F488611

General Info

Members Datasets Scaffolds Average Seq Length
1031 468 2062 136

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100707403|Ga0075436_1007074032
Length 157
Sequence MEPARQSPGQAARSPARVRVLVAKPGLDGHDRGAKIVARALRDAGFEVIFTGIRQRVEAIVATALQEDVAVVGLSILSGAHVGLTTRVVEGLRKAGADDIAVVVGGTIPAADVPRLRAAGAAAVYPTGTPLDVIVPEIRALASAQPGRHEETPCASA

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
124 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
127 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
189 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
190 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
191 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
192 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
193 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
194 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
195 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
196 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
197 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
200 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
208 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
209 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
210 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
211 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
212 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
213 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
214 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
215 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
216 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
217 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
218 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
220 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
221 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
222 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
223 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
224 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
225 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
226 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
227 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
228 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
229 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
230 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
232 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
233 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
234 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
235 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
236 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
237 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
240 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
241 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
242 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
243 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
244 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
245 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
246 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
247 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
248 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
249 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
250 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
251 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
252 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
253 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
254 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
255 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
256 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
257 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
258 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
259 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
260 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
261 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
262 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
263 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
264 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
265 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
266 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
267 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
268 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
269 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
270 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
271 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
272 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
273 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
274 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
275 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
276 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
277 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
278 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
281 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
282 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
283 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
284 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
285 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
286 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
287 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
288 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
289 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
290 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
291 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
292 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
293 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
297 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
298 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
299 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
300 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
301 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
302 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
303 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
304 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
305 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
306 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
307 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
308 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
309 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
310 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
311 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
312 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
313 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
314 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
315 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
316 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
317 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
318 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
319 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
320 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
321 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
322 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
323 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
324 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
325 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
326 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
327 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
328 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
329 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
330 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
331 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
332 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
333 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
334 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
335 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
336 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
337 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
338 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
339 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
340 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
341 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
342 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
343 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
344 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
345 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
346 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
347 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
348 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
349 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
350 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
351 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
352 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
353 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
354 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
355 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
356 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
357 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
358 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
359 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
360 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
361 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
362 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
363 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
364 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
365 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
366 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
367 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
368 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
369 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
381 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
382 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
383 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
384 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
385 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
386 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
388 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
389 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
390 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
391 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
392 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
393 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
394 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
395 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
396 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
397 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
398 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
399 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
400 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
401 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
402 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
403 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
404 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
405 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
406 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
407 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
408 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
409 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
410 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
411 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
412 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
413 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
414 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
415 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
416 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
417 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
418 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
419 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
420 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
421 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
422 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
423 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
424 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
425 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
426 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
427 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
428 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
429 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
430 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
431 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
432 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
433 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
434 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
435 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
436 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
437 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
438 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
439 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
440 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
441 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
442 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
443 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
444 2517572101 Frankia sp. DC12 Isolate Nodule
445 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
446 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
447 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
448 2643221692 Nocardia sp. Root136 Isolate Unclassified
449 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
450 2671180195 Frankia sp. CcI49 Isolate Nodule
451 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
452 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
453 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
454 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
455 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
456 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
457 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
458 2773857922 Frankia sp. CcI49 Isolate Nodule
459 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
460 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
461 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
462 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
463 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
464 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
465 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
466 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
467 8002775197 Frankia nepalensis CN7 Isolate Nodule
468 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.58
Metatranscriptomes 0
Isolates 2.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.03
Nodule 0.58
Rhizoplane 6.69
Rhizosphere 72.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100707403 3300006914 Bacteria 746
2 JGI24739J22299_10034313 3300001989 Bacteria 1730
3 JGI24737J22298_10065032 3300001990 Bacteria 1093
4 JGI24743J22301_10003191 3300001991 Bacteria 2569
5 JGI24735J21928_10146153 3300002067 Bacteria 682
6 JGI24750J21931_1016460 3300002070 Bacteria 1004
7 JGI24745J21846_1008346 3300002073 Bacteria 1166
8 JGI24738J21930_10010731 3300002075 Bacteria 2031
9 JGI24744J21845_10000043 3300002077 Bacteria 14405
10 JGI24034J26672_10009171 3300002239 Bacteria 1457
11 JGI24034J26672_10020396 3300002239 Bacteria 1039
12 JGI24034J26672_10038115 3300002239 Bacteria 801
13 JGI24742J22300_10001363 3300002244 Bacteria 3841
14 Ga0055540_1000003 3300003792 Bacteria 428375
15 Ga0070676_10039555 3300005328 Bacteria 2728
16 Ga0070683_100159646 3300005329 Bacteria 2139
17 Ga0070690_100179248 3300005330 Bacteria 1463
18 Ga0070670_100776435 3300005331 Bacteria 864
19 Ga0070670_102227393 3300005331 Bacteria 505
20 Ga0068869_100045219 3300005334 Bacteria 3169
21 Ga0068869_100091287 3300005334 Bacteria 2291
22 Ga0070666_10060432 3300005335 Bacteria 2565
23 Ga0070682_100070541 3300005337 Bacteria 2234
24 Ga0068868_100000580 3300005338 Bacteria 24531
25 Ga0068868_100007544 3300005338 Bacteria 7747
26 Ga0070660_101253628 3300005339 Bacteria 629
27 Ga0070689_100048034 3300005340 Bacteria 3291
28 Ga0070691_10266803 3300005341 Bacteria 924
29 Ga0070668_100004515 3300005347 Bacteria 10324
30 Ga0070668_100006775 3300005347 Bacteria 8494
31 Ga0070668_100737844 3300005347 Bacteria 871
32 Ga0070668_101339050 3300005347 Bacteria 651
33 Ga0070668_101862534 3300005347 Bacteria 554
34 Ga0070669_100005855 3300005353 Bacteria 8867
35 Ga0070669_100026800 3300005353 Bacteria 4147
36 Ga0070675_100274857 3300005354 Bacteria 1479
37 Ga0070675_101111593 3300005354 Bacteria 727
38 Ga0070671_100045894 3300005355 Bacteria 3633
39 Ga0070671_100187043 3300005355 Bacteria 1755
40 Ga0070671_100419086 3300005355 Bacteria 1147
41 Ga0070674_100014153 3300005356 Bacteria 4954
42 Ga0070688_100040308 3300005365 Bacteria 2862
43 Ga0070688_100537287 3300005365 Bacteria 887
44 Ga0070659_101402698 3300005366 Bacteria 621
45 Ga0070667_100001320 3300005367 Bacteria 22284
46 Ga0070667_100075872 3300005367 Bacteria 2870
47 Ga0070667_100160192 3300005367 Bacteria 1982
48 Ga0070667_100577587 3300005367 Bacteria 1034
49 Ga0070703_10069927 3300005406 Bacteria 1170
50 Ga0070709_10120850 3300005434 Bacteria 1775
51 Ga0070709_10171863 3300005434 Bacteria 1515
52 Ga0070714_100056497 3300005435 Bacteria 3357
53 Ga0070714_100132606 3300005435 Bacteria 2227
54 Ga0070714_100177279 3300005435 Bacteria 1937
55 Ga0070714_100858574 3300005435 Bacteria 880
56 Ga0070714_100896399 3300005435 Bacteria 861
57 Ga0070713_100992004 3300005436 Bacteria 810
58 Ga0070710_10003360 3300005437 Bacteria 7588
59 Ga0070710_10062929 3300005437 Bacteria 2118
60 Ga0070701_10001388 3300005438 Bacteria 8955
61 Ga0070701_10155643 3300005438 Bacteria 1320
62 Ga0070711_100001084 3300005439 Bacteria 14542
63 Ga0070711_100175535 3300005439 Bacteria 1636
64 Ga0070711_101176060 3300005439 Bacteria 663
65 Ga0070705_100021274 3300005440 Bacteria 3448
66 Ga0070705_100026467 3300005440 Bacteria 3157
67 Ga0070700_100001416 3300005441 Bacteria 11931
68 Ga0070700_100079273 3300005441 Bacteria 2116
69 Ga0070694_100001079 3300005444 Bacteria 15613
70 Ga0070694_100218934 3300005444 Bacteria 1427
71 Ga0070708_100110760 3300005445 Bacteria 2523
72 Ga0070708_100157819 3300005445 Bacteria 2113
73 Ga0070708_100311955 3300005445 Bacteria 1481
74 Ga0070708_100338538 3300005445 Bacteria 1418
75 Ga0070708_101589982 3300005445 Bacteria 608
76 Ga0070663_100002330 3300005455 Bacteria 10671
77 Ga0070663_100081568 3300005455 Bacteria 2378
78 Ga0070663_100754489 3300005455 Bacteria 831
79 Ga0070678_100000138 3300005456 Bacteria 29713
80 Ga0070662_100067048 3300005457 Bacteria 2635
81 Ga0070681_10003819 3300005458 Bacteria 14164
82 Ga0068867_100000240 3300005459 Bacteria 36047
83 Ga0068867_100475412 3300005459 Bacteria 1069
84 Ga0070685_10080767 3300005466 Bacteria 1949
85 Ga0070685_10093219 3300005466 Bacteria 1826
86 Ga0070706_100036152 3300005467 Bacteria 4560
87 Ga0070706_100167046 3300005467 Bacteria 2054
88 Ga0070706_100263525 3300005467 Bacteria 1609
89 Ga0070706_100427250 3300005467 Bacteria 1233
90 Ga0070706_102129039 3300005467 Bacteria 507
91 Ga0070707_100022444 3300005468 Bacteria 5967
92 Ga0070707_100189830 3300005468 Bacteria 2003
93 Ga0070707_101039022 3300005468 Bacteria 785
94 Ga0070707_101086434 3300005468 Bacteria 766
95 Ga0070698_100001547 3300005471 Bacteria 25515
96 Ga0070698_100009052 3300005471 Bacteria 10704
97 Ga0070698_100010657 3300005471 Bacteria 9794
98 Ga0070699_100000166 3300005518 Bacteria 63242
99 Ga0070699_100768345 3300005518 Bacteria 881
100 Ga0070699_100950612 3300005518 Bacteria 787
101 Ga0070699_102054327 3300005518 Bacteria 522
102 Ga0070679_100484444 3300005530 Bacteria 1181
103 Ga0070684_100029117 3300005535 Bacteria 4677
104 Ga0070697_100191993 3300005536 Bacteria 1734
105 Ga0070697_100335469 3300005536 Bacteria 1304
106 Ga0068853_100201789 3300005539 Bacteria 1810
107 Ga0068853_100891554 3300005539 Bacteria 854
108 Ga0070672_100090152 3300005543 Bacteria 2472
109 Ga0070695_100003648 3300005545 Bacteria 8975
110 Ga0070695_100103769 3300005545 Bacteria 1919
111 Ga0070696_100001790 3300005546 Bacteria 14084
112 Ga0070696_100115302 3300005546 Bacteria 1939
113 Ga0070696_100298131 3300005546 Bacteria 1234
114 Ga0070693_100027793 3300005547 Bacteria 3070
115 Ga0070693_100681664 3300005547 Bacteria 750
116 Ga0070665_100014182 3300005548 Bacteria 8008
117 Ga0070665_100016738 3300005548 Bacteria 7347
118 Ga0070665_100054317 3300005548 Bacteria 4018
119 Ga0070665_100093737 3300005548 Bacteria 3008
120 Ga0070665_100507087 3300005548 Bacteria 1218
121 Ga0070704_100013440 3300005549 Bacteria 5081
122 Ga0070704_100061064 3300005549 Bacteria 2696
123 Ga0068855_100149512 3300005563 Bacteria 2656
124 Ga0068855_100569649 3300005563 Bacteria 1224
125 Ga0068854_100004983 3300005578 Bacteria 8375
126 Ga0070702_100000152 3300005615 Bacteria 21674
127 Ga0068852_100236497 3300005616 Bacteria 1744
128 Ga0068859_100002335 3300005617 Bacteria 19295
129 Ga0068859_100009163 3300005617 Bacteria 9996
130 Ga0068859_100412048 3300005617 Bacteria 1447
131 Ga0068864_100099520 3300005618 Bacteria 2576
132 Ga0068864_100324316 3300005618 Bacteria 1447
133 Ga0068866_10002369 3300005718 Bacteria 7817
134 Ga0068866_10371152 3300005718 Bacteria 915
135 Ga0068861_100000258 3300005719 Bacteria 29459
136 Ga0068861_100120885 3300005719 Bacteria 2113
137 Ga0068863_100000768 3300005841 Bacteria 32211
138 Ga0068863_101075306 3300005841 Bacteria 809
139 Ga0068863_101808602 3300005841 Bacteria 621
140 Ga0068863_102666454 3300005841 Bacteria 509
141 Ga0068858_100005851 3300005842 Bacteria 12013
142 Ga0068858_100034131 3300005842 Bacteria 4719
143 Ga0068858_100039236 3300005842 Bacteria 4392
144 Ga0068858_100616800 3300005842 Bacteria 1053
145 Ga0068858_102177854 3300005842 Bacteria 548
146 Ga0068858_102266828 3300005842 Bacteria 537
147 Ga0068860_100000232 3300005843 Bacteria 85501
148 Ga0068860_100001342 3300005843 Bacteria 26770
149 Ga0068860_100920564 3300005843 Bacteria 891
150 Ga0068860_102654548 3300005843 Bacteria 520
151 Ga0068862_100000055 3300005844 Bacteria 142386
152 Ga0068862_100002510 3300005844 Bacteria 16244
153 Ga0068862_101089491 3300005844 Bacteria 793
154 Ga0081455_10013458 3300005937 Bacteria 8083
155 Ga0081455_10162039 3300005937 Bacteria 1713
156 Ga0081455_10322399 3300005937 Bacteria 1100
157 Ga0081455_10379792 3300005937 Bacteria 987
158 Ga0081539_10065146 3300005985 Bacteria 1980
159 Ga0070717_10000054 3300006028 Bacteria 99604
160 Ga0070717_10342222 3300006028 Bacteria 1336
161 Ga0075365_10009911 3300006038 Bacteria 5516
162 Ga0075365_10141869 3300006038 Bacteria 1668
163 Ga0075365_10187886 3300006038 Bacteria 1445
164 Ga0075365_10411932 3300006038 Bacteria 954
165 Ga0075365_10613158 3300006038 Bacteria 769
166 Ga0075365_11171322 3300006038 Bacteria 541
167 Ga0075363_100000371 3300006048 Bacteria 13560
168 Ga0075363_100003550 3300006048 Bacteria 6662
169 Ga0075363_100004379 3300006048 Bacteria 6167
170 Ga0075363_100055318 3300006048 Bacteria 2125
171 Ga0075363_100087477 3300006048 Bacteria 1712
172 Ga0075363_100090652 3300006048 Bacteria 1682
173 Ga0075363_100171730 3300006048 Bacteria 1231
174 Ga0075364_10003774 3300006051 Bacteria 8661
175 Ga0075364_10019329 3300006051 Bacteria 4275
176 Ga0075364_10032999 3300006051 Bacteria 3330
177 Ga0075364_10054358 3300006051 Bacteria 2618
178 Ga0075364_10110574 3300006051 Bacteria 1833
179 Ga0075364_10125099 3300006051 Bacteria 1723
180 Ga0075364_10563205 3300006051 Bacteria 779
181 Ga0075364_11121888 3300006051 Bacteria 534
182 Ga0070715_10186419 3300006163 Bacteria 1044
183 Ga0070716_100016337 3300006173 Bacteria 3827
184 Ga0070716_100039299 3300006173 Bacteria 2626
185 Ga0070716_100093808 3300006173 Bacteria 1823
186 Ga0070716_101103407 3300006173 Bacteria 633
187 Ga0070712_100000816 3300006175 Bacteria 18495
188 Ga0070712_101874815 3300006175 Bacteria 525
189 Ga0075362_10025626 3300006177 Bacteria 2513
190 Ga0075362_10090353 3300006177 Bacteria 1421
191 Ga0075362_10605422 3300006177 Bacteria 566
192 Ga0075367_10012940 3300006178 Bacteria 4469
193 Ga0075367_10186789 3300006178 Bacteria 1293
194 Ga0075369_10012607 3300006186 Bacteria 3339
195 Ga0075369_10040372 3300006186 Bacteria 1994
196 Ga0075369_10226851 3300006186 Bacteria 865
197 Ga0097621_101435735 3300006237 Bacteria 654
198 Ga0075370_10000639 3300006353 Bacteria 13581
199 Ga0075370_10044711 3300006353 Bacteria 2504
200 Ga0075370_10056353 3300006353 Bacteria 2234
201 Ga0075370_10079825 3300006353 Bacteria 1880
202 Ga0075370_10159699 3300006353 Bacteria 1323
203 Ga0068871_100054150 3300006358 Bacteria 3254
204 Ga0075428_100004586 3300006844 Bacteria 15280
205 Ga0075430_100010053 3300006846 Bacteria 8006
206 Ga0075431_100132269 3300006847 Bacteria 2573
207 Ga0075431_100318900 3300006847 Bacteria 1567
208 Ga0068865_100000633 3300006881 Bacteria 19836
209 Ga0097620_100002335 3300006931 Bacteria 19295
210 Ga0097620_100009163 3300006931 Bacteria 9996
211 Ga0097620_100412045 3300006931 Bacteria 1447
212 Ga0105251_10500764 3300009011 Bacteria 568
213 Ga0105250_10026058 3300009092 Bacteria 2355
214 Ga0105250_10104637 3300009092 Bacteria 1156
215 Ga0105250_10218450 3300009092 Bacteria 808
216 Ga0105250_10393863 3300009092 Bacteria 613
217 Ga0111539_10420782 3300009094 Bacteria 1556
218 Ga0111539_10928764 3300009094 Bacteria 1012
219 Ga0105245_10001210 3300009098 Bacteria 23346
220 Ga0105245_10330236 3300009098 Bacteria 1505
221 Ga0105245_10479518 3300009098 Bacteria 1257
222 Ga0105245_11457504 3300009098 Bacteria 735
223 Ga0105247_10000029 3300009101 Bacteria 198763
224 Ga0105247_10000896 3300009101 Bacteria 22411
225 Ga0105247_10033889 3300009101 Bacteria 3109
226 Ga0105247_10043520 3300009101 Bacteria 2751
227 Ga0105247_10441673 3300009101 Bacteria 936
228 Ga0114129_10013266 3300009147 Bacteria 11737
229 Ga0114129_10260191 3300009147 Bacteria 2326
230 Ga0114129_10885381 3300009147 Bacteria 1132
231 Ga0105243_10001403 3300009148 Bacteria 21306
232 Ga0105243_10849040 3300009148 Bacteria 904
233 Ga0105243_11149218 3300009148 Bacteria 787
234 Ga0105241_10011773 3300009174 Bacteria 6424
235 Ga0105242_10000154 3300009176 Bacteria 50757
236 Ga0105248_10000136 3300009177 Bacteria 85507
237 Ga0105248_10007026 3300009177 Bacteria 12332
238 Ga0105248_10256849 3300009177 Bacteria 1967
239 Ga0105248_11102217 3300009177 Bacteria 897
240 Ga0105237_10037568 3300009545 Bacteria 4893
241 Ga0105237_10043440 3300009545 Bacteria 4527
242 Ga0105238_10091762 3300009551 Bacteria 3024
243 Ga0105249_10000077 3300009553 Bacteria 141905
244 Ga0105249_10003764 3300009553 Bacteria 13090
245 Ga0105249_10040681 3300009553 Bacteria 4223
246 Ga0105249_13559254 3300009553 Bacteria 502
247 Ga0105239_10007085 3300010375 Bacteria 12907
248 Ga0105239_10019726 3300010375 Bacteria 7441
249 Ga0105239_10258462 3300010375 Bacteria 1957
250 Ga0105239_10607608 3300010375 Bacteria 1248
251 Ga0105239_12332402 3300010375 Bacteria 623
252 Ga0105246_10178623 3300011119 Bacteria 1632
253 Ga0157369_10105671 3300013105 Bacteria 2997
254 Ga0157369_10307794 3300013105 Bacteria 1648
255 Ga0157374_10254850 3300013296 Bacteria 1727
256 Ga0157378_10004436 3300013297 Bacteria 12344
257 Ga0163162_10009439 3300013306 Bacteria 9487
258 Ga0163162_10011973 3300013306 Bacteria 8459
259 Ga0163162_10332706 3300013306 Bacteria 1651
260 Ga0163162_11272622 3300013306 Bacteria 835
261 Ga0163162_11942832 3300013306 Bacteria 674
262 Ga0157372_10002900 3300013307 Bacteria 18542
263 Ga0157372_10996231 3300013307 Bacteria 971
264 Ga0157375_10000360 3300013308 Bacteria 41433
265 Ga0163163_10183606 3300014325 Bacteria 2139
266 Ga0163163_10205907 3300014325 Bacteria 2015
267 Ga0163163_11286160 3300014325 Bacteria 794
268 Ga0157380_10000198 3300014326 Bacteria 35239
269 Ga0157380_10229355 3300014326 Bacteria 1667
270 Ga0182008_10165101 3300014497 Bacteria 1116
271 Ga0157377_10052714 3300014745 Bacteria 2297
272 Ga0157377_10696652 3300014745 Bacteria 737
273 Ga0157379_10008626 3300014968 Bacteria 8872
274 Ga0157376_10100854 3300014969 Bacteria 2522
275 Ga0157376_10789160 3300014969 Bacteria 962
276 Ga0163161_10000846 3300017792 Bacteria 23880
277 Ga0163161_10610034 3300017792 Bacteria 900
278 Ga0163161_11030078 3300017792 Bacteria 704
279 Ga0213872_10150734 3300021361 Bacteria 1016
280 Ga0213874_10054034 3300021377 Bacteria 1241
281 Ga0213876_10032935 3300021384 Bacteria 2732
282 Ga0213875_10041518 3300021388 Bacteria 2164
283 Ga0213875_10111515 3300021388 Bacteria 1277
284 Ga0213875_10535627 3300021388 Bacteria 564
285 Ga0209051_1000011 3300025303 Bacteria 610828
286 Ga0209051_1013590 3300025303 Bacteria 3862
287 Ga0207653_10100283 3300025885 Bacteria 1023
288 Ga0207692_10000300 3300025898 Bacteria 17124
289 Ga0207692_10098828 3300025898 Bacteria 1598
290 Ga0207642_10000206 3300025899 Bacteria 17368
291 Ga0207642_10321724 3300025899 Bacteria 903
292 Ga0207710_10000046 3300025900 Bacteria 198754
293 Ga0207710_10000668 3300025900 Bacteria 19337
294 Ga0207710_10028621 3300025900 Bacteria 2419
295 Ga0207710_10226031 3300025900 Bacteria 930
296 Ga0207688_10000804 3300025901 Bacteria 15706
297 Ga0207688_10005289 3300025901 Bacteria 7014
298 Ga0207688_10225724 3300025901 Bacteria 1129
299 Ga0207680_10115767 3300025903 Bacteria 1746
300 Ga0207647_10036067 3300025904 Bacteria 3145
301 Ga0207647_10043712 3300025904 Bacteria 2801
302 Ga0207685_10141363 3300025905 Bacteria 1079
303 Ga0207699_10023276 3300025906 Bacteria 3369
304 Ga0207699_10170002 3300025906 Bacteria 1458
305 Ga0207645_10038787 3300025907 Bacteria 3053
306 Ga0207643_10782750 3300025908 Bacteria 618
307 Ga0207684_10000240 3300025910 Bacteria 82172
308 Ga0207684_10037303 3300025910 Bacteria 4124
309 Ga0207684_10049903 3300025910 Bacteria 3549
310 Ga0207684_10366884 3300025910 Bacteria 1239
311 Ga0207684_10477987 3300025910 Bacteria 1069
312 Ga0207654_10020719 3300025911 Bacteria 3490
313 Ga0207707_10002587 3300025912 Bacteria 16213
314 Ga0207695_10554898 3300025913 Bacteria 1030
315 Ga0207671_10294084 3300025914 Bacteria 1283
316 Ga0207693_10000469 3300025915 Bacteria 36811
317 Ga0207693_10119219 3300025915 Bacteria 2072
318 Ga0207693_10540780 3300025915 Bacteria 909
319 Ga0207663_10000663 3300025916 Bacteria 15195
320 Ga0207646_10076375 3300025922 Bacteria 2993
321 Ga0207646_10871717 3300025922 Bacteria 800
322 Ga0207681_10006615 3300025923 Bacteria 7116
323 Ga0207681_10012860 3300025923 Bacteria 5176
324 Ga0207681_11117729 3300025923 Bacteria 662
325 Ga0207650_10472279 3300025925 Bacteria 1046
326 Ga0207650_10485734 3300025925 Bacteria 1031
327 Ga0207659_10422379 3300025926 Bacteria 1118
328 Ga0207687_10000480 3300025927 Bacteria 26933
329 Ga0207687_10015541 3300025927 Bacteria 4993
330 Ga0207700_10113297 3300025928 Bacteria 2186
331 Ga0207700_10221370 3300025928 Bacteria 1604
332 Ga0207664_10041054 3300025929 Bacteria 3602
333 Ga0207664_10057951 3300025929 Bacteria 3080
334 Ga0207664_10146477 3300025929 Bacteria 2003
335 Ga0207664_10167531 3300025929 Bacteria 1878
336 Ga0207664_10183889 3300025929 Bacteria 1795
337 Ga0207664_10337404 3300025929 Bacteria 1332
338 Ga0207664_10972560 3300025929 Bacteria 761
339 Ga0207664_11113560 3300025929 Bacteria 706
340 Ga0207644_10122327 3300025931 Bacteria 1982
341 Ga0207644_10159769 3300025931 Bacteria 1751
342 Ga0207644_10609688 3300025931 Bacteria 907
343 Ga0207690_10651918 3300025932 Bacteria 863
344 Ga0207690_11263447 3300025932 Bacteria 617
345 Ga0207706_10012834 3300025933 Bacteria 7627
346 Ga0207686_10002525 3300025934 Bacteria 9944
347 Ga0207686_10336306 3300025934 Bacteria 1133
348 Ga0207709_10004429 3300025935 Bacteria 8124
349 Ga0207670_10034527 3300025936 Bacteria 3269
350 Ga0207670_10681591 3300025936 Bacteria 850
351 Ga0207669_10000085 3300025937 Bacteria 47505
352 Ga0207669_10650248 3300025937 Bacteria 862
353 Ga0207704_10000728 3300025938 Bacteria 14454
354 Ga0207704_10051515 3300025938 Bacteria 2490
355 Ga0207665_10006695 3300025939 Bacteria 7646
356 Ga0207665_10008806 3300025939 Bacteria 6635
357 Ga0207665_10037954 3300025939 Bacteria 3206
358 Ga0207665_10054156 3300025939 Bacteria 2705
359 Ga0207665_10596771 3300025939 Bacteria 862
360 Ga0207691_10051181 3300025940 Bacteria 3777
361 Ga0207711_10000111 3300025941 Bacteria 85466
362 Ga0207711_10327933 3300025941 Bacteria 1415
363 Ga0207689_10057651 3300025942 Bacteria 3195
364 Ga0207689_10180169 3300025942 Bacteria 1743
365 Ga0207661_10018406 3300025944 Bacteria 5190
366 Ga0207679_10491487 3300025945 Bacteria 1094
367 Ga0207667_10118673 3300025949 Bacteria 2726
368 Ga0207667_10121309 3300025949 Bacteria 2693
369 Ga0207651_10457642 3300025960 Bacteria 1096
370 Ga0207712_10001008 3300025961 Bacteria 20072
371 Ga0207712_10549515 3300025961 Bacteria 993
372 Ga0207712_11749330 3300025961 Bacteria 557
373 Ga0207668_10001761 3300025972 Bacteria 12655
374 Ga0207668_10029319 3300025972 Bacteria 3606
375 Ga0207668_10866909 3300025972 Bacteria 802
376 Ga0207640_10004679 3300025981 Bacteria 7425
377 Ga0207640_10585985 3300025981 Bacteria 942
378 Ga0207658_10000271 3300025986 Bacteria 54216
379 Ga0207658_10002257 3300025986 Bacteria 14254
380 Ga0207658_10031502 3300025986 Bacteria 3766
381 Ga0207658_10140535 3300025986 Bacteria 1953
382 Ga0207658_10214569 3300025986 Bacteria 1615
383 Ga0207658_10253240 3300025986 Bacteria 1497
384 Ga0207677_10000820 3300026023 Bacteria 17783
385 Ga0207677_10037503 3300026023 Bacteria 3169
386 Ga0207703_10010089 3300026035 Bacteria 7403
387 Ga0207703_10025994 3300026035 Bacteria 4607
388 Ga0207703_10179360 3300026035 Bacteria 1868
389 Ga0207703_10640739 3300026035 Bacteria 1008
390 Ga0207703_11085303 3300026035 Bacteria 769
391 Ga0207639_10251745 3300026041 Bacteria 1541
392 Ga0207639_10409938 3300026041 Bacteria 1223
393 Ga0207639_10491029 3300026041 Bacteria 1120
394 Ga0207678_10011563 3300026067 Bacteria 7752
395 Ga0207678_10377973 3300026067 Bacteria 1224
396 Ga0207678_10438248 3300026067 Bacteria 1135
397 Ga0207708_10000329 3300026075 Bacteria 37329
398 Ga0207641_10000378 3300026088 Bacteria 53027
399 Ga0207641_10099204 3300026088 Bacteria 2562
400 Ga0207648_10000112 3300026089 Bacteria 78746
401 Ga0207648_10391970 3300026089 Bacteria 1257
402 Ga0207676_10384539 3300026095 Bacteria 1307
403 Ga0207675_100000117 3300026118 Bacteria 64829
404 Ga0207675_100732202 3300026118 Bacteria 999
405 Ga0207683_10001010 3300026121 Bacteria 25655
406 Ga0207683_10248143 3300026121 Bacteria 1624
407 Ga0207683_11118971 3300026121 Bacteria 730
408 Ga0207698_10023753 3300026142 Bacteria 4289
409 Ga0209813_10109325 3300027866 Bacteria 950
410 Ga0268266_10009370 3300028379 Bacteria 8629
411 Ga0268266_10014627 3300028379 Bacteria 6744
412 Ga0268266_10024527 3300028379 Bacteria 5129
413 Ga0268266_10046488 3300028379 Bacteria 3716
414 Ga0268266_10597297 3300028379 Bacteria 1060
415 Ga0268265_10000067 3300028380 Bacteria 142389
416 Ga0268265_10004318 3300028380 Bacteria 9903
417 Ga0268265_10353773 3300028380 Bacteria 1342
418 Ga0268264_10000146 3300028381 Bacteria 165733
419 Ga0268264_10001796 3300028381 Bacteria 19621
420 Ga0268264_10771575 3300028381 Bacteria 959
421 Ga0307515_10011018 3300028794 Bacteria 17226
422 Ga0307515_10023776 3300028794 Bacteria 10717
423 Ga0307511_10003102 3300030521 Bacteria 17130
424 Ga0307511_10064628 3300030521 Bacteria 2748
425 Ga0307511_10123577 3300030521 Bacteria 1589
426 Ga0307511_10137094 3300030521 Bacteria 1453
427 Ga0307512_10006767 3300030522 Bacteria 11522
428 Ga0307512_10006967 3300030522 Bacteria 11293
429 Ga0307512_10019685 3300030522 Bacteria 6137
430 Ga0265327_10002845 3300031251 Bacteria 17454
431 Ga0265327_10071521 3300031251 Bacteria 1735
432 Ga0307513_10010212 3300031456 Bacteria 11797
433 Ga0307513_10041904 3300031456 Bacteria 5047
434 Ga0307513_10183985 3300031456 Bacteria 1949
435 Ga0307509_10011802 3300031507 Bacteria 10523
436 Ga0307509_10028010 3300031507 Bacteria 6266
437 Ga0307509_10169833 3300031507 Bacteria 2062
438 Ga0307509_10207338 3300031507 Bacteria 1789
439 Ga0307508_10016853 3300031616 Bacteria 6648
440 Ga0307508_10693192 3300031616 Bacteria 627
441 Ga0307508_10927013 3300031616 Bacteria 500
442 Ga0307514_10297641 3300031649 Bacteria 907
443 Ga0316578_10368718 3300031728 Bacteria 853
444 Ga0307516_10018641 3300031730 Bacteria 7207
445 Ga0307516_10019325 3300031730 Bacteria 7056
446 Ga0307516_10058066 3300031730 Bacteria 3768
447 Ga0307516_10106330 3300031730 Bacteria 2616
448 Ga0307405_10845159 3300031731 Bacteria 770
449 Ga0307413_10864661 3300031824 Bacteria 765
450 Ga0307518_10024942 3300031838 Bacteria 4308
451 Ga0307518_10169246 3300031838 Bacteria 1491
452 Ga0307518_10187293 3300031838 Bacteria 1391
453 Ga0307410_10009295 3300031852 Bacteria 5506
454 Ga0307410_10173312 3300031852 Bacteria 1628
455 Ga0307410_11655496 3300031852 Bacteria 566
456 Ga0307406_10164617 3300031901 Bacteria 1598
457 Ga0307407_10622514 3300031903 Bacteria 806
458 Ga0307409_100148069 3300031995 Bacteria 2034
459 Ga0307409_100393186 3300031995 Bacteria 1322
460 Ga0307409_100919695 3300031995 Bacteria 889
461 Ga0307409_101362961 3300031995 Bacteria 735
462 Ga0307416_100034920 3300032002 Bacteria 3833
463 Ga0307416_100396002 3300032002 Bacteria 1417
464 Ga0307416_102867856 3300032002 Bacteria 577
465 Ga0307415_100013668 3300032126 Bacteria 4746
466 Ga0316583_10053639 3300032133 Bacteria 1418
467 Ga0316580_10222089 3300032139 Bacteria 583
468 Ga0307507_10000003 3300033179 Bacteria 371707
469 Ga0307507_10005929 3300033179 Bacteria 19418
470 Ga0307510_10014262 3300033180 Bacteria 9411
471 Ga0307510_10063507 3300033180 Bacteria 3760
472 Ga0307510_10117282 3300033180 Bacteria 2380
473 Ga0373926_0004072 3300035083 Bacteria 4773
474 Ga0373928_0018249 3300035084 Bacteria 1452
475 Ga0373934_0032900 3300035086 Bacteria 2035
476 Ga0373940_0005855 3300035088 Bacteria 2690
477 Ga0373944_0010767 3300035089 Bacteria 2498
478 Ga0373949_0297326 3300035090 Bacteria 511
479 Ga0373932_0152236 3300035112 Bacteria 794
480 Ga0373936_0004137 3300035113 Bacteria 5472
481 Ga0373945_0002459 3300035116 Bacteria 5812
482 Ga0373953_0025395 3300035117 Bacteria 2263
483 Ga0373954_0035243 3300035118 Bacteria 2320
484 Ga0373956_0012630 3300035119 Bacteria 3504
485 Ga0373957_0016891 3300035120 Bacteria 2534
486 Ga0373943_0002954 3300035170 Bacteria 7710
487 Ga0373943_0579975 3300035170 Bacteria 659
488 Ga0373946_0004678 3300035171 Bacteria 4914
489 Ga0373955_0067620 3300035172 Bacteria 1989
490 Ga0373955_0904011 3300035172 Bacteria 543
491 Ga0373942_0000809 3300035207 Bacteria 8617
492 Ga0373942_0020476 3300035207 Bacteria 1662
493 Ga0373961_0065306 3300035241 Bacteria 1114
494 Ga0373962_0005213 3300035242 Bacteria 3142
495 Ga0373924_0456310 3300035410 Bacteria 573
496 Ga0373931_0908129 3300035691 Bacteria 592
497 Ga0373931_0948732 3300035691 Bacteria 580
498 Ga0373935_0028451 3300035692 Bacteria 3455
499 Ga0373935_0626336 3300035692 Bacteria 788
500 Ga0373927_0002196 3300035695 Bacteria 14345
501 Ga0373927_0876187 3300035695 Bacteria 593
502 Ga0373933_0059700 3300035724 Bacteria 2297
503 Ga0373947_0100232 3300035725 Bacteria 1819
504 Ga0373937_0042264 3300036401 Bacteria 4157
505 Ga0373937_0052232 3300036401 Bacteria 3747
506 Ga0316584_0034896 3300036712 Bacteria 3730
507 Ga0316584_0513307 3300036712 Bacteria 841
508 Ga0373925_0065040 3300037068 Bacteria 2747
509 Ga0373925_0072927 3300037068 Bacteria 2597
510 Ga0373925_0139523 3300037068 Bacteria 1896
511 Ga0436364_1059460 3300037853 Bacteria 4481
512 Ga0436364_1154797 3300037853 Bacteria 2014
513 Ga0436364_1482437 3300037853 Bacteria 4143
514 Ga0436365_1051614 3300039437 Bacteria 670
515 Ga0436365_1356761 3300039437 Bacteria 10416
516 Ga0436365_1525818 3300039437 Bacteria 1300
517 Ga0436365_1572675 3300039437 Bacteria 39347
518 Ga0436365_1627569 3300039437 Bacteria 24179
519 Ga0436360_0681582 3300039438 Bacteria 1100
520 Ga0436361_0000693 3300039447 Bacteria 1484
521 Ga0436363_1342054 3300039450 Bacteria 1534
522 Ga0436363_1584934 3300039450 Bacteria 878
523 Ga0439439_0182728 3300041406 Bacteria 605
524 Ga0439461_0022794 3300041410 Bacteria 1257
525 Ga0439461_0064573 3300041410 Bacteria 837
526 Ga0439466_0001192 3300041411 Bacteria 10126
527 Ga0439466_0022814 3300041411 Bacteria 2205
528 Ga0439466_0084189 3300041411 Bacteria 1001
529 Ga0439465_0007669 3300041413 Bacteria 3424
530 Ga0439465_0041863 3300041413 Bacteria 1483
531 Ga0439465_0229402 3300041413 Bacteria 682
532 Ga0451789_0227657 3300041443 Bacteria 690
533 Ga0451793_1004541 3300041452 Bacteria 612
534 Ga0451793_1395669 3300041452 Bacteria 719
535 Ga0451800_1404359 3300041459 Bacteria 568
536 Ga0451802_0245828 3300041460 Bacteria 538
537 Ga0451802_1608308 3300041460 Bacteria 583
538 Ga0451845_0346134 3300041501 Bacteria 542
539 Ga0451845_0749344 3300041501 Bacteria 558
540 Ga0451843_0827849 3300041509 Bacteria 630
541 Ga0451855_0837164 3300041511 Bacteria 633
542 Ga0451853_2582717 3300041512 Bacteria 987
543 Ga0451853_3508463 3300041512 Bacteria 2624
544 Ga0451853_4074114 3300041512 Bacteria 1124
545 Ga0439431_0009160 3300041997 Bacteria 2232
546 Ga0439442_002613 3300042002 Bacteria 3536
547 Ga0439442_162160 3300042002 Bacteria 500
548 Ga0439448_0315163 3300042005 Bacteria 556
549 Ga0439434_0012860 3300042435 Bacteria 2480
550 Ga0439434_0021562 3300042435 Bacteria 1936
551 Ga0439434_0083438 3300042435 Bacteria 1016
552 Ga0439435_0088248 3300042436 Bacteria 939
553 Ga0466969_0044470 3300044656 Bacteria 2208
554 Ga0466972_0005873 3300044658 Bacteria 6155
555 Ga0466972_0008049 3300044658 Bacteria 5284
556 Ga0466972_0009641 3300044658 Bacteria 4846
557 Ga0466972_0287281 3300044658 Bacteria 768
558 Ga0466972_0321437 3300044658 Bacteria 723
559 Ga0466965_0002928 3300044683 Bacteria 7379
560 Ga0466965_0015530 3300044683 Bacteria 3617
561 Ga0466965_0032505 3300044683 Bacteria 2548
562 Ga0466965_0312176 3300044683 Bacteria 855
563 Ga0466966_0012148 3300044684 Bacteria 5705
564 Ga0466966_0021640 3300044684 Bacteria 4222
565 Ga0466961_0002670 3300044693 Bacteria 11065
566 Ga0466961_0011244 3300044693 Bacteria 5722
567 Ga0466961_0691275 3300044693 Bacteria 611
568 Ga0466963_0033970 3300044694 Bacteria 3316
569 Ga0466963_0061065 3300044694 Bacteria 2519
570 Ga0466963_0201025 3300044694 Bacteria 1394
571 Ga0466963_0231127 3300044694 Bacteria 1296
572 Ga0466963_0297242 3300044694 Bacteria 1135
573 Ga0466963_1062259 3300044694 Bacteria 570
574 Ga0466963_1122720 3300044694 Bacteria 553
575 Ga0466964_0230287 3300044706 Bacteria 904
576 Ga0466971_0032496 3300044719 Bacteria 2338
577 Ga0466971_0039448 3300044719 Bacteria 2119
578 Ga0466971_0094361 3300044719 Bacteria 1371
579 Ga0466968_0012679 3300044735 Bacteria 3306
580 Ga0466968_0015685 3300044735 Bacteria 3007
581 Ga0466968_0137904 3300044735 Bacteria 1114
582 Ga0466968_0177380 3300044735 Bacteria 989
583 Ga0466968_0335297 3300044735 Bacteria 732
584 Ga0466968_0466896 3300044735 Bacteria 625
585 Ga0466970_0005008 3300044765 Bacteria 6545
586 Ga0466970_0040781 3300044765 Bacteria 2465
587 Ga0466957_0002976 3300044842 Bacteria 9200
588 Ga0466957_0027976 3300044842 Bacteria 3353
589 Ga0466957_0059996 3300044842 Bacteria 2332
590 Ga0466957_0120472 3300044842 Bacteria 1672
591 Ga0466957_0254148 3300044842 Bacteria 1169
592 Ga0466957_0639383 3300044842 Bacteria 747
593 Ga0466957_0693276 3300044842 Bacteria 718
594 Ga0466960_0009811 3300044901 Bacteria 3958
595 Ga0466960_0019392 3300044901 Bacteria 2996
596 Ga0466960_0058461 3300044901 Bacteria 1883
597 Ga0466960_0592363 3300044901 Bacteria 657
598 Ga0466959_0027932 3300045049 Bacteria 4184
599 Ga0466959_0034597 3300045049 Bacteria 3737
600 Ga0466959_0034662 3300045049 Bacteria 3734
601 Ga0466959_0042820 3300045049 Bacteria 3339
602 Ga0466959_0087549 3300045049 Bacteria 2240
603 Ga0466959_0201120 3300045049 Bacteria 1387
604 Ga0466958_0007717 3300045836 Bacteria 5935
605 Ga0466958_0099227 3300045836 Bacteria 1809
606 Ga0466958_0180117 3300045836 Bacteria 1341
607 Ga0466958_0377728 3300045836 Bacteria 913
608 Ga0466967_0005746 3300045976 Bacteria 8662
609 Ga0466967_0010937 3300045976 Bacteria 6840
610 Ga0466967_0021377 3300045976 Bacteria 5254
611 Ga0466967_0097303 3300045976 Bacteria 2686
612 Ga0466967_0241578 3300045976 Bacteria 1723
613 Ga0466967_0788934 3300045976 Bacteria 943
614 Ga0466967_1056024 3300045976 Bacteria 809
615 Ga0466967_1107965 3300045976 Bacteria 789
616 Ga0466967_1124048 3300045976 Bacteria 783
617 Ga0466967_1140412 3300045976 Bacteria 777
618 Ga0466967_1229583 3300045976 Bacteria 746
619 Ga0466967_1294174 3300045976 Bacteria 726
620 Ga0466967_1429522 3300045976 Bacteria 689
621 Ga0466967_1468976 3300045976 Bacteria 679
622 Ga0495617_136624 3300046452 Bacteria 784
623 Ga0495592_0085634 3300046454 Bacteria 2271
624 Ga0495592_0394274 3300046454 Bacteria 878
625 Ga0495603_0035080 3300046455 Bacteria 3014
626 Ga0495603_0050844 3300046455 Bacteria 2464
627 Ga0495629_0008706 3300046459 Bacteria 7468
628 Ga0495629_0014814 3300046459 Bacteria 5607
629 Ga0495629_0266460 3300046459 Bacteria 1177
630 Ga0495638_0007953 3300046460 Bacteria 7563
631 Ga0495638_0104391 3300046460 Bacteria 1690
632 Ga0495638_0262701 3300046460 Bacteria 946
633 Ga0495641_0070675 3300046461 Bacteria 1567
634 Ga0495651_0006616 3300046462 Bacteria 8848
635 Ga0495651_0194443 3300046462 Bacteria 1425
636 Ga0495653_0053303 3300046463 Bacteria 3095
637 Ga0495653_0202799 3300046463 Bacteria 1345
638 Ga0495580_0346515 3300046472 Bacteria 1007
639 Ga0495580_0522991 3300046472 Bacteria 790
640 Ga0495582_0009515 3300046473 Bacteria 5353
641 Ga0495639_0061184 3300046475 Bacteria 1726
642 Ga0495639_0118013 3300046475 Bacteria 1264
643 Ga0495662_0001407 3300046476 Bacteria 11933
644 Ga0495662_0019440 3300046476 Bacteria 3285
645 Ga0495662_0321112 3300046476 Bacteria 762
646 Ga0495664_0004018 3300046477 Bacteria 8030
647 Ga0495664_0005032 3300046477 Bacteria 7237
648 Ga0495585_0386455 3300046492 Bacteria 675
649 Ga0495594_0069148 3300046499 Bacteria 1961
650 Ga0495594_0329078 3300046499 Bacteria 870
651 Ga0495606_0007916 3300046507 Bacteria 9371
652 Ga0495608_0032570 3300046511 Bacteria 3523
653 Ga0495618_0013102 3300046514 Bacteria 5042
654 Ga0495618_0036212 3300046514 Bacteria 3096
655 Ga0495618_0039029 3300046514 Bacteria 2985
656 Ga0495618_0058374 3300046514 Bacteria 2444
657 Ga0495628_0043489 3300046516 Bacteria 3578
658 Ga0495628_0054052 3300046516 Bacteria 3167
659 Ga0495628_0136381 3300046516 Bacteria 1875
660 Ga0495630_0011073 3300046517 Bacteria 6524
661 Ga0495630_0020585 3300046517 Bacteria 4865
662 Ga0495630_0198386 3300046517 Bacteria 1531
663 Ga0495632_0173734 3300046519 Bacteria 989
664 Ga0495648_0024211 3300046524 Bacteria 4141
665 Ga0495648_0297639 3300046524 Bacteria 757
666 Ga0495652_0024733 3300046529 Bacteria 5314
667 Ga0495652_0063118 3300046529 Bacteria 3120
668 Ga0495652_0119196 3300046529 Bacteria 2108
669 Ga0495652_0160434 3300046529 Bacteria 1746
670 Ga0495652_0823183 3300046529 Bacteria 617
671 Ga0495652_0829931 3300046529 Bacteria 614
672 Ga0495654_0170316 3300046530 Bacteria 950
673 Ga0495665_0084879 3300046531 Bacteria 1664
674 Ga0495665_0137584 3300046531 Bacteria 1277
675 Ga0495640_0023248 3300046533 Bacteria 4522
676 Ga0495640_0092582 3300046533 Bacteria 1993
677 Ga0495640_0268385 3300046533 Bacteria 1065
678 Ga0495640_0326620 3300046533 Bacteria 949
679 Ga0495586_0074120 3300046535 Bacteria 1862
680 Ga0495586_0431632 3300046535 Bacteria 759
681 Ga0495587_0003071 3300046536 Bacteria 11155
682 Ga0495587_0089819 3300046536 Bacteria 1775
683 Ga0495609_0128854 3300046538 Bacteria 1084
684 Ga0495645_0003254 3300046543 Bacteria 11027
685 Ga0495645_0054441 3300046543 Bacteria 2907
686 Ga0495622_0026873 3300046557 Bacteria 2686
687 Ga0495622_0420223 3300046557 Bacteria 575
688 Ga0495667_0002799 3300046559 Bacteria 11647
689 Ga0495634_0012936 3300046642 Bacteria 6037
690 Ga0495634_0092285 3300046642 Bacteria 1965
691 Ga0495634_0158941 3300046642 Bacteria 1426
692 Ga0495634_0233658 3300046642 Bacteria 1130
693 Ga0495634_0523538 3300046642 Bacteria 693
694 Ga0495611_0005901 3300046648 Bacteria 5223
695 Ga0495611_0094202 3300046648 Bacteria 1385
696 Ga0495611_0268347 3300046648 Bacteria 789
697 Ga0495635_0018217 3300046663 Bacteria 4901
698 Ga0495635_0024213 3300046663 Bacteria 4232
699 Ga0495635_0025239 3300046663 Bacteria 4139
700 Ga0495635_0025943 3300046663 Bacteria 4080
701 Ga0495588_0018277 3300046674 Bacteria 3416
702 Ga0495588_0406786 3300046674 Bacteria 714
703 Ga0495657_0000085 3300046675 Bacteria 82569
704 Ga0495657_0050714 3300046675 Bacteria 2789
705 Ga0495599_0017527 3300046678 Bacteria 4451
706 Ga0495599_0152412 3300046678 Bacteria 1431
707 Ga0495599_0374070 3300046678 Bacteria 851
708 Ga0495623_0057312 3300046679 Bacteria 2451
709 Ga0495623_0284139 3300046679 Bacteria 919
710 Ga0495623_0743119 3300046679 Bacteria 500
711 Ga0495646_0001147 3300046680 Bacteria 15459
712 Ga0495646_0335889 3300046680 Bacteria 793
713 Ga0495647_0400847 3300046681 Bacteria 630
714 Ga0495647_0497204 3300046681 Bacteria 567
715 Ga0495658_0056632 3300046683 Bacteria 2236
716 Ga0495658_0056930 3300046683 Bacteria 2231
717 Ga0495613_0000396 3300046689 Bacteria 37260
718 Ga0495613_0065685 3300046689 Bacteria 2651
719 Ga0495613_0093484 3300046689 Bacteria 2177
720 Ga0495624_0003954 3300046690 Bacteria 10909
721 Ga0495624_0077397 3300046690 Bacteria 2063
722 Ga0495624_0097773 3300046690 Bacteria 1808
723 Ga0495671_0150454 3300046692 Bacteria 1133
724 Ga0495649_0304937 3300046694 Bacteria 810
725 Ga0495600_0041406 3300046809 Bacteria 3001
726 Ga0495600_0132614 3300046809 Bacteria 1619
727 Ga0495660_0062889 3300046810 Bacteria 1988
728 Ga0495581_0003051 3300047315 Bacteria 9595
729 Ga0495581_0068181 3300047315 Bacteria 2057
730 Ga0495604_0000250 3300047317 Bacteria 47753
731 Ga0495604_0186630 3300047317 Bacteria 1447
732 Ga0495636_0141261 3300047318 Bacteria 1076
733 Ga0495636_0385103 3300047318 Bacteria 666
734 Ga0495674_0044648 3300047319 Bacteria 3939
735 Ga0495674_0045673 3300047319 Bacteria 3889
736 Ga0495674_0092092 3300047319 Bacteria 2589
737 Ga0495674_0431808 3300047319 Bacteria 1060
738 Ga0495674_0498351 3300047319 Bacteria 974
739 Ga0495672_0036303 3300047320 Bacteria 3027
740 Ga0495672_0151575 3300047320 Bacteria 1202
741 Ga0495676_0010266 3300047321 Bacteria 8498
742 Ga0495676_0013790 3300047321 Bacteria 7247
743 Ga0495676_0067551 3300047321 Bacteria 2765
744 Ga0495680_0005669 3300047322 Bacteria 11687
745 Ga0495680_0007071 3300047322 Bacteria 10340
746 Ga0495680_0041089 3300047322 Bacteria 3678
747 Ga0495683_0020667 3300047323 Bacteria 3394
748 Ga0495683_0310857 3300047323 Bacteria 674
749 Ga0495687_001486 3300047443 Bacteria 21411
750 Ga0495687_021483 3300047443 Bacteria 3120
751 Ga0495687_034246 3300047443 Bacteria 2296
752 Ga0495675_0027216 3300047444 Bacteria 3644
753 Ga0495675_0087959 3300047444 Bacteria 1952
754 Ga0495675_0131673 3300047444 Bacteria 1554
755 Ga0495685_004080 3300047447 Bacteria 4697
756 Ga0495673_0343707 3300047469 Bacteria 527
757 Ga0495684_0028742 3300047471 Bacteria 4268
758 Ga0495684_0128555 3300047471 Bacteria 1904
759 Ga0495686_0002803 3300047472 Bacteria 15820
760 Ga0495686_0099823 3300047472 Bacteria 1752
761 Ga0495593_0000421 3300047673 Bacteria 23629
762 Ga0495593_0012599 3300047673 Bacteria 4828
763 Ga0495593_0013725 3300047673 Bacteria 4614
764 Ga0495593_0095303 3300047673 Bacteria 1530
765 Ga0495593_0185370 3300047673 Bacteria 1048
766 Ga0495602_0034492 3300048088 Bacteria 4733
767 Ga0495602_0133543 3300048088 Bacteria 1975
768 Ga0495602_0411248 3300048088 Bacteria 963
769 Ga0495602_0805879 3300048088 Bacteria 630
770 Ga0495614_0001131 3300048089 Bacteria 11472
771 Ga0496100_0109149 3300048903 Bacteria 1920
772 Ga0496100_0131354 3300048903 Bacteria 1764
773 Ga0496100_0428262 3300048903 Bacteria 1011
774 Ga0496100_0968408 3300048903 Bacteria 669
775 Ga0496101_0002286 3300048904 Bacteria 11703
776 Ga0496101_0146198 3300048904 Bacteria 1805
777 Ga0496101_0157950 3300048904 Bacteria 1738
778 Ga0496101_0664747 3300048904 Bacteria 823
779 Ga0496101_0930517 3300048904 Bacteria 684
780 Ga0496102_0000268 3300048905 Bacteria 66717
781 Ga0496102_0033616 3300048905 Bacteria 4609
782 Ga0496102_0055519 3300048905 Bacteria 3611
783 Ga0496102_0606039 3300048905 Bacteria 1018
784 Ga0496102_0676072 3300048905 Bacteria 955
785 Ga0496103_0001095 3300048906 Bacteria 18847
786 Ga0496103_0013476 3300048906 Bacteria 4849
787 Ga0496103_0157287 3300048906 Bacteria 1457
788 Ga0496103_0879079 3300048906 Bacteria 562
789 Ga0496104_0237623 3300048907 Bacteria 1734
790 Ga0496104_0330840 3300048907 Bacteria 1437
791 Ga0496104_0521768 3300048907 Bacteria 1099
792 Ga0496105_0069901 3300048908 Bacteria 2902
793 Ga0496105_0350064 3300048908 Bacteria 1180
794 Ga0496105_1111358 3300048908 Bacteria 586
795 Ga0496106_0000556 3300048909 Bacteria 26561
796 Ga0496107_0008445 3300048910 Bacteria 7128
797 Ga0496107_0686169 3300048910 Bacteria 754
798 Ga0496107_1347578 3300048910 Bacteria 509
799 Ga0496108_0000759 3300048911 Bacteria 25117
800 Ga0496108_0005195 3300048911 Bacteria 10519
801 Ga0496108_0131325 3300048911 Bacteria 2153
802 Ga0496108_0544460 3300048911 Bacteria 1013
803 Ga0496109_0012962 3300048912 Bacteria 7208
804 Ga0496109_0129167 3300048912 Bacteria 2358
805 Ga0496109_0253175 3300048912 Bacteria 1658
806 Ga0496109_0253297 3300048912 Bacteria 1658
807 Ga0496109_0383428 3300048912 Bacteria 1328
808 Ga0496109_0689382 3300048912 Bacteria 959
809 Ga0496110_0027246 3300048913 Bacteria 4898
810 Ga0496110_0160318 3300048913 Bacteria 2039
811 Ga0496110_0824427 3300048913 Bacteria 832
812 Ga0496110_0896706 3300048913 Bacteria 793
813 Ga0496110_0919106 3300048913 Bacteria 781
814 Ga0496111_0048204 3300048914 Bacteria 3069
815 Ga0496111_0851650 3300048914 Bacteria 658
816 Ga0496111_1260259 3300048914 Bacteria 522
817 Ga0496112_0006671 3300048915 Bacteria 10160
818 Ga0496112_0082046 3300048915 Bacteria 3189
819 Ga0496112_0095914 3300048915 Bacteria 2936
820 Ga0496112_0178605 3300048915 Bacteria 2087
821 Ga0496112_0341462 3300048915 Bacteria 1441
822 Ga0496112_0537847 3300048915 Bacteria 1103
823 Ga0496112_0706910 3300048915 Bacteria 935
824 Ga0496112_1424537 3300048915 Bacteria 607
825 Ga0496113_0013352 3300048916 Bacteria 5561
826 Ga0496113_0068249 3300048916 Bacteria 2698
827 Ga0496113_0081756 3300048916 Bacteria 2477
828 Ga0496113_0649141 3300048916 Bacteria 844
829 Ga0496113_0656615 3300048916 Bacteria 839
830 Ga0496114_0001695 3300048917 Bacteria 16749
831 Ga0496115_0002918 3300048918 Bacteria 12343
832 Ga0496115_0737093 3300048918 Bacteria 772
833 Ga0496115_1142893 3300048918 Bacteria 588
834 Ga0496116_0015809 3300048919 Bacteria 5944
835 Ga0496117_0001548 3300048920 Bacteria 32660
836 Ga0496118_0000185 3300048921 Bacteria 109095
837 Ga0496118_0001284 3300048921 Bacteria 38348
838 Ga0496119_0003869 3300048922 Bacteria 15271
839 Ga0496120_0013157 3300048923 Bacteria 5586
840 Ga0496120_0089996 3300048923 Bacteria 1642
841 Ga0496121_0017973 3300048924 Bacteria 7168
842 Ga0496121_0270933 3300048924 Bacteria 1167
843 Ga0496122_0049449 3300048925 Bacteria 3219
844 Ga0496123_0035647 3300048926 Bacteria 3541
845 Ga0496124_0009890 3300048927 Bacteria 9750
846 Ga0496124_0301833 3300048927 Bacteria 1156
847 Ga0496125_0007641 3300048928 Bacteria 11462
848 Ga0496125_0158225 3300048928 Bacteria 1544
849 Ga0496126_0002221 3300048929 Bacteria 26860
850 Ga0496126_0004250 3300048929 Bacteria 17244
851 Ga0496126_0010378 3300048929 Bacteria 9774
852 Ga0496126_0506030 3300048929 Bacteria 964
853 Ga0496126_0730238 3300048929 Bacteria 767
854 Ga0495678_074925 3300049459 Bacteria 1230
855 Ga0501032_0003441 3300049569 Bacteria 12120
856 Ga0501032_0004434 3300049569 Bacteria 10581
857 Ga0501033_0014667 3300049570 Bacteria 5949
858 Ga0501033_0126491 3300049570 Bacteria 1853
859 Ga0501033_0138652 3300049570 Bacteria 1759
860 Ga0501034_0003163 3300049571 Bacteria 18924
861 Ga0501034_0015265 3300049571 Bacteria 7894
862 Ga0501034_0061592 3300049571 Bacteria 3768
863 Ga0501034_0413224 3300049571 Bacteria 1271
864 Ga0501034_0698453 3300049571 Bacteria 913
865 Ga0501036_0027704 3300049572 Bacteria 4788
866 Ga0501036_0204183 3300049572 Bacteria 1662
867 Ga0501037_0006470 3300049573 Bacteria 8564
868 Ga0501037_0016834 3300049573 Bacteria 5379
869 Ga0501038_0009880 3300049574 Bacteria 8734
870 Ga0501039_0004829 3300049575 Bacteria 10207
871 Ga0501043_0009079 3300049579 Bacteria 7822
872 Ga0501043_0890373 3300049579 Bacteria 639
873 Ga0501046_0001136 3300049580 Bacteria 25942
874 Ga0501047_1162890 3300049581 Bacteria 585
875 Ga0501048_0001774 3300049582 Bacteria 16425
876 Ga0501048_0959525 3300049582 Bacteria 615
877 Ga0501067_0364704 3300049583 Bacteria 805
878 Ga0501068_0374924 3300049584 Bacteria 916
879 Ga0501069_0055072 3300049585 Bacteria 2215
880 Ga0501069_0493551 3300049585 Bacteria 730
881 Ga0501069_0834972 3300049585 Bacteria 559
882 Ga0501070_0000448 3300049586 Bacteria 37506
883 Ga0501070_0000622 3300049586 Bacteria 32559
884 Ga0501070_0068563 3300049586 Bacteria 2936
885 Ga0501070_0408599 3300049586 Bacteria 1097
886 Ga0501073_0050920 3300049589 Bacteria 2901
887 Ga0501073_0465899 3300049589 Bacteria 873
888 Ga0501073_0576992 3300049589 Bacteria 777
889 Ga0501080_0067062 3300049742 Bacteria 3338
890 Ga0501080_0740245 3300049742 Bacteria 865
891 Ga0501080_1763484 3300049742 Bacteria 521
892 Ga0501035_0000147 3300049822 Bacteria 85803
893 Ga0501035_0612853 3300049822 Bacteria 886
894 Ga0501044_0000152 3300049823 Bacteria 85715
895 Ga0501044_0001366 3300049823 Bacteria 28620
896 Ga0501044_0092672 3300049823 Bacteria 3047
897 Ga0501044_0621071 3300049823 Bacteria 972
898 Ga0501044_0847679 3300049823 Bacteria 791
899 nmdc:mga03683_18185_c1 3300050489 Bacteria 2668
900 nmdc:mga03n38_10656_c1 3300050490 Bacteria 3391
901 nmdc:mga03n38_167724_c1 3300050490 Bacteria 1116
902 nmdc:mga03n38_185576_c1 3300050490 Bacteria 1068
903 nmdc:mga03n38_18716_c1 3300050490 Bacteria 2739
904 nmdc:mga03n38_267829_c1 3300050490 Bacteria 908
905 nmdc:mga03n38_26814_c1 3300050490 Bacteria 2383
906 nmdc:mga03n38_4631_c1 3300050490 Bacteria 4583
907 nmdc:mga03n38_612016_c1 3300050490 Bacteria 621
908 nmdc:mga00v17_170662_c1 3300050491 Bacteria 1402
909 nmdc:mga00v17_22351_c1 3300050491 Bacteria 3649
910 nmdc:mga00v17_359917_c1 3300050491 Bacteria 946
911 nmdc:mga00v17_362112_c1 3300050491 Bacteria 943
912 nmdc:mga00v17_3787_c1 3300050491 Bacteria 7807
913 nmdc:mga00v17_438051_c1 3300050491 Bacteria 849
914 nmdc:mga00v17_460168_c1 3300050491 Bacteria 826
915 nmdc:mga00v17_64553_c1 3300050491 Bacteria 2256
916 nmdc:mga0yw44_1087405_c1 3300050492 Bacteria 540
917 nmdc:mga0yw44_1184878_c1 3300050492 Bacteria 515
918 nmdc:mga0yw44_118587_c1 3300050492 Bacteria 1703
919 nmdc:mga0yw44_12193_c1 3300050492 Bacteria 4470
920 nmdc:mga0yw44_12999_c1 3300050492 Bacteria 2844
921 nmdc:mga0yw44_293431_c1 3300050492 Bacteria 1088
922 nmdc:mga0yw44_447565_c1 3300050492 Bacteria 875
923 nmdc:mga0yw44_906705_c1 3300050492 Bacteria 598
924 nmdc:mga0k408_415390_c1 3300050493 Bacteria 800
925 nmdc:mga06z11_155263_c1 3300050494 Bacteria 1304
926 nmdc:mga06z11_26161_c1 3300050494 Bacteria 2774
927 nmdc:mga06z11_583253_c1 3300050494 Bacteria 680
928 nmdc:mga04h51_128708_c1 3300050495 Bacteria 950
929 nmdc:mga04h51_257603_c1 3300050495 Bacteria 701
930 nmdc:mga07m45_22174_c1 3300050496 Bacteria 3466
931 nmdc:mga07m45_44238_c1 3300050496 Bacteria 2498
932 nmdc:mga07m45_637573_c1 3300050496 Bacteria 614
933 nmdc:mga07m45_691363_c1 3300050496 Bacteria 587
934 nmdc:mga05p37_11463_c2 3300050507 Bacteria 9020
935 nmdc:mga05p37_300674_c1 3300050507 Bacteria 1907
936 nmdc:mga05p37_918625_c1 3300050507 Bacteria 941
937 nmdc:mga0qj67_1212111_c1 3300050509 Bacteria 587
938 nmdc:mga06r32_202245_c1 3300050510 Bacteria 1974
939 nmdc:mga06r32_570971_c1 3300050510 Bacteria 1104
940 nmdc:mga06r32_572715_c1 3300050510 Bacteria 1102
941 nmdc:mga08y16_930810_c1 3300050511 Bacteria 853
942 nmdc:mga08x19_607061_c1 3300050514 Bacteria 775
943 nmdc:mga0sz30_133341_c1 3300050516 Bacteria 1095
944 nmdc:mga0sz30_22479_c1 3300050516 Bacteria 2560
945 nmdc:mga0sz30_229844_c1 3300050516 Bacteria 825
946 nmdc:mga0sz30_2402_c1 3300050516 Bacteria 6682
947 nmdc:mga0sz30_296980_c1 3300050516 Bacteria 720
948 nmdc:mga0sz30_5503_c1 3300050516 Bacteria 4651
949 Ga0495601_0000403 3300053077 Bacteria 22823
950 Ga0495601_0253644 3300053077 Bacteria 1149
951 Ga0495601_0649184 3300053077 Bacteria 675
952 Ga0495612_0065483 3300053078 Bacteria 1509
953 Ga0500610_0011964 3300053079 Bacteria 3978
954 Ga0500635_0001516 3300053080 Bacteria 5585
955 Ga0495655_0002859 3300053083 Bacteria 2781
956 Ga0495595_0027241 3300053084 Bacteria 2545
957 Ga0495595_0159915 3300053084 Bacteria 1111
958 Ga0495619_0260714 3300053085 Bacteria 1201
959 Ga0495619_0571252 3300053085 Bacteria 775
960 Ga0495619_0694329 3300053085 Bacteria 692
961 Ga0500578_0133012 3300053086 Bacteria 1558
962 Ga0500643_002800 3300053087 Bacteria 8719
963 Ga0500643_006577 3300053087 Bacteria 4836
964 Ga0500644_0036042 3300053088 Bacteria 1607
965 Ga0500644_0383165 3300053088 Bacteria 611
966 Ga0500581_252450 3300053089 Bacteria 739
967 Ga0500647_0310302 3300053091 Bacteria 671
968 Ga0500583_0338359 3300053092 Bacteria 731
969 Ga0500651_0029222 3300053093 Bacteria 3466
970 Ga0500651_0299557 3300053093 Bacteria 923
971 Ga0500640_002440 3300053095 Bacteria 6146
972 Ga0500641_0105099 3300053096 Bacteria 1213
973 Ga0500650_0038585 3300053098 Bacteria 2199
974 Ga0500553_094023 3300053101 Bacteria 1310
975 Ga0500556_0283656 3300053104 Bacteria 649
976 Ga0500558_123149 3300053106 Bacteria 1001
977 Ga0500560_036713 3300053107 Bacteria 1515
978 Ga0500562_023542 3300053108 Bacteria 1608
979 Ga0500572_264550 3300053111 Bacteria 558
980 Ga0500621_250891 3300053126 Bacteria 594
981 Ga0500642_0064921 3300053130 Bacteria 1649
982 Ga0500642_0262446 3300053130 Bacteria 790
983 Ga0500652_005687 3300053131 Bacteria 3951
984 Ga0500652_024918 3300053131 Bacteria 2288
985 Ga0500561_0022595 3300053137 Bacteria 1497
986 Ga0500564_201664 3300053138 Bacteria 817
987 Ga0500568_0169053 3300053139 Bacteria 805
988 Ga0500573_0033901 3300053140 Bacteria 2945
989 Ga0500573_0206620 3300053140 Bacteria 1039
990 Ga0500577_0064992 3300053142 Bacteria 1414
991 Ga0500588_0031379 3300053146 Bacteria 1533
992 Ga0500600_0073788 3300053149 Bacteria 1864
993 Ga0500600_0169379 3300053149 Bacteria 1064
994 Ga0500600_0298168 3300053149 Bacteria 692
995 Ga0500616_0083657 3300053153 Bacteria 1598
996 Ga0500624_012666 3300053157 Bacteria 1250
997 Ga0500627_0004489 3300053158 Bacteria 4494
998 Ga0500630_049169 3300053159 Bacteria 2041
999 Ga0500633_0123223 3300053160 Bacteria 965
1000 Ga0500634_0209487 3300053161 Bacteria 848
1001 Ga0500645_000181 3300053730 Bacteria 49626
1002 Ga0500645_009096 3300053730 Bacteria 3352
1003 Ga0500552_103418 3300053733 Bacteria 543
1004 Ga0466962_0001728 3300061719 Bacteria 10266
1005 Ga0466962_0002480 3300061719 Bacteria 8746
1006 Ga0466962_0494149 3300061719 Bacteria 619
1007 2517763235 2517572101 Bacteria 6884336
1008 2523382996 2523231044 Bacteria 6434991
1009 2585313811 2582581314 Bacteria 11452267
1010 2616697774 2616644814 Bacteria 11555299
1011 2644511745 2643221692 Bacteria 7282860
1012 2644635950 2643221715 Bacteria 6671032
1013 2671836171 2671180195 Bacteria 9757215
1014 2686539991 2684623035 Bacteria 8032739
1015 2689994279 2687453743 Bacteria 8361025
1016 2738666983 2738541264 Bacteria 5935393
1017 2738707845 2738541274 Bacteria 6909446
1018 2739145827 2738541356 Bacteria 5935017
1019 2739334184 2738543028 Bacteria 6917070
1020 2744955273 2744054611 Bacteria 5611514
1021 2774854327 2773857922 Bacteria 9757215
1022 2895888808 2895880812 Bacteria 11255272
1023 2902802014 2902799365 Bacteria 5419524
1024 2902811968 2902810491 Bacteria 6794147
1025 2929216850 2929212328 Bacteria 7708288
1026 2939588881 2939582691 Bacteria 7088898
1027 2954691561 2954691527 Bacteria 10720516
1028 2954706655 2954701450 Bacteria 10834262
1029 3003006619 3002998708 Bacteria 11715108
1030 8002776605 8002775197 Bacteria 10728764
1031 8002788457 8002784119 Bacteria 9788632
1032 Ga0075436_100707403
1033 JGI24739J22299_10034313
1034 JGI24737J22298_10065032
1035 JGI24743J22301_10003191
1036 JGI24735J21928_10146153
1037 JGI24750J21931_1016460
1038 JGI24745J21846_1008346
1039 JGI24738J21930_10010731
1040 JGI24744J21845_10000043
1041 JGI24034J26672_10009171
1042 JGI24034J26672_10020396
1043 JGI24034J26672_10038115
1044 JGI24742J22300_10001363
1045 Ga0055540_1000003
1046 Ga0070676_10039555
1047 Ga0070683_100159646
1048 Ga0070690_100179248
1049 Ga0070670_100776435
1050 Ga0070670_102227393
1051 Ga0068869_100045219
1052 Ga0068869_100091287
1053 Ga0070666_10060432
1054 Ga0070682_100070541
1055 Ga0068868_100000580
1056 Ga0068868_100007544
1057 Ga0070660_101253628
1058 Ga0070689_100048034
1059 Ga0070691_10266803
1060 Ga0070668_100004515
1061 Ga0070668_100006775
1062 Ga0070668_100737844
1063 Ga0070668_101339050
1064 Ga0070668_101862534
1065 Ga0070669_100005855
1066 Ga0070669_100026800
1067 Ga0070675_100274857
1068 Ga0070675_101111593
1069 Ga0070671_100045894
1070 Ga0070671_100187043
1071 Ga0070671_100419086
1072 Ga0070674_100014153
1073 Ga0070688_100040308
1074 Ga0070688_100537287
1075 Ga0070659_101402698
1076 Ga0070667_100001320
1077 Ga0070667_100075872
1078 Ga0070667_100160192
1079 Ga0070667_100577587
1080 Ga0070703_10069927
1081 Ga0070709_10120850
1082 Ga0070709_10171863
1083 Ga0070714_100056497
1084 Ga0070714_100132606
1085 Ga0070714_100177279
1086 Ga0070714_100858574
1087 Ga0070714_100896399
1088 Ga0070713_100992004
1089 Ga0070710_10003360
1090 Ga0070710_10062929
1091 Ga0070701_10001388
1092 Ga0070701_10155643
1093 Ga0070711_100001084
1094 Ga0070711_100175535
1095 Ga0070711_101176060
1096 Ga0070705_100021274
1097 Ga0070705_100026467
1098 Ga0070700_100001416
1099 Ga0070700_100079273
1100 Ga0070694_100001079
1101 Ga0070694_100218934
1102 Ga0070708_100110760
1103 Ga0070708_100157819
1104 Ga0070708_100311955
1105 Ga0070708_100338538
1106 Ga0070708_101589982
1107 Ga0070663_100002330
1108 Ga0070663_100081568
1109 Ga0070663_100754489
1110 Ga0070678_100000138
1111 Ga0070662_100067048
1112 Ga0070681_10003819
1113 Ga0068867_100000240
1114 Ga0068867_100475412
1115 Ga0070685_10080767
1116 Ga0070685_10093219
1117 Ga0070706_100036152
1118 Ga0070706_100167046
1119 Ga0070706_100263525
1120 Ga0070706_100427250
1121 Ga0070706_102129039
1122 Ga0070707_100022444
1123 Ga0070707_100189830
1124 Ga0070707_101039022
1125 Ga0070707_101086434
1126 Ga0070698_100001547
1127 Ga0070698_100009052
1128 Ga0070698_100010657
1129 Ga0070699_100000166
1130 Ga0070699_100768345
1131 Ga0070699_100950612
1132 Ga0070699_102054327
1133 Ga0070679_100484444
1134 Ga0070684_100029117
1135 Ga0070697_100191993
1136 Ga0070697_100335469
1137 Ga0068853_100201789
1138 Ga0068853_100891554
1139 Ga0070672_100090152
1140 Ga0070695_100003648
1141 Ga0070695_100103769
1142 Ga0070696_100001790
1143 Ga0070696_100115302
1144 Ga0070696_100298131
1145 Ga0070693_100027793
1146 Ga0070693_100681664
1147 Ga0070665_100014182
1148 Ga0070665_100016738
1149 Ga0070665_100054317
1150 Ga0070665_100093737
1151 Ga0070665_100507087
1152 Ga0070704_100013440
1153 Ga0070704_100061064
1154 Ga0068855_100149512
1155 Ga0068855_100569649
1156 Ga0068854_100004983
1157 Ga0070702_100000152
1158 Ga0068852_100236497
1159 Ga0068859_100002335
1160 Ga0068859_100009163
1161 Ga0068859_100412048
1162 Ga0068864_100099520
1163 Ga0068864_100324316
1164 Ga0068866_10002369
1165 Ga0068866_10371152
1166 Ga0068861_100000258
1167 Ga0068861_100120885
1168 Ga0068863_100000768
1169 Ga0068863_101075306
1170 Ga0068863_101808602
1171 Ga0068863_102666454
1172 Ga0068858_100005851
1173 Ga0068858_100034131
1174 Ga0068858_100039236
1175 Ga0068858_100616800
1176 Ga0068858_102177854
1177 Ga0068858_102266828
1178 Ga0068860_100000232
1179 Ga0068860_100001342
1180 Ga0068860_100920564
1181 Ga0068860_102654548
1182 Ga0068862_100000055
1183 Ga0068862_100002510
1184 Ga0068862_101089491
1185 Ga0081455_10013458
1186 Ga0081455_10162039
1187 Ga0081455_10322399
1188 Ga0081455_10379792
1189 Ga0081539_10065146
1190 Ga0070717_10000054
1191 Ga0070717_10342222
1192 Ga0075365_10009911
1193 Ga0075365_10141869
1194 Ga0075365_10187886
1195 Ga0075365_10411932
1196 Ga0075365_10613158
1197 Ga0075365_11171322
1198 Ga0075363_100000371
1199 Ga0075363_100003550
1200 Ga0075363_100004379
1201 Ga0075363_100055318
1202 Ga0075363_100087477
1203 Ga0075363_100090652
1204 Ga0075363_100171730
1205 Ga0075364_10003774
1206 Ga0075364_10019329
1207 Ga0075364_10032999
1208 Ga0075364_10054358
1209 Ga0075364_10110574
1210 Ga0075364_10125099
1211 Ga0075364_10563205
1212 Ga0075364_11121888
1213 Ga0070715_10186419
1214 Ga0070716_100016337
1215 Ga0070716_100039299
1216 Ga0070716_100093808
1217 Ga0070716_101103407
1218 Ga0070712_100000816
1219 Ga0070712_101874815
1220 Ga0075362_10025626
1221 Ga0075362_10090353
1222 Ga0075362_10605422
1223 Ga0075367_10012940
1224 Ga0075367_10186789
1225 Ga0075369_10012607
1226 Ga0075369_10040372
1227 Ga0075369_10226851
1228 Ga0097621_101435735
1229 Ga0075370_10000639
1230 Ga0075370_10044711
1231 Ga0075370_10056353
1232 Ga0075370_10079825
1233 Ga0075370_10159699
1234 Ga0068871_100054150
1235 Ga0075428_100004586
1236 Ga0075430_100010053
1237 Ga0075431_100132269
1238 Ga0075431_100318900
1239 Ga0068865_100000633
1240 Ga0097620_100002335
1241 Ga0097620_100009163
1242 Ga0097620_100412045
1243 Ga0105251_10500764
1244 Ga0105250_10026058
1245 Ga0105250_10104637
1246 Ga0105250_10218450
1247 Ga0105250_10393863
1248 Ga0111539_10420782
1249 Ga0111539_10928764
1250 Ga0105245_10001210
1251 Ga0105245_10330236
1252 Ga0105245_10479518
1253 Ga0105245_11457504
1254 Ga0105247_10000029
1255 Ga0105247_10000896
1256 Ga0105247_10033889
1257 Ga0105247_10043520
1258 Ga0105247_10441673
1259 Ga0114129_10013266
1260 Ga0114129_10260191
1261 Ga0114129_10885381
1262 Ga0105243_10001403
1263 Ga0105243_10849040
1264 Ga0105243_11149218
1265 Ga0105241_10011773
1266 Ga0105242_10000154
1267 Ga0105248_10000136
1268 Ga0105248_10007026
1269 Ga0105248_10256849
1270 Ga0105248_11102217
1271 Ga0105237_10037568
1272 Ga0105237_10043440
1273 Ga0105238_10091762
1274 Ga0105249_10000077
1275 Ga0105249_10003764
1276 Ga0105249_10040681
1277 Ga0105249_13559254
1278 Ga0105239_10007085
1279 Ga0105239_10019726
1280 Ga0105239_10258462
1281 Ga0105239_10607608
1282 Ga0105239_12332402
1283 Ga0105246_10178623
1284 Ga0157369_10105671
1285 Ga0157369_10307794
1286 Ga0157374_10254850
1287 Ga0157378_10004436
1288 Ga0163162_10009439
1289 Ga0163162_10011973
1290 Ga0163162_10332706
1291 Ga0163162_11272622
1292 Ga0163162_11942832
1293 Ga0157372_10002900
1294 Ga0157372_10996231
1295 Ga0157375_10000360
1296 Ga0163163_10183606
1297 Ga0163163_10205907
1298 Ga0163163_11286160
1299 Ga0157380_10000198
1300 Ga0157380_10229355
1301 Ga0182008_10165101
1302 Ga0157377_10052714
1303 Ga0157377_10696652
1304 Ga0157379_10008626
1305 Ga0157376_10100854
1306 Ga0157376_10789160
1307 Ga0163161_10000846
1308 Ga0163161_10610034
1309 Ga0163161_11030078
1310 Ga0213872_10150734
1311 Ga0213874_10054034
1312 Ga0213876_10032935
1313 Ga0213875_10041518
1314 Ga0213875_10111515
1315 Ga0213875_10535627
1316 Ga0209051_1000011
1317 Ga0209051_1013590
1318 Ga0207653_10100283
1319 Ga0207692_10000300
1320 Ga0207692_10098828
1321 Ga0207642_10000206
1322 Ga0207642_10321724
1323 Ga0207710_10000046
1324 Ga0207710_10000668
1325 Ga0207710_10028621
1326 Ga0207710_10226031
1327 Ga0207688_10000804
1328 Ga0207688_10005289
1329 Ga0207688_10225724
1330 Ga0207680_10115767
1331 Ga0207647_10036067
1332 Ga0207647_10043712
1333 Ga0207685_10141363
1334 Ga0207699_10023276
1335 Ga0207699_10170002
1336 Ga0207645_10038787
1337 Ga0207643_10782750
1338 Ga0207684_10000240
1339 Ga0207684_10037303
1340 Ga0207684_10049903
1341 Ga0207684_10366884
1342 Ga0207684_10477987
1343 Ga0207654_10020719
1344 Ga0207707_10002587
1345 Ga0207695_10554898
1346 Ga0207671_10294084
1347 Ga0207693_10000469
1348 Ga0207693_10119219
1349 Ga0207693_10540780
1350 Ga0207663_10000663
1351 Ga0207646_10076375
1352 Ga0207646_10871717
1353 Ga0207681_10006615
1354 Ga0207681_10012860
1355 Ga0207681_11117729
1356 Ga0207650_10472279
1357 Ga0207650_10485734
1358 Ga0207659_10422379
1359 Ga0207687_10000480
1360 Ga0207687_10015541
1361 Ga0207700_10113297
1362 Ga0207700_10221370
1363 Ga0207664_10041054
1364 Ga0207664_10057951
1365 Ga0207664_10146477
1366 Ga0207664_10167531
1367 Ga0207664_10183889
1368 Ga0207664_10337404
1369 Ga0207664_10972560
1370 Ga0207664_11113560
1371 Ga0207644_10122327
1372 Ga0207644_10159769
1373 Ga0207644_10609688
1374 Ga0207690_10651918
1375 Ga0207690_11263447
1376 Ga0207706_10012834
1377 Ga0207686_10002525
1378 Ga0207686_10336306
1379 Ga0207709_10004429
1380 Ga0207670_10034527
1381 Ga0207670_10681591
1382 Ga0207669_10000085
1383 Ga0207669_10650248
1384 Ga0207704_10000728
1385 Ga0207704_10051515
1386 Ga0207665_10006695
1387 Ga0207665_10008806
1388 Ga0207665_10037954
1389 Ga0207665_10054156
1390 Ga0207665_10596771
1391 Ga0207691_10051181
1392 Ga0207711_10000111
1393 Ga0207711_10327933
1394 Ga0207689_10057651
1395 Ga0207689_10180169
1396 Ga0207661_10018406
1397 Ga0207679_10491487
1398 Ga0207667_10118673
1399 Ga0207667_10121309
1400 Ga0207651_10457642
1401 Ga0207712_10001008
1402 Ga0207712_10549515
1403 Ga0207712_11749330
1404 Ga0207668_10001761
1405 Ga0207668_10029319
1406 Ga0207668_10866909
1407 Ga0207640_10004679
1408 Ga0207640_10585985
1409 Ga0207658_10000271
1410 Ga0207658_10002257
1411 Ga0207658_10031502
1412 Ga0207658_10140535
1413 Ga0207658_10214569
1414 Ga0207658_10253240
1415 Ga0207677_10000820
1416 Ga0207677_10037503
1417 Ga0207703_10010089
1418 Ga0207703_10025994
1419 Ga0207703_10179360
1420 Ga0207703_10640739
1421 Ga0207703_11085303
1422 Ga0207639_10251745
1423 Ga0207639_10409938
1424 Ga0207639_10491029
1425 Ga0207678_10011563
1426 Ga0207678_10377973
1427 Ga0207678_10438248
1428 Ga0207708_10000329
1429 Ga0207641_10000378
1430 Ga0207641_10099204
1431 Ga0207648_10000112
1432 Ga0207648_10391970
1433 Ga0207676_10384539
1434 Ga0207675_100000117
1435 Ga0207675_100732202
1436 Ga0207683_10001010
1437 Ga0207683_10248143
1438 Ga0207683_11118971
1439 Ga0207698_10023753
1440 Ga0209813_10109325
1441 Ga0268266_10009370
1442 Ga0268266_10014627
1443 Ga0268266_10024527
1444 Ga0268266_10046488
1445 Ga0268266_10597297
1446 Ga0268265_10000067
1447 Ga0268265_10004318
1448 Ga0268265_10353773
1449 Ga0268264_10000146
1450 Ga0268264_10001796
1451 Ga0268264_10771575
1452 Ga0307515_10011018
1453 Ga0307515_10023776
1454 Ga0307511_10003102
1455 Ga0307511_10064628
1456 Ga0307511_10123577
1457 Ga0307511_10137094
1458 Ga0307512_10006767
1459 Ga0307512_10006967
1460 Ga0307512_10019685
1461 Ga0265327_10002845
1462 Ga0265327_10071521
1463 Ga0307513_10010212
1464 Ga0307513_10041904
1465 Ga0307513_10183985
1466 Ga0307509_10011802
1467 Ga0307509_10028010
1468 Ga0307509_10169833
1469 Ga0307509_10207338
1470 Ga0307508_10016853
1471 Ga0307508_10693192
1472 Ga0307508_10927013
1473 Ga0307514_10297641
1474 Ga0316578_10368718
1475 Ga0307516_10018641
1476 Ga0307516_10019325
1477 Ga0307516_10058066
1478 Ga0307516_10106330
1479 Ga0307405_10845159
1480 Ga0307413_10864661
1481 Ga0307518_10024942
1482 Ga0307518_10169246
1483 Ga0307518_10187293
1484 Ga0307410_10009295
1485 Ga0307410_10173312
1486 Ga0307410_11655496
1487 Ga0307406_10164617
1488 Ga0307407_10622514
1489 Ga0307409_100148069
1490 Ga0307409_100393186
1491 Ga0307409_100919695
1492 Ga0307409_101362961
1493 Ga0307416_100034920
1494 Ga0307416_100396002
1495 Ga0307416_102867856
1496 Ga0307415_100013668
1497 Ga0316583_10053639
1498 Ga0316580_10222089
1499 Ga0307507_10000003
1500 Ga0307507_10005929
1501 Ga0307510_10014262
1502 Ga0307510_10063507
1503 Ga0307510_10117282
1504 Ga0373926_0004072
1505 Ga0373928_0018249
1506 Ga0373934_0032900
1507 Ga0373940_0005855
1508 Ga0373944_0010767
1509 Ga0373949_0297326
1510 Ga0373932_0152236
1511 Ga0373936_0004137
1512 Ga0373945_0002459
1513 Ga0373953_0025395
1514 Ga0373954_0035243
1515 Ga0373956_0012630
1516 Ga0373957_0016891
1517 Ga0373943_0002954
1518 Ga0373943_0579975
1519 Ga0373946_0004678
1520 Ga0373955_0067620
1521 Ga0373955_0904011
1522 Ga0373942_0000809
1523 Ga0373942_0020476
1524 Ga0373961_0065306
1525 Ga0373962_0005213
1526 Ga0373924_0456310
1527 Ga0373931_0908129
1528 Ga0373931_0948732
1529 Ga0373935_0028451
1530 Ga0373935_0626336
1531 Ga0373927_0002196
1532 Ga0373927_0876187
1533 Ga0373933_0059700
1534 Ga0373947_0100232
1535 Ga0373937_0042264
1536 Ga0373937_0052232
1537 Ga0316584_0034896
1538 Ga0316584_0513307
1539 Ga0373925_0065040
1540 Ga0373925_0072927
1541 Ga0373925_0139523
1542 Ga0436364_1059460
1543 Ga0436364_1154797
1544 Ga0436364_1482437
1545 Ga0436365_1051614
1546 Ga0436365_1356761
1547 Ga0436365_1525818
1548 Ga0436365_1572675
1549 Ga0436365_1627569
1550 Ga0436360_0681582
1551 Ga0436361_0000693
1552 Ga0436363_1342054
1553 Ga0436363_1584934
1554 Ga0439439_0182728
1555 Ga0439461_0022794
1556 Ga0439461_0064573
1557 Ga0439466_0001192
1558 Ga0439466_0022814
1559 Ga0439466_0084189
1560 Ga0439465_0007669
1561 Ga0439465_0041863
1562 Ga0439465_0229402
1563 Ga0451789_0227657
1564 Ga0451793_1004541
1565 Ga0451793_1395669
1566 Ga0451800_1404359
1567 Ga0451802_0245828
1568 Ga0451802_1608308
1569 Ga0451845_0346134
1570 Ga0451845_0749344
1571 Ga0451843_0827849
1572 Ga0451855_0837164
1573 Ga0451853_2582717
1574 Ga0451853_3508463
1575 Ga0451853_4074114
1576 Ga0439431_0009160
1577 Ga0439442_002613
1578 Ga0439442_162160
1579 Ga0439448_0315163
1580 Ga0439434_0012860
1581 Ga0439434_0021562
1582 Ga0439434_0083438
1583 Ga0439435_0088248
1584 Ga0466969_0044470
1585 Ga0466972_0005873
1586 Ga0466972_0008049
1587 Ga0466972_0009641
1588 Ga0466972_0287281
1589 Ga0466972_0321437
1590 Ga0466965_0002928
1591 Ga0466965_0015530
1592 Ga0466965_0032505
1593 Ga0466965_0312176
1594 Ga0466966_0012148
1595 Ga0466966_0021640
1596 Ga0466961_0002670
1597 Ga0466961_0011244
1598 Ga0466961_0691275
1599 Ga0466963_0033970
1600 Ga0466963_0061065
1601 Ga0466963_0201025
1602 Ga0466963_0231127
1603 Ga0466963_0297242
1604 Ga0466963_1062259
1605 Ga0466963_1122720
1606 Ga0466964_0230287
1607 Ga0466971_0032496
1608 Ga0466971_0039448
1609 Ga0466971_0094361
1610 Ga0466968_0012679
1611 Ga0466968_0015685
1612 Ga0466968_0137904
1613 Ga0466968_0177380
1614 Ga0466968_0335297
1615 Ga0466968_0466896
1616 Ga0466970_0005008
1617 Ga0466970_0040781
1618 Ga0466957_0002976
1619 Ga0466957_0027976
1620 Ga0466957_0059996
1621 Ga0466957_0120472
1622 Ga0466957_0254148
1623 Ga0466957_0639383
1624 Ga0466957_0693276
1625 Ga0466960_0009811
1626 Ga0466960_0019392
1627 Ga0466960_0058461
1628 Ga0466960_0592363
1629 Ga0466959_0027932
1630 Ga0466959_0034597
1631 Ga0466959_0034662
1632 Ga0466959_0042820
1633 Ga0466959_0087549
1634 Ga0466959_0201120
1635 Ga0466958_0007717
1636 Ga0466958_0099227
1637 Ga0466958_0180117
1638 Ga0466958_0377728
1639 Ga0466967_0005746
1640 Ga0466967_0010937
1641 Ga0466967_0021377
1642 Ga0466967_0097303
1643 Ga0466967_0241578
1644 Ga0466967_0788934
1645 Ga0466967_1056024
1646 Ga0466967_1107965
1647 Ga0466967_1124048
1648 Ga0466967_1140412
1649 Ga0466967_1229583
1650 Ga0466967_1294174
1651 Ga0466967_1429522
1652 Ga0466967_1468976
1653 Ga0495617_136624
1654 Ga0495592_0085634
1655 Ga0495592_0394274
1656 Ga0495603_0035080
1657 Ga0495603_0050844
1658 Ga0495629_0008706
1659 Ga0495629_0014814
1660 Ga0495629_0266460
1661 Ga0495638_0007953
1662 Ga0495638_0104391
1663 Ga0495638_0262701
1664 Ga0495641_0070675
1665 Ga0495651_0006616
1666 Ga0495651_0194443
1667 Ga0495653_0053303
1668 Ga0495653_0202799
1669 Ga0495580_0346515
1670 Ga0495580_0522991
1671 Ga0495582_0009515
1672 Ga0495639_0061184
1673 Ga0495639_0118013
1674 Ga0495662_0001407
1675 Ga0495662_0019440
1676 Ga0495662_0321112
1677 Ga0495664_0004018
1678 Ga0495664_0005032
1679 Ga0495585_0386455
1680 Ga0495594_0069148
1681 Ga0495594_0329078
1682 Ga0495606_0007916
1683 Ga0495608_0032570
1684 Ga0495618_0013102
1685 Ga0495618_0036212
1686 Ga0495618_0039029
1687 Ga0495618_0058374
1688 Ga0495628_0043489
1689 Ga0495628_0054052
1690 Ga0495628_0136381
1691 Ga0495630_0011073
1692 Ga0495630_0020585
1693 Ga0495630_0198386
1694 Ga0495632_0173734
1695 Ga0495648_0024211
1696 Ga0495648_0297639
1697 Ga0495652_0024733
1698 Ga0495652_0063118
1699 Ga0495652_0119196
1700 Ga0495652_0160434
1701 Ga0495652_0823183
1702 Ga0495652_0829931
1703 Ga0495654_0170316
1704 Ga0495665_0084879
1705 Ga0495665_0137584
1706 Ga0495640_0023248
1707 Ga0495640_0092582
1708 Ga0495640_0268385
1709 Ga0495640_0326620
1710 Ga0495586_0074120
1711 Ga0495586_0431632
1712 Ga0495587_0003071
1713 Ga0495587_0089819
1714 Ga0495609_0128854
1715 Ga0495645_0003254
1716 Ga0495645_0054441
1717 Ga0495622_0026873
1718 Ga0495622_0420223
1719 Ga0495667_0002799
1720 Ga0495634_0012936
1721 Ga0495634_0092285
1722 Ga0495634_0158941
1723 Ga0495634_0233658
1724 Ga0495634_0523538
1725 Ga0495611_0005901
1726 Ga0495611_0094202
1727 Ga0495611_0268347
1728 Ga0495635_0018217
1729 Ga0495635_0024213
1730 Ga0495635_0025239
1731 Ga0495635_0025943
1732 Ga0495588_0018277
1733 Ga0495588_0406786
1734 Ga0495657_0000085
1735 Ga0495657_0050714
1736 Ga0495599_0017527
1737 Ga0495599_0152412
1738 Ga0495599_0374070
1739 Ga0495623_0057312
1740 Ga0495623_0284139
1741 Ga0495623_0743119
1742 Ga0495646_0001147
1743 Ga0495646_0335889
1744 Ga0495647_0400847
1745 Ga0495647_0497204
1746 Ga0495658_0056632
1747 Ga0495658_0056930
1748 Ga0495613_0000396
1749 Ga0495613_0065685
1750 Ga0495613_0093484
1751 Ga0495624_0003954
1752 Ga0495624_0077397
1753 Ga0495624_0097773
1754 Ga0495671_0150454
1755 Ga0495649_0304937
1756 Ga0495600_0041406
1757 Ga0495600_0132614
1758 Ga0495660_0062889
1759 Ga0495581_0003051
1760 Ga0495581_0068181
1761 Ga0495604_0000250
1762 Ga0495604_0186630
1763 Ga0495636_0141261
1764 Ga0495636_0385103
1765 Ga0495674_0044648
1766 Ga0495674_0045673
1767 Ga0495674_0092092
1768 Ga0495674_0431808
1769 Ga0495674_0498351
1770 Ga0495672_0036303
1771 Ga0495672_0151575
1772 Ga0495676_0010266
1773 Ga0495676_0013790
1774 Ga0495676_0067551
1775 Ga0495680_0005669
1776 Ga0495680_0007071
1777 Ga0495680_0041089
1778 Ga0495683_0020667
1779 Ga0495683_0310857
1780 Ga0495687_001486
1781 Ga0495687_021483
1782 Ga0495687_034246
1783 Ga0495675_0027216
1784 Ga0495675_0087959
1785 Ga0495675_0131673
1786 Ga0495685_004080
1787 Ga0495673_0343707
1788 Ga0495684_0028742
1789 Ga0495684_0128555
1790 Ga0495686_0002803
1791 Ga0495686_0099823
1792 Ga0495593_0000421
1793 Ga0495593_0012599
1794 Ga0495593_0013725
1795 Ga0495593_0095303
1796 Ga0495593_0185370
1797 Ga0495602_0034492
1798 Ga0495602_0133543
1799 Ga0495602_0411248
1800 Ga0495602_0805879
1801 Ga0495614_0001131
1802 Ga0496100_0109149
1803 Ga0496100_0131354
1804 Ga0496100_0428262
1805 Ga0496100_0968408
1806 Ga0496101_0002286
1807 Ga0496101_0146198
1808 Ga0496101_0157950
1809 Ga0496101_0664747
1810 Ga0496101_0930517
1811 Ga0496102_0000268
1812 Ga0496102_0033616
1813 Ga0496102_0055519
1814 Ga0496102_0606039
1815 Ga0496102_0676072
1816 Ga0496103_0001095
1817 Ga0496103_0013476
1818 Ga0496103_0157287
1819 Ga0496103_0879079
1820 Ga0496104_0237623
1821 Ga0496104_0330840
1822 Ga0496104_0521768
1823 Ga0496105_0069901
1824 Ga0496105_0350064
1825 Ga0496105_1111358
1826 Ga0496106_0000556
1827 Ga0496107_0008445
1828 Ga0496107_0686169
1829 Ga0496107_1347578
1830 Ga0496108_0000759
1831 Ga0496108_0005195
1832 Ga0496108_0131325
1833 Ga0496108_0544460
1834 Ga0496109_0012962
1835 Ga0496109_0129167
1836 Ga0496109_0253175
1837 Ga0496109_0253297
1838 Ga0496109_0383428
1839 Ga0496109_0689382
1840 Ga0496110_0027246
1841 Ga0496110_0160318
1842 Ga0496110_0824427
1843 Ga0496110_0896706
1844 Ga0496110_0919106
1845 Ga0496111_0048204
1846 Ga0496111_0851650
1847 Ga0496111_1260259
1848 Ga0496112_0006671
1849 Ga0496112_0082046
1850 Ga0496112_0095914
1851 Ga0496112_0178605
1852 Ga0496112_0341462
1853 Ga0496112_0537847
1854 Ga0496112_0706910
1855 Ga0496112_1424537
1856 Ga0496113_0013352
1857 Ga0496113_0068249
1858 Ga0496113_0081756
1859 Ga0496113_0649141
1860 Ga0496113_0656615
1861 Ga0496114_0001695
1862 Ga0496115_0002918
1863 Ga0496115_0737093
1864 Ga0496115_1142893
1865 Ga0496116_0015809
1866 Ga0496117_0001548
1867 Ga0496118_0000185
1868 Ga0496118_0001284
1869 Ga0496119_0003869
1870 Ga0496120_0013157
1871 Ga0496120_0089996
1872 Ga0496121_0017973
1873 Ga0496121_0270933
1874 Ga0496122_0049449
1875 Ga0496123_0035647
1876 Ga0496124_0009890
1877 Ga0496124_0301833
1878 Ga0496125_0007641
1879 Ga0496125_0158225
1880 Ga0496126_0002221
1881 Ga0496126_0004250
1882 Ga0496126_0010378
1883 Ga0496126_0506030
1884 Ga0496126_0730238
1885 Ga0495678_074925
1886 Ga0501032_0003441
1887 Ga0501032_0004434
1888 Ga0501033_0014667
1889 Ga0501033_0126491
1890 Ga0501033_0138652
1891 Ga0501034_0003163
1892 Ga0501034_0015265
1893 Ga0501034_0061592
1894 Ga0501034_0413224
1895 Ga0501034_0698453
1896 Ga0501036_0027704
1897 Ga0501036_0204183
1898 Ga0501037_0006470
1899 Ga0501037_0016834
1900 Ga0501038_0009880
1901 Ga0501039_0004829
1902 Ga0501043_0009079
1903 Ga0501043_0890373
1904 Ga0501046_0001136
1905 Ga0501047_1162890
1906 Ga0501048_0001774
1907 Ga0501048_0959525
1908 Ga0501067_0364704
1909 Ga0501068_0374924
1910 Ga0501069_0055072
1911 Ga0501069_0493551
1912 Ga0501069_0834972
1913 Ga0501070_0000448
1914 Ga0501070_0000622
1915 Ga0501070_0068563
1916 Ga0501070_0408599
1917 Ga0501073_0050920
1918 Ga0501073_0465899
1919 Ga0501073_0576992
1920 Ga0501080_0067062
1921 Ga0501080_0740245
1922 Ga0501080_1763484
1923 Ga0501035_0000147
1924 Ga0501035_0612853
1925 Ga0501044_0000152
1926 Ga0501044_0001366
1927 Ga0501044_0092672
1928 Ga0501044_0621071
1929 Ga0501044_0847679
1930 nmdc:mga03683_18185_c1
1931 nmdc:mga03n38_10656_c1
1932 nmdc:mga03n38_167724_c1
1933 nmdc:mga03n38_185576_c1
1934 nmdc:mga03n38_18716_c1
1935 nmdc:mga03n38_267829_c1
1936 nmdc:mga03n38_26814_c1
1937 nmdc:mga03n38_4631_c1
1938 nmdc:mga03n38_612016_c1
1939 nmdc:mga00v17_170662_c1
1940 nmdc:mga00v17_22351_c1
1941 nmdc:mga00v17_359917_c1
1942 nmdc:mga00v17_362112_c1
1943 nmdc:mga00v17_3787_c1
1944 nmdc:mga00v17_438051_c1
1945 nmdc:mga00v17_460168_c1
1946 nmdc:mga00v17_64553_c1
1947 nmdc:mga0yw44_1087405_c1
1948 nmdc:mga0yw44_1184878_c1
1949 nmdc:mga0yw44_118587_c1
1950 nmdc:mga0yw44_12193_c1
1951 nmdc:mga0yw44_12999_c1
1952 nmdc:mga0yw44_293431_c1
1953 nmdc:mga0yw44_447565_c1
1954 nmdc:mga0yw44_906705_c1
1955 nmdc:mga0k408_415390_c1
1956 nmdc:mga06z11_155263_c1
1957 nmdc:mga06z11_26161_c1
1958 nmdc:mga06z11_583253_c1
1959 nmdc:mga04h51_128708_c1
1960 nmdc:mga04h51_257603_c1
1961 nmdc:mga07m45_22174_c1
1962 nmdc:mga07m45_44238_c1
1963 nmdc:mga07m45_637573_c1
1964 nmdc:mga07m45_691363_c1
1965 nmdc:mga05p37_11463_c2
1966 nmdc:mga05p37_300674_c1
1967 nmdc:mga05p37_918625_c1
1968 nmdc:mga0qj67_1212111_c1
1969 nmdc:mga06r32_202245_c1
1970 nmdc:mga06r32_570971_c1
1971 nmdc:mga06r32_572715_c1
1972 nmdc:mga08y16_930810_c1
1973 nmdc:mga08x19_607061_c1
1974 nmdc:mga0sz30_133341_c1
1975 nmdc:mga0sz30_22479_c1
1976 nmdc:mga0sz30_229844_c1
1977 nmdc:mga0sz30_2402_c1
1978 nmdc:mga0sz30_296980_c1
1979 nmdc:mga0sz30_5503_c1
1980 Ga0495601_0000403
1981 Ga0495601_0253644
1982 Ga0495601_0649184
1983 Ga0495612_0065483
1984 Ga0500610_0011964
1985 Ga0500635_0001516
1986 Ga0495655_0002859
1987 Ga0495595_0027241
1988 Ga0495595_0159915
1989 Ga0495619_0260714
1990 Ga0495619_0571252
1991 Ga0495619_0694329
1992 Ga0500578_0133012
1993 Ga0500643_002800
1994 Ga0500643_006577
1995 Ga0500644_0036042
1996 Ga0500644_0383165
1997 Ga0500581_252450
1998 Ga0500647_0310302
1999 Ga0500583_0338359
2000 Ga0500651_0029222
2001 Ga0500651_0299557
2002 Ga0500640_002440
2003 Ga0500641_0105099
2004 Ga0500650_0038585
2005 Ga0500553_094023
2006 Ga0500556_0283656
2007 Ga0500558_123149
2008 Ga0500560_036713
2009 Ga0500562_023542
2010 Ga0500572_264550
2011 Ga0500621_250891
2012 Ga0500642_0064921
2013 Ga0500642_0262446
2014 Ga0500652_005687
2015 Ga0500652_024918
2016 Ga0500561_0022595
2017 Ga0500564_201664
2018 Ga0500568_0169053
2019 Ga0500573_0033901
2020 Ga0500573_0206620
2021 Ga0500577_0064992
2022 Ga0500588_0031379
2023 Ga0500600_0073788
2024 Ga0500600_0169379
2025 Ga0500600_0298168
2026 Ga0500616_0083657
2027 Ga0500624_012666
2028 Ga0500627_0004489
2029 Ga0500630_049169
2030 Ga0500633_0123223
2031 Ga0500634_0209487
2032 Ga0500645_000181
2033 Ga0500645_009096
2034 Ga0500552_103418
2035 Ga0466962_0001728
2036 Ga0466962_0002480
2037 Ga0466962_0494149
2038 2517763235
2039 2523382996
2040 2585313811
2041 2616697774
2042 2644511745
2043 2644635950
2044 2671836171
2045 2686539991
2046 2689994279
2047 2738666983
2048 2738707845
2049 2739145827
2050 2739334184
2051 2744955273
2052 2774854327
2053 2895888808
2054 2902802014
2055 2902811968
2056 2929216850
2057 2939588881
2058 2954691561
2059 2954706655
2060 3003006619
2061 8002776605
2062 8002788457

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02310

B12-binding

B12 binding domain

18

135

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r3u-assembly1.cif.gz_C crystal structure of 2-hydroxyisobutyryl-coa mutase 0.9619 1 129
2xiq-assembly1.cif.gz_A crystal structure of human methylmalonyl-coa mutase in complex with adenosylcobalamin and malonyl-coa 0.9608 3 131
8dyl-assembly1.cif.gz_B crystal structure of human methylmalonyl-coa mutase bound to aquocobalamin 0.9595 4 131
2req-assembly2.cif.gz_C methylmalonyl-coa mutase, non-productive coa complex, in open conformation representing substrate-free state 0.9566 3 131
6oxd-assembly1.cif.gz_A structure of mycobacterium tuberculosis methylmalonyl-coa mutase with adenosyl cobalamin 0.9521 4 132
ID Description Score Start End Superfamily
af_A4I2L1_581_723_3.40.50.280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.966 4 129 3.40.50.280
4r3uD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.961 1 128 3.40.50.280
3bicB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9487 4 131 3.40.50.280
4r3uD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9467 1 128 3.40.50.280
af_A4I2L1_581_723_3.40.50.280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9098 4 129 3.40.50.280
ID Description Score Start End GO Terms
AF-A0A132PCM7-F1-model_v4 Methylmalonyl-CoA mutase 0.9955 1 130 GO:0016853
GO:0031419
GO:0046872
AF-A0R1U8-F1-model_v4 Methylmalonyl-CoA mutase C-terminal domain protein 0.9952 1 132 GO:0016853
GO:0031419
GO:0046872
AF-A0A1E7Y6P4-F1-model_v4 deleted 0.9947 1 130
AF-A0A3N1CU38-F1-model_v4 Methylmalonyl-CoA mutase C-terminal domain/subunit 0.9923 1 128 GO:0016853
GO:0031419
GO:0046872
AF-A0A7Y3LNX2-F1-model_v4 Cobalamin B12-binding domain-containing protein 0.9923 1 128 GO:0016853
GO:0031419
GO:0046872

Map