F488578
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1029 | 376 | 1029 | 156 |
Family's Representative Sequence
| Representative Sequence | 3300031901|Ga0307406_10459983|Ga0307406_104599832 |
| Length | 189 |
| Sequence | MNARVQTSASPAIAAPPTTSTGASRKVLTGSNYAEAVAQANYRSGADYVVEFLGYRFGFGARDFEERVTAAAVKLGLVESNELDDDETADLVELAADGRIGDPRSGLGRYLVRHWERVSLVGGESLVYWLRKLVFRGAWLDHRVKEGLLEVAWDEDAADFGYRDPRGDRTLLELAPVPSWHELQFRRSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 111 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 131 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 194 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 196 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 197 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 200 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 202 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 203 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 208 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 209 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 210 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 211 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 215 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 217 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 220 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 224 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 226 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 227 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 228 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 229 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 230 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 231 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 232 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 233 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 234 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 235 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 236 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 241 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 242 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 243 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 244 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 245 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 246 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 247 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 248 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 249 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 250 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 251 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 252 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 253 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 254 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 255 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 256 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 257 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 258 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 259 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 260 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 261 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 262 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 263 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 317 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 318 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 319 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 320 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 321 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 324 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 325 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 326 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 327 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 328 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 329 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 376 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.32 |
| Metatranscriptomes | 0.68 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.19 |
| Nodule | 0 |
| Rhizoplane | 11.08 |
| Rhizosphere | 88.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10033953 | 3300001991 | Bacteria | 1011 |
| 2 | JGI24738J21930_10016802 | 3300002075 | Bacteria | 1542 |
| 3 | JGI24751J29686_10029864 | 3300002459 | Bacteria | 1131 |
| 4 | JGI25406J46586_10082873 | 3300003203 | Bacteria | 980 |
| 5 | Ga0070658_10091921 | 3300005327 | Bacteria | 2501 |
| 6 | Ga0070658_10160868 | 3300005327 | Bacteria | 1883 |
| 7 | Ga0070683_100003039 | 3300005329 | Bacteria | 13484 |
| 8 | Ga0070683_100238961 | 3300005329 | Bacteria | 1728 |
| 9 | Ga0070683_100594897 | 3300005329 | Bacteria | 1058 |
| 10 | Ga0070683_100771131 | 3300005329 | Bacteria | 921 |
| 11 | Ga0070690_100107022 | 3300005330 | Bacteria | 1861 |
| 12 | Ga0070670_100073980 | 3300005331 | Bacteria | 2926 |
| 13 | Ga0070677_10218021 | 3300005333 | Bacteria | 930 |
| 14 | Ga0068869_100173843 | 3300005334 | Bacteria | 1684 |
| 15 | Ga0068869_100186930 | 3300005334 | Bacteria | 1627 |
| 16 | Ga0070680_100086399 | 3300005336 | Bacteria | 2593 |
| 17 | Ga0070680_100420930 | 3300005336 | Bacteria | 1139 |
| 18 | Ga0070682_100004862 | 3300005337 | Bacteria | 7456 |
| 19 | Ga0070682_100076428 | 3300005337 | Bacteria | 2156 |
| 20 | Ga0070682_100095037 | 3300005337 | Bacteria | 1956 |
| 21 | Ga0070682_100332499 | 3300005337 | Bacteria | 1126 |
| 22 | Ga0068868_100078672 | 3300005338 | Bacteria | 2640 |
| 23 | Ga0068868_100090388 | 3300005338 | Unclassified | 2466 |
| 24 | Ga0068868_100147361 | 3300005338 | Bacteria | 1936 |
| 25 | Ga0068868_100426691 | 3300005338 | Unclassified | 1149 |
| 26 | Ga0070660_100011258 | 3300005339 | Bacteria | 6349 |
| 27 | Ga0070660_100067598 | 3300005339 | Bacteria | 2784 |
| 28 | Ga0070660_100220390 | 3300005339 | Unclassified | 1542 |
| 29 | Ga0070689_100007910 | 3300005340 | Bacteria | 7459 |
| 30 | Ga0070691_10021455 | 3300005341 | Bacteria | 2988 |
| 31 | Ga0070691_10150460 | 3300005341 | Unclassified | 1193 |
| 32 | Ga0070687_100367879 | 3300005343 | Bacteria | 933 |
| 33 | Ga0070661_100018221 | 3300005344 | Bacteria | 4989 |
| 34 | Ga0070692_10028248 | 3300005345 | Bacteria | 2787 |
| 35 | Ga0070692_10076474 | 3300005345 | Unclassified | 1794 |
| 36 | Ga0070692_10394693 | 3300005345 | Unclassified | 872 |
| 37 | Ga0070668_100236833 | 3300005347 | Bacteria | 1511 |
| 38 | Ga0070669_100399130 | 3300005353 | Bacteria | 1125 |
| 39 | Ga0070669_100935013 | 3300005353 | Bacteria | 742 |
| 40 | Ga0070675_100035405 | 3300005354 | Bacteria | 4056 |
| 41 | Ga0070675_100135730 | 3300005354 | Bacteria | 2100 |
| 42 | Ga0070671_100024898 | 3300005355 | Bacteria | 4903 |
| 43 | Ga0070671_100032475 | 3300005355 | Bacteria | 4315 |
| 44 | Ga0070674_100027096 | 3300005356 | Bacteria | 3752 |
| 45 | Ga0070674_100168144 | 3300005356 | Bacteria | 1669 |
| 46 | Ga0070674_100420967 | 3300005356 | Bacteria | 1096 |
| 47 | Ga0070673_100018556 | 3300005364 | Bacteria | 4972 |
| 48 | Ga0070673_100285605 | 3300005364 | Bacteria | 1448 |
| 49 | Ga0070673_100413504 | 3300005364 | Bacteria | 1208 |
| 50 | Ga0070688_100008089 | 3300005365 | Bacteria | 5695 |
| 51 | Ga0070688_101117541 | 3300005365 | Bacteria | 630 |
| 52 | Ga0070659_100034064 | 3300005366 | Bacteria | 3960 |
| 53 | Ga0070659_100075498 | 3300005366 | Bacteria | 2686 |
| 54 | Ga0070659_100078257 | 3300005366 | Unclassified | 2638 |
| 55 | Ga0070659_100132956 | 3300005366 | Bacteria | 2021 |
| 56 | Ga0070659_101004060 | 3300005366 | Bacteria | 733 |
| 57 | Ga0070667_100097501 | 3300005367 | Unclassified | 2536 |
| 58 | Ga0070667_100493864 | 3300005367 | Bacteria | 1121 |
| 59 | Ga0070703_10015426 | 3300005406 | Bacteria | 2186 |
| 60 | Ga0070709_10033600 | 3300005434 | Unclassified | 3103 |
| 61 | Ga0070709_10231665 | 3300005434 | Unclassified | 1322 |
| 62 | Ga0070709_10313801 | 3300005434 | Bacteria | 1149 |
| 63 | Ga0070714_100041880 | 3300005435 | Bacteria | 3867 |
| 64 | Ga0070714_100055569 | 3300005435 | Bacteria | 3384 |
| 65 | Ga0070714_100155133 | 3300005435 | Bacteria | 2066 |
| 66 | Ga0070714_100300780 | 3300005435 | Unclassified | 1495 |
| 67 | Ga0070714_100350685 | 3300005435 | Bacteria | 1386 |
| 68 | Ga0070714_101019294 | 3300005435 | Unclassified | 806 |
| 69 | Ga0070714_101412513 | 3300005435 | Bacteria | 680 |
| 70 | Ga0070713_100039071 | 3300005436 | Bacteria | 3849 |
| 71 | Ga0070713_100088719 | 3300005436 | Bacteria | 2655 |
| 72 | Ga0070713_100392050 | 3300005436 | Bacteria | 1295 |
| 73 | Ga0070713_100729979 | 3300005436 | Unclassified | 947 |
| 74 | Ga0070710_10016281 | 3300005437 | Bacteria | 3780 |
| 75 | Ga0070710_10447774 | 3300005437 | Unclassified | 875 |
| 76 | Ga0070701_10015957 | 3300005438 | Bacteria | 3481 |
| 77 | Ga0070701_10066150 | 3300005438 | Unclassified | 1920 |
| 78 | Ga0070711_100008896 | 3300005439 | Bacteria | 6162 |
| 79 | Ga0070711_100061027 | 3300005439 | Unclassified | 2623 |
| 80 | Ga0070711_100133651 | 3300005439 | Bacteria | 1851 |
| 81 | Ga0070711_100295805 | 3300005439 | Bacteria | 1286 |
| 82 | Ga0070705_100121785 | 3300005440 | Bacteria | 1685 |
| 83 | Ga0070705_100164040 | 3300005440 | Bacteria | 1488 |
| 84 | Ga0070700_100005657 | 3300005441 | Bacteria | 6632 |
| 85 | Ga0070700_100039344 | 3300005441 | Bacteria | 2888 |
| 86 | Ga0070700_100276115 | 3300005441 | Bacteria | 1216 |
| 87 | Ga0070700_100462838 | 3300005441 | Bacteria | 967 |
| 88 | Ga0070694_100010427 | 3300005444 | Bacteria | 5734 |
| 89 | Ga0070694_100439867 | 3300005444 | Bacteria | 1028 |
| 90 | Ga0070708_100035231 | 3300005445 | Bacteria | 4359 |
| 91 | Ga0070708_100099088 | 3300005445 | Bacteria | 2666 |
| 92 | Ga0070708_100127815 | 3300005445 | Bacteria | 2350 |
| 93 | Ga0070708_100671681 | 3300005445 | Bacteria | 976 |
| 94 | Ga0070663_100028601 | 3300005455 | Bacteria | 3797 |
| 95 | Ga0070663_100170142 | 3300005455 | Bacteria | 1683 |
| 96 | Ga0070663_100911941 | 3300005455 | Unclassified | 760 |
| 97 | Ga0070678_100143734 | 3300005456 | Bacteria | 1912 |
| 98 | Ga0070678_100542388 | 3300005456 | Unclassified | 1031 |
| 99 | Ga0070678_100959910 | 3300005456 | Unclassified | 784 |
| 100 | Ga0070662_100261437 | 3300005457 | Bacteria | 1394 |
| 101 | Ga0070662_100363614 | 3300005457 | Bacteria | 1188 |
| 102 | Ga0070662_100797923 | 3300005457 | Unclassified | 802 |
| 103 | Ga0070662_100813402 | 3300005457 | Unclassified | 795 |
| 104 | Ga0070681_10026696 | 3300005458 | Bacteria | 5805 |
| 105 | Ga0070681_10054579 | 3300005458 | Bacteria | 3982 |
| 106 | Ga0070681_10112138 | 3300005458 | Bacteria | 2667 |
| 107 | Ga0070681_10312857 | 3300005458 | Unclassified | 1480 |
| 108 | Ga0068867_100116194 | 3300005459 | Bacteria | 2061 |
| 109 | Ga0068867_100269851 | 3300005459 | Bacteria | 1390 |
| 110 | Ga0070685_10038333 | 3300005466 | Unclassified | 2717 |
| 111 | Ga0070706_100079146 | 3300005467 | Unclassified | 3042 |
| 112 | Ga0070706_100373835 | 3300005467 | Bacteria | 1328 |
| 113 | Ga0070707_100000419 | 3300005468 | Bacteria | 41972 |
| 114 | Ga0070707_100001607 | 3300005468 | Bacteria | 21878 |
| 115 | Ga0070707_100003988 | 3300005468 | Bacteria | 13898 |
| 116 | Ga0070707_100236109 | 3300005468 | Unclassified | 1780 |
| 117 | Ga0070707_100360090 | 3300005468 | Bacteria | 1413 |
| 118 | Ga0070707_100735109 | 3300005468 | Unclassified | 950 |
| 119 | Ga0070698_100045939 | 3300005471 | Bacteria | 4467 |
| 120 | Ga0070698_100052057 | 3300005471 | Bacteria | 4168 |
| 121 | Ga0070698_100114603 | 3300005471 | Bacteria | 2660 |
| 122 | Ga0070698_100192052 | 3300005471 | Bacteria | 1979 |
| 123 | Ga0070698_100193050 | 3300005471 | Bacteria | 1973 |
| 124 | Ga0070698_101142715 | 3300005471 | Unclassified | 728 |
| 125 | Ga0070699_100181543 | 3300005518 | Bacteria | 1867 |
| 126 | Ga0070699_100372920 | 3300005518 | Bacteria | 1288 |
| 127 | Ga0070699_100850918 | 3300005518 | Bacteria | 835 |
| 128 | Ga0070699_101042966 | 3300005518 | Unclassified | 750 |
| 129 | Ga0070699_101515277 | 3300005518 | Unclassified | 615 |
| 130 | Ga0070679_100041373 | 3300005530 | Bacteria | 4587 |
| 131 | Ga0070679_100120417 | 3300005530 | Bacteria | 2609 |
| 132 | Ga0070679_100162589 | 3300005530 | Bacteria | 2207 |
| 133 | Ga0070679_100674825 | 3300005530 | Bacteria | 976 |
| 134 | Ga0070679_100794012 | 3300005530 | Bacteria | 890 |
| 135 | Ga0070684_100037440 | 3300005535 | Bacteria | 4161 |
| 136 | Ga0070684_100049801 | 3300005535 | Bacteria | 3637 |
| 137 | Ga0070684_100124416 | 3300005535 | Bacteria | 2322 |
| 138 | Ga0070684_100435850 | 3300005535 | Bacteria | 1210 |
| 139 | Ga0070697_100105658 | 3300005536 | Bacteria | 2342 |
| 140 | Ga0070697_100679420 | 3300005536 | Unclassified | 908 |
| 141 | Ga0068853_100012336 | 3300005539 | Bacteria | 6954 |
| 142 | Ga0068853_100034262 | 3300005539 | Bacteria | 4310 |
| 143 | Ga0070672_100016613 | 3300005543 | Bacteria | 5274 |
| 144 | Ga0070672_100033472 | 3300005543 | Bacteria | 3893 |
| 145 | Ga0070672_100059769 | 3300005543 | Bacteria | 2999 |
| 146 | Ga0070686_100007592 | 3300005544 | Bacteria | 6057 |
| 147 | Ga0070686_100464423 | 3300005544 | Bacteria | 976 |
| 148 | Ga0070686_101019007 | 3300005544 | Bacteria | 680 |
| 149 | Ga0070695_100015857 | 3300005545 | Bacteria | 4553 |
| 150 | Ga0070696_100114749 | 3300005546 | Bacteria | 1943 |
| 151 | Ga0070696_100307116 | 3300005546 | Bacteria | 1217 |
| 152 | Ga0070693_100139884 | 3300005547 | Bacteria | 1522 |
| 153 | Ga0070665_100090983 | 3300005548 | Unclassified | 3056 |
| 154 | Ga0070665_100202007 | 3300005548 | Bacteria | 1988 |
| 155 | Ga0070665_100870218 | 3300005548 | Unclassified | 914 |
| 156 | Ga0070704_100034442 | 3300005549 | Bacteria | 3434 |
| 157 | Ga0068855_100066978 | 3300005563 | Bacteria | 4186 |
| 158 | Ga0068855_100151728 | 3300005563 | Bacteria | 2634 |
| 159 | Ga0068855_100182643 | 3300005563 | Bacteria | 2371 |
| 160 | Ga0068855_100244501 | 3300005563 | Unclassified | 2004 |
| 161 | Ga0068855_100727697 | 3300005563 | Bacteria | 1060 |
| 162 | Ga0070664_100089152 | 3300005564 | Bacteria | 2668 |
| 163 | Ga0070664_100109175 | 3300005564 | Bacteria | 2413 |
| 164 | Ga0070664_100520854 | 3300005564 | Bacteria | 1097 |
| 165 | Ga0068857_100121899 | 3300005577 | Unclassified | 2348 |
| 166 | Ga0068857_100155027 | 3300005577 | Bacteria | 2077 |
| 167 | Ga0068854_100025571 | 3300005578 | Bacteria | 4052 |
| 168 | Ga0068854_100073533 | 3300005578 | Bacteria | 2505 |
| 169 | Ga0068854_101034569 | 3300005578 | Bacteria | 729 |
| 170 | Ga0068856_100035377 | 3300005614 | Bacteria | 4894 |
| 171 | Ga0068856_100204018 | 3300005614 | Unclassified | 1992 |
| 172 | Ga0068856_100341942 | 3300005614 | Unclassified | 1514 |
| 173 | Ga0068856_100431644 | 3300005614 | Unclassified | 1338 |
| 174 | Ga0068852_100022989 | 3300005616 | Bacteria | 5010 |
| 175 | Ga0068852_100031104 | 3300005616 | Bacteria | 4400 |
| 176 | Ga0068852_100267557 | 3300005616 | Bacteria | 1644 |
| 177 | Ga0068859_100266234 | 3300005617 | Unclassified | 1806 |
| 178 | Ga0068864_100130691 | 3300005618 | Unclassified | 2255 |
| 179 | Ga0068864_100259900 | 3300005618 | Unclassified | 1615 |
| 180 | Ga0068866_10003027 | 3300005718 | Bacteria | 6938 |
| 181 | Ga0068866_10494740 | 3300005718 | Bacteria | 808 |
| 182 | Ga0068851_10808382 | 3300005834 | Unclassified | 583 |
| 183 | Ga0068870_10232310 | 3300005840 | Bacteria | 1134 |
| 184 | Ga0068870_10481742 | 3300005840 | Unclassified | 823 |
| 185 | Ga0068863_100081637 | 3300005841 | Bacteria | 3062 |
| 186 | Ga0068863_100152411 | 3300005841 | Bacteria | 2212 |
| 187 | Ga0068863_100272785 | 3300005841 | Bacteria | 1638 |
| 188 | Ga0068858_100280118 | 3300005842 | Bacteria | 1588 |
| 189 | Ga0068860_100074245 | 3300005843 | Bacteria | 3233 |
| 190 | Ga0068860_100188377 | 3300005843 | Bacteria | 1996 |
| 191 | Ga0068860_101349398 | 3300005843 | Bacteria | 734 |
| 192 | Ga0068862_101099954 | 3300005844 | Bacteria | 790 |
| 193 | Ga0081455_10078009 | 3300005937 | Bacteria | 2723 |
| 194 | Ga0081538_10079840 | 3300005981 | Bacteria | 1748 |
| 195 | Ga0081539_10002469 | 3300005985 | Bacteria | 26025 |
| 196 | Ga0081539_10026936 | 3300005985 | Bacteria | 3653 |
| 197 | Ga0081539_10055432 | 3300005985 | Bacteria | 2205 |
| 198 | Ga0070717_10010680 | 3300006028 | Bacteria | 6943 |
| 199 | Ga0070717_10019680 | 3300006028 | Bacteria | 5298 |
| 200 | Ga0070717_10029685 | 3300006028 | Bacteria | 4390 |
| 201 | Ga0070717_10186870 | 3300006028 | Bacteria | 1809 |
| 202 | Ga0070717_10383940 | 3300006028 | Bacteria | 1260 |
| 203 | Ga0070717_10619643 | 3300006028 | Bacteria | 982 |
| 204 | Ga0075432_10015184 | 3300006058 | Unclassified | 2626 |
| 205 | Ga0070716_100064676 | 3300006173 | Bacteria | 2128 |
| 206 | Ga0070716_100254273 | 3300006173 | Unclassified | 1199 |
| 207 | Ga0070716_100408304 | 3300006173 | Unclassified | 979 |
| 208 | Ga0070716_101050683 | 3300006173 | Bacteria | 647 |
| 209 | Ga0070712_100040223 | 3300006175 | Bacteria | 3204 |
| 210 | Ga0070712_100041602 | 3300006175 | Bacteria | 3156 |
| 211 | Ga0070712_100115633 | 3300006175 | Unclassified | 2010 |
| 212 | Ga0070712_100218667 | 3300006175 | Bacteria | 1507 |
| 213 | Ga0070712_100501332 | 3300006175 | Bacteria | 1018 |
| 214 | Ga0075367_10161378 | 3300006178 | Bacteria | 1394 |
| 215 | Ga0097621_100005668 | 3300006237 | Bacteria | 8813 |
| 216 | Ga0097621_100021679 | 3300006237 | Bacteria | 4975 |
| 217 | Ga0075370_10386093 | 3300006353 | Bacteria | 839 |
| 218 | Ga0068871_100040618 | 3300006358 | Bacteria | 3727 |
| 219 | Ga0068871_100380635 | 3300006358 | Bacteria | 1253 |
| 220 | Ga0075428_100388149 | 3300006844 | Bacteria | 1497 |
| 221 | Ga0075430_100003551 | 3300006846 | Bacteria | 13059 |
| 222 | Ga0075431_100056106 | 3300006847 | Bacteria | 4063 |
| 223 | Ga0075431_100065229 | 3300006847 | Bacteria | 3760 |
| 224 | Ga0075433_10003167 | 3300006852 | Bacteria | 12677 |
| 225 | Ga0075433_10032871 | 3300006852 | Bacteria | 4445 |
| 226 | Ga0075433_10255570 | 3300006852 | Bacteria | 1554 |
| 227 | Ga0075433_10270432 | 3300006852 | Bacteria | 1506 |
| 228 | Ga0075434_100003532 | 3300006871 | Bacteria | 13958 |
| 229 | Ga0075434_100013149 | 3300006871 | Bacteria | 7862 |
| 230 | Ga0075434_100022158 | 3300006871 | Bacteria | 6187 |
| 231 | Ga0075434_100027641 | 3300006871 | Bacteria | 5571 |
| 232 | Ga0075434_100089619 | 3300006871 | Bacteria | 3077 |
| 233 | Ga0075434_100095449 | 3300006871 | Bacteria | 2979 |
| 234 | Ga0075434_100439384 | 3300006871 | Bacteria | 1326 |
| 235 | Ga0075429_100177152 | 3300006880 | Unclassified | 1868 |
| 236 | Ga0075429_100283676 | 3300006880 | Bacteria | 1450 |
| 237 | Ga0068865_100002392 | 3300006881 | Bacteria | 11065 |
| 238 | Ga0068865_100073604 | 3300006881 | Bacteria | 2430 |
| 239 | Ga0068865_100226748 | 3300006881 | Unclassified | 1463 |
| 240 | Ga0068865_100422365 | 3300006881 | Bacteria | 1096 |
| 241 | Ga0068865_100647113 | 3300006881 | Bacteria | 898 |
| 242 | Ga0068865_101687097 | 3300006881 | Bacteria | 571 |
| 243 | Ga0075436_100026821 | 3300006914 | Bacteria | 3966 |
| 244 | Ga0075436_100148767 | 3300006914 | Bacteria | 1647 |
| 245 | Ga0075436_100338492 | 3300006914 | Unclassified | 1083 |
| 246 | Ga0075436_100495690 | 3300006914 | Unclassified | 893 |
| 247 | Ga0075436_101021753 | 3300006914 | Bacteria | 621 |
| 248 | Ga0097620_100266227 | 3300006931 | Unclassified | 1806 |
| 249 | Ga0075435_100011506 | 3300007076 | Bacteria | 6515 |
| 250 | Ga0075435_100050093 | 3300007076 | Bacteria | 3360 |
| 251 | Ga0075435_100103392 | 3300007076 | Bacteria | 2363 |
| 252 | Ga0075435_100174150 | 3300007076 | Unclassified | 1816 |
| 253 | Ga0105240_10018876 | 3300009093 | Bacteria | 9232 |
| 254 | Ga0105240_10206915 | 3300009093 | Bacteria | 2296 |
| 255 | Ga0105240_10355716 | 3300009093 | Bacteria | 1660 |
| 256 | Ga0111539_10014355 | 3300009094 | Bacteria | 9889 |
| 257 | Ga0111539_10054002 | 3300009094 | Bacteria | 4782 |
| 258 | Ga0111539_10086472 | 3300009094 | Bacteria | 3684 |
| 259 | Ga0111539_10459599 | 3300009094 | Bacteria | 1483 |
| 260 | Ga0111539_10523362 | 3300009094 | Bacteria | 1382 |
| 261 | Ga0111539_10821363 | 3300009094 | Unclassified | 1082 |
| 262 | Ga0111539_12519810 | 3300009094 | Bacteria | 596 |
| 263 | Ga0105245_10033732 | 3300009098 | Bacteria | 4537 |
| 264 | Ga0105245_10116058 | 3300009098 | Unclassified | 2496 |
| 265 | Ga0105245_10184692 | 3300009098 | Bacteria | 1994 |
| 266 | Ga0105245_10214751 | 3300009098 | Bacteria | 1853 |
| 267 | Ga0105245_10288822 | 3300009098 | Bacteria | 1606 |
| 268 | Ga0105245_10304859 | 3300009098 | Bacteria | 1564 |
| 269 | Ga0105245_10315925 | 3300009098 | Bacteria | 1537 |
| 270 | Ga0105245_10409629 | 3300009098 | Bacteria | 1357 |
| 271 | Ga0114129_10002076 | 3300009147 | Bacteria | 27550 |
| 272 | Ga0114129_10046212 | 3300009147 | Bacteria | 6120 |
| 273 | Ga0114129_10047402 | 3300009147 | Bacteria | 6038 |
| 274 | Ga0114129_10588614 | 3300009147 | Unclassified | 1443 |
| 275 | Ga0114129_10682440 | 3300009147 | Unclassified | 1322 |
| 276 | Ga0114129_10794502 | 3300009147 | Bacteria | 1208 |
| 277 | Ga0114129_12249354 | 3300009147 | Bacteria | 655 |
| 278 | Ga0105243_10006669 | 3300009148 | Bacteria | 8915 |
| 279 | Ga0105243_10033294 | 3300009148 | Bacteria | 3985 |
| 280 | Ga0105243_10189386 | 3300009148 | Bacteria | 1796 |
| 281 | Ga0105243_10855031 | 3300009148 | Unclassified | 901 |
| 282 | Ga0105243_11106201 | 3300009148 | Unclassified | 801 |
| 283 | Ga0105241_10062546 | 3300009174 | Unclassified | 2870 |
| 284 | Ga0105241_10068970 | 3300009174 | Bacteria | 2741 |
| 285 | Ga0105242_10003093 | 3300009176 | Bacteria | 12989 |
| 286 | Ga0105242_10040521 | 3300009176 | Bacteria | 3753 |
| 287 | Ga0105242_10233078 | 3300009176 | Bacteria | 1651 |
| 288 | Ga0105242_12301201 | 3300009176 | Bacteria | 585 |
| 289 | Ga0105248_10026898 | 3300009177 | Bacteria | 6398 |
| 290 | Ga0105248_10088812 | 3300009177 | Bacteria | 3479 |
| 291 | Ga0105248_11844089 | 3300009177 | Bacteria | 686 |
| 292 | Ga0105237_10017342 | 3300009545 | Bacteria | 7465 |
| 293 | Ga0105237_10033527 | 3300009545 | Bacteria | 5203 |
| 294 | Ga0105238_10054416 | 3300009551 | Bacteria | 4018 |
| 295 | Ga0105238_10071537 | 3300009551 | Bacteria | 3466 |
| 296 | Ga0105238_10118699 | 3300009551 | Bacteria | 2625 |
| 297 | Ga0105238_10255943 | 3300009551 | Bacteria | 1730 |
| 298 | Ga0105249_10001129 | 3300009553 | Bacteria | 23688 |
| 299 | Ga0105249_11876665 | 3300009553 | Unclassified | 672 |
| 300 | Ga0105239_10035534 | 3300010375 | Bacteria | 5472 |
| 301 | Ga0105239_10114040 | 3300010375 | Unclassified | 2997 |
| 302 | Ga0105239_10910247 | 3300010375 | Bacteria | 1010 |
| 303 | Ga0105246_10082381 | 3300011119 | Bacteria | 2296 |
| 304 | Ga0105246_10291556 | 3300011119 | Bacteria | 1313 |
| 305 | Ga0105246_10334365 | 3300011119 | Unclassified | 1236 |
| 306 | Ga0157347_1014097 | 3300012502 | Bacteria | 879 |
| 307 | Ga0157316_1026975 | 3300012510 | Bacteria | 671 |
| 308 | Ga0157371_10048863 | 3300013102 | Unclassified | 3007 |
| 309 | Ga0157371_10150922 | 3300013102 | Unclassified | 1657 |
| 310 | Ga0157370_10367683 | 3300013104 | Bacteria | 1325 |
| 311 | Ga0157370_10825476 | 3300013104 | Bacteria | 843 |
| 312 | Ga0157369_10038160 | 3300013105 | Bacteria | 5254 |
| 313 | Ga0157369_10665272 | 3300013105 | Unclassified | 1073 |
| 314 | Ga0157374_10035553 | 3300013296 | Bacteria | 4558 |
| 315 | Ga0157374_10271973 | 3300013296 | Bacteria | 1671 |
| 316 | Ga0157374_10275441 | 3300013296 | Unclassified | 1660 |
| 317 | Ga0157374_11103443 | 3300013296 | Bacteria | 814 |
| 318 | Ga0157378_10311335 | 3300013297 | Bacteria | 1527 |
| 319 | Ga0157378_10741838 | 3300013297 | Bacteria | 1004 |
| 320 | Ga0163162_10006515 | 3300013306 | Bacteria | 11310 |
| 321 | Ga0163162_10254301 | 3300013306 | Unclassified | 1889 |
| 322 | Ga0157372_10040194 | 3300013307 | Bacteria | 5165 |
| 323 | Ga0157372_10126490 | 3300013307 | Bacteria | 2938 |
| 324 | Ga0157372_10163377 | 3300013307 | Bacteria | 2574 |
| 325 | Ga0157372_10373262 | 3300013307 | Bacteria | 1662 |
| 326 | Ga0157372_11485226 | 3300013307 | Bacteria | 781 |
| 327 | Ga0157375_10104469 | 3300013308 | Unclassified | 2921 |
| 328 | Ga0157375_10387811 | 3300013308 | Bacteria | 1564 |
| 329 | Ga0163163_11279269 | 3300014325 | Bacteria | 796 |
| 330 | Ga0163163_12136958 | 3300014325 | Unclassified | 619 |
| 331 | Ga0157380_10150608 | 3300014326 | Bacteria | 2010 |
| 332 | Ga0157380_10423646 | 3300014326 | Bacteria | 1270 |
| 333 | Ga0157380_10645474 | 3300014326 | Bacteria | 1055 |
| 334 | Ga0157377_10009433 | 3300014745 | Bacteria | 4788 |
| 335 | Ga0157377_10023413 | 3300014745 | Bacteria | 3272 |
| 336 | Ga0157377_10070806 | 3300014745 | Bacteria | 2015 |
| 337 | Ga0157377_10175965 | 3300014745 | Bacteria | 1342 |
| 338 | Ga0157379_10250686 | 3300014968 | Bacteria | 1607 |
| 339 | Ga0157379_10442200 | 3300014968 | Bacteria | 1199 |
| 340 | Ga0157379_11251788 | 3300014968 | Unclassified | 715 |
| 341 | Ga0157376_10007904 | 3300014969 | Bacteria | 7630 |
| 342 | Ga0157376_10037609 | 3300014969 | Bacteria | 3931 |
| 343 | Ga0157376_10264839 | 3300014969 | Bacteria | 1612 |
| 344 | Ga0157376_11085808 | 3300014969 | Bacteria | 826 |
| 345 | Ga0182007_10053513 | 3300015262 | Bacteria | 1329 |
| 346 | Ga0163161_10083494 | 3300017792 | Bacteria | 2354 |
| 347 | Ga0206356_10262733 | 3300020070 | Bacteria | 1909 |
| 348 | Ga0206356_10787478 | 3300020070 | Bacteria | 3674 |
| 349 | Ga0206356_11730020 | 3300020070 | Bacteria | 809 |
| 350 | Ga0206354_10520745 | 3300020081 | Bacteria | 2283 |
| 351 | Ga0206354_10569858 | 3300020081 | Bacteria | 1173 |
| 352 | Ga0206354_11504563 | 3300020081 | Bacteria | 605 |
| 353 | Ga0206353_11087294 | 3300020082 | Bacteria | 1159 |
| 354 | Ga0213871_10007472 | 3300021441 | Bacteria | 2366 |
| 355 | Ga0207656_10010697 | 3300025321 | Bacteria | 3445 |
| 356 | Ga0207653_10004869 | 3300025885 | Bacteria | 4193 |
| 357 | Ga0207682_10288945 | 3300025893 | Unclassified | 767 |
| 358 | Ga0207692_10038360 | 3300025898 | Bacteria | 2349 |
| 359 | Ga0207642_10038947 | 3300025899 | Bacteria | 2061 |
| 360 | Ga0207710_10265134 | 3300025900 | Bacteria | 862 |
| 361 | Ga0207688_10079267 | 3300025901 | Bacteria | 1873 |
| 362 | Ga0207688_10089230 | 3300025901 | Bacteria | 1769 |
| 363 | Ga0207647_10349624 | 3300025904 | Bacteria | 837 |
| 364 | Ga0207685_10027301 | 3300025905 | Bacteria | 1996 |
| 365 | Ga0207685_10077729 | 3300025905 | Unclassified | 1364 |
| 366 | Ga0207699_10013206 | 3300025906 | Bacteria | 4220 |
| 367 | Ga0207699_10035692 | 3300025906 | Bacteria | 2830 |
| 368 | Ga0207699_10040944 | 3300025906 | Bacteria | 2672 |
| 369 | Ga0207699_10065567 | 3300025906 | Bacteria | 2202 |
| 370 | Ga0207699_10679624 | 3300025906 | Unclassified | 753 |
| 371 | Ga0207643_10215433 | 3300025908 | Bacteria | 1173 |
| 372 | Ga0207705_10030691 | 3300025909 | Bacteria | 3835 |
| 373 | Ga0207705_10385289 | 3300025909 | Bacteria | 1083 |
| 374 | Ga0207707_10047170 | 3300025912 | Bacteria | 3752 |
| 375 | Ga0207707_10169485 | 3300025912 | Bacteria | 1908 |
| 376 | Ga0207707_10438598 | 3300025912 | Bacteria | 1118 |
| 377 | Ga0207707_10522633 | 3300025912 | Bacteria | 1010 |
| 378 | Ga0207695_10152810 | 3300025913 | Bacteria | 2246 |
| 379 | Ga0207693_10011542 | 3300025915 | Bacteria | 7144 |
| 380 | Ga0207693_10012563 | 3300025915 | Bacteria | 6840 |
| 381 | Ga0207693_10829848 | 3300025915 | Bacteria | 712 |
| 382 | Ga0207663_10420265 | 3300025916 | Bacteria | 1026 |
| 383 | Ga0207663_10449672 | 3300025916 | Bacteria | 993 |
| 384 | Ga0207660_10142593 | 3300025917 | Bacteria | 1833 |
| 385 | Ga0207662_10036570 | 3300025918 | Bacteria | 2870 |
| 386 | Ga0207657_10007057 | 3300025919 | Bacteria | 11541 |
| 387 | Ga0207657_10020965 | 3300025919 | Bacteria | 6164 |
| 388 | Ga0207657_10235007 | 3300025919 | Archaea | 1465 |
| 389 | Ga0207649_10086997 | 3300025920 | Bacteria | 2038 |
| 390 | Ga0207649_10550527 | 3300025920 | Bacteria | 883 |
| 391 | Ga0207652_10022340 | 3300025921 | Bacteria | 5233 |
| 392 | Ga0207652_10780469 | 3300025921 | Bacteria | 849 |
| 393 | Ga0207652_10815415 | 3300025921 | Bacteria | 828 |
| 394 | Ga0207646_10003186 | 3300025922 | Bacteria | 18746 |
| 395 | Ga0207646_10054237 | 3300025922 | Bacteria | 3586 |
| 396 | Ga0207646_10226230 | 3300025922 | Bacteria | 1690 |
| 397 | Ga0207646_10774641 | 3300025922 | Bacteria | 855 |
| 398 | Ga0207681_10187838 | 3300025923 | Bacteria | 1579 |
| 399 | Ga0207694_10150732 | 3300025924 | Bacteria | 1873 |
| 400 | Ga0207694_10311660 | 3300025924 | Unclassified | 1297 |
| 401 | Ga0207650_10481011 | 3300025925 | Bacteria | 1036 |
| 402 | Ga0207659_10014776 | 3300025926 | Bacteria | 5045 |
| 403 | Ga0207659_10419313 | 3300025926 | Bacteria | 1122 |
| 404 | Ga0207687_10115735 | 3300025927 | Bacteria | 1998 |
| 405 | Ga0207687_10607600 | 3300025927 | Unclassified | 922 |
| 406 | Ga0207700_10000002 | 3300025928 | Bacteria | 775978 |
| 407 | Ga0207700_10245302 | 3300025928 | Bacteria | 1528 |
| 408 | Ga0207700_10511879 | 3300025928 | Bacteria | 1063 |
| 409 | Ga0207664_10043236 | 3300025929 | Bacteria | 3522 |
| 410 | Ga0207664_10129302 | 3300025929 | Bacteria | 2124 |
| 411 | Ga0207664_10153151 | 3300025929 | Bacteria | 1960 |
| 412 | Ga0207664_10293460 | 3300025929 | Bacteria | 1429 |
| 413 | Ga0207664_10333495 | 3300025929 | Bacteria | 1340 |
| 414 | Ga0207664_10535490 | 3300025929 | Unclassified | 1050 |
| 415 | Ga0207644_10771867 | 3300025931 | Bacteria | 803 |
| 416 | Ga0207690_10019099 | 3300025932 | Bacteria | 4212 |
| 417 | Ga0207690_10085158 | 3300025932 | Bacteria | 2218 |
| 418 | Ga0207706_10036043 | 3300025933 | Bacteria | 4395 |
| 419 | Ga0207706_11112823 | 3300025933 | Bacteria | 659 |
| 420 | Ga0207686_10164275 | 3300025934 | Bacteria | 1559 |
| 421 | Ga0207686_10198033 | 3300025934 | Bacteria | 1437 |
| 422 | Ga0207686_10479608 | 3300025934 | Bacteria | 961 |
| 423 | Ga0207709_10011741 | 3300025935 | Bacteria | 4829 |
| 424 | Ga0207669_10029973 | 3300025937 | Bacteria | 3017 |
| 425 | Ga0207669_10138624 | 3300025937 | Bacteria | 1685 |
| 426 | Ga0207704_10101339 | 3300025938 | Unclassified | 1920 |
| 427 | Ga0207704_10274267 | 3300025938 | Bacteria | 1279 |
| 428 | Ga0207704_10411163 | 3300025938 | Bacteria | 1070 |
| 429 | Ga0207665_10006081 | 3300025939 | Bacteria | 8014 |
| 430 | Ga0207665_10034021 | 3300025939 | Unclassified | 3381 |
| 431 | Ga0207665_10035443 | 3300025939 | Bacteria | 3312 |
| 432 | Ga0207665_10063722 | 3300025939 | Bacteria | 2504 |
| 433 | Ga0207665_10695347 | 3300025939 | Unclassified | 799 |
| 434 | Ga0207691_10180133 | 3300025940 | Bacteria | 1847 |
| 435 | Ga0207691_10192148 | 3300025940 | Bacteria | 1780 |
| 436 | Ga0207711_10385571 | 3300025941 | Unclassified | 1301 |
| 437 | Ga0207711_10421677 | 3300025941 | Unclassified | 1241 |
| 438 | Ga0207711_10752494 | 3300025941 | Bacteria | 908 |
| 439 | Ga0207689_10043039 | 3300025942 | Bacteria | 3734 |
| 440 | Ga0207689_10711119 | 3300025942 | Bacteria | 847 |
| 441 | Ga0207661_10028822 | 3300025944 | Bacteria | 4256 |
| 442 | Ga0207661_10064208 | 3300025944 | Bacteria | 2975 |
| 443 | Ga0207661_10243765 | 3300025944 | Bacteria | 1596 |
| 444 | Ga0207661_10277722 | 3300025944 | Unclassified | 1496 |
| 445 | Ga0207661_11704212 | 3300025944 | Bacteria | 575 |
| 446 | Ga0207679_10099881 | 3300025945 | Bacteria | 2267 |
| 447 | Ga0207679_10111311 | 3300025945 | Unclassified | 2161 |
| 448 | Ga0207679_11002182 | 3300025945 | Bacteria | 766 |
| 449 | Ga0207667_10232490 | 3300025949 | Bacteria | 1887 |
| 450 | Ga0207667_10292677 | 3300025949 | Unclassified | 1664 |
| 451 | Ga0207651_10017093 | 3300025960 | Bacteria | 4274 |
| 452 | Ga0207712_10581302 | 3300025961 | Bacteria | 967 |
| 453 | Ga0207640_11420574 | 3300025981 | Unclassified | 622 |
| 454 | Ga0207658_10945171 | 3300025986 | Bacteria | 786 |
| 455 | Ga0207677_10202239 | 3300026023 | Bacteria | 1580 |
| 456 | Ga0207703_10561277 | 3300026035 | Bacteria | 1077 |
| 457 | Ga0207639_10064181 | 3300026041 | Bacteria | 2846 |
| 458 | Ga0207678_10039230 | 3300026067 | Bacteria | 4111 |
| 459 | Ga0207678_10510420 | 3300026067 | Bacteria | 1048 |
| 460 | Ga0207708_10005647 | 3300026075 | Bacteria | 9239 |
| 461 | Ga0207708_10345608 | 3300026075 | Bacteria | 1219 |
| 462 | Ga0207702_10223826 | 3300026078 | Bacteria | 1754 |
| 463 | Ga0207702_10261651 | 3300026078 | Unclassified | 1629 |
| 464 | Ga0207702_10315278 | 3300026078 | Unclassified | 1488 |
| 465 | Ga0207702_10482675 | 3300026078 | Bacteria | 1206 |
| 466 | Ga0207702_10604575 | 3300026078 | Bacteria | 1076 |
| 467 | Ga0207641_10447263 | 3300026088 | Bacteria | 1248 |
| 468 | Ga0207648_10014192 | 3300026089 | Bacteria | 7368 |
| 469 | Ga0207648_10182953 | 3300026089 | Bacteria | 1855 |
| 470 | Ga0207676_11372407 | 3300026095 | Bacteria | 702 |
| 471 | Ga0207674_11273260 | 3300026116 | Unclassified | 705 |
| 472 | Ga0207675_100216861 | 3300026118 | Unclassified | 1842 |
| 473 | Ga0207683_10038100 | 3300026121 | Bacteria | 4188 |
| 474 | Ga0207683_10297370 | 3300026121 | Bacteria | 1477 |
| 475 | Ga0207683_10818396 | 3300026121 | Bacteria | 864 |
| 476 | Ga0207698_10403011 | 3300026142 | Unclassified | 1308 |
| 477 | Ga0207428_10197966 | 3300027907 | Bacteria | 1512 |
| 478 | Ga0268264_10244547 | 3300028381 | Unclassified | 1663 |
| 479 | Ga0265319_1039088 | 3300028563 | Bacteria | 1610 |
| 480 | Ga0265334_10057525 | 3300028573 | Bacteria | 1473 |
| 481 | Ga0265318_10094314 | 3300028577 | Bacteria | 1102 |
| 482 | Ga0265318_10205284 | 3300028577 | Bacteria | 720 |
| 483 | Ga0265322_10026972 | 3300028654 | Bacteria | 1642 |
| 484 | Ga0265322_10222877 | 3300028654 | Bacteria | 540 |
| 485 | Ga0265338_10006871 | 3300028800 | Bacteria | 14326 |
| 486 | Ga0265338_10021008 | 3300028800 | Bacteria | 6829 |
| 487 | Ga0265338_10033213 | 3300028800 | Bacteria | 5012 |
| 488 | Ga0265338_10283550 | 3300028800 | Bacteria | 1209 |
| 489 | Ga0265324_10021263 | 3300029957 | Unclassified | 2327 |
| 490 | Ga0265324_10046211 | 3300029957 | Bacteria | 1498 |
| 491 | Ga0265325_10115133 | 3300031241 | Bacteria | 1302 |
| 492 | Ga0265339_10003596 | 3300031249 | Bacteria | 10824 |
| 493 | Ga0265339_10250913 | 3300031249 | Bacteria | 856 |
| 494 | Ga0265316_10034471 | 3300031344 | Bacteria | 4111 |
| 495 | Ga0307408_101099614 | 3300031548 | Bacteria | 737 |
| 496 | Ga0265313_10005266 | 3300031595 | Bacteria | 9574 |
| 497 | Ga0265313_10035236 | 3300031595 | Bacteria | 2523 |
| 498 | Ga0265313_10074298 | 3300031595 | Unclassified | 1559 |
| 499 | Ga0265314_10018946 | 3300031711 | Bacteria | 5340 |
| 500 | Ga0265314_10264730 | 3300031711 | Bacteria | 980 |
| 501 | Ga0265342_10020754 | 3300031712 | Bacteria | 4206 |
| 502 | Ga0307406_10459983 | 3300031901 | Bacteria | 1023 |
| 503 | Ga0307416_100089371 | 3300032002 | Bacteria | 2637 |
| 504 | Ga0307415_100320294 | 3300032126 | Bacteria | 1292 |
| 505 | Ga0316583_10211054 | 3300032133 | Unclassified | 673 |
| 506 | Ga0373938_0216897 | 3300034957 | Bacteria | 536 |
| 507 | Ga0373934_0052817 | 3300035086 | Bacteria | 1612 |
| 508 | Ga0373940_0108164 | 3300035088 | Bacteria | 851 |
| 509 | Ga0373944_0175340 | 3300035089 | Bacteria | 767 |
| 510 | Ga0373952_0129280 | 3300035092 | Bacteria | 692 |
| 511 | Ga0373932_0342790 | 3300035112 | Bacteria | 567 |
| 512 | Ga0373939_0265191 | 3300035114 | Bacteria | 673 |
| 513 | Ga0373953_0144906 | 3300035117 | Bacteria | 1017 |
| 514 | Ga0373955_0229676 | 3300035172 | Bacteria | 1110 |
| 515 | Ga0373962_0041658 | 3300035242 | Bacteria | 1295 |
| 516 | Ga0373924_0021732 | 3300035410 | Bacteria | 2504 |
| 517 | Ga0373931_0629565 | 3300035691 | Bacteria | 703 |
| 518 | Ga0373935_0749894 | 3300035692 | Bacteria | 719 |
| 519 | Ga0373933_0106457 | 3300035724 | Bacteria | 1745 |
| 520 | Ga0373933_0321505 | 3300035724 | Bacteria | 1003 |
| 521 | Ga0373937_0000355 | 3300036401 | Bacteria | 42585 |
| 522 | Ga0373937_0091047 | 3300036401 | Bacteria | 2826 |
| 523 | Ga0373937_0298173 | 3300036401 | Bacteria | 1523 |
| 524 | Ga0373937_1145695 | 3300036401 | Archaea | 726 |
| 525 | Ga0395899_0071039 | 3300037312 | Bacteria | 2548 |
| 526 | Ga0395899_0122086 | 3300037312 | Unclassified | 1865 |
| 527 | Ga0395899_0708601 | 3300037312 | Unclassified | 630 |
| 528 | Ga0395899_0788968 | 3300037312 | Bacteria | 588 |
| 529 | Ga0395900_0002117 | 3300037418 | Bacteria | 22226 |
| 530 | Ga0395900_0059737 | 3300037418 | Bacteria | 3925 |
| 531 | Ga0395900_0077708 | 3300037418 | Bacteria | 3410 |
| 532 | Ga0395900_0311147 | 3300037418 | Unclassified | 1558 |
| 533 | Ga0395898_0001862 | 3300037466 | Bacteria | 27022 |
| 534 | Ga0395898_0012734 | 3300037466 | Bacteria | 8686 |
| 535 | Ga0395898_0043527 | 3300037466 | Bacteria | 4424 |
| 536 | Ga0395898_0054213 | 3300037466 | Bacteria | 3913 |
| 537 | Ga0395898_0197609 | 3300037466 | Bacteria | 1921 |
| 538 | Ga0395898_0484565 | 3300037466 | Bacteria | 1177 |
| 539 | Ga0395898_0616071 | 3300037466 | Bacteria | 1028 |
| 540 | Ga0395905_0006129 | 3300037471 | Bacteria | 12140 |
| 541 | Ga0395905_0029868 | 3300037471 | Bacteria | 5138 |
| 542 | Ga0395905_0083375 | 3300037471 | Bacteria | 2995 |
| 543 | Ga0395905_0414010 | 3300037471 | Bacteria | 1243 |
| 544 | Ga0395905_0494968 | 3300037471 | Bacteria | 1122 |
| 545 | Ga0395901_0002058 | 3300038443 | Bacteria | 20621 |
| 546 | Ga0395901_0006996 | 3300038443 | Bacteria | 11404 |
| 547 | Ga0395901_0207248 | 3300038443 | Bacteria | 2053 |
| 548 | Ga0395901_0238432 | 3300038443 | Bacteria | 1897 |
| 549 | Ga0395901_0335626 | 3300038443 | Bacteria | 1562 |
| 550 | Ga0395901_0449821 | 3300038443 | Bacteria | 1317 |
| 551 | Ga0395901_0611650 | 3300038443 | Bacteria | 1098 |
| 552 | Ga0395901_1240299 | 3300038443 | Bacteria | 710 |
| 553 | Ga0242420_021660 | 3300038996 | Bacteria | 1152 |
| 554 | Ga0242420_048160 | 3300038996 | Bacteria | 828 |
| 555 | Ga0436360_0128350 | 3300039438 | Bacteria | 9271 |
| 556 | Ga0436360_0322959 | 3300039438 | Bacteria | 909 |
| 557 | Ga0436363_0954544 | 3300039450 | Bacteria | 1273 |
| 558 | Ga0436362_0303237 | 3300039453 | Bacteria | 1220 |
| 559 | Ga0436362_1041280 | 3300039453 | Bacteria | 758 |
| 560 | Ga0439439_0003235 | 3300041406 | Bacteria | 3574 |
| 561 | Ga0439461_0041228 | 3300041410 | Unclassified | 998 |
| 562 | Ga0451789_0326424 | 3300041443 | Bacteria | 979 |
| 563 | Ga0451793_0333081 | 3300041452 | Bacteria | 683 |
| 564 | Ga0451802_1810917 | 3300041460 | Bacteria | 1025 |
| 565 | Ga0451807_2160026 | 3300041486 | Bacteria | 1894 |
| 566 | Ga0451845_0901567 | 3300041501 | Unclassified | 899 |
| 567 | Ga0439431_0055587 | 3300041997 | Unclassified | 1034 |
| 568 | Ga0439433_0001716 | 3300041999 | Bacteria | 4559 |
| 569 | Ga0439442_032183 | 3300042002 | Bacteria | 1096 |
| 570 | Ga0439449_0008224 | 3300042007 | Bacteria | 3967 |
| 571 | Ga0439454_019439 | 3300042011 | Unclassified | 988 |
| 572 | Ga0439462_0017304 | 3300042015 | Unclassified | 1867 |
| 573 | Ga0450920_011767 | 3300042122 | Bacteria | 1634 |
| 574 | Ga0439446_0009557 | 3300042156 | Bacteria | 2597 |
| 575 | Ga0466969_0000591 | 3300044656 | Bacteria | 19709 |
| 576 | Ga0466969_0010882 | 3300044656 | Bacteria | 4820 |
| 577 | Ga0466969_0102123 | 3300044656 | Bacteria | 1349 |
| 578 | Ga0466965_0032491 | 3300044683 | Bacteria | 2549 |
| 579 | Ga0466965_0056596 | 3300044683 | Bacteria | 1953 |
| 580 | Ga0466965_0068408 | 3300044683 | Bacteria | 1783 |
| 581 | Ga0466965_0140309 | 3300044683 | Bacteria | 1258 |
| 582 | Ga0466966_0003367 | 3300044684 | Bacteria | 10543 |
| 583 | Ga0466966_0069894 | 3300044684 | Bacteria | 2202 |
| 584 | Ga0466966_0101116 | 3300044684 | Bacteria | 1783 |
| 585 | Ga0466966_0142777 | 3300044684 | Bacteria | 1462 |
| 586 | Ga0466966_0502419 | 3300044684 | Bacteria | 729 |
| 587 | Ga0466961_0008344 | 3300044693 | Bacteria | 6595 |
| 588 | Ga0466961_0115240 | 3300044693 | Bacteria | 1689 |
| 589 | Ga0466961_0115468 | 3300044693 | Bacteria | 1687 |
| 590 | Ga0466961_0242394 | 3300044693 | Bacteria | 1108 |
| 591 | Ga0466963_0000037 | 3300044694 | Bacteria | 42541 |
| 592 | Ga0466963_0000670 | 3300044694 | Bacteria | 16566 |
| 593 | Ga0466963_0001565 | 3300044694 | Bacteria | 12405 |
| 594 | Ga0466963_0001933 | 3300044694 | Bacteria | 11347 |
| 595 | Ga0466963_0002985 | 3300044694 | Bacteria | 9562 |
| 596 | Ga0466963_0006848 | 3300044694 | Bacteria | 6780 |
| 597 | Ga0466963_0011378 | 3300044694 | Bacteria | 5417 |
| 598 | Ga0466963_0030930 | 3300044694 | Bacteria | 3457 |
| 599 | Ga0466963_0031901 | 3300044694 | Bacteria | 3407 |
| 600 | Ga0466963_0058286 | 3300044694 | Bacteria | 2574 |
| 601 | Ga0466963_0069923 | 3300044694 | Bacteria | 2360 |
| 602 | Ga0466963_0070698 | 3300044694 | Bacteria | 2348 |
| 603 | Ga0466963_0080094 | 3300044694 | Bacteria | 2210 |
| 604 | Ga0466963_0499285 | 3300044694 | Bacteria | 859 |
| 605 | Ga0466964_0008661 | 3300044706 | Bacteria | 3825 |
| 606 | Ga0466964_0010906 | 3300044706 | Bacteria | 3433 |
| 607 | Ga0466964_0044673 | 3300044706 | Bacteria | 1800 |
| 608 | Ga0466964_0055534 | 3300044706 | Bacteria | 1635 |
| 609 | Ga0466964_0058045 | 3300044706 | Unclassified | 1603 |
| 610 | Ga0466964_0275354 | 3300044706 | Bacteria | 839 |
| 611 | Ga0466964_0350581 | 3300044706 | Unclassified | 758 |
| 612 | Ga0466971_0000254 | 3300044719 | Bacteria | 20367 |
| 613 | Ga0466971_0002846 | 3300044719 | Bacteria | 7336 |
| 614 | Ga0466971_0021103 | 3300044719 | Bacteria | 2897 |
| 615 | Ga0466971_0026637 | 3300044719 | Bacteria | 2585 |
| 616 | Ga0466971_0051717 | 3300044719 | Bacteria | 1849 |
| 617 | Ga0466971_0083352 | 3300044719 | Unclassified | 1460 |
| 618 | Ga0466971_0480601 | 3300044719 | Bacteria | 611 |
| 619 | Ga0466968_0002132 | 3300044735 | Bacteria | 7206 |
| 620 | Ga0466968_0013032 | 3300044735 | Bacteria | 3264 |
| 621 | Ga0466968_0029866 | 3300044735 | Bacteria | 2256 |
| 622 | Ga0466968_0029981 | 3300044735 | Bacteria | 2252 |
| 623 | Ga0466968_0037552 | 3300044735 | Bacteria | 2032 |
| 624 | Ga0466968_0142724 | 3300044735 | Bacteria | 1096 |
| 625 | Ga0466968_0430099 | 3300044735 | Bacteria | 650 |
| 626 | Ga0466970_0011341 | 3300044765 | Bacteria | 4543 |
| 627 | Ga0466970_0035543 | 3300044765 | Bacteria | 2639 |
| 628 | Ga0466970_0077360 | 3300044765 | Bacteria | 1793 |
| 629 | Ga0466970_0194649 | 3300044765 | Bacteria | 1127 |
| 630 | Ga0466957_0000448 | 3300044842 | Bacteria | 20335 |
| 631 | Ga0466957_0001829 | 3300044842 | Bacteria | 11222 |
| 632 | Ga0466957_0006041 | 3300044842 | Bacteria | 6835 |
| 633 | Ga0466957_0010913 | 3300044842 | Bacteria | 5225 |
| 634 | Ga0466957_0031644 | 3300044842 | Bacteria | 3163 |
| 635 | Ga0466957_0037381 | 3300044842 | Bacteria | 2923 |
| 636 | Ga0466957_0053228 | 3300044842 | Bacteria | 2467 |
| 637 | Ga0466957_0108072 | 3300044842 | Bacteria | 1761 |
| 638 | Ga0466960_0339899 | 3300044901 | Unclassified | 854 |
| 639 | Ga0466960_0518787 | 3300044901 | Bacteria | 700 |
| 640 | Ga0466959_0007249 | 3300045049 | Bacteria | 7767 |
| 641 | Ga0466959_0044436 | 3300045049 | Bacteria | 3273 |
| 642 | Ga0466959_0050486 | 3300045049 | Bacteria | 3053 |
| 643 | Ga0466959_0054810 | 3300045049 | Bacteria | 2912 |
| 644 | Ga0466959_0084847 | 3300045049 | Bacteria | 2280 |
| 645 | Ga0466959_0156558 | 3300045049 | Bacteria | 1603 |
| 646 | Ga0466959_0268038 | 3300045049 | Unclassified | 1174 |
| 647 | Ga0466959_0387342 | 3300045049 | Bacteria | 951 |
| 648 | Ga0466959_0468185 | 3300045049 | Unclassified | 853 |
| 649 | Ga0466959_0808790 | 3300045049 | Bacteria | 626 |
| 650 | Ga0466958_0000148 | 3300045836 | Bacteria | 24461 |
| 651 | Ga0466958_0003106 | 3300045836 | Bacteria | 8528 |
| 652 | Ga0466958_0007030 | 3300045836 | Bacteria | 6157 |
| 653 | Ga0466958_0011254 | 3300045836 | Bacteria | 5036 |
| 654 | Ga0466958_0021374 | 3300045836 | Bacteria | 3780 |
| 655 | Ga0466958_0048556 | 3300045836 | Bacteria | 2565 |
| 656 | Ga0466958_0054158 | 3300045836 | Unclassified | 2433 |
| 657 | Ga0466958_0054184 | 3300045836 | Bacteria | 2432 |
| 658 | Ga0466958_0075009 | 3300045836 | Unclassified | 2074 |
| 659 | Ga0466958_0102200 | 3300045836 | Unclassified | 1783 |
| 660 | Ga0466958_0122974 | 3300045836 | Bacteria | 1625 |
| 661 | Ga0466967_0000173 | 3300045976 | Bacteria | 26504 |
| 662 | Ga0466967_0001347 | 3300045976 | Bacteria | 14104 |
| 663 | Ga0466967_0009541 | 3300045976 | Bacteria | 7209 |
| 664 | Ga0466967_0018176 | 3300045976 | Bacteria | 5610 |
| 665 | Ga0466967_0023676 | 3300045976 | Bacteria | 5036 |
| 666 | Ga0466967_0027634 | 3300045976 | Bacteria | 4722 |
| 667 | Ga0466967_0035273 | 3300045976 | Bacteria | 4255 |
| 668 | Ga0466967_0035961 | 3300045976 | Bacteria | 4223 |
| 669 | Ga0466967_0058650 | 3300045976 | Bacteria | 3403 |
| 670 | Ga0466967_0070089 | 3300045976 | Bacteria | 3135 |
| 671 | Ga0466967_0070749 | 3300045976 | Bacteria | 3121 |
| 672 | Ga0466967_0077176 | 3300045976 | Unclassified | 2998 |
| 673 | Ga0466967_0077614 | 3300045976 | Bacteria | 2990 |
| 674 | Ga0466967_0186982 | 3300045976 | Bacteria | 1956 |
| 675 | Ga0466967_0245960 | 3300045976 | Bacteria | 1707 |
| 676 | Ga0466967_0252204 | 3300045976 | Unclassified | 1686 |
| 677 | Ga0466967_0315563 | 3300045976 | Unclassified | 1506 |
| 678 | Ga0466967_0633642 | 3300045976 | Bacteria | 1056 |
| 679 | Ga0466967_0682903 | 3300045976 | Bacteria | 1016 |
| 680 | Ga0466967_1253520 | 3300045976 | Unclassified | 738 |
| 681 | Ga0495592_0000635 | 3300046454 | Bacteria | 24391 |
| 682 | Ga0495592_0000769 | 3300046454 | Bacteria | 22286 |
| 683 | Ga0495592_0068268 | 3300046454 | Bacteria | 2596 |
| 684 | Ga0495592_0099960 | 3300046454 | Bacteria | 2068 |
| 685 | Ga0495603_0086996 | 3300046455 | Bacteria | 1829 |
| 686 | Ga0495629_0016265 | 3300046459 | Bacteria | 5338 |
| 687 | Ga0495629_0033665 | 3300046459 | Bacteria | 3624 |
| 688 | Ga0495629_0692992 | 3300046459 | Unclassified | 677 |
| 689 | Ga0495641_0015557 | 3300046461 | Bacteria | 4053 |
| 690 | Ga0495641_0053659 | 3300046461 | Bacteria | 1833 |
| 691 | Ga0495641_0108458 | 3300046461 | Bacteria | 1239 |
| 692 | Ga0495641_0135945 | 3300046461 | Bacteria | 1097 |
| 693 | Ga0495641_0314608 | 3300046461 | Bacteria | 706 |
| 694 | Ga0495651_0000029 | 3300046462 | Bacteria | 105042 |
| 695 | Ga0495651_0086910 | 3300046462 | Bacteria | 2352 |
| 696 | Ga0495651_0772579 | 3300046462 | Bacteria | 594 |
| 697 | Ga0495653_0003221 | 3300046463 | Bacteria | 13077 |
| 698 | Ga0495653_0028900 | 3300046463 | Bacteria | 4432 |
| 699 | Ga0495653_0069379 | 3300046463 | Bacteria | 2641 |
| 700 | Ga0495582_0173928 | 3300046473 | Bacteria | 1226 |
| 701 | Ga0495582_0244091 | 3300046473 | Bacteria | 1029 |
| 702 | Ga0495662_0129371 | 3300046476 | Bacteria | 1241 |
| 703 | Ga0495664_0157772 | 3300046477 | Bacteria | 1376 |
| 704 | Ga0495584_0134281 | 3300046491 | Bacteria | 1256 |
| 705 | Ga0495585_0381145 | 3300046492 | Bacteria | 681 |
| 706 | Ga0495585_0443361 | 3300046492 | Unclassified | 622 |
| 707 | Ga0495608_0004327 | 3300046511 | Bacteria | 10173 |
| 708 | Ga0495618_0001935 | 3300046514 | Bacteria | 13569 |
| 709 | Ga0495618_0157414 | 3300046514 | Unclassified | 1449 |
| 710 | Ga0495618_0632432 | 3300046514 | Bacteria | 634 |
| 711 | Ga0495628_0000016 | 3300046516 | Bacteria | 170260 |
| 712 | Ga0495628_0073325 | 3300046516 | Bacteria | 2667 |
| 713 | Ga0495628_0094887 | 3300046516 | Bacteria | 2305 |
| 714 | Ga0495630_0045205 | 3300046517 | Bacteria | 3290 |
| 715 | Ga0495630_0049241 | 3300046517 | Bacteria | 3154 |
| 716 | Ga0495630_0139944 | 3300046517 | Unclassified | 1840 |
| 717 | Ga0495630_0537494 | 3300046517 | Bacteria | 896 |
| 718 | Ga0495630_1124873 | 3300046517 | Bacteria | 595 |
| 719 | Ga0495644_0050042 | 3300046523 | Bacteria | 1568 |
| 720 | Ga0495644_0169650 | 3300046523 | Bacteria | 838 |
| 721 | Ga0495663_0225661 | 3300046525 | Bacteria | 660 |
| 722 | Ga0495642_0117259 | 3300046528 | Bacteria | 1141 |
| 723 | Ga0495652_0001228 | 3300046529 | Bacteria | 28728 |
| 724 | Ga0495652_0037452 | 3300046529 | Bacteria | 4208 |
| 725 | Ga0495652_0091507 | 3300046529 | Bacteria | 2486 |
| 726 | Ga0495652_0157880 | 3300046529 | Bacteria | 1764 |
| 727 | Ga0495652_0562398 | 3300046529 | Bacteria | 783 |
| 728 | Ga0495640_0210480 | 3300046533 | Bacteria | 1229 |
| 729 | Ga0495586_0079888 | 3300046535 | Bacteria | 1796 |
| 730 | Ga0495586_0202148 | 3300046535 | Bacteria | 1126 |
| 731 | Ga0495587_0000434 | 3300046536 | Bacteria | 29352 |
| 732 | Ga0495587_0430646 | 3300046536 | Unclassified | 732 |
| 733 | Ga0495645_0000367 | 3300046543 | Bacteria | 31425 |
| 734 | Ga0495645_0096485 | 3300046543 | Bacteria | 2106 |
| 735 | Ga0495645_0344535 | 3300046543 | Bacteria | 961 |
| 736 | Ga0495633_0295740 | 3300046558 | Bacteria | 736 |
| 737 | Ga0495667_0056732 | 3300046559 | Bacteria | 2575 |
| 738 | Ga0495667_0062029 | 3300046559 | Bacteria | 2450 |
| 739 | Ga0495667_0062037 | 3300046559 | Bacteria | 2450 |
| 740 | Ga0495667_0090591 | 3300046559 | Bacteria | 1981 |
| 741 | Ga0495667_0122966 | 3300046559 | Bacteria | 1675 |
| 742 | Ga0495667_0333940 | 3300046559 | Bacteria | 959 |
| 743 | Ga0495656_0001482 | 3300046615 | Bacteria | 7677 |
| 744 | Ga0495634_0015712 | 3300046642 | Bacteria | 5429 |
| 745 | Ga0495634_0245756 | 3300046642 | Unclassified | 1096 |
| 746 | Ga0495634_0415343 | 3300046642 | Bacteria | 797 |
| 747 | Ga0495611_0067422 | 3300046648 | Bacteria | 1633 |
| 748 | Ga0495635_0047562 | 3300046663 | Bacteria | 2958 |
| 749 | Ga0495661_0212988 | 3300046665 | Bacteria | 1005 |
| 750 | Ga0495657_0005282 | 3300046675 | Bacteria | 10223 |
| 751 | Ga0495657_0073618 | 3300046675 | Bacteria | 2224 |
| 752 | Ga0495657_0116583 | 3300046675 | Archaea | 1686 |
| 753 | Ga0495657_0133210 | 3300046675 | Bacteria | 1555 |
| 754 | Ga0495599_0000187 | 3300046678 | Bacteria | 40807 |
| 755 | Ga0495599_0020779 | 3300046678 | Bacteria | 4090 |
| 756 | Ga0495623_0000121 | 3300046679 | Bacteria | 47882 |
| 757 | Ga0495646_0025332 | 3300046680 | Bacteria | 3731 |
| 758 | Ga0495646_0057372 | 3300046680 | Bacteria | 2331 |
| 759 | Ga0495646_0121485 | 3300046680 | Bacteria | 1477 |
| 760 | Ga0495647_0027244 | 3300046681 | Bacteria | 2099 |
| 761 | Ga0495658_0056370 | 3300046683 | Bacteria | 2241 |
| 762 | Ga0495613_0006994 | 3300046689 | Bacteria | 8405 |
| 763 | Ga0495613_0274624 | 3300046689 | Bacteria | 1171 |
| 764 | Ga0495613_1096376 | 3300046689 | Unclassified | 508 |
| 765 | Ga0495624_0014162 | 3300046690 | Bacteria | 5421 |
| 766 | Ga0495589_0041834 | 3300046794 | Bacteria | 2285 |
| 767 | Ga0495600_0085761 | 3300046809 | Bacteria | 2054 |
| 768 | Ga0495581_0065178 | 3300047315 | Bacteria | 2106 |
| 769 | Ga0495604_0000628 | 3300047317 | Bacteria | 30365 |
| 770 | Ga0495674_0222904 | 3300047319 | Bacteria | 1558 |
| 771 | Ga0495676_0023206 | 3300047321 | Bacteria | 5388 |
| 772 | Ga0495680_0002048 | 3300047322 | Bacteria | 21061 |
| 773 | Ga0495680_0143711 | 3300047322 | Archaea | 1744 |
| 774 | Ga0495680_0662748 | 3300047322 | Bacteria | 692 |
| 775 | Ga0495675_0000031 | 3300047444 | Bacteria | 99240 |
| 776 | Ga0495675_0081670 | 3300047444 | Bacteria | 2035 |
| 777 | Ga0495685_083212 | 3300047447 | Bacteria | 1065 |
| 778 | Ga0495684_0208753 | 3300047471 | Bacteria | 1437 |
| 779 | Ga0495684_0728392 | 3300047471 | Unclassified | 655 |
| 780 | Ga0495602_0000133 | 3300048088 | Bacteria | 69392 |
| 781 | Ga0495602_0090849 | 3300048088 | Unclassified | 2535 |
| 782 | Ga0495602_0189574 | 3300048088 | Bacteria | 1578 |
| 783 | Ga0495602_0278109 | 3300048088 | Bacteria | 1234 |
| 784 | Ga0495602_0318424 | 3300048088 | Bacteria | 1132 |
| 785 | Ga0495615_0054597 | 3300048090 | Bacteria | 1038 |
| 786 | Ga0496100_0276661 | 3300048903 | Unclassified | 1250 |
| 787 | Ga0496100_1077898 | 3300048903 | Bacteria | 633 |
| 788 | Ga0496101_0022844 | 3300048904 | Bacteria | 4312 |
| 789 | Ga0496101_0063633 | 3300048904 | Bacteria | 2686 |
| 790 | Ga0496101_0087614 | 3300048904 | Bacteria | 2311 |
| 791 | Ga0496101_0112509 | 3300048904 | Bacteria | 2051 |
| 792 | Ga0496101_0220725 | 3300048904 | Bacteria | 1471 |
| 793 | Ga0496101_0354016 | 3300048904 | Unclassified | 1154 |
| 794 | Ga0496101_0396021 | 3300048904 | Bacteria | 1087 |
| 795 | Ga0496101_0421988 | 3300048904 | Bacteria | 1051 |
| 796 | Ga0496102_0072024 | 3300048905 | Bacteria | 3174 |
| 797 | Ga0496102_0076014 | 3300048905 | Bacteria | 3088 |
| 798 | Ga0496102_0258959 | 3300048905 | Bacteria | 1640 |
| 799 | Ga0496102_0368532 | 3300048905 | Bacteria | 1352 |
| 800 | Ga0496103_0084153 | 3300048906 | Bacteria | 2003 |
| 801 | Ga0496103_0229255 | 3300048906 | Bacteria | 1195 |
| 802 | Ga0496103_0831652 | 3300048906 | Bacteria | 581 |
| 803 | Ga0496104_0122313 | 3300048907 | Bacteria | 2499 |
| 804 | Ga0496104_0173486 | 3300048907 | Bacteria | 2067 |
| 805 | Ga0496104_0181134 | 3300048907 | Unclassified | 2017 |
| 806 | Ga0496104_0499867 | 3300048907 | Bacteria | 1127 |
| 807 | Ga0496104_0527974 | 3300048907 | Bacteria | 1091 |
| 808 | Ga0496104_0604752 | 3300048907 | Bacteria | 1006 |
| 809 | Ga0496104_1701089 | 3300048907 | Unclassified | 533 |
| 810 | Ga0496105_0023043 | 3300048908 | Bacteria | 5049 |
| 811 | Ga0496105_0031873 | 3300048908 | Bacteria | 4322 |
| 812 | Ga0496105_0054893 | 3300048908 | Bacteria | 3289 |
| 813 | Ga0496105_0189969 | 3300048908 | Bacteria | 1680 |
| 814 | Ga0496106_0123596 | 3300048909 | Bacteria | 2025 |
| 815 | Ga0496106_0148189 | 3300048909 | Bacteria | 1850 |
| 816 | Ga0496106_0274547 | 3300048909 | Bacteria | 1350 |
| 817 | Ga0496106_0291659 | 3300048909 | Bacteria | 1308 |
| 818 | Ga0496106_0376575 | 3300048909 | Bacteria | 1141 |
| 819 | Ga0496106_0824665 | 3300048909 | Unclassified | 735 |
| 820 | Ga0496107_0064067 | 3300048910 | Bacteria | 2664 |
| 821 | Ga0496107_0169901 | 3300048910 | Unclassified | 1618 |
| 822 | Ga0496107_0253321 | 3300048910 | Bacteria | 1310 |
| 823 | Ga0496107_0289463 | 3300048910 | Bacteria | 1219 |
| 824 | Ga0496107_0432830 | 3300048910 | Bacteria | 978 |
| 825 | Ga0496107_0631538 | 3300048910 | Bacteria | 790 |
| 826 | Ga0496108_0006504 | 3300048911 | Bacteria | 9478 |
| 827 | Ga0496108_0040454 | 3300048911 | Bacteria | 3887 |
| 828 | Ga0496108_0051123 | 3300048911 | Bacteria | 3462 |
| 829 | Ga0496108_0060419 | 3300048911 | Bacteria | 3189 |
| 830 | Ga0496108_0083291 | 3300048911 | Bacteria | 2713 |
| 831 | Ga0496108_0094102 | 3300048911 | Bacteria | 2550 |
| 832 | Ga0496108_0175087 | 3300048911 | Bacteria | 1857 |
| 833 | Ga0496108_0204985 | 3300048911 | Unclassified | 1711 |
| 834 | Ga0496108_0500021 | 3300048911 | Bacteria | 1062 |
| 835 | Ga0496109_0004548 | 3300048912 | Bacteria | 11588 |
| 836 | Ga0496109_0033113 | 3300048912 | Bacteria | 4649 |
| 837 | Ga0496109_0050623 | 3300048912 | Bacteria | 3782 |
| 838 | Ga0496109_0063809 | 3300048912 | Bacteria | 3369 |
| 839 | Ga0496109_0154556 | 3300048912 | Unclassified | 2149 |
| 840 | Ga0496109_0176637 | 3300048912 | Unclassified | 2005 |
| 841 | Ga0496109_0213436 | 3300048912 | Bacteria | 1815 |
| 842 | Ga0496109_0258788 | 3300048912 | Bacteria | 1639 |
| 843 | Ga0496109_0385272 | 3300048912 | Unclassified | 1325 |
| 844 | Ga0496110_0013143 | 3300048913 | Bacteria | 6835 |
| 845 | Ga0496110_0091180 | 3300048913 | Bacteria | 2726 |
| 846 | Ga0496110_0127356 | 3300048913 | Unclassified | 2298 |
| 847 | Ga0496110_0134743 | 3300048913 | Unclassified | 2232 |
| 848 | Ga0496110_0137530 | 3300048913 | Bacteria | 2208 |
| 849 | Ga0496110_0256424 | 3300048913 | Bacteria | 1592 |
| 850 | Ga0496110_0306503 | 3300048913 | Bacteria | 1446 |
| 851 | Ga0496110_0581390 | 3300048913 | Bacteria | 1017 |
| 852 | Ga0496110_1142366 | 3300048913 | Bacteria | 687 |
| 853 | Ga0496111_0002951 | 3300048914 | Bacteria | 10408 |
| 854 | Ga0496111_0076252 | 3300048914 | Bacteria | 2444 |
| 855 | Ga0496111_0100914 | 3300048914 | Bacteria | 2120 |
| 856 | Ga0496111_0106585 | 3300048914 | Bacteria | 2063 |
| 857 | Ga0496111_0285657 | 3300048914 | Bacteria | 1224 |
| 858 | Ga0496111_0403163 | 3300048914 | Bacteria | 1010 |
| 859 | Ga0496111_0476187 | 3300048914 | Unclassified | 920 |
| 860 | Ga0496112_0000720 | 3300048915 | Bacteria | 22965 |
| 861 | Ga0496112_0003665 | 3300048915 | Bacteria | 12803 |
| 862 | Ga0496112_0006839 | 3300048915 | Bacteria | 10052 |
| 863 | Ga0496112_0016198 | 3300048915 | Bacteria | 6975 |
| 864 | Ga0496112_0084870 | 3300048915 | Bacteria | 3133 |
| 865 | Ga0496112_0086167 | 3300048915 | Bacteria | 3108 |
| 866 | Ga0496112_0110864 | 3300048915 | Bacteria | 2714 |
| 867 | Ga0496112_0204049 | 3300048915 | Bacteria | 1935 |
| 868 | Ga0496112_0221458 | 3300048915 | Bacteria | 1848 |
| 869 | Ga0496112_0604821 | 3300048915 | Bacteria | 1028 |
| 870 | Ga0496112_1097166 | 3300048915 | Bacteria | 714 |
| 871 | Ga0496112_1372219 | 3300048915 | Bacteria | 622 |
| 872 | Ga0496113_0019216 | 3300048916 | Bacteria | 4776 |
| 873 | Ga0496113_0050512 | 3300048916 | Bacteria | 3101 |
| 874 | Ga0496113_0069451 | 3300048916 | Bacteria | 2676 |
| 875 | Ga0496113_0085623 | 3300048916 | Bacteria | 2421 |
| 876 | Ga0496113_0113480 | 3300048916 | Bacteria | 2112 |
| 877 | Ga0496113_0199406 | 3300048916 | Bacteria | 1591 |
| 878 | Ga0496113_0316648 | 3300048916 | Bacteria | 1250 |
| 879 | Ga0496113_0518232 | 3300048916 | Bacteria | 957 |
| 880 | Ga0496113_0658285 | 3300048916 | Bacteria | 837 |
| 881 | Ga0496113_0696164 | 3300048916 | Unclassified | 811 |
| 882 | Ga0496113_0791058 | 3300048916 | Bacteria | 754 |
| 883 | Ga0496113_1095409 | 3300048916 | Bacteria | 625 |
| 884 | Ga0496114_0016663 | 3300048917 | Bacteria | 5926 |
| 885 | Ga0496114_0023362 | 3300048917 | Bacteria | 5045 |
| 886 | Ga0496114_0029580 | 3300048917 | Bacteria | 4505 |
| 887 | Ga0496114_0058250 | 3300048917 | Bacteria | 3225 |
| 888 | Ga0496114_0132984 | 3300048917 | Bacteria | 2149 |
| 889 | Ga0496114_0198861 | 3300048917 | Bacteria | 1755 |
| 890 | Ga0496114_0270748 | 3300048917 | Bacteria | 1496 |
| 891 | Ga0496114_0354604 | 3300048917 | Unclassified | 1298 |
| 892 | Ga0496115_0002049 | 3300048918 | Bacteria | 14422 |
| 893 | Ga0496115_0231014 | 3300048918 | Unclassified | 1525 |
| 894 | Ga0496115_0264290 | 3300048918 | Bacteria | 1415 |
| 895 | Ga0496115_0680437 | 3300048918 | Bacteria | 810 |
| 896 | Ga0501031_0073730 | 3300049568 | Bacteria | 2222 |
| 897 | Ga0501031_0120507 | 3300049568 | Bacteria | 1714 |
| 898 | Ga0501031_0293840 | 3300049568 | Bacteria | 1053 |
| 899 | Ga0501032_0012583 | 3300049569 | Bacteria | 6040 |
| 900 | Ga0501033_0110157 | 3300049570 | Bacteria | 2004 |
| 901 | Ga0501034_0510141 | 3300049571 | Unclassified | 1115 |
| 902 | Ga0501036_0102459 | 3300049572 | Bacteria | 2421 |
| 903 | Ga0501037_0155190 | 3300049573 | Bacteria | 1634 |
| 904 | Ga0501038_0010922 | 3300049574 | Bacteria | 8295 |
| 905 | Ga0501038_1011522 | 3300049574 | Unclassified | 610 |
| 906 | Ga0501039_0006374 | 3300049575 | Bacteria | 8964 |
| 907 | Ga0501039_0044426 | 3300049575 | Bacteria | 3431 |
| 908 | Ga0501039_0217914 | 3300049575 | Bacteria | 1501 |
| 909 | Ga0501039_0312183 | 3300049575 | Bacteria | 1236 |
| 910 | Ga0501040_0116536 | 3300049576 | Bacteria | 1871 |
| 911 | Ga0501040_0220435 | 3300049576 | Bacteria | 1349 |
| 912 | Ga0501041_0022834 | 3300049577 | Bacteria | 3748 |
| 913 | Ga0501041_0026041 | 3300049577 | Bacteria | 3515 |
| 914 | Ga0501041_0234751 | 3300049577 | Bacteria | 1152 |
| 915 | Ga0501041_0488357 | 3300049577 | Bacteria | 783 |
| 916 | Ga0501042_0007698 | 3300049578 | Bacteria | 7073 |
| 917 | Ga0501042_0008751 | 3300049578 | Bacteria | 6714 |
| 918 | Ga0501042_0382134 | 3300049578 | Bacteria | 1020 |
| 919 | Ga0501043_0090432 | 3300049579 | Bacteria | 2407 |
| 920 | Ga0501043_1129210 | 3300049579 | Bacteria | 553 |
| 921 | Ga0501046_0008561 | 3300049580 | Bacteria | 8904 |
| 922 | Ga0501046_0346840 | 3300049580 | Bacteria | 1078 |
| 923 | Ga0501048_0080734 | 3300049582 | Bacteria | 2294 |
| 924 | Ga0501048_0096625 | 3300049582 | Bacteria | 2083 |
| 925 | Ga0501067_0002804 | 3300049583 | Bacteria | 9587 |
| 926 | Ga0501067_0002965 | 3300049583 | Bacteria | 9362 |
| 927 | Ga0501067_0099360 | 3300049583 | Unclassified | 1616 |
| 928 | Ga0501068_0011617 | 3300049584 | Bacteria | 4975 |
| 929 | Ga0501068_0016962 | 3300049584 | Bacteria | 4207 |
| 930 | Ga0501068_0083778 | 3300049584 | Bacteria | 1960 |
| 931 | Ga0501068_0153665 | 3300049584 | Bacteria | 1447 |
| 932 | Ga0501069_0023483 | 3300049585 | Bacteria | 3363 |
| 933 | Ga0501069_0035622 | 3300049585 | Bacteria | 2743 |
| 934 | Ga0501069_0036725 | 3300049585 | Bacteria | 2702 |
| 935 | Ga0501069_0074069 | 3300049585 | Bacteria | 1910 |
| 936 | Ga0501069_0461598 | 3300049585 | Unclassified | 755 |
| 937 | Ga0501070_0019851 | 3300049586 | Bacteria | 5635 |
| 938 | Ga0501070_0068804 | 3300049586 | Bacteria | 2931 |
| 939 | Ga0501070_0251789 | 3300049586 | Bacteria | 1445 |
| 940 | Ga0501071_0016213 | 3300049587 | Bacteria | 5122 |
| 941 | Ga0501071_0088291 | 3300049587 | Bacteria | 2275 |
| 942 | Ga0501071_0868642 | 3300049587 | Unclassified | 696 |
| 943 | Ga0501072_0003835 | 3300049588 | Bacteria | 11357 |
| 944 | Ga0501072_0100526 | 3300049588 | Bacteria | 2299 |
| 945 | Ga0501072_0451265 | 3300049588 | Bacteria | 1018 |
| 946 | Ga0501072_0836280 | 3300049588 | Bacteria | 720 |
| 947 | Ga0501073_0031712 | 3300049589 | Bacteria | 3770 |
| 948 | Ga0501073_0457343 | 3300049589 | Bacteria | 882 |
| 949 | Ga0501074_0014813 | 3300049590 | Bacteria | 5671 |
| 950 | Ga0501075_0084674 | 3300049591 | Bacteria | 2401 |
| 951 | Ga0501075_0114590 | 3300049591 | Bacteria | 2050 |
| 952 | Ga0501075_0147794 | 3300049591 | Bacteria | 1791 |
| 953 | Ga0501075_0846829 | 3300049591 | Unclassified | 696 |
| 954 | Ga0501076_0013005 | 3300049592 | Bacteria | 6230 |
| 955 | Ga0501076_0136482 | 3300049592 | Bacteria | 1991 |
| 956 | Ga0501076_0185714 | 3300049592 | Bacteria | 1696 |
| 957 | Ga0501076_0764644 | 3300049592 | Bacteria | 797 |
| 958 | Ga0501076_1315756 | 3300049592 | Bacteria | 594 |
| 959 | Ga0501077_0134763 | 3300049593 | Bacteria | 1566 |
| 960 | Ga0501077_0398730 | 3300049593 | Bacteria | 879 |
| 961 | Ga0501079_0005790 | 3300049741 | Bacteria | 9236 |
| 962 | Ga0501079_0041140 | 3300049741 | Bacteria | 3566 |
| 963 | Ga0501079_1035281 | 3300049741 | Unclassified | 647 |
| 964 | Ga0501080_0074455 | 3300049742 | Bacteria | 3158 |
| 965 | Ga0501080_0221249 | 3300049742 | Bacteria | 1732 |
| 966 | Ga0501080_0407259 | 3300049742 | Bacteria | 1223 |
| 967 | Ga0501081_0177045 | 3300049743 | Bacteria | 1541 |
| 968 | Ga0501081_0289824 | 3300049743 | Bacteria | 1199 |
| 969 | Ga0501081_0765512 | 3300049743 | Bacteria | 726 |
| 970 | Ga0501081_0971149 | 3300049743 | Bacteria | 641 |
| 971 | Ga0501035_0142488 | 3300049822 | Bacteria | 2083 |
| 972 | Ga0501035_0246531 | 3300049822 | Bacteria | 1518 |
| 973 | Ga0501044_0254930 | 3300049823 | Bacteria | 1694 |
| 974 | Ga0501044_1191020 | 3300049823 | Bacteria | 630 |
| 975 | Ga0501045_0034406 | 3300049824 | Bacteria | 3677 |
| 976 | Ga0501045_0061970 | 3300049824 | Bacteria | 2744 |
| 977 | nmdc:mga05p37_13210_c1 | 3300050507 | Bacteria | 9885 |
| 978 | nmdc:mga05p37_710891_c1 | 3300050507 | Bacteria | 1114 |
| 979 | nmdc:mga09592_1170905_c1 | 3300050508 | Bacteria | 636 |
| 980 | nmdc:mga06r32_412105_c1 | 3300050510 | Bacteria | 1333 |
| 981 | nmdc:mga08y16_112887_c1 | 3300050511 | Bacteria | 2829 |
| 982 | nmdc:mga0n895_120235_c1 | 3300050512 | Unclassified | 2648 |
| 983 | nmdc:mga0n895_356849_c1 | 3300050512 | Bacteria | 1481 |
| 984 | nmdc:mga0n895_65535_c1 | 3300050512 | Bacteria | 3595 |
| 985 | nmdc:mga0n895_9466_c1 | 3300050512 | Bacteria | 8524 |
| 986 | nmdc:mga0rr50_133592_c1 | 3300050513 | Bacteria | 1990 |
| 987 | nmdc:mga0rr50_275130_c1 | 3300050513 | Unclassified | 1404 |
| 988 | nmdc:mga0rr50_445408_c1 | 3300050513 | Bacteria | 1097 |
| 989 | nmdc:mga08x19_136461_c1 | 3300050514 | Bacteria | 1654 |
| 990 | nmdc:mga08x19_234183_c1 | 3300050514 | Bacteria | 1265 |
| 991 | nmdc:mga08x19_477598_c1 | 3300050514 | Unclassified | 879 |
| 992 | nmdc:mga0a205_1061274_c1 | 3300050515 | Bacteria | 657 |
| 993 | nmdc:mga0a205_185681_c1 | 3300050515 | Bacteria | 1972 |
| 994 | nmdc:mga0a205_190749_c1 | 3300050515 | Bacteria | 1942 |
| 995 | nmdc:mga0a205_202022_c1 | 3300050515 | Bacteria | 1878 |
| 996 | Ga0495601_0001112 | 3300053077 | Bacteria | 14736 |
| 997 | Ga0495601_0217567 | 3300053077 | Bacteria | 1247 |
| 998 | Ga0495612_0013653 | 3300053078 | Bacteria | 3271 |
| 999 | Ga0495655_0001758 | 3300053083 | Bacteria | 3363 |
| 1000 | Ga0495595_0011768 | 3300053084 | Bacteria | 3665 |
| 1001 | Ga0495595_0049184 | 3300053084 | Archaea | 1949 |
| 1002 | Ga0495595_0192421 | 3300053084 | Bacteria | 1014 |
| 1003 | Ga0495595_0391885 | 3300053084 | Bacteria | 703 |
| 1004 | Ga0495619_0001848 | 3300053085 | Bacteria | 14098 |
| 1005 | Ga0495619_0013151 | 3300053085 | Bacteria | 5215 |
| 1006 | Ga0495619_0208461 | 3300053085 | Bacteria | 1353 |
| 1007 | Ga0495619_0208963 | 3300053085 | Bacteria | 1352 |
| 1008 | Ga0495619_0264306 | 3300053085 | Bacteria | 1192 |
| 1009 | Ga0495619_0380583 | 3300053085 | Bacteria | 975 |
| 1010 | Ga0501084_0117814 | 3300054114 | Bacteria | 2233 |
| 1011 | Ga0501084_0146488 | 3300054114 | Bacteria | 1989 |
| 1012 | Ga0501084_0576791 | 3300054114 | Bacteria | 950 |
| 1013 | Ga0501084_0791884 | 3300054114 | Unclassified | 798 |
| 1014 | Ga0501082_0049073 | 3300060353 | Bacteria | 3640 |
| 1015 | Ga0501082_0066763 | 3300060353 | Bacteria | 3097 |
| 1016 | Ga0501082_0069889 | 3300060353 | Bacteria | 3024 |
| 1017 | Ga0501082_0232192 | 3300060353 | Bacteria | 1605 |
| 1018 | Ga0466962_0000794 | 3300061719 | Bacteria | 14225 |
| 1019 | Ga0466962_0006426 | 3300061719 | Bacteria | 5641 |
| 1020 | Ga0466962_0034806 | 3300061719 | Bacteria | 2411 |
| 1021 | Ga0466962_0073765 | 3300061719 | Unclassified | 1630 |
| 1022 | Ga0466962_0092458 | 3300061719 | Unclassified | 1450 |
| 1023 | Ga0466962_0138530 | 3300061719 | Bacteria | 1178 |
| 1024 | Ga0466962_0268158 | 3300061719 | Bacteria | 841 |
| 1025 | Ga0530510_0168889 | 3300061734 | Bacteria | 1620 |
| 1026 | Ga0530510_0277033 | 3300061734 | Bacteria | 1252 |
| 1027 | Ga0530510_0287224 | 3300061734 | Unclassified | 1229 |
| 1028 | Ga0530510_0701213 | 3300061734 | Bacteria | 771 |
| 1029 | Ga0530510_1458776 | 3300061734 | Bacteria | 525 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300020070 | Ga0206356_10262733 | Ga0206356_102627331 | 135 |
| 2 | 3300005843 | Ga0068860_101349398 | Ga0068860_1013493981 | 149 |
| 3 | 3300009098 | Ga0105245_10409629 | Ga0105245_104096293 | 149 |
| 4 | 3300009148 | Ga0105243_10855031 | Ga0105243_108550312 | 149 |
| 5 | 3300009176 | Ga0105242_10233078 | Ga0105242_102330783 | 149 |
| 6 | 3300013297 | Ga0157378_10311335 | Ga0157378_103113353 | 149 |
| 7 | 3300026121 | Ga0207683_10818396 | Ga0207683_108183962 | 149 |
| 8 | 3300041452 | Ga0451793_0333081 | Ga0451793_0333081_134_598 | 149 |
| 9 | 3300048917 | Ga0496114_0354604 | Ga0496114_0354604_286_750 | 149 |
| 10 | 3300025922 | Ga0207646_10226230 | Ga0207646_102262303 | 150 |
| 11 | 3300046492 | Ga0495585_0443361 | Ga0495585_0443361_19_477 | 150 |
| 12 | 3300048090 | Ga0495615_0054597 | Ga0495615_0054597_222_680 | 150 |
| 13 | 3300048908 | Ga0496105_0189969 | Ga0496105_0189969_65_523 | 150 |
| 14 | 3300002459 | JGI24751J29686_10029864 | JGI24751J29686_100298642 | 151 |
| 15 | 3300005333 | Ga0070677_10218021 | Ga0070677_102180212 | 151 |
| 16 | 3300005334 | Ga0068869_100186930 | Ga0068869_1001869302 | 151 |
| 17 | 3300005337 | Ga0070682_100004862 | Ga0070682_1000048623 | 151 |
| 18 | 3300005338 | Ga0068868_100090388 | Ga0068868_1000903882 | 151 |
| 19 | 3300005340 | Ga0070689_100007910 | Ga0070689_1000079107 | 151 |
| 20 | 3300005345 | Ga0070692_10028248 | Ga0070692_100282483 | 151 |
| 21 | 3300005347 | Ga0070668_100236833 | Ga0070668_1002368332 | 151 |
| 22 | 3300005354 | Ga0070675_100135730 | Ga0070675_1001357303 | 151 |
| 23 | 3300005355 | Ga0070671_100024898 | Ga0070671_1000248982 | 151 |
| 24 | 3300005356 | Ga0070674_100420967 | Ga0070674_1004209672 | 151 |
| 25 | 3300005364 | Ga0070673_100413504 | Ga0070673_1004135043 | 151 |
| 26 | 3300005365 | Ga0070688_100008089 | Ga0070688_1000080893 | 151 |
| 27 | 3300005366 | Ga0070659_100078257 | Ga0070659_1000782572 | 151 |
| 28 | 3300005367 | Ga0070667_100097501 | Ga0070667_1000975012 | 151 |
| 29 | 3300005434 | Ga0070709_10033600 | Ga0070709_100336003 | 151 |
| 30 | 3300005434 | Ga0070709_10313801 | Ga0070709_103138012 | 151 |
| 31 | 3300005435 | Ga0070714_100350685 | Ga0070714_1003506852 | 151 |
| 32 | 3300005435 | Ga0070714_101412513 | Ga0070714_1014125132 | 151 |
| 33 | 3300005436 | Ga0070713_100088719 | Ga0070713_1000887192 | 151 |
| 34 | 3300005436 | Ga0070713_100729979 | Ga0070713_1007299792 | 151 |
| 35 | 3300005437 | Ga0070710_10016281 | Ga0070710_100162815 | 151 |
| 36 | 3300005438 | Ga0070701_10066150 | Ga0070701_100661502 | 151 |
| 37 | 3300005439 | Ga0070711_100061027 | Ga0070711_1000610274 | 151 |
| 38 | 3300005439 | Ga0070711_100133651 | Ga0070711_1001336513 | 151 |
| 39 | 3300005441 | Ga0070700_100005657 | Ga0070700_1000056574 | 151 |
| 40 | 3300005441 | Ga0070700_100462838 | Ga0070700_1004628382 | 151 |
| 41 | 3300005444 | Ga0070694_100010427 | Ga0070694_1000104274 | 151 |
| 42 | 3300005445 | Ga0070708_100127815 | Ga0070708_1001278153 | 151 |
| 43 | 3300005445 | Ga0070708_100671681 | Ga0070708_1006716813 | 151 |
| 44 | 3300005455 | Ga0070663_100028601 | Ga0070663_1000286012 | 151 |
| 45 | 3300005456 | Ga0070678_100959910 | Ga0070678_1009599102 | 151 |
| 46 | 3300005458 | Ga0070681_10312857 | Ga0070681_103128573 | 151 |
| 47 | 3300005459 | Ga0068867_100116194 | Ga0068867_1001161942 | 151 |
| 48 | 3300005466 | Ga0070685_10038333 | Ga0070685_100383332 | 151 |
| 49 | 3300005467 | Ga0070706_100373835 | Ga0070706_1003738353 | 151 |
| 50 | 3300005468 | Ga0070707_100001607 | Ga0070707_10000160734 | 151 |
| 51 | 3300005468 | Ga0070707_100003988 | Ga0070707_10000398811 | 151 |
| 52 | 3300005468 | Ga0070707_100360090 | Ga0070707_1003600903 | 151 |
| 53 | 3300005468 | Ga0070707_100735109 | Ga0070707_1007351091 | 151 |
| 54 | 3300005471 | Ga0070698_100052057 | Ga0070698_1000520574 | 151 |
| 55 | 3300005471 | Ga0070698_100114603 | Ga0070698_1001146033 | 151 |
| 56 | 3300005471 | Ga0070698_100192052 | Ga0070698_1001920524 | 151 |
| 57 | 3300005471 | Ga0070698_101142715 | Ga0070698_1011427152 | 151 |
| 58 | 3300005518 | Ga0070699_100181543 | Ga0070699_1001815434 | 151 |
| 59 | 3300005518 | Ga0070699_100850918 | Ga0070699_1008509181 | 151 |
| 60 | 3300005518 | Ga0070699_101042966 | Ga0070699_1010429662 | 151 |
| 61 | 3300005530 | Ga0070679_100674825 | Ga0070679_1006748251 | 151 |
| 62 | 3300005536 | Ga0070697_100105658 | Ga0070697_1001056582 | 151 |
| 63 | 3300005536 | Ga0070697_100679420 | Ga0070697_1006794201 | 151 |
| 64 | 3300005539 | Ga0068853_100012336 | Ga0068853_1000123367 | 151 |
| 65 | 3300005543 | Ga0070672_100033472 | Ga0070672_1000334724 | 151 |
| 66 | 3300005544 | Ga0070686_100007592 | Ga0070686_1000075921 | 151 |
| 67 | 3300005548 | Ga0070665_100090983 | Ga0070665_1000909834 | 151 |
| 68 | 3300005548 | Ga0070665_100202007 | Ga0070665_1002020073 | 151 |
| 69 | 3300005548 | Ga0070665_100870218 | Ga0070665_1008702182 | 151 |
| 70 | 3300005563 | Ga0068855_100066978 | Ga0068855_1000669784 | 151 |
| 71 | 3300005563 | Ga0068855_100182643 | Ga0068855_1001826432 | 151 |
| 72 | 3300005614 | Ga0068856_100035377 | Ga0068856_1000353773 | 151 |
| 73 | 3300005616 | Ga0068852_100022989 | Ga0068852_1000229895 | 151 |
| 74 | 3300005617 | Ga0068859_100266234 | Ga0068859_1002662341 | 151 |
| 75 | 3300005618 | Ga0068864_100130691 | Ga0068864_1001306912 | 151 |
| 76 | 3300005618 | Ga0068864_100259900 | Ga0068864_1002599002 | 151 |
| 77 | 3300005718 | Ga0068866_10003027 | Ga0068866_100030274 | 151 |
| 78 | 3300005843 | Ga0068860_100188377 | Ga0068860_1001883773 | 151 |
| 79 | 3300005844 | Ga0068862_101099954 | Ga0068862_1010999542 | 151 |
| 80 | 3300005981 | Ga0081538_10079840 | Ga0081538_100798402 | 151 |
| 81 | 3300006173 | Ga0070716_101050683 | Ga0070716_1010506832 | 151 |
| 82 | 3300006175 | Ga0070712_100041602 | Ga0070712_1000416024 | 151 |
| 83 | 3300006237 | Ga0097621_100021679 | Ga0097621_1000216795 | 151 |
| 84 | 3300006358 | Ga0068871_100040618 | Ga0068871_1000406182 | 151 |
| 85 | 3300006844 | Ga0075428_100388149 | Ga0075428_1003881492 | 151 |
| 86 | 3300006846 | Ga0075430_100003551 | Ga0075430_1000035512 | 151 |
| 87 | 3300006847 | Ga0075431_100056106 | Ga0075431_1000561065 | 151 |
| 88 | 3300006871 | Ga0075434_100003532 | Ga0075434_10000353213 | 151 |
| 89 | 3300006871 | Ga0075434_100095449 | Ga0075434_1000954493 | 151 |
| 90 | 3300006871 | Ga0075434_100439384 | Ga0075434_1004393841 | 151 |
| 91 | 3300006880 | Ga0075429_100177152 | Ga0075429_1001771523 | 151 |
| 92 | 3300006880 | Ga0075429_100283676 | Ga0075429_1002836762 | 151 |
| 93 | 3300006881 | Ga0068865_100002392 | Ga0068865_1000023923 | 151 |
| 94 | 3300006881 | Ga0068865_100073604 | Ga0068865_1000736042 | 151 |
| 95 | 3300006914 | Ga0075436_101021753 | Ga0075436_1010217531 | 151 |
| 96 | 3300006931 | Ga0097620_100266227 | Ga0097620_1002662274 | 151 |
| 97 | 3300007076 | Ga0075435_100011506 | Ga0075435_1000115067 | 151 |
| 98 | 3300007076 | Ga0075435_100174150 | Ga0075435_1001741502 | 151 |
| 99 | 3300009093 | Ga0105240_10355716 | Ga0105240_103557163 | 151 |
| 100 | 3300009094 | Ga0111539_10014355 | Ga0111539_100143559 | 151 |
| 101 | 3300009094 | Ga0111539_10086472 | Ga0111539_100864722 | 151 |
| 102 | 3300009094 | Ga0111539_10821363 | Ga0111539_108213632 | 151 |
| 103 | 3300009094 | Ga0111539_12519810 | Ga0111539_125198102 | 151 |
| 104 | 3300009098 | Ga0105245_10033732 | Ga0105245_100337323 | 151 |
| 105 | 3300009098 | Ga0105245_10116058 | Ga0105245_101160583 | 151 |
| 106 | 3300009147 | Ga0114129_10046212 | Ga0114129_100462126 | 151 |
| 107 | 3300009147 | Ga0114129_10794502 | Ga0114129_107945021 | 151 |
| 108 | 3300009148 | Ga0105243_10033294 | Ga0105243_100332942 | 151 |
| 109 | 3300009148 | Ga0105243_11106201 | Ga0105243_111062012 | 151 |
| 110 | 3300009174 | Ga0105241_10062546 | Ga0105241_100625464 | 151 |
| 111 | 3300009176 | Ga0105242_10003093 | Ga0105242_100030932 | 151 |
| 112 | 3300009177 | Ga0105248_10026898 | Ga0105248_100268987 | 151 |
| 113 | 3300009545 | Ga0105237_10033527 | Ga0105237_100335275 | 151 |
| 114 | 3300009551 | Ga0105238_10071537 | Ga0105238_100715372 | 151 |
| 115 | 3300009553 | Ga0105249_10001129 | Ga0105249_1000112924 | 151 |
| 116 | 3300010375 | Ga0105239_10114040 | Ga0105239_101140405 | 151 |
| 117 | 3300011119 | Ga0105246_10082381 | Ga0105246_100823812 | 151 |
| 118 | 3300012502 | Ga0157347_1014097 | Ga0157347_10140971 | 151 |
| 119 | 3300012510 | Ga0157316_1026975 | Ga0157316_10269752 | 151 |
| 120 | 3300013102 | Ga0157371_10048863 | Ga0157371_100488635 | 151 |
| 121 | 3300013296 | Ga0157374_10035553 | Ga0157374_100355534 | 151 |
| 122 | 3300013296 | Ga0157374_10275441 | Ga0157374_102754413 | 151 |
| 123 | 3300013306 | Ga0163162_10006515 | Ga0163162_1000651512 | 151 |
| 124 | 3300013308 | Ga0157375_10104469 | Ga0157375_101044692 | 151 |
| 125 | 3300014325 | Ga0163163_11279269 | Ga0163163_112792692 | 151 |
| 126 | 3300014326 | Ga0157380_10150608 | Ga0157380_101506082 | 151 |
| 127 | 3300014326 | Ga0157380_10423646 | Ga0157380_104236462 | 151 |
| 128 | 3300014745 | Ga0157377_10009433 | Ga0157377_100094335 | 151 |
| 129 | 3300014745 | Ga0157377_10070806 | Ga0157377_100708063 | 151 |
| 130 | 3300014968 | Ga0157379_10250686 | Ga0157379_102506862 | 151 |
| 131 | 3300014968 | Ga0157379_10442200 | Ga0157379_104422003 | 151 |
| 132 | 3300014969 | Ga0157376_10037609 | Ga0157376_100376092 | 151 |
| 133 | 3300014969 | Ga0157376_11085808 | Ga0157376_110858082 | 151 |
| 134 | 3300031548 | Ga0307408_101099614 | Ga0307408_1010996141 | 151 |
| 135 | 3300032126 | Ga0307415_100320294 | Ga0307415_1003202941 | 151 |
| 136 | 3300048911 | Ga0496108_0500021 | Ga0496108_0500021_137_595 | 151 |
| 137 | 3300048912 | Ga0496109_0213436 | Ga0496109_0213436_943_1401 | 151 |
| 138 | 3300005336 | Ga0070680_100086399 | Ga0070680_1000863992 | 152 |
| 139 | 3300005339 | Ga0070660_100067598 | Ga0070660_1000675984 | 152 |
| 140 | 3300005339 | Ga0070660_100220390 | Ga0070660_1002203903 | 152 |
| 141 | 3300005341 | Ga0070691_10150460 | Ga0070691_101504602 | 152 |
| 142 | 3300005345 | Ga0070692_10394693 | Ga0070692_103946931 | 152 |
| 143 | 3300005366 | Ga0070659_100075498 | Ga0070659_1000754982 | 152 |
| 144 | 3300005435 | Ga0070714_100041880 | Ga0070714_1000418804 | 152 |
| 145 | 3300005435 | Ga0070714_100055569 | Ga0070714_1000555694 | 152 |
| 146 | 3300005435 | Ga0070714_100155133 | Ga0070714_1001551332 | 152 |
| 147 | 3300005435 | Ga0070714_100300780 | Ga0070714_1003007801 | 152 |
| 148 | 3300005435 | Ga0070714_101019294 | Ga0070714_1010192941 | 152 |
| 149 | 3300005436 | Ga0070713_100039071 | Ga0070713_1000390715 | 152 |
| 150 | 3300005457 | Ga0070662_100813402 | Ga0070662_1008134021 | 152 |
| 151 | 3300005458 | Ga0070681_10026696 | Ga0070681_100266962 | 152 |
| 152 | 3300005458 | Ga0070681_10112138 | Ga0070681_101121383 | 152 |
| 153 | 3300005518 | Ga0070699_101515277 | Ga0070699_1015152772 | 152 |
| 154 | 3300005530 | Ga0070679_100120417 | Ga0070679_1001204172 | 152 |
| 155 | 3300005530 | Ga0070679_100794012 | Ga0070679_1007940122 | 152 |
| 156 | 3300005535 | Ga0070684_100049801 | Ga0070684_1000498013 | 152 |
| 157 | 3300005545 | Ga0070695_100015857 | Ga0070695_1000158576 | 152 |
| 158 | 3300005546 | Ga0070696_100114749 | Ga0070696_1001147492 | 152 |
| 159 | 3300005614 | Ga0068856_100431644 | Ga0068856_1004316442 | 152 |
| 160 | 3300005841 | Ga0068863_100081637 | Ga0068863_1000816372 | 152 |
| 161 | 3300005937 | Ga0081455_10078009 | Ga0081455_100780093 | 152 |
| 162 | 3300005985 | Ga0081539_10026936 | Ga0081539_100269361 | 152 |
| 163 | 3300006028 | Ga0070717_10010680 | Ga0070717_100106804 | 152 |
| 164 | 3300006028 | Ga0070717_10186870 | Ga0070717_101868701 | 152 |
| 165 | 3300006028 | Ga0070717_10383940 | Ga0070717_103839402 | 152 |
| 166 | 3300006028 | Ga0070717_10619643 | Ga0070717_106196432 | 152 |
| 167 | 3300006173 | Ga0070716_100254273 | Ga0070716_1002542732 | 152 |
| 168 | 3300006173 | Ga0070716_100408304 | Ga0070716_1004083042 | 152 |
| 169 | 3300006175 | Ga0070712_100218667 | Ga0070712_1002186672 | 152 |
| 170 | 3300006175 | Ga0070712_100501332 | Ga0070712_1005013322 | 152 |
| 171 | 3300006852 | Ga0075433_10255570 | Ga0075433_102555702 | 152 |
| 172 | 3300006852 | Ga0075433_10270432 | Ga0075433_102704323 | 152 |
| 173 | 3300006871 | Ga0075434_100013149 | Ga0075434_1000131495 | 152 |
| 174 | 3300006871 | Ga0075434_100089619 | Ga0075434_1000896193 | 152 |
| 175 | 3300006881 | Ga0068865_100647113 | Ga0068865_1006471132 | 152 |
| 176 | 3300006914 | Ga0075436_100148767 | Ga0075436_1001487674 | 152 |
| 177 | 3300006914 | Ga0075436_100338492 | Ga0075436_1003384923 | 152 |
| 178 | 3300006914 | Ga0075436_100495690 | Ga0075436_1004956902 | 152 |
| 179 | 3300007076 | Ga0075435_100103392 | Ga0075435_1001033923 | 152 |
| 180 | 3300009093 | Ga0105240_10018876 | Ga0105240_100188765 | 152 |
| 181 | 3300009176 | Ga0105242_12301201 | Ga0105242_123012011 | 152 |
| 182 | 3300009545 | Ga0105237_10017342 | Ga0105237_100173427 | 152 |
| 183 | 3300011119 | Ga0105246_10334365 | Ga0105246_103343651 | 152 |
| 184 | 3300013104 | Ga0157370_10825476 | Ga0157370_108254761 | 152 |
| 185 | 3300013105 | Ga0157369_10665272 | Ga0157369_106652722 | 152 |
| 186 | 3300013306 | Ga0163162_10254301 | Ga0163162_102543012 | 152 |
| 187 | 3300013307 | Ga0157372_10040194 | Ga0157372_100401943 | 152 |
| 188 | 3300013307 | Ga0157372_10373262 | Ga0157372_103732622 | 152 |
| 189 | 3300014968 | Ga0157379_11251788 | Ga0157379_112517882 | 152 |
| 190 | 3300015262 | Ga0182007_10053513 | Ga0182007_100535132 | 152 |
| 191 | 3300021441 | Ga0213871_10007472 | Ga0213871_100074723 | 152 |
| 192 | 3300025905 | Ga0207685_10027301 | Ga0207685_100273011 | 152 |
| 193 | 3300025905 | Ga0207685_10077729 | Ga0207685_100777291 | 152 |
| 194 | 3300025906 | Ga0207699_10013206 | Ga0207699_100132064 | 152 |
| 195 | 3300025906 | Ga0207699_10679624 | Ga0207699_106796242 | 152 |
| 196 | 3300025912 | Ga0207707_10438598 | Ga0207707_104385982 | 152 |
| 197 | 3300025915 | Ga0207693_10829848 | Ga0207693_108298482 | 152 |
| 198 | 3300025917 | Ga0207660_10142593 | Ga0207660_101425932 | 152 |
| 199 | 3300025921 | Ga0207652_10780469 | Ga0207652_107804692 | 152 |
| 200 | 3300025922 | Ga0207646_10054237 | Ga0207646_100542373 | 152 |
| 201 | 3300025928 | Ga0207700_10000002 | Ga0207700_10000002192 | 152 |
| 202 | 3300025928 | Ga0207700_10511879 | Ga0207700_105118791 | 152 |
| 203 | 3300025929 | Ga0207664_10043236 | Ga0207664_100432364 | 152 |
| 204 | 3300025929 | Ga0207664_10333495 | Ga0207664_103334952 | 152 |
| 205 | 3300025929 | Ga0207664_10535490 | Ga0207664_105354902 | 152 |
| 206 | 3300025934 | Ga0207686_10198033 | Ga0207686_101980332 | 152 |
| 207 | 3300025939 | Ga0207665_10006081 | Ga0207665_100060812 | 152 |
| 208 | 3300025939 | Ga0207665_10035443 | Ga0207665_100354434 | 152 |
| 209 | 3300025939 | Ga0207665_10695347 | Ga0207665_106953472 | 152 |
| 210 | 3300025941 | Ga0207711_10385571 | Ga0207711_103855712 | 152 |
| 211 | 3300026067 | Ga0207678_10510420 | Ga0207678_105104202 | 152 |
| 212 | 3300026078 | Ga0207702_10223826 | Ga0207702_102238262 | 152 |
| 213 | 3300028563 | Ga0265319_1039088 | Ga0265319_10390881 | 152 |
| 214 | 3300028573 | Ga0265334_10057525 | Ga0265334_100575253 | 152 |
| 215 | 3300028577 | Ga0265318_10094314 | Ga0265318_100943141 | 152 |
| 216 | 3300028577 | Ga0265318_10205284 | Ga0265318_102052842 | 152 |
| 217 | 3300028654 | Ga0265322_10026972 | Ga0265322_100269724 | 152 |
| 218 | 3300028654 | Ga0265322_10222877 | Ga0265322_102228771 | 152 |
| 219 | 3300028800 | Ga0265338_10006871 | Ga0265338_1000687110 | 152 |
| 220 | 3300028800 | Ga0265338_10021008 | Ga0265338_100210084 | 152 |
| 221 | 3300028800 | Ga0265338_10033213 | Ga0265338_100332134 | 152 |
| 222 | 3300028800 | Ga0265338_10283550 | Ga0265338_102835501 | 152 |
| 223 | 3300029957 | Ga0265324_10021263 | Ga0265324_100212634 | 152 |
| 224 | 3300029957 | Ga0265324_10046211 | Ga0265324_100462112 | 152 |
| 225 | 3300031241 | Ga0265325_10115133 | Ga0265325_101151332 | 152 |
| 226 | 3300031249 | Ga0265339_10003596 | Ga0265339_1000359610 | 152 |
| 227 | 3300031249 | Ga0265339_10250913 | Ga0265339_102509132 | 152 |
| 228 | 3300031344 | Ga0265316_10034471 | Ga0265316_100344719 | 152 |
| 229 | 3300031595 | Ga0265313_10005266 | Ga0265313_100052666 | 152 |
| 230 | 3300031595 | Ga0265313_10035236 | Ga0265313_100352365 | 152 |
| 231 | 3300031595 | Ga0265313_10074298 | Ga0265313_100742981 | 152 |
| 232 | 3300031711 | Ga0265314_10018946 | Ga0265314_1001894611 | 152 |
| 233 | 3300031711 | Ga0265314_10264730 | Ga0265314_102647301 | 152 |
| 234 | 3300031712 | Ga0265342_10020754 | Ga0265342_100207545 | 152 |
| 235 | 3300032133 | Ga0316583_10211054 | Ga0316583_102110542 | 152 |
| 236 | 3300035089 | Ga0373944_0175340 | Ga0373944_0175340_145_603 | 152 |
| 237 | 3300035117 | Ga0373953_0144906 | Ga0373953_0144906_60_518 | 152 |
| 238 | 3300035692 | Ga0373935_0749894 | Ga0373935_0749894_58_516 | 152 |
| 239 | 3300035724 | Ga0373933_0106457 | Ga0373933_0106457_990_1448 | 152 |
| 240 | 3300036401 | Ga0373937_1145695 | Ga0373937_1145695_44_502 | 152 |
| 241 | 3300037312 | Ga0395899_0122086 | Ga0395899_0122086_797_1270 | 152 |
| 242 | 3300037312 | Ga0395899_0788968 | Ga0395899_0788968_52_525 | 152 |
| 243 | 3300037418 | Ga0395900_0311147 | Ga0395900_0311147_583_1056 | 152 |
| 244 | 3300037466 | Ga0395898_0054213 | Ga0395898_0054213_782_1255 | 152 |
| 245 | 3300037466 | Ga0395898_0616071 | Ga0395898_0616071_496_954 | 152 |
| 246 | 3300037471 | Ga0395905_0494968 | Ga0395905_0494968_378_851 | 152 |
| 247 | 3300038443 | Ga0395901_0238432 | Ga0395901_0238432_936_1409 | 152 |
| 248 | 3300038443 | Ga0395901_0335626 | Ga0395901_0335626_843_1301 | 152 |
| 249 | 3300038443 | Ga0395901_0449821 | Ga0395901_0449821_415_888 | 152 |
| 250 | 3300038996 | Ga0242420_048160 | Ga0242420_048160_195_653 | 152 |
| 251 | 3300039438 | Ga0436360_0128350 | Ga0436360_0128350_7709_8167 | 152 |
| 252 | 3300039438 | Ga0436360_0322959 | Ga0436360_0322959_204_662 | 152 |
| 253 | 3300039453 | Ga0436362_0303237 | Ga0436362_0303237_104_562 | 152 |
| 254 | 3300039453 | Ga0436362_1041280 | Ga0436362_1041280_187_645 | 152 |
| 255 | 3300044656 | Ga0466969_0010882 | Ga0466969_0010882_3191_3649 | 152 |
| 256 | 3300044656 | Ga0466969_0102123 | Ga0466969_0102123_97_555 | 152 |
| 257 | 3300044683 | Ga0466965_0068408 | Ga0466965_0068408_103_561 | 152 |
| 258 | 3300044683 | Ga0466965_0140309 | Ga0466965_0140309_254_712 | 152 |
| 259 | 3300044684 | Ga0466966_0003367 | Ga0466966_0003367_3261_3719 | 152 |
| 260 | 3300044684 | Ga0466966_0069894 | Ga0466966_0069894_569_1027 | 152 |
| 261 | 3300044684 | Ga0466966_0101116 | Ga0466966_0101116_680_1159 | 152 |
| 262 | 3300044684 | Ga0466966_0142777 | Ga0466966_0142777_209_667 | 152 |
| 263 | 3300044684 | Ga0466966_0502419 | Ga0466966_0502419_193_669 | 152 |
| 264 | 3300044693 | Ga0466961_0115468 | Ga0466961_0115468_562_1020 | 152 |
| 265 | 3300044693 | Ga0466961_0242394 | Ga0466961_0242394_346_804 | 152 |
| 266 | 3300044694 | Ga0466963_0000037 | Ga0466963_0000037_24497_24976 | 152 |
| 267 | 3300044694 | Ga0466963_0002985 | Ga0466963_0002985_8534_8992 | 152 |
| 268 | 3300044694 | Ga0466963_0011378 | Ga0466963_0011378_1578_2036 | 152 |
| 269 | 3300044694 | Ga0466963_0030930 | Ga0466963_0030930_319_777 | 152 |
| 270 | 3300044694 | Ga0466963_0031901 | Ga0466963_0031901_2188_2646 | 152 |
| 271 | 3300044694 | Ga0466963_0070698 | Ga0466963_0070698_389_847 | 152 |
| 272 | 3300044694 | Ga0466963_0499285 | Ga0466963_0499285_379_837 | 152 |
| 273 | 3300044706 | Ga0466964_0008661 | Ga0466964_0008661_1447_1926 | 152 |
| 274 | 3300044706 | Ga0466964_0010906 | Ga0466964_0010906_1135_1593 | 152 |
| 275 | 3300044706 | Ga0466964_0275354 | Ga0466964_0275354_202_660 | 152 |
| 276 | 3300044706 | Ga0466964_0350581 | Ga0466964_0350581_272_730 | 152 |
| 277 | 3300044719 | Ga0466971_0000254 | Ga0466971_0000254_12644_13123 | 152 |
| 278 | 3300044719 | Ga0466971_0021103 | Ga0466971_0021103_1381_1839 | 152 |
| 279 | 3300044719 | Ga0466971_0026637 | Ga0466971_0026637_1801_2259 | 152 |
| 280 | 3300044719 | Ga0466971_0051717 | Ga0466971_0051717_1328_1786 | 152 |
| 281 | 3300044719 | Ga0466971_0480601 | Ga0466971_0480601_70_528 | 152 |
| 282 | 3300044735 | Ga0466968_0002132 | Ga0466968_0002132_3107_3565 | 152 |
| 283 | 3300044735 | Ga0466968_0029866 | Ga0466968_0029866_758_1216 | 152 |
| 284 | 3300044735 | Ga0466968_0142724 | Ga0466968_0142724_382_840 | 152 |
| 285 | 3300044735 | Ga0466968_0430099 | Ga0466968_0430099_10_486 | 152 |
| 286 | 3300044765 | Ga0466970_0035543 | Ga0466970_0035543_769_1248 | 152 |
| 287 | 3300044765 | Ga0466970_0194649 | Ga0466970_0194649_472_930 | 152 |
| 288 | 3300044842 | Ga0466957_0000448 | Ga0466957_0000448_13522_14001 | 152 |
| 289 | 3300044842 | Ga0466957_0001829 | Ga0466957_0001829_1613_2071 | 152 |
| 290 | 3300044842 | Ga0466957_0037381 | Ga0466957_0037381_1911_2369 | 152 |
| 291 | 3300044842 | Ga0466957_0108072 | Ga0466957_0108072_1073_1531 | 152 |
| 292 | 3300044901 | Ga0466960_0518787 | Ga0466960_0518787_162_620 | 152 |
| 293 | 3300045049 | Ga0466959_0007249 | Ga0466959_0007249_6206_6664 | 152 |
| 294 | 3300045049 | Ga0466959_0044436 | Ga0466959_0044436_2674_3132 | 152 |
| 295 | 3300045049 | Ga0466959_0054810 | Ga0466959_0054810_1214_1672 | 152 |
| 296 | 3300045049 | Ga0466959_0084847 | Ga0466959_0084847_1279_1755 | 152 |
| 297 | 3300045049 | Ga0466959_0156558 | Ga0466959_0156558_312_791 | 152 |
| 298 | 3300045049 | Ga0466959_0387342 | Ga0466959_0387342_406_864 | 152 |
| 299 | 3300045049 | Ga0466959_0468185 | Ga0466959_0468185_212_688 | 152 |
| 300 | 3300045049 | Ga0466959_0808790 | Ga0466959_0808790_134_592 | 152 |
| 301 | 3300045836 | Ga0466958_0000148 | Ga0466958_0000148_617_1096 | 152 |
| 302 | 3300045836 | Ga0466958_0003106 | Ga0466958_0003106_660_1118 | 152 |
| 303 | 3300045836 | Ga0466958_0011254 | Ga0466958_0011254_1350_1808 | 152 |
| 304 | 3300045836 | Ga0466958_0054158 | Ga0466958_0054158_337_795 | 152 |
| 305 | 3300045836 | Ga0466958_0054184 | Ga0466958_0054184_152_610 | 152 |
| 306 | 3300045836 | Ga0466958_0075009 | Ga0466958_0075009_694_1152 | 152 |
| 307 | 3300045836 | Ga0466958_0102200 | Ga0466958_0102200_1027_1503 | 152 |
| 308 | 3300045976 | Ga0466967_0001347 | Ga0466967_0001347_6426_6905 | 152 |
| 309 | 3300045976 | Ga0466967_0009541 | Ga0466967_0009541_226_684 | 152 |
| 310 | 3300045976 | Ga0466967_0018176 | Ga0466967_0018176_3912_4370 | 152 |
| 311 | 3300045976 | Ga0466967_0070089 | Ga0466967_0070089_708_1166 | 152 |
| 312 | 3300045976 | Ga0466967_0077176 | Ga0466967_0077176_1018_1476 | 152 |
| 313 | 3300045976 | Ga0466967_0245960 | Ga0466967_0245960_565_1047 | 152 |
| 314 | 3300045976 | Ga0466967_0252204 | Ga0466967_0252204_882_1340 | 152 |
| 315 | 3300045976 | Ga0466967_0682903 | Ga0466967_0682903_417_875 | 152 |
| 316 | 3300045976 | Ga0466967_1253520 | Ga0466967_1253520_67_525 | 152 |
| 317 | 3300046459 | Ga0495629_0033665 | Ga0495629_0033665_1438_1911 | 152 |
| 318 | 3300046459 | Ga0495629_0692992 | Ga0495629_0692992_66_524 | 152 |
| 319 | 3300046461 | Ga0495641_0053659 | Ga0495641_0053659_1349_1807 | 152 |
| 320 | 3300046462 | Ga0495651_0086910 | Ga0495651_0086910_291_749 | 152 |
| 321 | 3300046463 | Ga0495653_0028900 | Ga0495653_0028900_2997_3455 | 152 |
| 322 | 3300046514 | Ga0495618_0157414 | Ga0495618_0157414_383_841 | 152 |
| 323 | 3300046517 | Ga0495630_0049241 | Ga0495630_0049241_1144_1602 | 152 |
| 324 | 3300046517 | Ga0495630_0139944 | Ga0495630_0139944_517_975 | 152 |
| 325 | 3300046517 | Ga0495630_0537494 | Ga0495630_0537494_193_651 | 152 |
| 326 | 3300046517 | Ga0495630_1124873 | Ga0495630_1124873_64_522 | 152 |
| 327 | 3300046523 | Ga0495644_0169650 | Ga0495644_0169650_263_721 | 152 |
| 328 | 3300046525 | Ga0495663_0225661 | Ga0495663_0225661_179_637 | 152 |
| 329 | 3300046529 | Ga0495652_0157880 | Ga0495652_0157880_100_558 | 152 |
| 330 | 3300046529 | Ga0495652_0562398 | Ga0495652_0562398_37_522 | 152 |
| 331 | 3300046536 | Ga0495587_0430646 | Ga0495587_0430646_264_722 | 152 |
| 332 | 3300046543 | Ga0495645_0096485 | Ga0495645_0096485_200_658 | 152 |
| 333 | 3300046559 | Ga0495667_0062029 | Ga0495667_0062029_1138_1596 | 152 |
| 334 | 3300046559 | Ga0495667_0062037 | Ga0495667_0062037_1237_1695 | 152 |
| 335 | 3300046559 | Ga0495667_0090591 | Ga0495667_0090591_1275_1733 | 152 |
| 336 | 3300046559 | Ga0495667_0333940 | Ga0495667_0333940_437_895 | 152 |
| 337 | 3300046642 | Ga0495634_0245756 | Ga0495634_0245756_411_869 | 152 |
| 338 | 3300046675 | Ga0495657_0073618 | Ga0495657_0073618_769_1227 | 152 |
| 339 | 3300046675 | Ga0495657_0116583 | Ga0495657_0116583_348_806 | 152 |
| 340 | 3300046689 | Ga0495613_0274624 | Ga0495613_0274624_139_597 | 152 |
| 341 | 3300046689 | Ga0495613_1096376 | Ga0495613_1096376_38_496 | 152 |
| 342 | 3300047322 | Ga0495680_0143711 | Ga0495680_0143711_384_842 | 152 |
| 343 | 3300047444 | Ga0495675_0081670 | Ga0495675_0081670_1421_1879 | 152 |
| 344 | 3300047471 | Ga0495684_0208753 | Ga0495684_0208753_141_599 | 152 |
| 345 | 3300048088 | Ga0495602_0090849 | Ga0495602_0090849_223_708 | 152 |
| 346 | 3300048088 | Ga0495602_0189574 | Ga0495602_0189574_189_647 | 152 |
| 347 | 3300048904 | Ga0496101_0022844 | Ga0496101_0022844_918_1394 | 152 |
| 348 | 3300048904 | Ga0496101_0087614 | Ga0496101_0087614_800_1273 | 152 |
| 349 | 3300048905 | Ga0496102_0258959 | Ga0496102_0258959_599_1072 | 152 |
| 350 | 3300048906 | Ga0496103_0831652 | Ga0496103_0831652_23_481 | 152 |
| 351 | 3300048907 | Ga0496104_0181134 | Ga0496104_0181134_422_880 | 152 |
| 352 | 3300048907 | Ga0496104_0527974 | Ga0496104_0527974_529_1002 | 152 |
| 353 | 3300048909 | Ga0496106_0123596 | Ga0496106_0123596_1094_1552 | 152 |
| 354 | 3300048909 | Ga0496106_0274547 | Ga0496106_0274547_412_870 | 152 |
| 355 | 3300048909 | Ga0496106_0824665 | Ga0496106_0824665_205_663 | 152 |
| 356 | 3300048910 | Ga0496107_0064067 | Ga0496107_0064067_1358_1834 | 152 |
| 357 | 3300048911 | Ga0496108_0040454 | Ga0496108_0040454_578_1036 | 152 |
| 358 | 3300048912 | Ga0496109_0154556 | Ga0496109_0154556_934_1392 | 152 |
| 359 | 3300048913 | Ga0496110_0091180 | Ga0496110_0091180_845_1303 | 152 |
| 360 | 3300048913 | Ga0496110_0134743 | Ga0496110_0134743_583_1041 | 152 |
| 361 | 3300048914 | Ga0496111_0285657 | Ga0496111_0285657_363_821 | 152 |
| 362 | 3300048915 | Ga0496112_0003665 | Ga0496112_0003665_3193_3651 | 152 |
| 363 | 3300048915 | Ga0496112_0006839 | Ga0496112_0006839_9296_9754 | 152 |
| 364 | 3300048915 | Ga0496112_0084870 | Ga0496112_0084870_629_1087 | 152 |
| 365 | 3300048915 | Ga0496112_0604821 | Ga0496112_0604821_90_548 | 152 |
| 366 | 3300048915 | Ga0496112_1097166 | Ga0496112_1097166_200_658 | 152 |
| 367 | 3300048916 | Ga0496113_0069451 | Ga0496113_0069451_1141_1599 | 152 |
| 368 | 3300048916 | Ga0496113_0085623 | Ga0496113_0085623_570_1028 | 152 |
| 369 | 3300048916 | Ga0496113_0316648 | Ga0496113_0316648_63_539 | 152 |
| 370 | 3300048916 | Ga0496113_0696164 | Ga0496113_0696164_122_580 | 152 |
| 371 | 3300048917 | Ga0496114_0058250 | Ga0496114_0058250_759_1232 | 152 |
| 372 | 3300048918 | Ga0496115_0002049 | Ga0496115_0002049_10650_11123 | 152 |
| 373 | 3300048918 | Ga0496115_0264290 | Ga0496115_0264290_561_1019 | 152 |
| 374 | 3300049577 | Ga0501041_0234751 | Ga0501041_0234751_641_1099 | 152 |
| 375 | 3300049578 | Ga0501042_0382134 | Ga0501042_0382134_94_552 | 152 |
| 376 | 3300049579 | Ga0501043_1129210 | Ga0501043_1129210_55_513 | 152 |
| 377 | 3300049583 | Ga0501067_0002804 | Ga0501067_0002804_490_948 | 152 |
| 378 | 3300049583 | Ga0501067_0002965 | Ga0501067_0002965_963_1421 | 152 |
| 379 | 3300049583 | Ga0501067_0099360 | Ga0501067_0099360_985_1443 | 152 |
| 380 | 3300049584 | Ga0501068_0011617 | Ga0501068_0011617_1812_2270 | 152 |
| 381 | 3300049585 | Ga0501069_0035622 | Ga0501069_0035622_805_1263 | 152 |
| 382 | 3300049585 | Ga0501069_0461598 | Ga0501069_0461598_168_626 | 152 |
| 383 | 3300049586 | Ga0501070_0251789 | Ga0501070_0251789_519_977 | 152 |
| 384 | 3300049588 | Ga0501072_0100526 | Ga0501072_0100526_1730_2188 | 152 |
| 385 | 3300049591 | Ga0501075_0147794 | Ga0501075_0147794_555_1013 | 152 |
| 386 | 3300049591 | Ga0501075_0846829 | Ga0501075_0846829_155_613 | 152 |
| 387 | 3300049592 | Ga0501076_0185714 | Ga0501076_0185714_1119_1577 | 152 |
| 388 | 3300049593 | Ga0501077_0134763 | Ga0501077_0134763_843_1301 | 152 |
| 389 | 3300049741 | Ga0501079_1035281 | Ga0501079_1035281_33_491 | 152 |
| 390 | 3300049742 | Ga0501080_0407259 | Ga0501080_0407259_270_728 | 152 |
| 391 | 3300049823 | Ga0501044_1191020 | Ga0501044_1191020_138_614 | 152 |
| 392 | 3300050512 | nmdc:mga0n895_65535_c1 | nmdc:mga0n895_65535_c1_453_911 | 152 |
| 393 | 3300050513 | nmdc:mga0rr50_445408_c1 | nmdc:mga0rr50_445408_c1_213_671 | 152 |
| 394 | 3300050514 | nmdc:mga08x19_136461_c1 | nmdc:mga08x19_136461_c1_559_1017 | 152 |
| 395 | 3300050514 | nmdc:mga08x19_477598_c1 | nmdc:mga08x19_477598_c1_135_593 | 152 |
| 396 | 3300050515 | nmdc:mga0a205_1061274_c1 | nmdc:mga0a205_1061274_c1_131_589 | 152 |
| 397 | 3300050515 | nmdc:mga0a205_185681_c1 | nmdc:mga0a205_185681_c1_861_1319 | 152 |
| 398 | 3300053083 | Ga0495655_0001758 | Ga0495655_0001758_1407_1883 | 152 |
| 399 | 3300053084 | Ga0495595_0049184 | Ga0495595_0049184_177_635 | 152 |
| 400 | 3300053084 | Ga0495595_0192421 | Ga0495595_0192421_126_584 | 152 |
| 401 | 3300053085 | Ga0495619_0013151 | Ga0495619_0013151_3822_4280 | 152 |
| 402 | 3300053085 | Ga0495619_0208963 | Ga0495619_0208963_618_1076 | 152 |
| 403 | 3300054114 | Ga0501084_0117814 | Ga0501084_0117814_685_1143 | 152 |
| 404 | 3300054114 | Ga0501084_0146488 | Ga0501084_0146488_111_569 | 152 |
| 405 | 3300060353 | Ga0501082_0049073 | Ga0501082_0049073_1481_1939 | 152 |
| 406 | 3300061719 | Ga0466962_0000794 | Ga0466962_0000794_6542_7021 | 152 |
| 407 | 3300061719 | Ga0466962_0006426 | Ga0466962_0006426_193_651 | 152 |
| 408 | 3300061719 | Ga0466962_0034806 | Ga0466962_0034806_1939_2397 | 152 |
| 409 | 3300061719 | Ga0466962_0092458 | Ga0466962_0092458_331_789 | 152 |
| 410 | 3300061734 | Ga0530510_0168889 | Ga0530510_0168889_937_1395 | 152 |
| 411 | 3300005327 | Ga0070658_10160868 | Ga0070658_101608683 | 153 |
| 412 | 3300005329 | Ga0070683_100003039 | Ga0070683_1000030395 | 153 |
| 413 | 3300005329 | Ga0070683_100238961 | Ga0070683_1002389613 | 153 |
| 414 | 3300005336 | Ga0070680_100420930 | Ga0070680_1004209302 | 153 |
| 415 | 3300005337 | Ga0070682_100076428 | Ga0070682_1000764282 | 153 |
| 416 | 3300005338 | Ga0068868_100426691 | Ga0068868_1004266912 | 153 |
| 417 | 3300005366 | Ga0070659_101004060 | Ga0070659_1010040601 | 153 |
| 418 | 3300005434 | Ga0070709_10231665 | Ga0070709_102316652 | 153 |
| 419 | 3300005436 | Ga0070713_100392050 | Ga0070713_1003920502 | 153 |
| 420 | 3300005437 | Ga0070710_10447774 | Ga0070710_104477741 | 153 |
| 421 | 3300005439 | Ga0070711_100008896 | Ga0070711_1000088963 | 153 |
| 422 | 3300005439 | Ga0070711_100295805 | Ga0070711_1002958051 | 153 |
| 423 | 3300005440 | Ga0070705_100164040 | Ga0070705_1001640401 | 153 |
| 424 | 3300005445 | Ga0070708_100035231 | Ga0070708_1000352316 | 153 |
| 425 | 3300005445 | Ga0070708_100099088 | Ga0070708_1000990882 | 153 |
| 426 | 3300005455 | Ga0070663_100911941 | Ga0070663_1009119411 | 153 |
| 427 | 3300005457 | Ga0070662_100363614 | Ga0070662_1003636143 | 153 |
| 428 | 3300005458 | Ga0070681_10054579 | Ga0070681_100545794 | 153 |
| 429 | 3300005467 | Ga0070706_100079146 | Ga0070706_1000791463 | 153 |
| 430 | 3300005468 | Ga0070707_100000419 | Ga0070707_10000041958 | 153 |
| 431 | 3300005468 | Ga0070707_100236109 | Ga0070707_1002361092 | 153 |
| 432 | 3300005471 | Ga0070698_100045939 | Ga0070698_1000459393 | 153 |
| 433 | 3300005471 | Ga0070698_100193050 | Ga0070698_1001930502 | 153 |
| 434 | 3300005518 | Ga0070699_100372920 | Ga0070699_1003729202 | 153 |
| 435 | 3300005530 | Ga0070679_100041373 | Ga0070679_1000413732 | 153 |
| 436 | 3300005535 | Ga0070684_100037440 | Ga0070684_1000374403 | 153 |
| 437 | 3300005544 | Ga0070686_101019007 | Ga0070686_1010190072 | 153 |
| 438 | 3300005563 | Ga0068855_100244501 | Ga0068855_1002445013 | 153 |
| 439 | 3300005563 | Ga0068855_100727697 | Ga0068855_1007276973 | 153 |
| 440 | 3300005577 | Ga0068857_100121899 | Ga0068857_1001218993 | 153 |
| 441 | 3300005578 | Ga0068854_101034569 | Ga0068854_1010345691 | 153 |
| 442 | 3300005614 | Ga0068856_100341942 | Ga0068856_1003419422 | 153 |
| 443 | 3300005718 | Ga0068866_10494740 | Ga0068866_104947402 | 153 |
| 444 | 3300005834 | Ga0068851_10808382 | Ga0068851_108083821 | 153 |
| 445 | 3300005841 | Ga0068863_100272785 | Ga0068863_1002727851 | 153 |
| 446 | 3300005985 | Ga0081539_10055432 | Ga0081539_100554323 | 153 |
| 447 | 3300006028 | Ga0070717_10019680 | Ga0070717_100196805 | 153 |
| 448 | 3300006028 | Ga0070717_10029685 | Ga0070717_100296852 | 153 |
| 449 | 3300006058 | Ga0075432_10015184 | Ga0075432_100151843 | 153 |
| 450 | 3300006173 | Ga0070716_100064676 | Ga0070716_1000646763 | 153 |
| 451 | 3300006175 | Ga0070712_100040223 | Ga0070712_1000402235 | 153 |
| 452 | 3300006175 | Ga0070712_100115633 | Ga0070712_1001156334 | 153 |
| 453 | 3300006178 | Ga0075367_10161378 | Ga0075367_101613782 | 153 |
| 454 | 3300006353 | Ga0075370_10386093 | Ga0075370_103860932 | 153 |
| 455 | 3300006847 | Ga0075431_100065229 | Ga0075431_1000652293 | 153 |
| 456 | 3300006852 | Ga0075433_10003167 | Ga0075433_1000316714 | 153 |
| 457 | 3300006852 | Ga0075433_10032871 | Ga0075433_100328713 | 153 |
| 458 | 3300006871 | Ga0075434_100022158 | Ga0075434_1000221582 | 153 |
| 459 | 3300006871 | Ga0075434_100027641 | Ga0075434_1000276412 | 153 |
| 460 | 3300006881 | Ga0068865_101687097 | Ga0068865_1016870971 | 153 |
| 461 | 3300006914 | Ga0075436_100026821 | Ga0075436_1000268215 | 153 |
| 462 | 3300007076 | Ga0075435_100050093 | Ga0075435_1000500932 | 153 |
| 463 | 3300009093 | Ga0105240_10206915 | Ga0105240_102069154 | 153 |
| 464 | 3300009094 | Ga0111539_10459599 | Ga0111539_104595992 | 153 |
| 465 | 3300009094 | Ga0111539_10523362 | Ga0111539_105233622 | 153 |
| 466 | 3300009098 | Ga0105245_10184692 | Ga0105245_101846923 | 153 |
| 467 | 3300009098 | Ga0105245_10214751 | Ga0105245_102147512 | 153 |
| 468 | 3300009147 | Ga0114129_10002076 | Ga0114129_100020768 | 153 |
| 469 | 3300009147 | Ga0114129_10047402 | Ga0114129_100474022 | 153 |
| 470 | 3300009147 | Ga0114129_10682440 | Ga0114129_106824403 | 153 |
| 471 | 3300009147 | Ga0114129_12249354 | Ga0114129_122493542 | 153 |
| 472 | 3300009148 | Ga0105243_10189386 | Ga0105243_101893862 | 153 |
| 473 | 3300009177 | Ga0105248_10088812 | Ga0105248_100888122 | 153 |
| 474 | 3300009177 | Ga0105248_11844089 | Ga0105248_118440891 | 153 |
| 475 | 3300009551 | Ga0105238_10054416 | Ga0105238_100544162 | 153 |
| 476 | 3300009553 | Ga0105249_11876665 | Ga0105249_118766651 | 153 |
| 477 | 3300010375 | Ga0105239_10910247 | Ga0105239_109102471 | 153 |
| 478 | 3300011119 | Ga0105246_10291556 | Ga0105246_102915563 | 153 |
| 479 | 3300013104 | Ga0157370_10367683 | Ga0157370_103676832 | 153 |
| 480 | 3300013105 | Ga0157369_10038160 | Ga0157369_100381604 | 153 |
| 481 | 3300013296 | Ga0157374_11103443 | Ga0157374_111034432 | 153 |
| 482 | 3300013307 | Ga0157372_11485226 | Ga0157372_114852262 | 153 |
| 483 | 3300013308 | Ga0157375_10387811 | Ga0157375_103878112 | 153 |
| 484 | 3300014325 | Ga0163163_12136958 | Ga0163163_121369581 | 153 |
| 485 | 3300014969 | Ga0157376_10007904 | Ga0157376_100079047 | 153 |
| 486 | 3300014969 | Ga0157376_10264839 | Ga0157376_102648392 | 153 |
| 487 | 3300020070 | Ga0206356_10787478 | Ga0206356_107874783 | 153 |
| 488 | 3300020070 | Ga0206356_11730020 | Ga0206356_117300201 | 153 |
| 489 | 3300020081 | Ga0206354_10520745 | Ga0206354_105207453 | 153 |
| 490 | 3300020081 | Ga0206354_10569858 | Ga0206354_105698582 | 153 |
| 491 | 3300020082 | Ga0206353_11087294 | Ga0206353_110872943 | 153 |
| 492 | 3300025898 | Ga0207692_10038360 | Ga0207692_100383603 | 153 |
| 493 | 3300025906 | Ga0207699_10035692 | Ga0207699_100356924 | 153 |
| 494 | 3300025906 | Ga0207699_10040944 | Ga0207699_100409443 | 153 |
| 495 | 3300025906 | Ga0207699_10065567 | Ga0207699_100655674 | 153 |
| 496 | 3300025909 | Ga0207705_10385289 | Ga0207705_103852892 | 153 |
| 497 | 3300025912 | Ga0207707_10047170 | Ga0207707_100471705 | 153 |
| 498 | 3300025912 | Ga0207707_10169485 | Ga0207707_101694852 | 153 |
| 499 | 3300025913 | Ga0207695_10152810 | Ga0207695_101528102 | 153 |
| 500 | 3300025915 | Ga0207693_10011542 | Ga0207693_100115426 | 153 |
| 501 | 3300025915 | Ga0207693_10012563 | Ga0207693_100125633 | 153 |
| 502 | 3300025916 | Ga0207663_10420265 | Ga0207663_104202652 | 153 |
| 503 | 3300025916 | Ga0207663_10449672 | Ga0207663_104496722 | 153 |
| 504 | 3300025919 | Ga0207657_10007057 | Ga0207657_100070576 | 153 |
| 505 | 3300025920 | Ga0207649_10086997 | Ga0207649_100869972 | 153 |
| 506 | 3300025921 | Ga0207652_10022340 | Ga0207652_100223406 | 153 |
| 507 | 3300025921 | Ga0207652_10815415 | Ga0207652_108154151 | 153 |
| 508 | 3300025922 | Ga0207646_10003186 | Ga0207646_1000318614 | 153 |
| 509 | 3300025924 | Ga0207694_10311660 | Ga0207694_103116602 | 153 |
| 510 | 3300025927 | Ga0207687_10115735 | Ga0207687_101157353 | 153 |
| 511 | 3300025927 | Ga0207687_10607600 | Ga0207687_106076002 | 153 |
| 512 | 3300025928 | Ga0207700_10245302 | Ga0207700_102453022 | 153 |
| 513 | 3300025929 | Ga0207664_10129302 | Ga0207664_101293023 | 153 |
| 514 | 3300025929 | Ga0207664_10153151 | Ga0207664_101531513 | 153 |
| 515 | 3300025929 | Ga0207664_10293460 | Ga0207664_102934602 | 153 |
| 516 | 3300025933 | Ga0207706_11112823 | Ga0207706_111128231 | 153 |
| 517 | 3300025937 | Ga0207669_10138624 | Ga0207669_101386243 | 153 |
| 518 | 3300025938 | Ga0207704_10274267 | Ga0207704_102742673 | 153 |
| 519 | 3300025939 | Ga0207665_10034021 | Ga0207665_100340212 | 153 |
| 520 | 3300025939 | Ga0207665_10063722 | Ga0207665_100637222 | 153 |
| 521 | 3300025941 | Ga0207711_10421677 | Ga0207711_104216771 | 153 |
| 522 | 3300025944 | Ga0207661_10028822 | Ga0207661_100288225 | 153 |
| 523 | 3300025944 | Ga0207661_10243765 | Ga0207661_102437652 | 153 |
| 524 | 3300025944 | Ga0207661_10277722 | Ga0207661_102777222 | 153 |
| 525 | 3300025945 | Ga0207679_10111311 | Ga0207679_101113113 | 153 |
| 526 | 3300025949 | Ga0207667_10292677 | Ga0207667_102926772 | 153 |
| 527 | 3300025981 | Ga0207640_11420574 | Ga0207640_114205742 | 153 |
| 528 | 3300025986 | Ga0207658_10945171 | Ga0207658_109451712 | 153 |
| 529 | 3300026078 | Ga0207702_10261651 | Ga0207702_102616512 | 153 |
| 530 | 3300026078 | Ga0207702_10482675 | Ga0207702_104826752 | 153 |
| 531 | 3300026078 | Ga0207702_10604575 | Ga0207702_106045752 | 153 |
| 532 | 3300026116 | Ga0207674_11273260 | Ga0207674_112732602 | 153 |
| 533 | 3300026121 | Ga0207683_10297370 | Ga0207683_102973703 | 153 |
| 534 | 3300026142 | Ga0207698_10403011 | Ga0207698_104030111 | 153 |
| 535 | 3300027907 | Ga0207428_10197966 | Ga0207428_101979663 | 153 |
| 536 | 3300034957 | Ga0373938_0216897 | Ga0373938_0216897_11_484 | 153 |
| 537 | 3300035086 | Ga0373934_0052817 | Ga0373934_0052817_817_1299 | 153 |
| 538 | 3300035172 | Ga0373955_0229676 | Ga0373955_0229676_260_742 | 153 |
| 539 | 3300035410 | Ga0373924_0021732 | Ga0373924_0021732_312_794 | 153 |
| 540 | 3300035724 | Ga0373933_0321505 | Ga0373933_0321505_413_895 | 153 |
| 541 | 3300036401 | Ga0373937_0000355 | Ga0373937_0000355_37925_38407 | 153 |
| 542 | 3300036401 | Ga0373937_0091047 | Ga0373937_0091047_1355_1837 | 153 |
| 543 | 3300036401 | Ga0373937_0298173 | Ga0373937_0298173_402_884 | 153 |
| 544 | 3300037312 | Ga0395899_0071039 | Ga0395899_0071039_1601_2083 | 153 |
| 545 | 3300037312 | Ga0395899_0708601 | Ga0395899_0708601_146_613 | 153 |
| 546 | 3300037418 | Ga0395900_0002117 | Ga0395900_0002117_17441_17908 | 153 |
| 547 | 3300037418 | Ga0395900_0059737 | Ga0395900_0059737_19_501 | 153 |
| 548 | 3300037418 | Ga0395900_0077708 | Ga0395900_0077708_2506_2973 | 153 |
| 549 | 3300037466 | Ga0395898_0001862 | Ga0395898_0001862_24418_24885 | 153 |
| 550 | 3300037466 | Ga0395898_0012734 | Ga0395898_0012734_5172_5639 | 153 |
| 551 | 3300037466 | Ga0395898_0043527 | Ga0395898_0043527_3406_3888 | 153 |
| 552 | 3300037466 | Ga0395898_0197609 | Ga0395898_0197609_1160_1633 | 153 |
| 553 | 3300037466 | Ga0395898_0484565 | Ga0395898_0484565_549_1031 | 153 |
| 554 | 3300037471 | Ga0395905_0006129 | Ga0395905_0006129_9456_9923 | 153 |
| 555 | 3300037471 | Ga0395905_0029868 | Ga0395905_0029868_1783_2250 | 153 |
| 556 | 3300037471 | Ga0395905_0083375 | Ga0395905_0083375_1064_1537 | 153 |
| 557 | 3300037471 | Ga0395905_0414010 | Ga0395905_0414010_186_668 | 153 |
| 558 | 3300038443 | Ga0395901_0002058 | Ga0395901_0002058_15548_16015 | 153 |
| 559 | 3300038443 | Ga0395901_0006996 | Ga0395901_0006996_2094_2561 | 153 |
| 560 | 3300038443 | Ga0395901_0207248 | Ga0395901_0207248_315_788 | 153 |
| 561 | 3300038443 | Ga0395901_0611650 | Ga0395901_0611650_542_1021 | 153 |
| 562 | 3300038996 | Ga0242420_021660 | Ga0242420_021660_353_820 | 153 |
| 563 | 3300039450 | Ga0436363_0954544 | Ga0436363_0954544_259_741 | 153 |
| 564 | 3300041406 | Ga0439439_0003235 | Ga0439439_0003235_2434_2949 | 153 |
| 565 | 3300041410 | Ga0439461_0041228 | Ga0439461_0041228_331_846 | 153 |
| 566 | 3300041997 | Ga0439431_0055587 | Ga0439431_0055587_59_574 | 153 |
| 567 | 3300041999 | Ga0439433_0001716 | Ga0439433_0001716_1149_1664 | 153 |
| 568 | 3300042002 | Ga0439442_032183 | Ga0439442_032183_314_829 | 153 |
| 569 | 3300042007 | Ga0439449_0008224 | Ga0439449_0008224_1913_2428 | 153 |
| 570 | 3300042011 | Ga0439454_019439 | Ga0439454_019439_407_892 | 153 |
| 571 | 3300042015 | Ga0439462_0017304 | Ga0439462_0017304_280_795 | 153 |
| 572 | 3300042122 | Ga0450920_011767 | Ga0450920_011767_183_668 | 153 |
| 573 | 3300042156 | Ga0439446_0009557 | Ga0439446_0009557_2044_2559 | 153 |
| 574 | 3300044656 | Ga0466969_0000591 | Ga0466969_0000591_405_887 | 153 |
| 575 | 3300044683 | Ga0466965_0032491 | Ga0466965_0032491_1762_2244 | 153 |
| 576 | 3300044683 | Ga0466965_0056596 | Ga0466965_0056596_1166_1648 | 153 |
| 577 | 3300044693 | Ga0466961_0008344 | Ga0466961_0008344_3636_4118 | 153 |
| 578 | 3300044693 | Ga0466961_0115240 | Ga0466961_0115240_1195_1677 | 153 |
| 579 | 3300044694 | Ga0466963_0000670 | Ga0466963_0000670_5386_5868 | 153 |
| 580 | 3300044694 | Ga0466963_0001565 | Ga0466963_0001565_5401_5883 | 153 |
| 581 | 3300044694 | Ga0466963_0001933 | Ga0466963_0001933_6878_7360 | 153 |
| 582 | 3300044694 | Ga0466963_0006848 | Ga0466963_0006848_3451_3933 | 153 |
| 583 | 3300044694 | Ga0466963_0058286 | Ga0466963_0058286_691_1173 | 153 |
| 584 | 3300044694 | Ga0466963_0069923 | Ga0466963_0069923_653_1135 | 153 |
| 585 | 3300044694 | Ga0466963_0080094 | Ga0466963_0080094_408_890 | 153 |
| 586 | 3300044706 | Ga0466964_0044673 | Ga0466964_0044673_1192_1674 | 153 |
| 587 | 3300044706 | Ga0466964_0055534 | Ga0466964_0055534_493_975 | 153 |
| 588 | 3300044706 | Ga0466964_0058045 | Ga0466964_0058045_813_1295 | 153 |
| 589 | 3300044719 | Ga0466971_0002846 | Ga0466971_0002846_421_903 | 153 |
| 590 | 3300044719 | Ga0466971_0083352 | Ga0466971_0083352_719_1201 | 153 |
| 591 | 3300044735 | Ga0466968_0013032 | Ga0466968_0013032_2697_3179 | 153 |
| 592 | 3300044735 | Ga0466968_0029981 | Ga0466968_0029981_430_912 | 153 |
| 593 | 3300044735 | Ga0466968_0037552 | Ga0466968_0037552_181_663 | 153 |
| 594 | 3300044765 | Ga0466970_0011341 | Ga0466970_0011341_242_724 | 153 |
| 595 | 3300044765 | Ga0466970_0077360 | Ga0466970_0077360_1132_1614 | 153 |
| 596 | 3300044842 | Ga0466957_0006041 | Ga0466957_0006041_5507_5989 | 153 |
| 597 | 3300044842 | Ga0466957_0010913 | Ga0466957_0010913_224_706 | 153 |
| 598 | 3300044842 | Ga0466957_0031644 | Ga0466957_0031644_1414_1896 | 153 |
| 599 | 3300044842 | Ga0466957_0053228 | Ga0466957_0053228_1209_1691 | 153 |
| 600 | 3300044901 | Ga0466960_0339899 | Ga0466960_0339899_185_667 | 153 |
| 601 | 3300045049 | Ga0466959_0050486 | Ga0466959_0050486_1203_1685 | 153 |
| 602 | 3300045049 | Ga0466959_0268038 | Ga0466959_0268038_52_534 | 153 |
| 603 | 3300045836 | Ga0466958_0007030 | Ga0466958_0007030_4185_4667 | 153 |
| 604 | 3300045836 | Ga0466958_0021374 | Ga0466958_0021374_651_1133 | 153 |
| 605 | 3300045836 | Ga0466958_0048556 | Ga0466958_0048556_126_608 | 153 |
| 606 | 3300045836 | Ga0466958_0122974 | Ga0466958_0122974_338_820 | 153 |
| 607 | 3300045976 | Ga0466967_0000173 | Ga0466967_0000173_18901_19383 | 153 |
| 608 | 3300045976 | Ga0466967_0023676 | Ga0466967_0023676_1320_1802 | 153 |
| 609 | 3300045976 | Ga0466967_0027634 | Ga0466967_0027634_111_593 | 153 |
| 610 | 3300045976 | Ga0466967_0035273 | Ga0466967_0035273_1091_1573 | 153 |
| 611 | 3300045976 | Ga0466967_0035961 | Ga0466967_0035961_2385_2867 | 153 |
| 612 | 3300045976 | Ga0466967_0058650 | Ga0466967_0058650_2658_3140 | 153 |
| 613 | 3300045976 | Ga0466967_0070749 | Ga0466967_0070749_733_1215 | 153 |
| 614 | 3300045976 | Ga0466967_0077614 | Ga0466967_0077614_1926_2408 | 153 |
| 615 | 3300045976 | Ga0466967_0186982 | Ga0466967_0186982_806_1288 | 153 |
| 616 | 3300045976 | Ga0466967_0315563 | Ga0466967_0315563_595_1077 | 153 |
| 617 | 3300045976 | Ga0466967_0633642 | Ga0466967_0633642_183_665 | 153 |
| 618 | 3300046454 | Ga0495592_0000635 | Ga0495592_0000635_1132_1614 | 153 |
| 619 | 3300046454 | Ga0495592_0000769 | Ga0495592_0000769_10205_10687 | 153 |
| 620 | 3300046454 | Ga0495592_0068268 | Ga0495592_0068268_1611_2093 | 153 |
| 621 | 3300046454 | Ga0495592_0099960 | Ga0495592_0099960_1522_2004 | 153 |
| 622 | 3300046455 | Ga0495603_0086996 | Ga0495603_0086996_469_942 | 153 |
| 623 | 3300046459 | Ga0495629_0016265 | Ga0495629_0016265_1941_2414 | 153 |
| 624 | 3300046461 | Ga0495641_0015557 | Ga0495641_0015557_2186_2668 | 153 |
| 625 | 3300046461 | Ga0495641_0108458 | Ga0495641_0108458_553_1026 | 153 |
| 626 | 3300046461 | Ga0495641_0135945 | Ga0495641_0135945_177_659 | 153 |
| 627 | 3300046461 | Ga0495641_0314608 | Ga0495641_0314608_182_664 | 153 |
| 628 | 3300046462 | Ga0495651_0000029 | Ga0495651_0000029_10206_10688 | 153 |
| 629 | 3300046462 | Ga0495651_0772579 | Ga0495651_0772579_86_568 | 153 |
| 630 | 3300046463 | Ga0495653_0003221 | Ga0495653_0003221_5034_5516 | 153 |
| 631 | 3300046463 | Ga0495653_0069379 | Ga0495653_0069379_1777_2259 | 153 |
| 632 | 3300046473 | Ga0495582_0173928 | Ga0495582_0173928_248_730 | 153 |
| 633 | 3300046473 | Ga0495582_0244091 | Ga0495582_0244091_240_722 | 153 |
| 634 | 3300046476 | Ga0495662_0129371 | Ga0495662_0129371_364_846 | 153 |
| 635 | 3300046477 | Ga0495664_0157772 | Ga0495664_0157772_170_652 | 153 |
| 636 | 3300046491 | Ga0495584_0134281 | Ga0495584_0134281_543_1025 | 153 |
| 637 | 3300046492 | Ga0495585_0381145 | Ga0495585_0381145_159_641 | 153 |
| 638 | 3300046511 | Ga0495608_0004327 | Ga0495608_0004327_5412_5894 | 153 |
| 639 | 3300046514 | Ga0495618_0001935 | Ga0495618_0001935_2076_2558 | 153 |
| 640 | 3300046514 | Ga0495618_0632432 | Ga0495618_0632432_42_524 | 153 |
| 641 | 3300046516 | Ga0495628_0000016 | Ga0495628_0000016_10179_10661 | 153 |
| 642 | 3300046516 | Ga0495628_0073325 | Ga0495628_0073325_90_572 | 153 |
| 643 | 3300046516 | Ga0495628_0094887 | Ga0495628_0094887_719_1201 | 153 |
| 644 | 3300046517 | Ga0495630_0045205 | Ga0495630_0045205_2276_2758 | 153 |
| 645 | 3300046523 | Ga0495644_0050042 | Ga0495644_0050042_485_967 | 153 |
| 646 | 3300046528 | Ga0495642_0117259 | Ga0495642_0117259_121_603 | 153 |
| 647 | 3300046529 | Ga0495652_0001228 | Ga0495652_0001228_10206_10688 | 153 |
| 648 | 3300046529 | Ga0495652_0037452 | Ga0495652_0037452_1523_2005 | 153 |
| 649 | 3300046529 | Ga0495652_0091507 | Ga0495652_0091507_605_1087 | 153 |
| 650 | 3300046533 | Ga0495640_0210480 | Ga0495640_0210480_251_733 | 153 |
| 651 | 3300046535 | Ga0495586_0079888 | Ga0495586_0079888_1007_1480 | 153 |
| 652 | 3300046535 | Ga0495586_0202148 | Ga0495586_0202148_385_867 | 153 |
| 653 | 3300046536 | Ga0495587_0000434 | Ga0495587_0000434_10206_10688 | 153 |
| 654 | 3300046543 | Ga0495645_0000367 | Ga0495645_0000367_10180_10662 | 153 |
| 655 | 3300046543 | Ga0495645_0344535 | Ga0495645_0344535_185_667 | 153 |
| 656 | 3300046558 | Ga0495633_0295740 | Ga0495633_0295740_123_605 | 153 |
| 657 | 3300046559 | Ga0495667_0056732 | Ga0495667_0056732_1786_2268 | 153 |
| 658 | 3300046559 | Ga0495667_0122966 | Ga0495667_0122966_998_1480 | 153 |
| 659 | 3300046615 | Ga0495656_0001482 | Ga0495656_0001482_3922_4404 | 153 |
| 660 | 3300046642 | Ga0495634_0015712 | Ga0495634_0015712_2194_2667 | 153 |
| 661 | 3300046642 | Ga0495634_0415343 | Ga0495634_0415343_130_612 | 153 |
| 662 | 3300046648 | Ga0495611_0067422 | Ga0495611_0067422_474_956 | 153 |
| 663 | 3300046663 | Ga0495635_0047562 | Ga0495635_0047562_2007_2489 | 153 |
| 664 | 3300046665 | Ga0495661_0212988 | Ga0495661_0212988_287_769 | 153 |
| 665 | 3300046675 | Ga0495657_0005282 | Ga0495657_0005282_8600_9082 | 153 |
| 666 | 3300046675 | Ga0495657_0133210 | Ga0495657_0133210_37_519 | 153 |
| 667 | 3300046678 | Ga0495599_0000187 | Ga0495599_0000187_32705_33187 | 153 |
| 668 | 3300046678 | Ga0495599_0020779 | Ga0495599_0020779_1586_2068 | 153 |
| 669 | 3300046679 | Ga0495623_0000121 | Ga0495623_0000121_10198_10680 | 153 |
| 670 | 3300046680 | Ga0495646_0025332 | Ga0495646_0025332_2599_3081 | 153 |
| 671 | 3300046680 | Ga0495646_0057372 | Ga0495646_0057372_1021_1503 | 153 |
| 672 | 3300046680 | Ga0495646_0121485 | Ga0495646_0121485_370_852 | 153 |
| 673 | 3300046681 | Ga0495647_0027244 | Ga0495647_0027244_163_636 | 153 |
| 674 | 3300046683 | Ga0495658_0056370 | Ga0495658_0056370_318_800 | 153 |
| 675 | 3300046689 | Ga0495613_0006994 | Ga0495613_0006994_4002_4475 | 153 |
| 676 | 3300046690 | Ga0495624_0014162 | Ga0495624_0014162_2893_3375 | 153 |
| 677 | 3300046794 | Ga0495589_0041834 | Ga0495589_0041834_1595_2077 | 153 |
| 678 | 3300046809 | Ga0495600_0085761 | Ga0495600_0085761_765_1247 | 153 |
| 679 | 3300047315 | Ga0495581_0065178 | Ga0495581_0065178_1378_1860 | 153 |
| 680 | 3300047317 | Ga0495604_0000628 | Ga0495604_0000628_19706_20188 | 153 |
| 681 | 3300047319 | Ga0495674_0222904 | Ga0495674_0222904_868_1350 | 153 |
| 682 | 3300047321 | Ga0495676_0023206 | Ga0495676_0023206_1856_2329 | 153 |
| 683 | 3300047322 | Ga0495680_0002048 | Ga0495680_0002048_18716_19198 | 153 |
| 684 | 3300047322 | Ga0495680_0662748 | Ga0495680_0662748_37_519 | 153 |
| 685 | 3300047444 | Ga0495675_0000031 | Ga0495675_0000031_93168_93650 | 153 |
| 686 | 3300047447 | Ga0495685_083212 | Ga0495685_083212_483_965 | 153 |
| 687 | 3300047471 | Ga0495684_0728392 | Ga0495684_0728392_12_494 | 153 |
| 688 | 3300048088 | Ga0495602_0000133 | Ga0495602_0000133_10206_10688 | 153 |
| 689 | 3300048088 | Ga0495602_0278109 | Ga0495602_0278109_419_901 | 153 |
| 690 | 3300048088 | Ga0495602_0318424 | Ga0495602_0318424_32_514 | 153 |
| 691 | 3300048903 | Ga0496100_0276661 | Ga0496100_0276661_540_1022 | 153 |
| 692 | 3300048903 | Ga0496100_1077898 | Ga0496100_1077898_11_493 | 153 |
| 693 | 3300048904 | Ga0496101_0063633 | Ga0496101_0063633_356_829 | 153 |
| 694 | 3300048904 | Ga0496101_0112509 | Ga0496101_0112509_1557_2039 | 153 |
| 695 | 3300048904 | Ga0496101_0220725 | Ga0496101_0220725_662_1129 | 153 |
| 696 | 3300048904 | Ga0496101_0354016 | Ga0496101_0354016_424_906 | 153 |
| 697 | 3300048904 | Ga0496101_0421988 | Ga0496101_0421988_485_967 | 153 |
| 698 | 3300048905 | Ga0496102_0072024 | Ga0496102_0072024_1023_1490 | 153 |
| 699 | 3300048905 | Ga0496102_0076014 | Ga0496102_0076014_46_537 | 153 |
| 700 | 3300048905 | Ga0496102_0368532 | Ga0496102_0368532_464_937 | 153 |
| 701 | 3300048906 | Ga0496103_0084153 | Ga0496103_0084153_1412_1879 | 153 |
| 702 | 3300048907 | Ga0496104_0122313 | Ga0496104_0122313_1475_1957 | 153 |
| 703 | 3300048907 | Ga0496104_0499867 | Ga0496104_0499867_270_743 | 153 |
| 704 | 3300048907 | Ga0496104_0604752 | Ga0496104_0604752_276_749 | 153 |
| 705 | 3300048907 | Ga0496104_1701089 | Ga0496104_1701089_13_480 | 153 |
| 706 | 3300048908 | Ga0496105_0023043 | Ga0496105_0023043_1745_2218 | 153 |
| 707 | 3300048908 | Ga0496105_0031873 | Ga0496105_0031873_3750_4232 | 153 |
| 708 | 3300048908 | Ga0496105_0054893 | Ga0496105_0054893_579_1046 | 153 |
| 709 | 3300048909 | Ga0496106_0148189 | Ga0496106_0148189_1198_1671 | 153 |
| 710 | 3300048909 | Ga0496106_0291659 | Ga0496106_0291659_674_1141 | 153 |
| 711 | 3300048910 | Ga0496107_0169901 | Ga0496107_0169901_198_680 | 153 |
| 712 | 3300048910 | Ga0496107_0253321 | Ga0496107_0253321_46_528 | 153 |
| 713 | 3300048910 | Ga0496107_0289463 | Ga0496107_0289463_30_503 | 153 |
| 714 | 3300048910 | Ga0496107_0432830 | Ga0496107_0432830_114_605 | 153 |
| 715 | 3300048910 | Ga0496107_0631538 | Ga0496107_0631538_74_541 | 153 |
| 716 | 3300048911 | Ga0496108_0006504 | Ga0496108_0006504_4502_4975 | 153 |
| 717 | 3300048911 | Ga0496108_0051123 | Ga0496108_0051123_290_772 | 153 |
| 718 | 3300048911 | Ga0496108_0060419 | Ga0496108_0060419_2466_2933 | 153 |
| 719 | 3300048911 | Ga0496108_0083291 | Ga0496108_0083291_867_1358 | 153 |
| 720 | 3300048911 | Ga0496108_0094102 | Ga0496108_0094102_241_726 | 153 |
| 721 | 3300048911 | Ga0496108_0175087 | Ga0496108_0175087_279_752 | 153 |
| 722 | 3300048911 | Ga0496108_0204985 | Ga0496108_0204985_685_1167 | 153 |
| 723 | 3300048912 | Ga0496109_0004548 | Ga0496109_0004548_7400_7873 | 153 |
| 724 | 3300048912 | Ga0496109_0033113 | Ga0496109_0033113_683_1174 | 153 |
| 725 | 3300048912 | Ga0496109_0063809 | Ga0496109_0063809_118_585 | 153 |
| 726 | 3300048912 | Ga0496109_0176637 | Ga0496109_0176637_249_716 | 153 |
| 727 | 3300048912 | Ga0496109_0258788 | Ga0496109_0258788_284_757 | 153 |
| 728 | 3300048912 | Ga0496109_0385272 | Ga0496109_0385272_503_985 | 153 |
| 729 | 3300048913 | Ga0496110_0013143 | Ga0496110_0013143_5262_5735 | 153 |
| 730 | 3300048913 | Ga0496110_0127356 | Ga0496110_0127356_93_560 | 153 |
| 731 | 3300048913 | Ga0496110_0137530 | Ga0496110_0137530_528_1013 | 153 |
| 732 | 3300048913 | Ga0496110_0256424 | Ga0496110_0256424_118_585 | 153 |
| 733 | 3300048913 | Ga0496110_0581390 | Ga0496110_0581390_476_949 | 153 |
| 734 | 3300048914 | Ga0496111_0002951 | Ga0496111_0002951_8083_8556 | 153 |
| 735 | 3300048914 | Ga0496111_0076252 | Ga0496111_0076252_374_856 | 153 |
| 736 | 3300048914 | Ga0496111_0106585 | Ga0496111_0106585_1196_1669 | 153 |
| 737 | 3300048914 | Ga0496111_0403163 | Ga0496111_0403163_259_726 | 153 |
| 738 | 3300048914 | Ga0496111_0476187 | Ga0496111_0476187_404_886 | 153 |
| 739 | 3300048915 | Ga0496112_0000720 | Ga0496112_0000720_18767_19234 | 153 |
| 740 | 3300048915 | Ga0496112_0016198 | Ga0496112_0016198_1143_1610 | 153 |
| 741 | 3300048915 | Ga0496112_0086167 | Ga0496112_0086167_1254_1736 | 153 |
| 742 | 3300048915 | Ga0496112_0110864 | Ga0496112_0110864_76_558 | 153 |
| 743 | 3300048915 | Ga0496112_0204049 | Ga0496112_0204049_42_524 | 153 |
| 744 | 3300048915 | Ga0496112_0221458 | Ga0496112_0221458_897_1379 | 153 |
| 745 | 3300048916 | Ga0496113_0019216 | Ga0496113_0019216_3928_4401 | 153 |
| 746 | 3300048916 | Ga0496113_0050512 | Ga0496113_0050512_322_813 | 153 |
| 747 | 3300048916 | Ga0496113_0113480 | Ga0496113_0113480_318_800 | 153 |
| 748 | 3300048916 | Ga0496113_0199406 | Ga0496113_0199406_61_534 | 153 |
| 749 | 3300048916 | Ga0496113_0658285 | Ga0496113_0658285_296_763 | 153 |
| 750 | 3300048916 | Ga0496113_0791058 | Ga0496113_0791058_249_734 | 153 |
| 751 | 3300048916 | Ga0496113_1095409 | Ga0496113_1095409_69_551 | 153 |
| 752 | 3300048917 | Ga0496114_0016663 | Ga0496114_0016663_4612_5079 | 153 |
| 753 | 3300048917 | Ga0496114_0029580 | Ga0496114_0029580_3778_4251 | 153 |
| 754 | 3300048917 | Ga0496114_0132984 | Ga0496114_0132984_1278_1763 | 153 |
| 755 | 3300048917 | Ga0496114_0198861 | Ga0496114_0198861_646_1119 | 153 |
| 756 | 3300048917 | Ga0496114_0270748 | Ga0496114_0270748_846_1328 | 153 |
| 757 | 3300048918 | Ga0496115_0231014 | Ga0496115_0231014_672_1154 | 153 |
| 758 | 3300048918 | Ga0496115_0680437 | Ga0496115_0680437_199_681 | 153 |
| 759 | 3300049568 | Ga0501031_0120507 | Ga0501031_0120507_973_1434 | 153 |
| 760 | 3300049574 | Ga0501038_1011522 | Ga0501038_1011522_55_540 | 153 |
| 761 | 3300049575 | Ga0501039_0312183 | Ga0501039_0312183_669_1154 | 153 |
| 762 | 3300049577 | Ga0501041_0488357 | Ga0501041_0488357_209_670 | 153 |
| 763 | 3300049584 | Ga0501068_0016962 | Ga0501068_0016962_707_1219 | 153 |
| 764 | 3300049585 | Ga0501069_0023483 | Ga0501069_0023483_131_643 | 153 |
| 765 | 3300049587 | Ga0501071_0088291 | Ga0501071_0088291_797_1282 | 153 |
| 766 | 3300049587 | Ga0501071_0868642 | Ga0501071_0868642_33_494 | 153 |
| 767 | 3300049588 | Ga0501072_0451265 | Ga0501072_0451265_325_810 | 153 |
| 768 | 3300049588 | Ga0501072_0836280 | Ga0501072_0836280_171_632 | 153 |
| 769 | 3300049591 | Ga0501075_0114590 | Ga0501075_0114590_876_1361 | 153 |
| 770 | 3300049592 | Ga0501076_0764644 | Ga0501076_0764644_194_679 | 153 |
| 771 | 3300049592 | Ga0501076_1315756 | Ga0501076_1315756_106_567 | 153 |
| 772 | 3300049743 | Ga0501081_0765512 | Ga0501081_0765512_157_618 | 153 |
| 773 | 3300049743 | Ga0501081_0971149 | Ga0501081_0971149_124_585 | 153 |
| 774 | 3300050507 | nmdc:mga05p37_13210_c1 | nmdc:mga05p37_13210_c1_436_903 | 153 |
| 775 | 3300050507 | nmdc:mga05p37_710891_c1 | nmdc:mga05p37_710891_c1_413_898 | 153 |
| 776 | 3300050508 | nmdc:mga09592_1170905_c1 | nmdc:mga09592_1170905_c1_114_599 | 153 |
| 777 | 3300050510 | nmdc:mga06r32_412105_c1 | nmdc:mga06r32_412105_c1_849_1316 | 153 |
| 778 | 3300050512 | nmdc:mga0n895_120235_c1 | nmdc:mga0n895_120235_c1_1381_1866 | 153 |
| 779 | 3300050512 | nmdc:mga0n895_356849_c1 | nmdc:mga0n895_356849_c1_431_898 | 153 |
| 780 | 3300050512 | nmdc:mga0n895_9466_c1 | nmdc:mga0n895_9466_c1_1595_2077 | 153 |
| 781 | 3300050513 | nmdc:mga0rr50_133592_c1 | nmdc:mga0rr50_133592_c1_1158_1625 | 153 |
| 782 | 3300050513 | nmdc:mga0rr50_275130_c1 | nmdc:mga0rr50_275130_c1_756_1241 | 153 |
| 783 | 3300050514 | nmdc:mga08x19_234183_c1 | nmdc:mga08x19_234183_c1_579_1046 | 153 |
| 784 | 3300050515 | nmdc:mga0a205_190749_c1 | nmdc:mga0a205_190749_c1_409_876 | 153 |
| 785 | 3300050515 | nmdc:mga0a205_202022_c1 | nmdc:mga0a205_202022_c1_448_930 | 153 |
| 786 | 3300053077 | Ga0495601_0001112 | Ga0495601_0001112_5076_5558 | 153 |
| 787 | 3300053077 | Ga0495601_0217567 | Ga0495601_0217567_17_499 | 153 |
| 788 | 3300053078 | Ga0495612_0013653 | Ga0495612_0013653_1553_2035 | 153 |
| 789 | 3300053084 | Ga0495595_0011768 | Ga0495595_0011768_2602_3084 | 153 |
| 790 | 3300053084 | Ga0495595_0391885 | Ga0495595_0391885_139_621 | 153 |
| 791 | 3300053085 | Ga0495619_0001848 | Ga0495619_0001848_2014_2496 | 153 |
| 792 | 3300053085 | Ga0495619_0208461 | Ga0495619_0208461_389_871 | 153 |
| 793 | 3300053085 | Ga0495619_0264306 | Ga0495619_0264306_347_829 | 153 |
| 794 | 3300053085 | Ga0495619_0380583 | Ga0495619_0380583_471_953 | 153 |
| 795 | 3300060353 | Ga0501082_0069889 | Ga0501082_0069889_1000_1485 | 153 |
| 796 | 3300061719 | Ga0466962_0073765 | Ga0466962_0073765_927_1409 | 153 |
| 797 | 3300061719 | Ga0466962_0138530 | Ga0466962_0138530_83_565 | 153 |
| 798 | 3300061719 | Ga0466962_0268158 | Ga0466962_0268158_301_783 | 153 |
| 799 | 3300061734 | Ga0530510_0701213 | Ga0530510_0701213_191_664 | 153 |
| 800 | 3300061734 | Ga0530510_1458776 | Ga0530510_1458776_15_497 | 153 |
| 801 | 3300003203 | JGI25406J46586_10082873 | JGI25406J46586_100828732 | 154 |
| 802 | 3300005353 | Ga0070669_100399130 | Ga0070669_1003991301 | 154 |
| 803 | 3300005457 | Ga0070662_100261437 | Ga0070662_1002614372 | 154 |
| 804 | 3300005535 | Ga0070684_100124416 | Ga0070684_1001244163 | 154 |
| 805 | 3300005578 | Ga0068854_100025571 | Ga0068854_1000255715 | 154 |
| 806 | 3300005616 | Ga0068852_100267557 | Ga0068852_1002675572 | 154 |
| 807 | 3300005985 | Ga0081539_10002469 | Ga0081539_1000246921 | 154 |
| 808 | 3300009094 | Ga0111539_10054002 | Ga0111539_100540023 | 154 |
| 809 | 3300009098 | Ga0105245_10304859 | Ga0105245_103048593 | 154 |
| 810 | 3300009147 | Ga0114129_10588614 | Ga0114129_105886143 | 154 |
| 811 | 3300010375 | Ga0105239_10035534 | Ga0105239_100355342 | 154 |
| 812 | 3300013307 | Ga0157372_10163377 | Ga0157372_101633773 | 154 |
| 813 | 3300014745 | Ga0157377_10175965 | Ga0157377_101759653 | 154 |
| 814 | 3300025932 | Ga0207690_10085158 | Ga0207690_100851583 | 154 |
| 815 | 3300048906 | Ga0496103_0229255 | Ga0496103_0229255_266_730 | 154 |
| 816 | 3300048913 | Ga0496110_1142366 | Ga0496110_1142366_149_613 | 154 |
| 817 | 3300049568 | Ga0501031_0073730 | Ga0501031_0073730_1061_1525 | 154 |
| 818 | 3300049568 | Ga0501031_0293840 | Ga0501031_0293840_312_776 | 154 |
| 819 | 3300049569 | Ga0501032_0012583 | Ga0501032_0012583_489_953 | 154 |
| 820 | 3300049570 | Ga0501033_0110157 | Ga0501033_0110157_1219_1683 | 154 |
| 821 | 3300049571 | Ga0501034_0510141 | Ga0501034_0510141_313_777 | 154 |
| 822 | 3300049572 | Ga0501036_0102459 | Ga0501036_0102459_1496_1960 | 154 |
| 823 | 3300049573 | Ga0501037_0155190 | Ga0501037_0155190_874_1338 | 154 |
| 824 | 3300049574 | Ga0501038_0010922 | Ga0501038_0010922_4864_5328 | 154 |
| 825 | 3300049575 | Ga0501039_0006374 | Ga0501039_0006374_3220_3684 | 154 |
| 826 | 3300049575 | Ga0501039_0044426 | Ga0501039_0044426_207_671 | 154 |
| 827 | 3300049576 | Ga0501040_0116536 | Ga0501040_0116536_1373_1837 | 154 |
| 828 | 3300049576 | Ga0501040_0220435 | Ga0501040_0220435_424_888 | 154 |
| 829 | 3300049577 | Ga0501041_0022834 | Ga0501041_0022834_2738_3202 | 154 |
| 830 | 3300049577 | Ga0501041_0026041 | Ga0501041_0026041_57_521 | 154 |
| 831 | 3300049578 | Ga0501042_0007698 | Ga0501042_0007698_4034_4498 | 154 |
| 832 | 3300049578 | Ga0501042_0008751 | Ga0501042_0008751_718_1182 | 154 |
| 833 | 3300049579 | Ga0501043_0090432 | Ga0501043_0090432_262_726 | 154 |
| 834 | 3300049580 | Ga0501046_0008561 | Ga0501046_0008561_8279_8743 | 154 |
| 835 | 3300049580 | Ga0501046_0346840 | Ga0501046_0346840_547_1011 | 154 |
| 836 | 3300049582 | Ga0501048_0080734 | Ga0501048_0080734_186_650 | 154 |
| 837 | 3300049582 | Ga0501048_0096625 | Ga0501048_0096625_248_712 | 154 |
| 838 | 3300049584 | Ga0501068_0083778 | Ga0501068_0083778_162_626 | 154 |
| 839 | 3300049584 | Ga0501068_0153665 | Ga0501068_0153665_514_978 | 154 |
| 840 | 3300049585 | Ga0501069_0036725 | Ga0501069_0036725_1906_2370 | 154 |
| 841 | 3300049585 | Ga0501069_0074069 | Ga0501069_0074069_954_1418 | 154 |
| 842 | 3300049586 | Ga0501070_0019851 | Ga0501070_0019851_4820_5284 | 154 |
| 843 | 3300049586 | Ga0501070_0068804 | Ga0501070_0068804_264_728 | 154 |
| 844 | 3300049587 | Ga0501071_0016213 | Ga0501071_0016213_3550_4014 | 154 |
| 845 | 3300049588 | Ga0501072_0003835 | Ga0501072_0003835_1702_2166 | 154 |
| 846 | 3300049589 | Ga0501073_0031712 | Ga0501073_0031712_379_843 | 154 |
| 847 | 3300049589 | Ga0501073_0457343 | Ga0501073_0457343_85_549 | 154 |
| 848 | 3300049590 | Ga0501074_0014813 | Ga0501074_0014813_5035_5499 | 154 |
| 849 | 3300049591 | Ga0501075_0084674 | Ga0501075_0084674_456_920 | 154 |
| 850 | 3300049592 | Ga0501076_0013005 | Ga0501076_0013005_4246_4710 | 154 |
| 851 | 3300049592 | Ga0501076_0136482 | Ga0501076_0136482_1250_1714 | 154 |
| 852 | 3300049593 | Ga0501077_0398730 | Ga0501077_0398730_285_749 | 154 |
| 853 | 3300049741 | Ga0501079_0005790 | Ga0501079_0005790_5143_5607 | 154 |
| 854 | 3300049741 | Ga0501079_0041140 | Ga0501079_0041140_312_776 | 154 |
| 855 | 3300049742 | Ga0501080_0074455 | Ga0501080_0074455_383_847 | 154 |
| 856 | 3300049742 | Ga0501080_0221249 | Ga0501080_0221249_483_947 | 154 |
| 857 | 3300049743 | Ga0501081_0177045 | Ga0501081_0177045_872_1336 | 154 |
| 858 | 3300049743 | Ga0501081_0289824 | Ga0501081_0289824_312_776 | 154 |
| 859 | 3300049822 | Ga0501035_0142488 | Ga0501035_0142488_1335_1799 | 154 |
| 860 | 3300049822 | Ga0501035_0246531 | Ga0501035_0246531_775_1239 | 154 |
| 861 | 3300049823 | Ga0501044_0254930 | Ga0501044_0254930_975_1439 | 154 |
| 862 | 3300049824 | Ga0501045_0034406 | Ga0501045_0034406_2342_2806 | 154 |
| 863 | 3300049824 | Ga0501045_0061970 | Ga0501045_0061970_1798_2262 | 154 |
| 864 | 3300050511 | nmdc:mga08y16_112887_c1 | nmdc:mga08y16_112887_c1_498_962 | 154 |
| 865 | 3300054114 | Ga0501084_0576791 | Ga0501084_0576791_174_638 | 154 |
| 866 | 3300054114 | Ga0501084_0791884 | Ga0501084_0791884_17_481 | 154 |
| 867 | 3300060353 | Ga0501082_0066763 | Ga0501082_0066763_932_1396 | 154 |
| 868 | 3300060353 | Ga0501082_0232192 | Ga0501082_0232192_1125_1589 | 154 |
| 869 | 3300061734 | Ga0530510_0277033 | Ga0530510_0277033_307_771 | 154 |
| 870 | 3300061734 | Ga0530510_0287224 | Ga0530510_0287224_371_835 | 154 |
| 871 | 3300001991 | JGI24743J22301_10033953 | JGI24743J22301_100339532 | 155 |
| 872 | 3300002075 | JGI24738J21930_10016802 | JGI24738J21930_100168022 | 155 |
| 873 | 3300005327 | Ga0070658_10091921 | Ga0070658_100919213 | 155 |
| 874 | 3300005329 | Ga0070683_100594897 | Ga0070683_1005948972 | 155 |
| 875 | 3300005329 | Ga0070683_100771131 | Ga0070683_1007711312 | 155 |
| 876 | 3300005330 | Ga0070690_100107022 | Ga0070690_1001070221 | 155 |
| 877 | 3300005331 | Ga0070670_100073980 | Ga0070670_1000739803 | 155 |
| 878 | 3300005334 | Ga0068869_100173843 | Ga0068869_1001738432 | 155 |
| 879 | 3300005337 | Ga0070682_100095037 | Ga0070682_1000950372 | 155 |
| 880 | 3300005337 | Ga0070682_100332499 | Ga0070682_1003324993 | 155 |
| 881 | 3300005338 | Ga0068868_100078672 | Ga0068868_1000786723 | 155 |
| 882 | 3300005338 | Ga0068868_100147361 | Ga0068868_1001473614 | 155 |
| 883 | 3300005339 | Ga0070660_100011258 | Ga0070660_1000112585 | 155 |
| 884 | 3300005341 | Ga0070691_10021455 | Ga0070691_100214553 | 155 |
| 885 | 3300005343 | Ga0070687_100367879 | Ga0070687_1003678792 | 155 |
| 886 | 3300005344 | Ga0070661_100018221 | Ga0070661_1000182214 | 155 |
| 887 | 3300005345 | Ga0070692_10076474 | Ga0070692_100764742 | 155 |
| 888 | 3300005353 | Ga0070669_100935013 | Ga0070669_1009350132 | 155 |
| 889 | 3300005354 | Ga0070675_100035405 | Ga0070675_1000354054 | 155 |
| 890 | 3300005355 | Ga0070671_100032475 | Ga0070671_1000324754 | 155 |
| 891 | 3300005356 | Ga0070674_100027096 | Ga0070674_1000270965 | 155 |
| 892 | 3300005356 | Ga0070674_100168144 | Ga0070674_1001681443 | 155 |
| 893 | 3300005364 | Ga0070673_100018556 | Ga0070673_1000185562 | 155 |
| 894 | 3300005364 | Ga0070673_100285605 | Ga0070673_1002856053 | 155 |
| 895 | 3300005365 | Ga0070688_101117541 | Ga0070688_1011175411 | 155 |
| 896 | 3300005366 | Ga0070659_100034064 | Ga0070659_1000340645 | 155 |
| 897 | 3300005366 | Ga0070659_100132956 | Ga0070659_1001329564 | 155 |
| 898 | 3300005367 | Ga0070667_100493864 | Ga0070667_1004938641 | 155 |
| 899 | 3300005406 | Ga0070703_10015426 | Ga0070703_100154263 | 155 |
| 900 | 3300005438 | Ga0070701_10015957 | Ga0070701_100159572 | 155 |
| 901 | 3300005440 | Ga0070705_100121785 | Ga0070705_1001217853 | 155 |
| 902 | 3300005441 | Ga0070700_100039344 | Ga0070700_1000393445 | 155 |
| 903 | 3300005441 | Ga0070700_100276115 | Ga0070700_1002761152 | 155 |
| 904 | 3300005444 | Ga0070694_100439867 | Ga0070694_1004398672 | 155 |
| 905 | 3300005455 | Ga0070663_100170142 | Ga0070663_1001701423 | 155 |
| 906 | 3300005456 | Ga0070678_100143734 | Ga0070678_1001437342 | 155 |
| 907 | 3300005456 | Ga0070678_100542388 | Ga0070678_1005423882 | 155 |
| 908 | 3300005457 | Ga0070662_100797923 | Ga0070662_1007979231 | 155 |
| 909 | 3300005459 | Ga0068867_100269851 | Ga0068867_1002698513 | 155 |
| 910 | 3300005530 | Ga0070679_100162589 | Ga0070679_1001625893 | 155 |
| 911 | 3300005535 | Ga0070684_100435850 | Ga0070684_1004358503 | 155 |
| 912 | 3300005539 | Ga0068853_100034262 | Ga0068853_1000342623 | 155 |
| 913 | 3300005543 | Ga0070672_100016613 | Ga0070672_1000166135 | 155 |
| 914 | 3300005543 | Ga0070672_100059769 | Ga0070672_1000597693 | 155 |
| 915 | 3300005544 | Ga0070686_100464423 | Ga0070686_1004644232 | 155 |
| 916 | 3300005546 | Ga0070696_100307116 | Ga0070696_1003071163 | 155 |
| 917 | 3300005547 | Ga0070693_100139884 | Ga0070693_1001398843 | 155 |
| 918 | 3300005549 | Ga0070704_100034442 | Ga0070704_1000344426 | 155 |
| 919 | 3300005563 | Ga0068855_100151728 | Ga0068855_1001517283 | 155 |
| 920 | 3300005564 | Ga0070664_100089152 | Ga0070664_1000891524 | 155 |
| 921 | 3300005564 | Ga0070664_100109175 | Ga0070664_1001091753 | 155 |
| 922 | 3300005564 | Ga0070664_100520854 | Ga0070664_1005208542 | 155 |
| 923 | 3300005577 | Ga0068857_100155027 | Ga0068857_1001550274 | 155 |
| 924 | 3300005578 | Ga0068854_100073533 | Ga0068854_1000735332 | 155 |
| 925 | 3300005614 | Ga0068856_100204018 | Ga0068856_1002040183 | 155 |
| 926 | 3300005616 | Ga0068852_100031104 | Ga0068852_1000311046 | 155 |
| 927 | 3300005840 | Ga0068870_10232310 | Ga0068870_102323103 | 155 |
| 928 | 3300005840 | Ga0068870_10481742 | Ga0068870_104817422 | 155 |
| 929 | 3300005841 | Ga0068863_100152411 | Ga0068863_1001524113 | 155 |
| 930 | 3300005842 | Ga0068858_100280118 | Ga0068858_1002801183 | 155 |
| 931 | 3300005843 | Ga0068860_100074245 | Ga0068860_1000742453 | 155 |
| 932 | 3300006237 | Ga0097621_100005668 | Ga0097621_1000056686 | 155 |
| 933 | 3300006358 | Ga0068871_100380635 | Ga0068871_1003806352 | 155 |
| 934 | 3300006881 | Ga0068865_100226748 | Ga0068865_1002267483 | 155 |
| 935 | 3300006881 | Ga0068865_100422365 | Ga0068865_1004223651 | 155 |
| 936 | 3300009098 | Ga0105245_10288822 | Ga0105245_102888222 | 155 |
| 937 | 3300009098 | Ga0105245_10315925 | Ga0105245_103159253 | 155 |
| 938 | 3300009148 | Ga0105243_10006669 | Ga0105243_100066697 | 155 |
| 939 | 3300009174 | Ga0105241_10068970 | Ga0105241_100689703 | 155 |
| 940 | 3300009176 | Ga0105242_10040521 | Ga0105242_100405213 | 155 |
| 941 | 3300009551 | Ga0105238_10118699 | Ga0105238_101186993 | 155 |
| 942 | 3300009551 | Ga0105238_10255943 | Ga0105238_102559432 | 155 |
| 943 | 3300013102 | Ga0157371_10150922 | Ga0157371_101509222 | 155 |
| 944 | 3300013296 | Ga0157374_10271973 | Ga0157374_102719732 | 155 |
| 945 | 3300013297 | Ga0157378_10741838 | Ga0157378_107418382 | 155 |
| 946 | 3300013307 | Ga0157372_10126490 | Ga0157372_101264901 | 155 |
| 947 | 3300014326 | Ga0157380_10645474 | Ga0157380_106454742 | 155 |
| 948 | 3300014745 | Ga0157377_10023413 | Ga0157377_100234132 | 155 |
| 949 | 3300017792 | Ga0163161_10083494 | Ga0163161_100834943 | 155 |
| 950 | 3300020081 | Ga0206354_11504563 | Ga0206354_115045631 | 155 |
| 951 | 3300025321 | Ga0207656_10010697 | Ga0207656_100106974 | 155 |
| 952 | 3300025885 | Ga0207653_10004869 | Ga0207653_100048693 | 155 |
| 953 | 3300025893 | Ga0207682_10288945 | Ga0207682_102889452 | 155 |
| 954 | 3300025899 | Ga0207642_10038947 | Ga0207642_100389474 | 155 |
| 955 | 3300025900 | Ga0207710_10265134 | Ga0207710_102651342 | 155 |
| 956 | 3300025901 | Ga0207688_10079267 | Ga0207688_100792673 | 155 |
| 957 | 3300025901 | Ga0207688_10089230 | Ga0207688_100892303 | 155 |
| 958 | 3300025904 | Ga0207647_10349624 | Ga0207647_103496242 | 155 |
| 959 | 3300025908 | Ga0207643_10215433 | Ga0207643_102154332 | 155 |
| 960 | 3300025909 | Ga0207705_10030691 | Ga0207705_100306915 | 155 |
| 961 | 3300025912 | Ga0207707_10522633 | Ga0207707_105226333 | 155 |
| 962 | 3300025918 | Ga0207662_10036570 | Ga0207662_100365705 | 155 |
| 963 | 3300025919 | Ga0207657_10020965 | Ga0207657_100209656 | 155 |
| 964 | 3300025919 | Ga0207657_10235007 | Ga0207657_102350071 | 155 |
| 965 | 3300025920 | Ga0207649_10550527 | Ga0207649_105505272 | 155 |
| 966 | 3300025922 | Ga0207646_10774641 | Ga0207646_107746412 | 155 |
| 967 | 3300025923 | Ga0207681_10187838 | Ga0207681_101878383 | 155 |
| 968 | 3300025924 | Ga0207694_10150732 | Ga0207694_101507323 | 155 |
| 969 | 3300025925 | Ga0207650_10481011 | Ga0207650_104810113 | 155 |
| 970 | 3300025926 | Ga0207659_10014776 | Ga0207659_100147764 | 155 |
| 971 | 3300025926 | Ga0207659_10419313 | Ga0207659_104193132 | 155 |
| 972 | 3300025931 | Ga0207644_10771867 | Ga0207644_107718672 | 155 |
| 973 | 3300025932 | Ga0207690_10019099 | Ga0207690_100190993 | 155 |
| 974 | 3300025933 | Ga0207706_10036043 | Ga0207706_100360434 | 155 |
| 975 | 3300025934 | Ga0207686_10164275 | Ga0207686_101642753 | 155 |
| 976 | 3300025934 | Ga0207686_10479608 | Ga0207686_104796082 | 155 |
| 977 | 3300025935 | Ga0207709_10011741 | Ga0207709_100117413 | 155 |
| 978 | 3300025937 | Ga0207669_10029973 | Ga0207669_100299732 | 155 |
| 979 | 3300025938 | Ga0207704_10101339 | Ga0207704_101013393 | 155 |
| 980 | 3300025938 | Ga0207704_10411163 | Ga0207704_104111633 | 155 |
| 981 | 3300025940 | Ga0207691_10180133 | Ga0207691_101801332 | 155 |
| 982 | 3300025940 | Ga0207691_10192148 | Ga0207691_101921483 | 155 |
| 983 | 3300025941 | Ga0207711_10752494 | Ga0207711_107524942 | 155 |
| 984 | 3300025942 | Ga0207689_10043039 | Ga0207689_100430393 | 155 |
| 985 | 3300025942 | Ga0207689_10711119 | Ga0207689_107111192 | 155 |
| 986 | 3300025944 | Ga0207661_10064208 | Ga0207661_100642081 | 155 |
| 987 | 3300025944 | Ga0207661_11704212 | Ga0207661_117042121 | 155 |
| 988 | 3300025945 | Ga0207679_10099881 | Ga0207679_100998813 | 155 |
| 989 | 3300025945 | Ga0207679_11002182 | Ga0207679_110021822 | 155 |
| 990 | 3300025949 | Ga0207667_10232490 | Ga0207667_102324903 | 155 |
| 991 | 3300025960 | Ga0207651_10017093 | Ga0207651_100170936 | 155 |
| 992 | 3300025961 | Ga0207712_10581302 | Ga0207712_105813022 | 155 |
| 993 | 3300026023 | Ga0207677_10202239 | Ga0207677_102022393 | 155 |
| 994 | 3300026035 | Ga0207703_10561277 | Ga0207703_105612773 | 155 |
| 995 | 3300026041 | Ga0207639_10064181 | Ga0207639_100641815 | 155 |
| 996 | 3300026067 | Ga0207678_10039230 | Ga0207678_100392306 | 155 |
| 997 | 3300026075 | Ga0207708_10005647 | Ga0207708_100056478 | 155 |
| 998 | 3300026075 | Ga0207708_10345608 | Ga0207708_103456083 | 155 |
| 999 | 3300026078 | Ga0207702_10315278 | Ga0207702_103152783 | 155 |
| 1000 | 3300026088 | Ga0207641_10447263 | Ga0207641_104472631 | 155 |
| 1001 | 3300026089 | Ga0207648_10014192 | Ga0207648_100141925 | 155 |
| 1002 | 3300026089 | Ga0207648_10182953 | Ga0207648_101829533 | 155 |
| 1003 | 3300026095 | Ga0207676_11372407 | Ga0207676_113724071 | 155 |
| 1004 | 3300026118 | Ga0207675_100216861 | Ga0207675_1002168613 | 155 |
| 1005 | 3300026121 | Ga0207683_10038100 | Ga0207683_100381005 | 155 |
| 1006 | 3300028381 | Ga0268264_10244547 | Ga0268264_102445473 | 155 |
| 1007 | 3300031901 | Ga0307406_10459983 | Ga0307406_104599832 | 155 |
| 1008 | 3300032002 | Ga0307416_100089371 | Ga0307416_1000893712 | 155 |
| 1009 | 3300035088 | Ga0373940_0108164 | Ga0373940_0108164_119_589 | 155 |
| 1010 | 3300035092 | Ga0373952_0129280 | Ga0373952_0129280_132_602 | 155 |
| 1011 | 3300035112 | Ga0373932_0342790 | Ga0373932_0342790_84_554 | 155 |
| 1012 | 3300035114 | Ga0373939_0265191 | Ga0373939_0265191_113_583 | 155 |
| 1013 | 3300035242 | Ga0373962_0041658 | Ga0373962_0041658_659_1129 | 155 |
| 1014 | 3300035691 | Ga0373931_0629565 | Ga0373931_0629565_49_519 | 155 |
| 1015 | 3300038443 | Ga0395901_1240299 | Ga0395901_1240299_228_695 | 155 |
| 1016 | 3300041443 | Ga0451789_0326424 | Ga0451789_0326424_104_571 | 155 |
| 1017 | 3300041460 | Ga0451802_1810917 | Ga0451802_1810917_125_592 | 155 |
| 1018 | 3300041486 | Ga0451807_2160026 | Ga0451807_2160026_605_1072 | 155 |
| 1019 | 3300041501 | Ga0451845_0901567 | Ga0451845_0901567_121_588 | 155 |
| 1020 | 3300048904 | Ga0496101_0396021 | Ga0496101_0396021_498_968 | 155 |
| 1021 | 3300048907 | Ga0496104_0173486 | Ga0496104_0173486_1187_1657 | 155 |
| 1022 | 3300048909 | Ga0496106_0376575 | Ga0496106_0376575_238_705 | 155 |
| 1023 | 3300048912 | Ga0496109_0050623 | Ga0496109_0050623_2779_3249 | 155 |
| 1024 | 3300048913 | Ga0496110_0306503 | Ga0496110_0306503_514_984 | 155 |
| 1025 | 3300048914 | Ga0496111_0100914 | Ga0496111_0100914_433_903 | 155 |
| 1026 | 3300048915 | Ga0496112_1372219 | Ga0496112_1372219_111_581 | 155 |
| 1027 | 3300048916 | Ga0496113_0518232 | Ga0496113_0518232_49_519 | 155 |
| 1028 | 3300048917 | Ga0496114_0023362 | Ga0496114_0023362_3004_3474 | 155 |
| 1029 | 3300049575 | Ga0501039_0217914 | Ga0501039_0217914_70_540 | 155 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4d5l-assembly1.cif.gz_Z | cryo-em structures of ribosomal 80s complexes with termination factors and cricket paralysis virus ires reveal the ires in the translocated state | 0.7148 | 98 | 132 |
| 8a98-assembly1.cif.gz_Sa | cryo-em structure of leishmania major 80s ribosome : snorna mutant | 0.6669 | 93 | 128 |
| 4ce4-assembly1.cif.gz_Y | 39s large subunit of the porcine mitochondrial ribosome | 0.6047 | 114 | 135 |
| 4v3p-assembly1.cif.gz_SV | the molecular structure of the left-handed supra-molecular helix of eukaryotic polyribosomes | 0.4788 | 91 | 134 |
| 4gcv-assembly1.cif.gz_A | structure of a putative transcription factor (pa1374)from pseudomonas aeruginosa | 0.4705 | 77 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1w7pA03 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.7693 | 98 | 130 | 1.10.10.10 |
| af_G3XA30_282_372_2.20.70.10 | Mainly Beta;Single Sheet;Ubiquitin Ligase Nedd4; Chain: W;; | 0.5585 | 85 | 128 | 2.20.70.10 |
| 5d1pB03 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme | 0.5199 | 114 | 137 | 3.30.470.30 |
| af_Q4CL09_91_139_3.30.30.30 | Alpha Beta;2-Layer Sandwich;Defensin A-like; | 0.5024 | 106 | 137 | 3.30.30.30 |
| af_O94663_173_242_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.479 | 74 | 128 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q6XAZ9-F1-model_v4 | Uncharacterized protein | 0.9651 | 3 | 120 |
|
| AF-A0A538BMM1-F1-model_v4 | Uncharacterized protein | 0.9532 | 4 | 90 |
|
| AF-A0A1Q6XAZ9-F1-model_v4 | Uncharacterized protein | 0.9417 | 3 | 120 |
|
| AF-A0A7V8YUX2-F1-model_v4 | Uncharacterized protein | 0.9364 | 1 | 135 |
|
| AF-A0A7X7E639-F1-model_v4 | Uncharacterized protein | 0.9331 | 1 | 150 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar