0097620_100002335 | |||
| 1241 | Ga0097620_100009163 | |||
| 1242 | Ga0097620_100412045 | |||
| 1243 | Ga0105251_10500764 | |||
| 1244 | Ga0105250_10026058 | |||
| 1245 | Ga0105250_10104637 | |||
| 1246 | Ga0105250_10218450 | |||
| 1247 | Ga0105250_10393863 | |||
| 1248 | Ga0111539_10420782 | |||
| 1249 | Ga0111539_10928764 | |||
| 1250 | Ga0105245_10001210 | |||
| 1251 | Ga0105245_10330236 | |||
| 1252 | Ga0105245_10479518 | |||
| 1253 | Ga0105245_11457504 | |||
| 1254 | Ga0105247_10000029 | |||
| 1255 | Ga0105247_10000896 | |||
| 1256 | Ga0105247_10033889 | |||
| 1257 | Ga0105247_10043520 | |||
| 1258 | Ga0105247_10441673 | |||
| 1259 | Ga0114129_10013266 | |||
| 1260 | Ga0114129_10260191 | |||
| 1261 | Ga0114129_10885381 | |||
| 1262 | Ga0105243_10001403 | |||
| 1263 | Ga0105243_10849040 | |||
| 1264 | Ga0105243_11149218 | |||
| 1265 | Ga0105241_10011773 | |||
| 1266 | Ga0105242_10000154 | |||
| 1267 | Ga0105248_10000136 | |||
| 1268 | Ga0105248_10007026 | |||
| 1269 | Ga0105248_10256849 | |||
| 1270 | Ga0105248_11102217 | |||
| 1271 | Ga0105237_10037568 | |||
| 1272 | Ga0105237_10043440 | |||
| 1273 | Ga0105238_10091762 | |||
| 1274 | Ga0105249_10000077 | |||
| 1275 | Ga0105249_10003764 | |||
| 1276 | Ga0105249_10040681 | |||
| 1277 | Ga0105249_13559254 | |||
| 1278 | Ga0105239_10007085 | |||
| 1279 | Ga0105239_10019726 | |||
| 1280 | Ga0105239_10258462 | |||
| 1281 | Ga0105239_10607608 | |||
| 1282 | Ga0105239_12332402 | |||
| 1283 | Ga0105246_10178623 | |||
| 1284 | Ga0157369_10105671 | |||
| 1285 | Ga0157369_10307794 | |||
| 1286 | Ga0157374_10254850 | |||
| 1287 | Ga0157378_10004436 | |||
| 1288 | Ga0163162_10009439 | |||
| 1289 | Ga0163162_10011973 | |||
| 1290 | Ga0163162_10332706 | |||
| 1291 | Ga0163162_11272622 | |||
| 1292 | Ga0163162_11942832 | |||
| 1293 | Ga0157372_10002900 | |||
| 1294 | Ga0157372_10996231 | |||
| 1295 | Ga0157375_10000360 | |||
| 1296 | Ga0163163_10183606 | |||
| 1297 | Ga0163163_10205907 | |||
| 1298 | Ga0163163_11286160 | |||
| 1299 | Ga0157380_10000198 | |||
| 1300 | Ga0157380_10229355 | |||
| 1301 | Ga0182008_10165101 | |||
| 1302 | Ga0157377_10052714 | |||
| 1303 | Ga0157377_10696652 | |||
| 1304 | Ga0157379_10008626 | |||
| 1305 | Ga0157376_10100854 | |||
| 1306 | Ga0157376_10789160 | |||
| 1307 | Ga0163161_10000846 | |||
| 1308 | Ga0163161_10610034 | |||
| 1309 | Ga0163161_11030078 | |||
| 1310 | Ga0213872_10150734 | |||
| 1311 | Ga0213874_10054034 | |||
| 1312 | Ga0213876_10032935 | |||
| 1313 | Ga0213875_10041518 | |||
| 1314 | Ga0213875_10111515 | |||
| 1315 | Ga0213875_10535627 | |||
| 1316 | Ga0209051_1000011 | |||
| 1317 | Ga0209051_1013590 | |||
| 1318 | Ga0207653_10100283 | |||
| 1319 | Ga0207692_10000300 | |||
| 1320 | Ga0207692_10098828 | |||
| 1321 | Ga0207642_10000206 | |||
| 1322 | Ga0207642_10321724 | |||
| 1323 | Ga0207710_10000046 | |||
| 1324 | Ga0207710_10000668 | |||
| 1325 | Ga0207710_10028621 | |||
| 1326 | Ga0207710_10226031 | |||
| 1327 | Ga0207688_10000804 | |||
| 1328 | Ga0207688_10005289 | |||
| 1329 | Ga0207688_10225724 | |||
| 1330 | Ga0207680_10115767 | |||
| 1331 | Ga0207647_10036067 | |||
| 1332 | Ga0207647_10043712 | |||
| 1333 | Ga0207685_10141363 | |||
| 1334 | Ga0207699_10023276 | |||
| 1335 | Ga0207699_10170002 | |||
| 1336 | Ga0207645_10038787 | |||
| 1337 | Ga0207643_10782750 | |||
| 1338 | Ga0207684_10000240 | |||
| 1339 | Ga0207684_10037303 | |||
| 1340 | Ga0207684_10049903 | |||
| 1341 | Ga0207684_10366884 | |||
| 1342 | Ga0207684_10477987 | |||
| 1343 | Ga0207654_10020719 | |||
| 1344 | Ga0207707_10002587 | |||
| 1345 | Ga0207695_10554898 | |||
| 1346 | Ga0207671_10294084 | |||
| 1347 | Ga0207693_10000469 | |||
| 1348 | Ga0207693_10119219 | |||
| 1349 | Ga0207693_10540780 | |||
| 1350 | Ga0207663_10000663 | |||
| 1351 | Ga0207646_10076375 | |||
| 1352 | Ga0207646_10871717 | |||
| 1353 | Ga0207681_10006615 | |||
| 1354 | Ga0207681_10012860 | |||
| 1355 | Ga0207681_11117729 | |||
| 1356 | Ga0207650_10472279 | |||
| 1357 | Ga0207650_10485734 | |||
| 1358 | Ga0207659_10422379 | |||
| 1359 | Ga0207687_10000480 | |||
| 1360 | Ga0207687_10015541 | |||
| 1361 | Ga0207700_10113297 | |||
| 1362 | Ga0207700_10221370 | |||
| 1363 | Ga0207664_10041054 | |||
| 1364 | Ga0207664_10057951 | |||
| 1365 | Ga0207664_10146477 | |||
| 1366 | Ga0207664_10167531 | |||
| 1367 | Ga0207664_10183889 | |||
| 1368 | Ga0207664_10337404 | |||
| 1369 | Ga0207664_10972560 | |||
| 1370 | Ga0207664_11113560 | |||
| 1371 | Ga0207644_10122327 | |||
| 1372 | Ga0207644_10159769 | |||
| 1373 | Ga0207644_10609688 | |||
| 1374 | Ga0207690_10651918 | |||
| 1375 | Ga0207690_11263447 | |||
| 1376 | Ga0207706_10012834 | |||
| 1377 | Ga0207686_10002525 | |||
| 1378 | Ga0207686_10336306 | |||
| 1379 | Ga0207709_10004429 | |||
| 1380 | Ga0207670_10034527 | |||
| 1381 | Ga0207670_10681591 | |||
| 1382 | Ga0207669_10000085 | |||
| 1383 | Ga0207669_10650248 | |||
| 1384 | Ga0207704_10000728 | |||
| 1385 | Ga0207704_10051515 | |||
| 1386 | Ga0207665_10006695 | |||
| 1387 | Ga0207665_10008806 | |||
| 1388 | Ga0207665_10037954 | |||
| 1389 | Ga0207665_10054156 | |||
| 1390 | Ga0207665_10596771 | |||
| 1391 | Ga0207691_10051181 | |||
| 1392 | Ga0207711_10000111 | |||
| 1393 | Ga0207711_10327933 | |||
| 1394 | Ga0207689_10057651 | |||
| 1395 | Ga0207689_10180169 | |||
| 1396 | Ga0207661_10018406 | |||
| 1397 | Ga0207679_10491487 | |||
| 1398 | Ga0207667_10118673 | |||
| 1399 | Ga0207667_10121309 | |||
| 1400 | Ga0207651_10457642 | |||
| 1401 | Ga0207712_10001008 | |||
| 1402 | Ga0207712_10549515 | |||
| 1403 | Ga0207712_11749330 | |||
| 1404 | Ga0207668_10001761 | |||
| 1405 | Ga0207668_10029319 | |||
| 1406 | Ga0207668_10866909 | |||
| 1407 | Ga0207640_10004679 | |||
| 1408 | Ga0207640_10585985 | |||
| 1409 | Ga0207658_10000271 | |||
| 1410 | Ga0207658_10002257 | |||
| 1411 | Ga0207658_10031502 | |||
| 1412 | Ga0207658_10140535 | |||
| 1413 | Ga0207658_10214569 | |||
| 1414 | Ga0207658_10253240 | |||
| 1415 | Ga0207677_10000820 | |||
| 1416 | Ga0207677_10037503 | |||
| 1417 | Ga0207703_10010089 | |||
| 1418 | Ga0207703_10025994 | |||
| 1419 | Ga0207703_10179360 | |||
| 1420 | Ga0207703_10640739 | |||
| 1421 | Ga0207703_11085303 | |||
| 1422 | Ga0207639_10251745 | |||
| 1423 | Ga0207639_10409938 | |||
| 1424 | Ga0207639_10491029 | |||
| 1425 | Ga0207678_10011563 | |||
| 1426 | Ga0207678_10377973 | |||
| 1427 | Ga0207678_10438248 | |||
| 1428 | Ga0207708_10000329 | |||
| 1429 | Ga0207641_10000378 | |||
| 1430 | Ga0207641_10099204 | |||
| 1431 | Ga0207648_10000112 | |||
| 1432 | Ga0207648_10391970 | |||
| 1433 | Ga0207676_10384539 | |||
| 1434 | Ga0207675_100000117 | |||
| 1435 | Ga0207675_100732202 | |||
| 1436 | Ga0207683_10001010 | |||
| 1437 | Ga0207683_10248143 | |||
| 1438 | Ga0207683_11118971 | |||
| 1439 | Ga0207698_10023753 | |||
| 1440 | Ga0209813_10109325 | |||
| 1441 | Ga0268266_10009370 | |||
| 1442 | Ga0268266_10014627 | |||
| 1443 | Ga0268266_10024527 | |||
| 1444 | Ga0268266_10046488 | |||
| 1445 | Ga0268266_10597297 | |||
| 1446 | Ga0268265_10000067 | |||
| 1447 | Ga0268265_10004318 | |||
| 1448 | Ga0268265_10353773 | |||
| 1449 | Ga0268264_10000146 | |||
| 1450 | Ga0268264_10001796 | |||
| 1451 | Ga0268264_10771575 | |||
| 1452 | Ga0307515_10011018 | |||
| 1453 | Ga0307515_10023776 | |||
| 1454 | Ga0307511_10003102 | |||
| 1455 | Ga0307511_10064628 | |||
| 1456 | Ga0307511_10123577 | |||
| 1457 | Ga0307511_10137094 | |||
| 1458 | Ga0307512_10006767 | |||
| 1459 | Ga0307512_10006967 | |||
| 1460 | Ga0307512_10019685 | |||
| 1461 | Ga0265327_10002845 | |||
| 1462 | Ga0265327_10071521 | |||
| 1463 | Ga0307513_10010212 | |||
| 1464 | Ga0307513_10041904 | |||
| 1465 | Ga0307513_10183985 | |||
| 1466 | Ga0307509_10011802 | |||
| 1467 | Ga0307509_10028010 | |||
| 1468 | Ga0307509_10169833 | |||
| 1469 | Ga0307509_10207338 | |||
| 1470 | Ga0307508_10016853 | |||
| 1471 | Ga0307508_10693192 | |||
| 1472 | Ga0307508_10927013 | |||
| 1473 | Ga0307514_10297641 | |||
| 1474 | Ga0316578_10368718 | |||
| 1475 | Ga0307516_10018641 | |||
| 1476 | Ga0307516_10019325 | |||
| 1477 | Ga0307516_10058066 | |||
| 1478 | Ga0307516_10106330 | |||
| 1479 | Ga0307405_10845159 | |||
| 1480 | Ga0307413_10864661 | |||
| 1481 | Ga0307518_10024942 | |||
| 1482 | Ga0307518_10169246 | |||
| 1483 | Ga0307518_10187293 | |||
| 1484 | Ga0307410_10009295 | |||
| 1485 | Ga0307410_10173312 | |||
| 1486 | Ga0307410_11655496 | |||
| 1487 | Ga0307406_10164617 | |||
| 1488 | Ga0307407_10622514 | |||
| 1489 | Ga0307409_100148069 | |||
| 1490 | Ga0307409_100393186 | |||
| 1491 | Ga0307409_100919695 | |||
| 1492 | Ga0307409_101362961 | |||
| 1493 | Ga0307416_100034920 | |||
| 1494 | Ga0307416_100396002 | |||
| 1495 | Ga0307416_102867856 | |||
| 1496 | Ga0307415_100013668 | |||
| 1497 | Ga0316583_10053639 | |||
| 1498 | Ga0316580_10222089 | |||
| 1499 | Ga0307507_10000003 | |||
| 1500 | Ga0307507_10005929 | |||
| 1501 | Ga0307510_10014262 | |||
| 1502 | Ga0307510_10063507 | |||
| 1503 | Ga0307510_10117282 | |||
| 1504 | Ga0373926_0004072 | |||
| 1505 | Ga0373928_0018249 | |||
| 1506 | Ga0373934_0032900 | |||
| 1507 | Ga0373940_0005855 | |||
| 1508 | Ga0373944_0010767 | |||
| 1509 | Ga0373949_0297326 | |||
| 1510 | Ga0373932_0152236 | |||
| 1511 | Ga0373936_0004137 | |||
| 1512 | Ga0373945_0002459 | |||
| 1513 | Ga0373953_0025395 | |||
| 1514 | Ga0373954_0035243 | |||
| 1515 | Ga0373956_0012630 | |||
| 1516 | Ga0373957_0016891 | |||
| 1517 | Ga0373943_0002954 | |||
| 1518 | Ga0373943_0579975 | |||
| 1519 | Ga0373946_0004678 | |||
| 1520 | Ga0373955_0067620 | |||
| 1521 | Ga0373955_0904011 | |||
| 1522 | Ga0373942_0000809 | |||
| 1523 | Ga0373942_0020476 | |||
| 1524 | Ga0373961_0065306 | |||
| 1525 | Ga0373962_0005213 | |||
| 1526 | Ga0373924_0456310 | |||
| 1527 | Ga0373931_0908129 | |||
| 1528 | Ga0373931_0948732 | |||
| 1529 | Ga0373935_0028451 | |||
| 1530 | Ga0373935_0626336 | |||
| 1531 | Ga0373927_0002196 | |||
| 1532 | Ga0373927_0876187 | |||
| 1533 | Ga0373933_0059700 | |||
| 1534 | Ga0373947_0100232 | |||
| 1535 | Ga0373937_0042264 | |||
| 1536 | Ga0373937_0052232 | |||
| 1537 | Ga0316584_0034896 | |||
| 1538 | Ga0316584_0513307 | |||
| 1539 | Ga0373925_0065040 | |||
| 1540 | Ga0373925_0072927 | |||
| 1541 | Ga0373925_0139523 | |||
| 1542 | Ga0436364_1059460 | |||
| 1543 | Ga0436364_1154797 | |||
| 1544 | Ga0436364_1482437 | |||
| 1545 | Ga0436365_1051614 | |||
| 1546 | Ga0436365_1356761 | |||
| 1547 | Ga0436365_1525818 | |||
| 1548 | Ga0436365_1572675 | |||
| 1549 | Ga0436365_1627569 | |||
| 1550 | Ga0436360_0681582 | |||
| 1551 | Ga0436361_0000693 | |||
| 1552 | Ga0436363_1342054 | |||
| 1553 | Ga0436363_1584934 | |||
| 1554 | Ga0439439_0182728 | |||
| 1555 | Ga0439461_0022794 | |||
| 1556 | Ga0439461_0064573 | |||
| 1557 | Ga0439466_0001192 | |||
| 1558 | Ga0439466_0022814 | |||
| 1559 | Ga0439466_0084189 | |||
| 1560 | Ga0439465_0007669 | |||
| 1561 | Ga0439465_0041863 | |||
| 1562 | Ga0439465_0229402 | |||
| 1563 | Ga0451789_0227657 | |||
| 1564 | Ga0451793_1004541 | |||
| 1565 | Ga0451793_1395669 | |||
| 1566 | Ga0451800_1404359 | |||
| 1567 | Ga0451802_0245828 | |||
| 1568 | Ga0451802_1608308 | |||
| 1569 | Ga0451845_0346134 | |||
| 1570 | Ga0451845_0749344 | |||
| 1571 | Ga0451843_0827849 | |||
| 1572 | Ga0451855_0837164 | |||
| 1573 | Ga0451853_2582717 | |||
| 1574 | Ga0451853_3508463 | |||
| 1575 | Ga0451853_4074114 | |||
| 1576 | Ga0439431_0009160 | |||
| 1577 | Ga0439442_002613 | |||
| 1578 | Ga0439442_162160 | |||
| 1579 | Ga0439448_0315163 | |||
| 1580 | Ga0439434_0012860 | |||
| 1581 | Ga0439434_0021562 | |||
| 1582 | Ga0439434_0083438 | |||
| 1583 | Ga0439435_0088248 | |||
| 1584 | Ga0466969_0044470 | |||
| 1585 | Ga0466972_0005873 | |||
| 1586 | Ga0466972_0008049 | |||
| 1587 | Ga0466972_0009641 | |||
| 1588 | Ga0466972_0287281 | |||
| 1589 | Ga0466972_0321437 | |||
| 1590 | Ga0466965_0002928 | |||
| 1591 | Ga0466965_0015530 | |||
| 1592 | Ga0466965_0032505 | |||
| 1593 | Ga0466965_0312176 | |||
| 1594 | Ga0466966_0012148 | |||
| 1595 | Ga0466966_0021640 | |||
| 1596 | Ga0466961_0002670 | |||
| 1597 | Ga0466961_0011244 | |||
| 1598 | Ga0466961_0691275 | |||
| 1599 | Ga0466963_0033970 | |||
| 1600 | Ga0466963_0061065 | |||
| 1601 | Ga0466963_0201025 | |||
| 1602 | Ga0466963_0231127 | |||
| 1603 | Ga0466963_0297242 | |||
| 1604 | Ga0466963_1062259 | |||
| 1605 | Ga0466963_1122720 | |||
| 1606 | Ga0466964_0230287 | |||
| 1607 | Ga0466971_0032496 | |||
| 1608 | Ga0466971_0039448 | |||
| 1609 | Ga0466971_0094361 | |||
| 1610 | Ga0466968_0012679 | |||
| 1611 | Ga0466968_0015685 | |||
| 1612 | Ga0466968_0137904 | |||
| 1613 | Ga0466968_0177380 | |||
| 1614 | Ga0466968_0335297 | |||
| 1615 | Ga0466968_0466896 | |||
| 1616 | Ga0466970_0005008 | |||
| 1617 | Ga0466970_0040781 | |||
| 1618 | Ga0466957_0002976 | |||
| 1619 | Ga0466957_0027976 | |||
| 1620 | Ga0466957_0059996 | |||
| 1621 | Ga0466957_0120472 | |||
| 1622 | Ga0466957_0254148 | |||
| 1623 | Ga0466957_0639383 | |||
| 1624 | Ga0466957_0693276 | |||
| 1625 | Ga0466960_0009811 | |||
| 1626 | Ga0466960_0019392 | |||
| 1627 | Ga0466960_0058461 | |||
| 1628 | Ga0466960_0592363 | |||
| 1629 | Ga0466959_0027932 | |||
| 1630 | Ga0466959_0034597 | |||
| 1631 | Ga0466959_0034662 | |||
| 1632 | Ga0466959_0042820 | |||
| 1633 | Ga0466959_0087549 | |||
| 1634 | Ga0466959_0201120 | |||
| 1635 | Ga0466958_0007717 | |||
| 1636 | Ga0466958_0099227 | |||
| 1637 | Ga0466958_0180117 | |||
| 1638 | Ga0466958_0377728 | |||
| 1639 | Ga0466967_0005746 | |||
| 1640 | Ga0466967_0010937 | |||
| 1641 | Ga0466967_0021377 | |||
| 1642 | Ga0466967_0097303 | |||
| 1643 | Ga0466967_0241578 | |||
| 1644 | Ga0466967_0788934 | |||
| 1645 | Ga0466967_1056024 | |||
| 1646 | Ga0466967_1107965 | |||
| 1647 | Ga0466967_1124048 | |||
| 1648 | Ga0466967_1140412 | |||
| 1649 | Ga0466967_1229583 | |||
| 1650 | Ga0466967_1294174 | |||
| 1651 | Ga0466967_1429522 | |||
| 1652 | Ga0466967_1468976 | |||
| 1653 | Ga0495617_136624 | |||
| 1654 | Ga0495592_0085634 | |||
| 1655 | Ga0495592_0394274 | |||
| 1656 | Ga0495603_0035080 | |||
| 1657 | Ga0495603_0050844 | |||
| 1658 | Ga0495629_0008706 | |||
| 1659 | Ga0495629_0014814 | |||
| 1660 | Ga0495629_0266460 | |||
| 1661 | Ga0495638_0007953 | |||
| 1662 | Ga0495638_0104391 | |||
| 1663 | Ga0495638_0262701 | |||
| 1664 | Ga0495641_0070675 | |||
| 1665 | Ga0495651_0006616 | |||
| 1666 | Ga0495651_0194443 | |||
| 1667 | Ga0495653_0053303 | |||
| 1668 | Ga0495653_0202799 | |||
| 1669 | Ga0495580_0346515 | |||
| 1670 | Ga0495580_0522991 | |||
| 1671 | Ga0495582_0009515 | |||
| 1672 | Ga0495639_0061184 | |||
| 1673 | Ga0495639_0118013 | |||
| 1674 | Ga0495662_0001407 | |||
| 1675 | Ga0495662_0019440 | |||
| 1676 | Ga0495662_0321112 | |||
| 1677 | Ga0495664_0004018 | |||
| 1678 | Ga0495664_0005032 | |||
| 1679 | Ga0495585_0386455 | |||
| 1680 | Ga0495594_0069148 | |||
| 1681 | Ga0495594_0329078 | |||
| 1682 | Ga0495606_0007916 | |||
| 1683 | Ga0495608_0032570 | |||
| 1684 | Ga0495618_0013102 | |||
| 1685 | Ga0495618_0036212 | |||
| 1686 | Ga0495618_0039029 | |||
| 1687 | Ga0495618_0058374 | |||
| 1688 | Ga0495628_0043489 | |||
| 1689 | Ga0495628_0054052 | |||
| 1690 | Ga0495628_0136381 | |||
| 1691 | Ga0495630_0011073 | |||
| 1692 | Ga0495630_0020585 | |||
| 1693 | Ga0495630_0198386 | |||
| 1694 | Ga0495632_0173734 | |||
| 1695 | Ga0495648_0024211 | |||
| 1696 | Ga0495648_0297639 | |||
| 1697 | Ga0495652_0024733 | |||
| 1698 | Ga0495652_0063118 | |||
| 1699 | Ga0495652_0119196 | |||
| 1700 | Ga0495652_0160434 | |||
| 1701 | Ga0495652_0823183 | |||
| 1702 | Ga0495652_0829931 | |||
| 1703 | Ga0495654_0170316 | |||
| 1704 | Ga0495665_0084879 | |||
| 1705 | Ga0495665_0137584 | |||
| 1706 | Ga0495640_0023248 | |||
| 1707 | Ga0495640_0092582 | |||
| 1708 | Ga0495640_0268385 | |||
| 1709 | Ga0495640_0326620 | |||
| 1710 | Ga0495586_0074120 | |||
| 1711 | Ga0495586_0431632 | |||
| 1712 | Ga0495587_0003071 | |||
| 1713 | Ga0495587_0089819 | |||
| 1714 | Ga0495609_0128854 | |||
| 1715 | Ga0495645_0003254 | |||
| 1716 | Ga0495645_0054441 | |||
| 1717 | Ga0495622_0026873 | |||
| 1718 | Ga0495622_0420223 | |||
| 1719 | Ga0495667_0002799 | |||
| 1720 | Ga0495634_0012936 | |||
| 1721 | Ga0495634_0092285 | |||
| 1722 | Ga0495634_0158941 | |||
| 1723 | Ga0495634_0233658 | |||
| 1724 | Ga0495634_0523538 | |||
| 1725 | Ga0495611_0005901 | |||
| 1726 | Ga0495611_0094202 | |||
| 1727 | Ga0495611_0268347 | |||
| 1728 | Ga0495635_0018217 | |||
| 1729 | Ga0495635_0024213 | |||
| 1730 | Ga0495635_0025239 | |||
| 1731 | Ga0495635_0025943 | |||
| 1732 | Ga0495588_0018277 | |||
| 1733 | Ga0495588_0406786 | |||
| 1734 | Ga0495657_0000085 | |||
| 1735 | Ga0495657_0050714 | |||
| 1736 | Ga0495599_0017527 | |||
| 1737 | Ga0495599_0152412 | |||
| 1738 | Ga0495599_0374070 | |||
| 1739 | Ga0495623_0057312 | |||
| 1740 | Ga0495623_0284139 | |||
| 1741 | Ga0495623_0743119 | |||
| 1742 | Ga0495646_0001147 | |||
| 1743 | Ga0495646_0335889 | |||
| 1744 | Ga0495647_0400847 | |||
| 1745 | Ga0495647_0497204 | |||
| 1746 | Ga0495658_0056632 | |||
| 1747 | Ga0495658_0056930 | |||
| 1748 | Ga0495613_0000396 | |||
| 1749 | Ga0495613_0065685 | |||
| 1750 | Ga0495613_0093484 | |||
| 1751 | Ga0495624_0003954 | |||
| 1752 | Ga0495624_0077397 | |||
| 1753 | Ga0495624_0097773 | |||
| 1754 | Ga0495671_0150454 | |||
| 1755 | Ga0495649_0304937 | |||
| 1756 | Ga0495600_0041406 | |||
| 1757 | Ga0495600_0132614 | |||
| 1758 | Ga0495660_0062889 | |||
| 1759 | Ga0495581_0003051 | |||
| 1760 | Ga0495581_0068181 | |||
| 1761 | Ga0495604_0000250 | |||
| 1762 | Ga0495604_0186630 | |||
| 1763 | Ga0495636_0141261 | |||
| 1764 | Ga0495636_0385103 | |||
| 1765 | Ga0495674_0044648 | |||
| 1766 | Ga0495674_0045673 | |||
| 1767 | Ga0495674_0092092 | |||
| 1768 | Ga0495674_0431808 | |||
| 1769 | Ga0495674_0498351 | |||
| 1770 | Ga0495672_0036303 | |||
| 1771 | Ga0495672_0151575 | |||
| 1772 | Ga0495676_0010266 | |||
| 1773 | Ga0495676_0013790 | |||
| 1774 | Ga0495676_0067551 | |||
| 1775 | Ga0495680_0005669 | |||
| 1776 | Ga0495680_0007071 | |||
| 1777 | Ga0495680_0041089 | |||
| 1778 | Ga0495683_0020667 | |||
| 1779 | Ga0495683_0310857 | |||
| 1780 | Ga0495687_001486 | |||
| 1781 | Ga0495687_021483 | |||
| 1782 | Ga0495687_034246 | |||
| 1783 | Ga0495675_0027216 | |||
| 1784 | Ga0495675_0087959 | |||
| 1785 | Ga0495675_0131673 | |||
| 1786 | Ga0495685_004080 | |||
| 1787 | Ga0495673_0343707 | |||
| 1788 | Ga0495684_0028742 | |||
| 1789 | Ga0495684_0128555 | |||
| 1790 | Ga0495686_0002803 | |||
| 1791 | Ga0495686_0099823 | |||
| 1792 | Ga0495593_0000421 | |||
| 1793 | Ga0495593_0012599 | |||
| 1794 | Ga0495593_0013725 | |||
| 1795 | Ga0495593_0095303 | |||
| 1796 | Ga0495593_0185370 | |||
| 1797 | Ga0495602_0034492 | |||
| 1798 | Ga0495602_0133543 | |||
| 1799 | Ga0495602_0411248 | |||
| 1800 | Ga0495602_0805879 | |||
| 1801 | Ga0495614_0001131 | |||
| 1802 | Ga0496100_0109149 | |||
| 1803 | Ga0496100_0131354 | |||
| 1804 | Ga0496100_0428262 | |||
| 1805 | Ga0496100_0968408 | |||
| 1806 | Ga0496101_0002286 | |||
| 1807 | Ga0496101_0146198 | |||
| 1808 | Ga0496101_0157950 | |||
| 1809 | Ga0496101_0664747 | |||
| 1810 | Ga0496101_0930517 | |||
| 1811 | Ga0496102_0000268 | |||
| 1812 | Ga0496102_0033616 | |||
| 1813 | Ga0496102_0055519 | |||
| 1814 | Ga0496102_0606039 | |||
| 1815 | Ga0496102_0676072 | |||
| 1816 | Ga0496103_0001095 | |||
| 1817 | Ga0496103_0013476 | |||
| 1818 | Ga0496103_0157287 | |||
| 1819 | Ga0496103_0879079 | |||
| 1820 | Ga0496104_0237623 | |||
| 1821 | Ga0496104_0330840 | |||
| 1822 | Ga0496104_0521768 | |||
| 1823 | Ga0496105_0069901 | |||
| 1824 | Ga0496105_0350064 | |||
| 1825 | Ga0496105_1111358 | |||
| 1826 | Ga0496106_0000556 | |||
| 1827 | Ga0496107_0008445 | |||
| 1828 | Ga0496107_0686169 | |||
| 1829 | Ga0496107_1347578 | |||
| 1830 | Ga0496108_0000759 | |||
| 1831 | Ga0496108_0005195 | |||
| 1832 | Ga0496108_0131325 | |||
| 1833 | Ga0496108_0544460 | |||
| 1834 | Ga0496109_0012962 | |||
| 1835 | Ga0496109_0129167 | |||
| 1836 | Ga0496109_0253175 | |||
| 1837 | Ga0496109_0253297 | |||
| 1838 | Ga0496109_0383428 | |||
| 1839 | Ga0496109_0689382 | |||
| 1840 | Ga0496110_0027246 | |||
| 1841 | Ga0496110_0160318 | |||
| 1842 | Ga0496110_0824427 | |||
| 1843 | Ga0496110_0896706 | |||
| 1844 | Ga0496110_0919106 | |||
| 1845 | Ga0496111_0048204 | |||
| 1846 | Ga0496111_0851650 | |||
| 1847 | Ga0496111_1260259 | |||
| 1848 | Ga0496112_0006671 | |||
| 1849 | Ga0496112_0082046 | |||
| 1850 | Ga0496112_0095914 | |||
| 1851 | Ga0496112_0178605 | |||
| 1852 | Ga0496112_0341462 | |||
| 1853 | Ga0496112_0537847 | |||
| 1854 | Ga0496112_0706910 | |||
| 1855 | Ga0496112_1424537 | |||
| 1856 | Ga0496113_0013352 | |||
| 1857 | Ga0496113_0068249 | |||
| 1858 | Ga0496113_0081756 | |||
| 1859 | Ga0496113_0649141 | |||
| 1860 | Ga0496113_0656615 | |||
| 1861 | Ga0496114_0001695 | |||
| 1862 | Ga0496115_0002918 | |||
| 1863 | Ga0496115_0737093 | |||
| 1864 | Ga0496115_1142893 | |||
| 1865 | Ga0496116_0015809 | |||
| 1866 | Ga0496117_0001548 | |||
| 1867 | Ga0496118_0000185 | |||
| 1868 | Ga0496118_0001284 | |||
| 1869 | Ga0496119_0003869 | |||
| 1870 | Ga0496120_0013157 | |||
| 1871 | Ga0496120_0089996 | |||
| 1872 | Ga0496121_0017973 | |||
| 1873 | Ga0496121_0270933 | |||
| 1874 | Ga0496122_0049449 | |||
| 1875 | Ga0496123_0035647 | |||
| 1876 | Ga0496124_0009890 | |||
| 1877 | Ga0496124_0301833 | |||
| 1878 | Ga0496125_0007641 | |||
| 1879 | Ga0496125_0158225 | |||
| 1880 | Ga0496126_0002221 | |||
| 1881 | Ga0496126_0004250 | |||
| 1882 | Ga0496126_0010378 | |||
| 1883 | Ga0496126_0506030 | |||
| 1884 | Ga0496126_0730238 | |||
| 1885 | Ga0495678_074925 | |||
| 1886 | Ga0501032_0003441 | |||
| 1887 | Ga0501032_0004434 | |||
| 1888 | Ga0501033_0014667 | |||
| 1889 | Ga0501033_0126491 | |||
| 1890 | Ga0501033_0138652 | |||
| 1891 | Ga0501034_0003163 | |||
| 1892 | Ga0501034_0015265 | |||
| 1893 | Ga0501034_0061592 | |||
| 1894 | Ga0501034_0413224 | |||
| 1895 | Ga0501034_0698453 | |||
| 1896 | Ga0501036_0027704 | |||
| 1897 | Ga0501036_0204183 | |||
| 1898 | Ga0501037_0006470 | |||
| 1899 | Ga0501037_0016834 | |||
| 1900 | Ga0501038_0009880 | |||
| 1901 | Ga0501039_0004829 | |||
| 1902 | Ga0501043_0009079 | |||
| 1903 | Ga0501043_0890373 | |||
| 1904 | Ga0501046_0001136 | |||
| 1905 | Ga0501047_1162890 | |||
| 1906 | Ga0501048_0001774 | |||
| 1907 | Ga0501048_0959525 | |||
| 1908 | Ga0501067_0364704 | |||
| 1909 | Ga0501068_0374924 | |||
| 1910 | Ga0501069_0055072 | |||
| 1911 | Ga0501069_0493551 | |||
| 1912 | Ga0501069_0834972 | |||
| 1913 | Ga0501070_0000448 | |||
| 1914 | Ga0501070_0000622 | |||
| 1915 | Ga0501070_0068563 | |||
| 1916 | Ga0501070_0408599 | |||
| 1917 | Ga0501073_0050920 | |||
| 1918 | Ga0501073_0465899 | |||
| 1919 | Ga0501073_0576992 | |||
| 1920 | Ga0501080_0067062 | |||
| 1921 | Ga0501080_0740245 | |||
| 1922 | Ga0501080_1763484 | |||
| 1923 | Ga0501035_0000147 | |||
| 1924 | Ga0501035_0612853 | |||
| 1925 | Ga0501044_0000152 | |||
| 1926 | Ga0501044_0001366 | |||
| 1927 | Ga0501044_0092672 | |||
| 1928 | Ga0501044_0621071 | |||
| 1929 | Ga0501044_0847679 | |||
| 1930 | nmdc:mga03683_18185_c1 | |||
| 1931 | nmdc:mga03n38_10656_c1 | |||
| 1932 | nmdc:mga03n38_167724_c1 | |||
| 1933 | nmdc:mga03n38_185576_c1 | |||
| 1934 | nmdc:mga03n38_18716_c1 | |||
| 1935 | nmdc:mga03n38_267829_c1 | |||
| 1936 | nmdc:mga03n38_26814_c1 | |||
| 1937 | nmdc:mga03n38_4631_c1 | |||
| 1938 | nmdc:mga03n38_612016_c1 | |||
| 1939 | nmdc:mga00v17_170662_c1 | |||
| 1940 | nmdc:mga00v17_22351_c1 | |||
| 1941 | nmdc:mga00v17_359917_c1 | |||
| 1942 | nmdc:mga00v17_362112_c1 | |||
| 1943 | nmdc:mga00v17_3787_c1 | |||
| 1944 | nmdc:mga00v17_438051_c1 | |||
| 1945 | nmdc:mga00v17_460168_c1 | |||
| 1946 | nmdc:mga00v17_64553_c1 | |||
| 1947 | nmdc:mga0yw44_1087405_c1 | |||
| 1948 | nmdc:mga0yw44_1184878_c1 | |||
| 1949 | nmdc:mga0yw44_118587_c1 | |||
| 1950 | nmdc:mga0yw44_12193_c1 | |||
| 1951 | nmdc:mga0yw44_12999_c1 | |||
| 1952 | nmdc:mga0yw44_293431_c1 | |||
| 1953 | nmdc:mga0yw44_447565_c1 | |||
| 1954 | nmdc:mga0yw44_906705_c1 | |||
| 1955 | nmdc:mga0k408_415390_c1 | |||
| 1956 | nmdc:mga06z11_155263_c1 | |||
| 1957 | nmdc:mga06z11_26161_c1 | |||
| 1958 | nmdc:mga06z11_583253_c1 | |||
| 1959 | nmdc:mga04h51_128708_c1 | |||
| 1960 | nmdc:mga04h51_257603_c1 | |||
| 1961 | nmdc:mga07m45_22174_c1 | |||
| 1962 | nmdc:mga07m45_44238_c1 | |||
| 1963 | nmdc:mga07m45_637573_c1 | |||
| 1964 | nmdc:mga07m45_691363_c1 | |||
| 1965 | nmdc:mga05p37_11463_c2 | |||
| 1966 | nmdc:mga05p37_300674_c1 | |||
| 1967 | nmdc:mga05p37_918625_c1 | |||
| 1968 | nmdc:mga0qj67_1212111_c1 | |||
| 1969 | nmdc:mga06r32_202245_c1 | |||
| 1970 | nmdc:mga06r32_570971_c1 | |||
| 1971 | nmdc:mga06r32_572715_c1 | |||
| 1972 | nmdc:mga08y16_930810_c1 | |||
| 1973 | nmdc:mga08x19_607061_c1 | |||
| 1974 | nmdc:mga0sz30_133341_c1 | |||
| 1975 | nmdc:mga0sz30_22479_c1 | |||
| 1976 | nmdc:mga0sz30_229844_c1 | |||
| 1977 | nmdc:mga0sz30_2402_c1 | |||
| 1978 | nmdc:mga0sz30_296980_c1 | |||
| 1979 | nmdc:mga0sz30_5503_c1 | |||
| 1980 | Ga0495601_0000403 | |||
| 1981 | Ga0495601_0253644 | |||
| 1982 | Ga0495601_0649184 | |||
| 1983 | Ga0495612_0065483 | |||
| 1984 | Ga0500610_0011964 | |||
| 1985 | Ga0500635_0001516 | |||
| 1986 | Ga0495655_0002859 | |||
| 1987 | Ga0495595_0027241 | |||
| 1988 | Ga0495595_0159915 | |||
| 1989 | Ga0495619_0260714 | |||
| 1990 | Ga0495619_0571252 | |||
| 1991 | Ga0495619_0694329 | |||
| 1992 | Ga0500578_0133012 | |||
| 1993 | Ga0500643_002800 | |||
| 1994 | Ga0500643_006577 | |||
| 1995 | Ga0500644_0036042 | |||
| 1996 | Ga0500644_0383165 | |||
| 1997 | Ga0500581_252450 | |||
| 1998 | Ga0500647_0310302 | |||
| 1999 | Ga0500583_0338359 | |||
| 2000 | Ga0500651_0029222 | |||
| 2001 | Ga0500651_0299557 | |||
| 2002 | Ga0500640_002440 | |||
| 2003 | Ga0500641_0105099 | |||
| 2004 | Ga0500650_0038585 | |||
| 2005 | Ga0500553_094023 | |||
| 2006 | Ga0500556_0283656 | |||
| 2007 | Ga0500558_123149 | |||
| 2008 | Ga0500560_036713 | |||
| 2009 | Ga0500562_023542 | |||
| 2010 | Ga0500572_264550 | |||
| 2011 | Ga0500621_250891 | |||
| 2012 | Ga0500642_0064921 | |||
| 2013 | Ga0500642_0262446 | |||
| 2014 | Ga0500652_005687 | |||
| 2015 | Ga0500652_024918 | |||
| 2016 | Ga0500561_0022595 | |||
| 2017 | Ga0500564_201664 | |||
| 2018 | Ga0500568_0169053 | |||
| 2019 | Ga0500573_0033901 | |||
| 2020 | Ga0500573_0206620 | |||
| 2021 | Ga0500577_0064992 | |||
| 2022 | Ga0500588_0031379 | |||
| 2023 | Ga0500600_0073788 | |||
| 2024 | Ga0500600_0169379 | |||
| 2025 | Ga0500600_0298168 | |||
| 2026 | Ga0500616_0083657 | |||
| 2027 | Ga0500624_012666 | |||
| 2028 | Ga0500627_0004489 | |||
| 2029 | Ga0500630_049169 | |||
| 2030 | Ga0500633_0123223 | |||
| 2031 | Ga0500634_0209487 | |||
| 2032 | Ga0500645_000181 | |||
| 2033 | Ga0500645_009096 | |||
| 2034 | Ga0500552_103418 | |||
| 2035 | Ga0466962_0001728 | |||
| 2036 | Ga0466962_0002480 | |||
| 2037 | Ga0466962_0494149 | |||
| 2038 | 2517763235 | |||
| 2039 | 2523382996 | |||
| 2040 | 2585313811 | |||
| 2041 | 2616697774 | |||
| 2042 | 2644511745 | |||
| 2043 | 2644635950 | |||
| 2044 | 2671836171 | |||
| 2045 | 2686539991 | |||
| 2046 | 2689994279 | |||
| 2047 | 2738666983 | |||
| 2048 | 2738707845 | |||
| 2049 | 2739145827 | |||
| 2050 | 2739334184 | |||
| 2051 | 2744955273 | |||
| 2052 | 2774854327 | |||
| 2053 | 2895888808 | |||
| 2054 | 2902802014 | |||
| 2055 | 2902811968 | |||
| 2056 | 2929216850 | |||
| 2057 | 2939588881 | |||
| 2058 | 2954691561 | |||
| 2059 | 2954706655 | |||
| 2060 | 3003006619 | |||
| 2061 | 8002776605 | |||
| 2062 | 8002788457 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4r3u-assembly1.cif.gz_C | crystal structure of 2-hydroxyisobutyryl-coa mutase | 0.9619 | 1 | 129 |
| 2xiq-assembly1.cif.gz_A | crystal structure of human methylmalonyl-coa mutase in complex with adenosylcobalamin and malonyl-coa | 0.9608 | 3 | 131 |
| 8dyl-assembly1.cif.gz_B | crystal structure of human methylmalonyl-coa mutase bound to aquocobalamin | 0.9595 | 4 | 131 |
| 2req-assembly2.cif.gz_C | methylmalonyl-coa mutase, non-productive coa complex, in open conformation representing substrate-free state | 0.9566 | 3 | 131 |
| 6oxd-assembly1.cif.gz_A | structure of mycobacterium tuberculosis methylmalonyl-coa mutase with adenosyl cobalamin | 0.9521 | 4 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4I2L1_581_723_3.40.50.280 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain | 0.966 | 4 | 129 | 3.40.50.280 |
| 4r3uD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain | 0.961 | 1 | 128 | 3.40.50.280 |
| 3bicB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain | 0.9487 | 4 | 131 | 3.40.50.280 |
| 4r3uD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain | 0.9467 | 1 | 128 | 3.40.50.280 |
| af_A4I2L1_581_723_3.40.50.280 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain | 0.9098 | 4 | 129 | 3.40.50.280 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A132PCM7-F1-model_v4 | Methylmalonyl-CoA mutase | 0.9955 | 1 | 130 |
GO:0016853
GO:0031419 GO:0046872 |
| AF-A0R1U8-F1-model_v4 | Methylmalonyl-CoA mutase C-terminal domain protein | 0.9952 | 1 | 132 |
GO:0016853
GO:0031419 GO:0046872 |
| AF-A0A1E7Y6P4-F1-model_v4 | deleted | 0.9947 | 1 | 130 |
|
| AF-A0A3N1CU38-F1-model_v4 | Methylmalonyl-CoA mutase C-terminal domain/subunit | 0.9923 | 1 | 128 |
GO:0016853
GO:0031419 GO:0046872 |
| AF-A0A7Y3LNX2-F1-model_v4 | Cobalamin B12-binding domain-containing protein | 0.9923 | 1 | 128 |
GO:0016853
GO:0031419 GO:0046872 |