F488578

General Info

Members Datasets Scaffolds Average Seq Length
1029 376 1029 156

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10459983|Ga0307406_104599832
Length 189
Sequence MNARVQTSASPAIAAPPTTSTGASRKVLTGSNYAEAVAQANYRSGADYVVEFLGYRFGFGARDFEERVTAAAVKLGLVESNELDDDETADLVELAADGRIGDPRSGLGRYLVRHWERVSLVGGESLVYWLRKLVFRGAWLDHRVKEGLLEVAWDEDAADFGYRDPRGDRTLLELAPVPSWHELQFRRSA

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
111 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
194 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
195 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
196 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
197 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
198 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
199 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
200 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
204 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
205 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
209 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
210 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
211 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
212 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
213 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
214 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
215 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
216 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
217 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
218 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
219 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
220 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
226 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
231 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
232 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
233 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
234 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
235 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
236 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
237 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
238 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
239 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
240 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
241 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
242 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
243 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
244 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
245 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
246 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
247 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
248 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
249 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
250 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
251 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
252 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
253 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
254 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
255 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
256 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
257 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
258 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
259 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
260 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
261 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
262 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
263 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
264 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
265 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
266 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
267 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
268 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
271 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
272 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
273 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
276 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
277 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
278 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
279 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
280 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
281 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
282 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
283 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
284 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
285 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
286 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
287 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
288 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
289 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
290 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
291 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
292 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
293 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
294 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
295 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
296 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
297 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
298 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
299 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
300 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
301 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
302 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
303 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
304 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
305 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
306 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
307 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
308 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
309 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
310 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
311 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
312 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
320 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
329 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
344 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
345 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
346 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
347 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
348 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
349 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
350 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
351 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
354 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
355 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
356 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
357 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
360 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
361 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
362 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
363 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
364 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
365 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
366 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
367 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
368 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
369 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
370 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
371 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
372 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
373 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
374 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
375 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
376 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 11.08
Rhizosphere 88.53
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10033953 3300001991 Bacteria 1011
2 JGI24738J21930_10016802 3300002075 Bacteria 1542
3 JGI24751J29686_10029864 3300002459 Bacteria 1131
4 JGI25406J46586_10082873 3300003203 Bacteria 980
5 Ga0070658_10091921 3300005327 Bacteria 2501
6 Ga0070658_10160868 3300005327 Bacteria 1883
7 Ga0070683_100003039 3300005329 Bacteria 13484
8 Ga0070683_100238961 3300005329 Bacteria 1728
9 Ga0070683_100594897 3300005329 Bacteria 1058
10 Ga0070683_100771131 3300005329 Bacteria 921
11 Ga0070690_100107022 3300005330 Bacteria 1861
12 Ga0070670_100073980 3300005331 Bacteria 2926
13 Ga0070677_10218021 3300005333 Bacteria 930
14 Ga0068869_100173843 3300005334 Bacteria 1684
15 Ga0068869_100186930 3300005334 Bacteria 1627
16 Ga0070680_100086399 3300005336 Bacteria 2593
17 Ga0070680_100420930 3300005336 Bacteria 1139
18 Ga0070682_100004862 3300005337 Bacteria 7456
19 Ga0070682_100076428 3300005337 Bacteria 2156
20 Ga0070682_100095037 3300005337 Bacteria 1956
21 Ga0070682_100332499 3300005337 Bacteria 1126
22 Ga0068868_100078672 3300005338 Bacteria 2640
23 Ga0068868_100090388 3300005338 Unclassified 2466
24 Ga0068868_100147361 3300005338 Bacteria 1936
25 Ga0068868_100426691 3300005338 Unclassified 1149
26 Ga0070660_100011258 3300005339 Bacteria 6349
27 Ga0070660_100067598 3300005339 Bacteria 2784
28 Ga0070660_100220390 3300005339 Unclassified 1542
29 Ga0070689_100007910 3300005340 Bacteria 7459
30 Ga0070691_10021455 3300005341 Bacteria 2988
31 Ga0070691_10150460 3300005341 Unclassified 1193
32 Ga0070687_100367879 3300005343 Bacteria 933
33 Ga0070661_100018221 3300005344 Bacteria 4989
34 Ga0070692_10028248 3300005345 Bacteria 2787
35 Ga0070692_10076474 3300005345 Unclassified 1794
36 Ga0070692_10394693 3300005345 Unclassified 872
37 Ga0070668_100236833 3300005347 Bacteria 1511
38 Ga0070669_100399130 3300005353 Bacteria 1125
39 Ga0070669_100935013 3300005353 Bacteria 742
40 Ga0070675_100035405 3300005354 Bacteria 4056
41 Ga0070675_100135730 3300005354 Bacteria 2100
42 Ga0070671_100024898 3300005355 Bacteria 4903
43 Ga0070671_100032475 3300005355 Bacteria 4315
44 Ga0070674_100027096 3300005356 Bacteria 3752
45 Ga0070674_100168144 3300005356 Bacteria 1669
46 Ga0070674_100420967 3300005356 Bacteria 1096
47 Ga0070673_100018556 3300005364 Bacteria 4972
48 Ga0070673_100285605 3300005364 Bacteria 1448
49 Ga0070673_100413504 3300005364 Bacteria 1208
50 Ga0070688_100008089 3300005365 Bacteria 5695
51 Ga0070688_101117541 3300005365 Bacteria 630
52 Ga0070659_100034064 3300005366 Bacteria 3960
53 Ga0070659_100075498 3300005366 Bacteria 2686
54 Ga0070659_100078257 3300005366 Unclassified 2638
55 Ga0070659_100132956 3300005366 Bacteria 2021
56 Ga0070659_101004060 3300005366 Bacteria 733
57 Ga0070667_100097501 3300005367 Unclassified 2536
58 Ga0070667_100493864 3300005367 Bacteria 1121
59 Ga0070703_10015426 3300005406 Bacteria 2186
60 Ga0070709_10033600 3300005434 Unclassified 3103
61 Ga0070709_10231665 3300005434 Unclassified 1322
62 Ga0070709_10313801 3300005434 Bacteria 1149
63 Ga0070714_100041880 3300005435 Bacteria 3867
64 Ga0070714_100055569 3300005435 Bacteria 3384
65 Ga0070714_100155133 3300005435 Bacteria 2066
66 Ga0070714_100300780 3300005435 Unclassified 1495
67 Ga0070714_100350685 3300005435 Bacteria 1386
68 Ga0070714_101019294 3300005435 Unclassified 806
69 Ga0070714_101412513 3300005435 Bacteria 680
70 Ga0070713_100039071 3300005436 Bacteria 3849
71 Ga0070713_100088719 3300005436 Bacteria 2655
72 Ga0070713_100392050 3300005436 Bacteria 1295
73 Ga0070713_100729979 3300005436 Unclassified 947
74 Ga0070710_10016281 3300005437 Bacteria 3780
75 Ga0070710_10447774 3300005437 Unclassified 875
76 Ga0070701_10015957 3300005438 Bacteria 3481
77 Ga0070701_10066150 3300005438 Unclassified 1920
78 Ga0070711_100008896 3300005439 Bacteria 6162
79 Ga0070711_100061027 3300005439 Unclassified 2623
80 Ga0070711_100133651 3300005439 Bacteria 1851
81 Ga0070711_100295805 3300005439 Bacteria 1286
82 Ga0070705_100121785 3300005440 Bacteria 1685
83 Ga0070705_100164040 3300005440 Bacteria 1488
84 Ga0070700_100005657 3300005441 Bacteria 6632
85 Ga0070700_100039344 3300005441 Bacteria 2888
86 Ga0070700_100276115 3300005441 Bacteria 1216
87 Ga0070700_100462838 3300005441 Bacteria 967
88 Ga0070694_100010427 3300005444 Bacteria 5734
89 Ga0070694_100439867 3300005444 Bacteria 1028
90 Ga0070708_100035231 3300005445 Bacteria 4359
91 Ga0070708_100099088 3300005445 Bacteria 2666
92 Ga0070708_100127815 3300005445 Bacteria 2350
93 Ga0070708_100671681 3300005445 Bacteria 976
94 Ga0070663_100028601 3300005455 Bacteria 3797
95 Ga0070663_100170142 3300005455 Bacteria 1683
96 Ga0070663_100911941 3300005455 Unclassified 760
97 Ga0070678_100143734 3300005456 Bacteria 1912
98 Ga0070678_100542388 3300005456 Unclassified 1031
99 Ga0070678_100959910 3300005456 Unclassified 784
100 Ga0070662_100261437 3300005457 Bacteria 1394
101 Ga0070662_100363614 3300005457 Bacteria 1188
102 Ga0070662_100797923 3300005457 Unclassified 802
103 Ga0070662_100813402 3300005457 Unclassified 795
104 Ga0070681_10026696 3300005458 Bacteria 5805
105 Ga0070681_10054579 3300005458 Bacteria 3982
106 Ga0070681_10112138 3300005458 Bacteria 2667
107 Ga0070681_10312857 3300005458 Unclassified 1480
108 Ga0068867_100116194 3300005459 Bacteria 2061
109 Ga0068867_100269851 3300005459 Bacteria 1390
110 Ga0070685_10038333 3300005466 Unclassified 2717
111 Ga0070706_100079146 3300005467 Unclassified 3042
112 Ga0070706_100373835 3300005467 Bacteria 1328
113 Ga0070707_100000419 3300005468 Bacteria 41972
114 Ga0070707_100001607 3300005468 Bacteria 21878
115 Ga0070707_100003988 3300005468 Bacteria 13898
116 Ga0070707_100236109 3300005468 Unclassified 1780
117 Ga0070707_100360090 3300005468 Bacteria 1413
118 Ga0070707_100735109 3300005468 Unclassified 950
119 Ga0070698_100045939 3300005471 Bacteria 4467
120 Ga0070698_100052057 3300005471 Bacteria 4168
121 Ga0070698_100114603 3300005471 Bacteria 2660
122 Ga0070698_100192052 3300005471 Bacteria 1979
123 Ga0070698_100193050 3300005471 Bacteria 1973
124 Ga0070698_101142715 3300005471 Unclassified 728
125 Ga0070699_100181543 3300005518 Bacteria 1867
126 Ga0070699_100372920 3300005518 Bacteria 1288
127 Ga0070699_100850918 3300005518 Bacteria 835
128 Ga0070699_101042966 3300005518 Unclassified 750
129 Ga0070699_101515277 3300005518 Unclassified 615
130 Ga0070679_100041373 3300005530 Bacteria 4587
131 Ga0070679_100120417 3300005530 Bacteria 2609
132 Ga0070679_100162589 3300005530 Bacteria 2207
133 Ga0070679_100674825 3300005530 Bacteria 976
134 Ga0070679_100794012 3300005530 Bacteria 890
135 Ga0070684_100037440 3300005535 Bacteria 4161
136 Ga0070684_100049801 3300005535 Bacteria 3637
137 Ga0070684_100124416 3300005535 Bacteria 2322
138 Ga0070684_100435850 3300005535 Bacteria 1210
139 Ga0070697_100105658 3300005536 Bacteria 2342
140 Ga0070697_100679420 3300005536 Unclassified 908
141 Ga0068853_100012336 3300005539 Bacteria 6954
142 Ga0068853_100034262 3300005539 Bacteria 4310
143 Ga0070672_100016613 3300005543 Bacteria 5274
144 Ga0070672_100033472 3300005543 Bacteria 3893
145 Ga0070672_100059769 3300005543 Bacteria 2999
146 Ga0070686_100007592 3300005544 Bacteria 6057
147 Ga0070686_100464423 3300005544 Bacteria 976
148 Ga0070686_101019007 3300005544 Bacteria 680
149 Ga0070695_100015857 3300005545 Bacteria 4553
150 Ga0070696_100114749 3300005546 Bacteria 1943
151 Ga0070696_100307116 3300005546 Bacteria 1217
152 Ga0070693_100139884 3300005547 Bacteria 1522
153 Ga0070665_100090983 3300005548 Unclassified 3056
154 Ga0070665_100202007 3300005548 Bacteria 1988
155 Ga0070665_100870218 3300005548 Unclassified 914
156 Ga0070704_100034442 3300005549 Bacteria 3434
157 Ga0068855_100066978 3300005563 Bacteria 4186
158 Ga0068855_100151728 3300005563 Bacteria 2634
159 Ga0068855_100182643 3300005563 Bacteria 2371
160 Ga0068855_100244501 3300005563 Unclassified 2004
161 Ga0068855_100727697 3300005563 Bacteria 1060
162 Ga0070664_100089152 3300005564 Bacteria 2668
163 Ga0070664_100109175 3300005564 Bacteria 2413
164 Ga0070664_100520854 3300005564 Bacteria 1097
165 Ga0068857_100121899 3300005577 Unclassified 2348
166 Ga0068857_100155027 3300005577 Bacteria 2077
167 Ga0068854_100025571 3300005578 Bacteria 4052
168 Ga0068854_100073533 3300005578 Bacteria 2505
169 Ga0068854_101034569 3300005578 Bacteria 729
170 Ga0068856_100035377 3300005614 Bacteria 4894
171 Ga0068856_100204018 3300005614 Unclassified 1992
172 Ga0068856_100341942 3300005614 Unclassified 1514
173 Ga0068856_100431644 3300005614 Unclassified 1338
174 Ga0068852_100022989 3300005616 Bacteria 5010
175 Ga0068852_100031104 3300005616 Bacteria 4400
176 Ga0068852_100267557 3300005616 Bacteria 1644
177 Ga0068859_100266234 3300005617 Unclassified 1806
178 Ga0068864_100130691 3300005618 Unclassified 2255
179 Ga0068864_100259900 3300005618 Unclassified 1615
180 Ga0068866_10003027 3300005718 Bacteria 6938
181 Ga0068866_10494740 3300005718 Bacteria 808
182 Ga0068851_10808382 3300005834 Unclassified 583
183 Ga0068870_10232310 3300005840 Bacteria 1134
184 Ga0068870_10481742 3300005840 Unclassified 823
185 Ga0068863_100081637 3300005841 Bacteria 3062
186 Ga0068863_100152411 3300005841 Bacteria 2212
187 Ga0068863_100272785 3300005841 Bacteria 1638
188 Ga0068858_100280118 3300005842 Bacteria 1588
189 Ga0068860_100074245 3300005843 Bacteria 3233
190 Ga0068860_100188377 3300005843 Bacteria 1996
191 Ga0068860_101349398 3300005843 Bacteria 734
192 Ga0068862_101099954 3300005844 Bacteria 790
193 Ga0081455_10078009 3300005937 Bacteria 2723
194 Ga0081538_10079840 3300005981 Bacteria 1748
195 Ga0081539_10002469 3300005985 Bacteria 26025
196 Ga0081539_10026936 3300005985 Bacteria 3653
197 Ga0081539_10055432 3300005985 Bacteria 2205
198 Ga0070717_10010680 3300006028 Bacteria 6943
199 Ga0070717_10019680 3300006028 Bacteria 5298
200 Ga0070717_10029685 3300006028 Bacteria 4390
201 Ga0070717_10186870 3300006028 Bacteria 1809
202 Ga0070717_10383940 3300006028 Bacteria 1260
203 Ga0070717_10619643 3300006028 Bacteria 982
204 Ga0075432_10015184 3300006058 Unclassified 2626
205 Ga0070716_100064676 3300006173 Bacteria 2128
206 Ga0070716_100254273 3300006173 Unclassified 1199
207 Ga0070716_100408304 3300006173 Unclassified 979
208 Ga0070716_101050683 3300006173 Bacteria 647
209 Ga0070712_100040223 3300006175 Bacteria 3204
210 Ga0070712_100041602 3300006175 Bacteria 3156
211 Ga0070712_100115633 3300006175 Unclassified 2010
212 Ga0070712_100218667 3300006175 Bacteria 1507
213 Ga0070712_100501332 3300006175 Bacteria 1018
214 Ga0075367_10161378 3300006178 Bacteria 1394
215 Ga0097621_100005668 3300006237 Bacteria 8813
216 Ga0097621_100021679 3300006237 Bacteria 4975
217 Ga0075370_10386093 3300006353 Bacteria 839
218 Ga0068871_100040618 3300006358 Bacteria 3727
219 Ga0068871_100380635 3300006358 Bacteria 1253
220 Ga0075428_100388149 3300006844 Bacteria 1497
221 Ga0075430_100003551 3300006846 Bacteria 13059
222 Ga0075431_100056106 3300006847 Bacteria 4063
223 Ga0075431_100065229 3300006847 Bacteria 3760
224 Ga0075433_10003167 3300006852 Bacteria 12677
225 Ga0075433_10032871 3300006852 Bacteria 4445
226 Ga0075433_10255570 3300006852 Bacteria 1554
227 Ga0075433_10270432 3300006852 Bacteria 1506
228 Ga0075434_100003532 3300006871 Bacteria 13958
229 Ga0075434_100013149 3300006871 Bacteria 7862
230 Ga0075434_100022158 3300006871 Bacteria 6187
231 Ga0075434_100027641 3300006871 Bacteria 5571
232 Ga0075434_100089619 3300006871 Bacteria 3077
233 Ga0075434_100095449 3300006871 Bacteria 2979
234 Ga0075434_100439384 3300006871 Bacteria 1326
235 Ga0075429_100177152 3300006880 Unclassified 1868
236 Ga0075429_100283676 3300006880 Bacteria 1450
237 Ga0068865_100002392 3300006881 Bacteria 11065
238 Ga0068865_100073604 3300006881 Bacteria 2430
239 Ga0068865_100226748 3300006881 Unclassified 1463
240 Ga0068865_100422365 3300006881 Bacteria 1096
241 Ga0068865_100647113 3300006881 Bacteria 898
242 Ga0068865_101687097 3300006881 Bacteria 571
243 Ga0075436_100026821 3300006914 Bacteria 3966
244 Ga0075436_100148767 3300006914 Bacteria 1647
245 Ga0075436_100338492 3300006914 Unclassified 1083
246 Ga0075436_100495690 3300006914 Unclassified 893
247 Ga0075436_101021753 3300006914 Bacteria 621
248 Ga0097620_100266227 3300006931 Unclassified 1806
249 Ga0075435_100011506 3300007076 Bacteria 6515
250 Ga0075435_100050093 3300007076 Bacteria 3360
251 Ga0075435_100103392 3300007076 Bacteria 2363
252 Ga0075435_100174150 3300007076 Unclassified 1816
253 Ga0105240_10018876 3300009093 Bacteria 9232
254 Ga0105240_10206915 3300009093 Bacteria 2296
255 Ga0105240_10355716 3300009093 Bacteria 1660
256 Ga0111539_10014355 3300009094 Bacteria 9889
257 Ga0111539_10054002 3300009094 Bacteria 4782
258 Ga0111539_10086472 3300009094 Bacteria 3684
259 Ga0111539_10459599 3300009094 Bacteria 1483
260 Ga0111539_10523362 3300009094 Bacteria 1382
261 Ga0111539_10821363 3300009094 Unclassified 1082
262 Ga0111539_12519810 3300009094 Bacteria 596
263 Ga0105245_10033732 3300009098 Bacteria 4537
264 Ga0105245_10116058 3300009098 Unclassified 2496
265 Ga0105245_10184692 3300009098 Bacteria 1994
266 Ga0105245_10214751 3300009098 Bacteria 1853
267 Ga0105245_10288822 3300009098 Bacteria 1606
268 Ga0105245_10304859 3300009098 Bacteria 1564
269 Ga0105245_10315925 3300009098 Bacteria 1537
270 Ga0105245_10409629 3300009098 Bacteria 1357
271 Ga0114129_10002076 3300009147 Bacteria 27550
272 Ga0114129_10046212 3300009147 Bacteria 6120
273 Ga0114129_10047402 3300009147 Bacteria 6038
274 Ga0114129_10588614 3300009147 Unclassified 1443
275 Ga0114129_10682440 3300009147 Unclassified 1322
276 Ga0114129_10794502 3300009147 Bacteria 1208
277 Ga0114129_12249354 3300009147 Bacteria 655
278 Ga0105243_10006669 3300009148 Bacteria 8915
279 Ga0105243_10033294 3300009148 Bacteria 3985
280 Ga0105243_10189386 3300009148 Bacteria 1796
281 Ga0105243_10855031 3300009148 Unclassified 901
282 Ga0105243_11106201 3300009148 Unclassified 801
283 Ga0105241_10062546 3300009174 Unclassified 2870
284 Ga0105241_10068970 3300009174 Bacteria 2741
285 Ga0105242_10003093 3300009176 Bacteria 12989
286 Ga0105242_10040521 3300009176 Bacteria 3753
287 Ga0105242_10233078 3300009176 Bacteria 1651
288 Ga0105242_12301201 3300009176 Bacteria 585
289 Ga0105248_10026898 3300009177 Bacteria 6398
290 Ga0105248_10088812 3300009177 Bacteria 3479
291 Ga0105248_11844089 3300009177 Bacteria 686
292 Ga0105237_10017342 3300009545 Bacteria 7465
293 Ga0105237_10033527 3300009545 Bacteria 5203
294 Ga0105238_10054416 3300009551 Bacteria 4018
295 Ga0105238_10071537 3300009551 Bacteria 3466
296 Ga0105238_10118699 3300009551 Bacteria 2625
297 Ga0105238_10255943 3300009551 Bacteria 1730
298 Ga0105249_10001129 3300009553 Bacteria 23688
299 Ga0105249_11876665 3300009553 Unclassified 672
300 Ga0105239_10035534 3300010375 Bacteria 5472
301 Ga0105239_10114040 3300010375 Unclassified 2997
302 Ga0105239_10910247 3300010375 Bacteria 1010
303 Ga0105246_10082381 3300011119 Bacteria 2296
304 Ga0105246_10291556 3300011119 Bacteria 1313
305 Ga0105246_10334365 3300011119 Unclassified 1236
306 Ga0157347_1014097 3300012502 Bacteria 879
307 Ga0157316_1026975 3300012510 Bacteria 671
308 Ga0157371_10048863 3300013102 Unclassified 3007
309 Ga0157371_10150922 3300013102 Unclassified 1657
310 Ga0157370_10367683 3300013104 Bacteria 1325
311 Ga0157370_10825476 3300013104 Bacteria 843
312 Ga0157369_10038160 3300013105 Bacteria 5254
313 Ga0157369_10665272 3300013105 Unclassified 1073
314 Ga0157374_10035553 3300013296 Bacteria 4558
315 Ga0157374_10271973 3300013296 Bacteria 1671
316 Ga0157374_10275441 3300013296 Unclassified 1660
317 Ga0157374_11103443 3300013296 Bacteria 814
318 Ga0157378_10311335 3300013297 Bacteria 1527
319 Ga0157378_10741838 3300013297 Bacteria 1004
320 Ga0163162_10006515 3300013306 Bacteria 11310
321 Ga0163162_10254301 3300013306 Unclassified 1889
322 Ga0157372_10040194 3300013307 Bacteria 5165
323 Ga0157372_10126490 3300013307 Bacteria 2938
324 Ga0157372_10163377 3300013307 Bacteria 2574
325 Ga0157372_10373262 3300013307 Bacteria 1662
326 Ga0157372_11485226 3300013307 Bacteria 781
327 Ga0157375_10104469 3300013308 Unclassified 2921
328 Ga0157375_10387811 3300013308 Bacteria 1564
329 Ga0163163_11279269 3300014325 Bacteria 796
330 Ga0163163_12136958 3300014325 Unclassified 619
331 Ga0157380_10150608 3300014326 Bacteria 2010
332 Ga0157380_10423646 3300014326 Bacteria 1270
333 Ga0157380_10645474 3300014326 Bacteria 1055
334 Ga0157377_10009433 3300014745 Bacteria 4788
335 Ga0157377_10023413 3300014745 Bacteria 3272
336 Ga0157377_10070806 3300014745 Bacteria 2015
337 Ga0157377_10175965 3300014745 Bacteria 1342
338 Ga0157379_10250686 3300014968 Bacteria 1607
339 Ga0157379_10442200 3300014968 Bacteria 1199
340 Ga0157379_11251788 3300014968 Unclassified 715
341 Ga0157376_10007904 3300014969 Bacteria 7630
342 Ga0157376_10037609 3300014969 Bacteria 3931
343 Ga0157376_10264839 3300014969 Bacteria 1612
344 Ga0157376_11085808 3300014969 Bacteria 826
345 Ga0182007_10053513 3300015262 Bacteria 1329
346 Ga0163161_10083494 3300017792 Bacteria 2354
347 Ga0206356_10262733 3300020070 Bacteria 1909
348 Ga0206356_10787478 3300020070 Bacteria 3674
349 Ga0206356_11730020 3300020070 Bacteria 809
350 Ga0206354_10520745 3300020081 Bacteria 2283
351 Ga0206354_10569858 3300020081 Bacteria 1173
352 Ga0206354_11504563 3300020081 Bacteria 605
353 Ga0206353_11087294 3300020082 Bacteria 1159
354 Ga0213871_10007472 3300021441 Bacteria 2366
355 Ga0207656_10010697 3300025321 Bacteria 3445
356 Ga0207653_10004869 3300025885 Bacteria 4193
357 Ga0207682_10288945 3300025893 Unclassified 767
358 Ga0207692_10038360 3300025898 Bacteria 2349
359 Ga0207642_10038947 3300025899 Bacteria 2061
360 Ga0207710_10265134 3300025900 Bacteria 862
361 Ga0207688_10079267 3300025901 Bacteria 1873
362 Ga0207688_10089230 3300025901 Bacteria 1769
363 Ga0207647_10349624 3300025904 Bacteria 837
364 Ga0207685_10027301 3300025905 Bacteria 1996
365 Ga0207685_10077729 3300025905 Unclassified 1364
366 Ga0207699_10013206 3300025906 Bacteria 4220
367 Ga0207699_10035692 3300025906 Bacteria 2830
368 Ga0207699_10040944 3300025906 Bacteria 2672
369 Ga0207699_10065567 3300025906 Bacteria 2202
370 Ga0207699_10679624 3300025906 Unclassified 753
371 Ga0207643_10215433 3300025908 Bacteria 1173
372 Ga0207705_10030691 3300025909 Bacteria 3835
373 Ga0207705_10385289 3300025909 Bacteria 1083
374 Ga0207707_10047170 3300025912 Bacteria 3752
375 Ga0207707_10169485 3300025912 Bacteria 1908
376 Ga0207707_10438598 3300025912 Bacteria 1118
377 Ga0207707_10522633 3300025912 Bacteria 1010
378 Ga0207695_10152810 3300025913 Bacteria 2246
379 Ga0207693_10011542 3300025915 Bacteria 7144
380 Ga0207693_10012563 3300025915 Bacteria 6840
381 Ga0207693_10829848 3300025915 Bacteria 712
382 Ga0207663_10420265 3300025916 Bacteria 1026
383 Ga0207663_10449672 3300025916 Bacteria 993
384 Ga0207660_10142593 3300025917 Bacteria 1833
385 Ga0207662_10036570 3300025918 Bacteria 2870
386 Ga0207657_10007057 3300025919 Bacteria 11541
387 Ga0207657_10020965 3300025919 Bacteria 6164
388 Ga0207657_10235007 3300025919 Archaea 1465
389 Ga0207649_10086997 3300025920 Bacteria 2038
390 Ga0207649_10550527 3300025920 Bacteria 883
391 Ga0207652_10022340 3300025921 Bacteria 5233
392 Ga0207652_10780469 3300025921 Bacteria 849
393 Ga0207652_10815415 3300025921 Bacteria 828
394 Ga0207646_10003186 3300025922 Bacteria 18746
395 Ga0207646_10054237 3300025922 Bacteria 3586
396 Ga0207646_10226230 3300025922 Bacteria 1690
397 Ga0207646_10774641 3300025922 Bacteria 855
398 Ga0207681_10187838 3300025923 Bacteria 1579
399 Ga0207694_10150732 3300025924 Bacteria 1873
400 Ga0207694_10311660 3300025924 Unclassified 1297
401 Ga0207650_10481011 3300025925 Bacteria 1036
402 Ga0207659_10014776 3300025926 Bacteria 5045
403 Ga0207659_10419313 3300025926 Bacteria 1122
404 Ga0207687_10115735 3300025927 Bacteria 1998
405 Ga0207687_10607600 3300025927 Unclassified 922
406 Ga0207700_10000002 3300025928 Bacteria 775978
407 Ga0207700_10245302 3300025928 Bacteria 1528
408 Ga0207700_10511879 3300025928 Bacteria 1063
409 Ga0207664_10043236 3300025929 Bacteria 3522
410 Ga0207664_10129302 3300025929 Bacteria 2124
411 Ga0207664_10153151 3300025929 Bacteria 1960
412 Ga0207664_10293460 3300025929 Bacteria 1429
413 Ga0207664_10333495 3300025929 Bacteria 1340
414 Ga0207664_10535490 3300025929 Unclassified 1050
415 Ga0207644_10771867 3300025931 Bacteria 803
416 Ga0207690_10019099 3300025932 Bacteria 4212
417 Ga0207690_10085158 3300025932 Bacteria 2218
418 Ga0207706_10036043 3300025933 Bacteria 4395
419 Ga0207706_11112823 3300025933 Bacteria 659
420 Ga0207686_10164275 3300025934 Bacteria 1559
421 Ga0207686_10198033 3300025934 Bacteria 1437
422 Ga0207686_10479608 3300025934 Bacteria 961
423 Ga0207709_10011741 3300025935 Bacteria 4829
424 Ga0207669_10029973 3300025937 Bacteria 3017
425 Ga0207669_10138624 3300025937 Bacteria 1685
426 Ga0207704_10101339 3300025938 Unclassified 1920
427 Ga0207704_10274267 3300025938 Bacteria 1279
428 Ga0207704_10411163 3300025938 Bacteria 1070
429 Ga0207665_10006081 3300025939 Bacteria 8014
430 Ga0207665_10034021 3300025939 Unclassified 3381
431 Ga0207665_10035443 3300025939 Bacteria 3312
432 Ga0207665_10063722 3300025939 Bacteria 2504
433 Ga0207665_10695347 3300025939 Unclassified 799
434 Ga0207691_10180133 3300025940 Bacteria 1847
435 Ga0207691_10192148 3300025940 Bacteria 1780
436 Ga0207711_10385571 3300025941 Unclassified 1301
437 Ga0207711_10421677 3300025941 Unclassified 1241
438 Ga0207711_10752494 3300025941 Bacteria 908
439 Ga0207689_10043039 3300025942 Bacteria 3734
440 Ga0207689_10711119 3300025942 Bacteria 847
441 Ga0207661_10028822 3300025944 Bacteria 4256
442 Ga0207661_10064208 3300025944 Bacteria 2975
443 Ga0207661_10243765 3300025944 Bacteria 1596
444 Ga0207661_10277722 3300025944 Unclassified 1496
445 Ga0207661_11704212 3300025944 Bacteria 575
446 Ga0207679_10099881 3300025945 Bacteria 2267
447 Ga0207679_10111311 3300025945 Unclassified 2161
448 Ga0207679_11002182 3300025945 Bacteria 766
449 Ga0207667_10232490 3300025949 Bacteria 1887
450 Ga0207667_10292677 3300025949 Unclassified 1664
451 Ga0207651_10017093 3300025960 Bacteria 4274
452 Ga0207712_10581302 3300025961 Bacteria 967
453 Ga0207640_11420574 3300025981 Unclassified 622
454 Ga0207658_10945171 3300025986 Bacteria 786
455 Ga0207677_10202239 3300026023 Bacteria 1580
456 Ga0207703_10561277 3300026035 Bacteria 1077
457 Ga0207639_10064181 3300026041 Bacteria 2846
458 Ga0207678_10039230 3300026067 Bacteria 4111
459 Ga0207678_10510420 3300026067 Bacteria 1048
460 Ga0207708_10005647 3300026075 Bacteria 9239
461 Ga0207708_10345608 3300026075 Bacteria 1219
462 Ga0207702_10223826 3300026078 Bacteria 1754
463 Ga0207702_10261651 3300026078 Unclassified 1629
464 Ga0207702_10315278 3300026078 Unclassified 1488
465 Ga0207702_10482675 3300026078 Bacteria 1206
466 Ga0207702_10604575 3300026078 Bacteria 1076
467 Ga0207641_10447263 3300026088 Bacteria 1248
468 Ga0207648_10014192 3300026089 Bacteria 7368
469 Ga0207648_10182953 3300026089 Bacteria 1855
470 Ga0207676_11372407 3300026095 Bacteria 702
471 Ga0207674_11273260 3300026116 Unclassified 705
472 Ga0207675_100216861 3300026118 Unclassified 1842
473 Ga0207683_10038100 3300026121 Bacteria 4188
474 Ga0207683_10297370 3300026121 Bacteria 1477
475 Ga0207683_10818396 3300026121 Bacteria 864
476 Ga0207698_10403011 3300026142 Unclassified 1308
477 Ga0207428_10197966 3300027907 Bacteria 1512
478 Ga0268264_10244547 3300028381 Unclassified 1663
479 Ga0265319_1039088 3300028563 Bacteria 1610
480 Ga0265334_10057525 3300028573 Bacteria 1473
481 Ga0265318_10094314 3300028577 Bacteria 1102
482 Ga0265318_10205284 3300028577 Bacteria 720
483 Ga0265322_10026972 3300028654 Bacteria 1642
484 Ga0265322_10222877 3300028654 Bacteria 540
485 Ga0265338_10006871 3300028800 Bacteria 14326
486 Ga0265338_10021008 3300028800 Bacteria 6829
487 Ga0265338_10033213 3300028800 Bacteria 5012
488 Ga0265338_10283550 3300028800 Bacteria 1209
489 Ga0265324_10021263 3300029957 Unclassified 2327
490 Ga0265324_10046211 3300029957 Bacteria 1498
491 Ga0265325_10115133 3300031241 Bacteria 1302
492 Ga0265339_10003596 3300031249 Bacteria 10824
493 Ga0265339_10250913 3300031249 Bacteria 856
494 Ga0265316_10034471 3300031344 Bacteria 4111
495 Ga0307408_101099614 3300031548 Bacteria 737
496 Ga0265313_10005266 3300031595 Bacteria 9574
497 Ga0265313_10035236 3300031595 Bacteria 2523
498 Ga0265313_10074298 3300031595 Unclassified 1559
499 Ga0265314_10018946 3300031711 Bacteria 5340
500 Ga0265314_10264730 3300031711 Bacteria 980
501 Ga0265342_10020754 3300031712 Bacteria 4206
502 Ga0307406_10459983 3300031901 Bacteria 1023
503 Ga0307416_100089371 3300032002 Bacteria 2637
504 Ga0307415_100320294 3300032126 Bacteria 1292
505 Ga0316583_10211054 3300032133 Unclassified 673
506 Ga0373938_0216897 3300034957 Bacteria 536
507 Ga0373934_0052817 3300035086 Bacteria 1612
508 Ga0373940_0108164 3300035088 Bacteria 851
509 Ga0373944_0175340 3300035089 Bacteria 767
510 Ga0373952_0129280 3300035092 Bacteria 692
511 Ga0373932_0342790 3300035112 Bacteria 567
512 Ga0373939_0265191 3300035114 Bacteria 673
513 Ga0373953_0144906 3300035117 Bacteria 1017
514 Ga0373955_0229676 3300035172 Bacteria 1110
515 Ga0373962_0041658 3300035242 Bacteria 1295
516 Ga0373924_0021732 3300035410 Bacteria 2504
517 Ga0373931_0629565 3300035691 Bacteria 703
518 Ga0373935_0749894 3300035692 Bacteria 719
519 Ga0373933_0106457 3300035724 Bacteria 1745
520 Ga0373933_0321505 3300035724 Bacteria 1003
521 Ga0373937_0000355 3300036401 Bacteria 42585
522 Ga0373937_0091047 3300036401 Bacteria 2826
523 Ga0373937_0298173 3300036401 Bacteria 1523
524 Ga0373937_1145695 3300036401 Archaea 726
525 Ga0395899_0071039 3300037312 Bacteria 2548
526 Ga0395899_0122086 3300037312 Unclassified 1865
527 Ga0395899_0708601 3300037312 Unclassified 630
528 Ga0395899_0788968 3300037312 Bacteria 588
529 Ga0395900_0002117 3300037418 Bacteria 22226
530 Ga0395900_0059737 3300037418 Bacteria 3925
531 Ga0395900_0077708 3300037418 Bacteria 3410
532 Ga0395900_0311147 3300037418 Unclassified 1558
533 Ga0395898_0001862 3300037466 Bacteria 27022
534 Ga0395898_0012734 3300037466 Bacteria 8686
535 Ga0395898_0043527 3300037466 Bacteria 4424
536 Ga0395898_0054213 3300037466 Bacteria 3913
537 Ga0395898_0197609 3300037466 Bacteria 1921
538 Ga0395898_0484565 3300037466 Bacteria 1177
539 Ga0395898_0616071 3300037466 Bacteria 1028
540 Ga0395905_0006129 3300037471 Bacteria 12140
541 Ga0395905_0029868 3300037471 Bacteria 5138
542 Ga0395905_0083375 3300037471 Bacteria 2995
543 Ga0395905_0414010 3300037471 Bacteria 1243
544 Ga0395905_0494968 3300037471 Bacteria 1122
545 Ga0395901_0002058 3300038443 Bacteria 20621
546 Ga0395901_0006996 3300038443 Bacteria 11404
547 Ga0395901_0207248 3300038443 Bacteria 2053
548 Ga0395901_0238432 3300038443 Bacteria 1897
549 Ga0395901_0335626 3300038443 Bacteria 1562
550 Ga0395901_0449821 3300038443 Bacteria 1317
551 Ga0395901_0611650 3300038443 Bacteria 1098
552 Ga0395901_1240299 3300038443 Bacteria 710
553 Ga0242420_021660 3300038996 Bacteria 1152
554 Ga0242420_048160 3300038996 Bacteria 828
555 Ga0436360_0128350 3300039438 Bacteria 9271
556 Ga0436360_0322959 3300039438 Bacteria 909
557 Ga0436363_0954544 3300039450 Bacteria 1273
558 Ga0436362_0303237 3300039453 Bacteria 1220
559 Ga0436362_1041280 3300039453 Bacteria 758
560 Ga0439439_0003235 3300041406 Bacteria 3574
561 Ga0439461_0041228 3300041410 Unclassified 998
562 Ga0451789_0326424 3300041443 Bacteria 979
563 Ga0451793_0333081 3300041452 Bacteria 683
564 Ga0451802_1810917 3300041460 Bacteria 1025
565 Ga0451807_2160026 3300041486 Bacteria 1894
566 Ga0451845_0901567 3300041501 Unclassified 899
567 Ga0439431_0055587 3300041997 Unclassified 1034
568 Ga0439433_0001716 3300041999 Bacteria 4559
569 Ga0439442_032183 3300042002 Bacteria 1096
570 Ga0439449_0008224 3300042007 Bacteria 3967
571 Ga0439454_019439 3300042011 Unclassified 988
572 Ga0439462_0017304 3300042015 Unclassified 1867
573 Ga0450920_011767 3300042122 Bacteria 1634
574 Ga0439446_0009557 3300042156 Bacteria 2597
575 Ga0466969_0000591 3300044656 Bacteria 19709
576 Ga0466969_0010882 3300044656 Bacteria 4820
577 Ga0466969_0102123 3300044656 Bacteria 1349
578 Ga0466965_0032491 3300044683 Bacteria 2549
579 Ga0466965_0056596 3300044683 Bacteria 1953
580 Ga0466965_0068408 3300044683 Bacteria 1783
581 Ga0466965_0140309 3300044683 Bacteria 1258
582 Ga0466966_0003367 3300044684 Bacteria 10543
583 Ga0466966_0069894 3300044684 Bacteria 2202
584 Ga0466966_0101116 3300044684 Bacteria 1783
585 Ga0466966_0142777 3300044684 Bacteria 1462
586 Ga0466966_0502419 3300044684 Bacteria 729
587 Ga0466961_0008344 3300044693 Bacteria 6595
588 Ga0466961_0115240 3300044693 Bacteria 1689
589 Ga0466961_0115468 3300044693 Bacteria 1687
590 Ga0466961_0242394 3300044693 Bacteria 1108
591 Ga0466963_0000037 3300044694 Bacteria 42541
592 Ga0466963_0000670 3300044694 Bacteria 16566
593 Ga0466963_0001565 3300044694 Bacteria 12405
594 Ga0466963_0001933 3300044694 Bacteria 11347
595 Ga0466963_0002985 3300044694 Bacteria 9562
596 Ga0466963_0006848 3300044694 Bacteria 6780
597 Ga0466963_0011378 3300044694 Bacteria 5417
598 Ga0466963_0030930 3300044694 Bacteria 3457
599 Ga0466963_0031901 3300044694 Bacteria 3407
600 Ga0466963_0058286 3300044694 Bacteria 2574
601 Ga0466963_0069923 3300044694 Bacteria 2360
602 Ga0466963_0070698 3300044694 Bacteria 2348
603 Ga0466963_0080094 3300044694 Bacteria 2210
604 Ga0466963_0499285 3300044694 Bacteria 859
605 Ga0466964_0008661 3300044706 Bacteria 3825
606 Ga0466964_0010906 3300044706 Bacteria 3433
607 Ga0466964_0044673 3300044706 Bacteria 1800
608 Ga0466964_0055534 3300044706 Bacteria 1635
609 Ga0466964_0058045 3300044706 Unclassified 1603
610 Ga0466964_0275354 3300044706 Bacteria 839
611 Ga0466964_0350581 3300044706 Unclassified 758
612 Ga0466971_0000254 3300044719 Bacteria 20367
613 Ga0466971_0002846 3300044719 Bacteria 7336
614 Ga0466971_0021103 3300044719 Bacteria 2897
615 Ga0466971_0026637 3300044719 Bacteria 2585
616 Ga0466971_0051717 3300044719 Bacteria 1849
617 Ga0466971_0083352 3300044719 Unclassified 1460
618 Ga0466971_0480601 3300044719 Bacteria 611
619 Ga0466968_0002132 3300044735 Bacteria 7206
620 Ga0466968_0013032 3300044735 Bacteria 3264
621 Ga0466968_0029866 3300044735 Bacteria 2256
622 Ga0466968_0029981 3300044735 Bacteria 2252
623 Ga0466968_0037552 3300044735 Bacteria 2032
624 Ga0466968_0142724 3300044735 Bacteria 1096
625 Ga0466968_0430099 3300044735 Bacteria 650
626 Ga0466970_0011341 3300044765 Bacteria 4543
627 Ga0466970_0035543 3300044765 Bacteria 2639
628 Ga0466970_0077360 3300044765 Bacteria 1793
629 Ga0466970_0194649 3300044765 Bacteria 1127
630 Ga0466957_0000448 3300044842 Bacteria 20335
631 Ga0466957_0001829 3300044842 Bacteria 11222
632 Ga0466957_0006041 3300044842 Bacteria 6835
633 Ga0466957_0010913 3300044842 Bacteria 5225
634 Ga0466957_0031644 3300044842 Bacteria 3163
635 Ga0466957_0037381 3300044842 Bacteria 2923
636 Ga0466957_0053228 3300044842 Bacteria 2467
637 Ga0466957_0108072 3300044842 Bacteria 1761
638 Ga0466960_0339899 3300044901 Unclassified 854
639 Ga0466960_0518787 3300044901 Bacteria 700
640 Ga0466959_0007249 3300045049 Bacteria 7767
641 Ga0466959_0044436 3300045049 Bacteria 3273
642 Ga0466959_0050486 3300045049 Bacteria 3053
643 Ga0466959_0054810 3300045049 Bacteria 2912
644 Ga0466959_0084847 3300045049 Bacteria 2280
645 Ga0466959_0156558 3300045049 Bacteria 1603
646 Ga0466959_0268038 3300045049 Unclassified 1174
647 Ga0466959_0387342 3300045049 Bacteria 951
648 Ga0466959_0468185 3300045049 Unclassified 853
649 Ga0466959_0808790 3300045049 Bacteria 626
650 Ga0466958_0000148 3300045836 Bacteria 24461
651 Ga0466958_0003106 3300045836 Bacteria 8528
652 Ga0466958_0007030 3300045836 Bacteria 6157
653 Ga0466958_0011254 3300045836 Bacteria 5036
654 Ga0466958_0021374 3300045836 Bacteria 3780
655 Ga0466958_0048556 3300045836 Bacteria 2565
656 Ga0466958_0054158 3300045836 Unclassified 2433
657 Ga0466958_0054184 3300045836 Bacteria 2432
658 Ga0466958_0075009 3300045836 Unclassified 2074
659 Ga0466958_0102200 3300045836 Unclassified 1783
660 Ga0466958_0122974 3300045836 Bacteria 1625
661 Ga0466967_0000173 3300045976 Bacteria 26504
662 Ga0466967_0001347 3300045976 Bacteria 14104
663 Ga0466967_0009541 3300045976 Bacteria 7209
664 Ga0466967_0018176 3300045976 Bacteria 5610
665 Ga0466967_0023676 3300045976 Bacteria 5036
666 Ga0466967_0027634 3300045976 Bacteria 4722
667 Ga0466967_0035273 3300045976 Bacteria 4255
668 Ga0466967_0035961 3300045976 Bacteria 4223
669 Ga0466967_0058650 3300045976 Bacteria 3403
670 Ga0466967_0070089 3300045976 Bacteria 3135
671 Ga0466967_0070749 3300045976 Bacteria 3121
672 Ga0466967_0077176 3300045976 Unclassified 2998
673 Ga0466967_0077614 3300045976 Bacteria 2990
674 Ga0466967_0186982 3300045976 Bacteria 1956
675 Ga0466967_0245960 3300045976 Bacteria 1707
676 Ga0466967_0252204 3300045976 Unclassified 1686
677 Ga0466967_0315563 3300045976 Unclassified 1506
678 Ga0466967_0633642 3300045976 Bacteria 1056
679 Ga0466967_0682903 3300045976 Bacteria 1016
680 Ga0466967_1253520 3300045976 Unclassified 738
681 Ga0495592_0000635 3300046454 Bacteria 24391
682 Ga0495592_0000769 3300046454 Bacteria 22286
683 Ga0495592_0068268 3300046454 Bacteria 2596
684 Ga0495592_0099960 3300046454 Bacteria 2068
685 Ga0495603_0086996 3300046455 Bacteria 1829
686 Ga0495629_0016265 3300046459 Bacteria 5338
687 Ga0495629_0033665 3300046459 Bacteria 3624
688 Ga0495629_0692992 3300046459 Unclassified 677
689 Ga0495641_0015557 3300046461 Bacteria 4053
690 Ga0495641_0053659 3300046461 Bacteria 1833
691 Ga0495641_0108458 3300046461 Bacteria 1239
692 Ga0495641_0135945 3300046461 Bacteria 1097
693 Ga0495641_0314608 3300046461 Bacteria 706
694 Ga0495651_0000029 3300046462 Bacteria 105042
695 Ga0495651_0086910 3300046462 Bacteria 2352
696 Ga0495651_0772579 3300046462 Bacteria 594
697 Ga0495653_0003221 3300046463 Bacteria 13077
698 Ga0495653_0028900 3300046463 Bacteria 4432
699 Ga0495653_0069379 3300046463 Bacteria 2641
700 Ga0495582_0173928 3300046473 Bacteria 1226
701 Ga0495582_0244091 3300046473 Bacteria 1029
702 Ga0495662_0129371 3300046476 Bacteria 1241
703 Ga0495664_0157772 3300046477 Bacteria 1376
704 Ga0495584_0134281 3300046491 Bacteria 1256
705 Ga0495585_0381145 3300046492 Bacteria 681
706 Ga0495585_0443361 3300046492 Unclassified 622
707 Ga0495608_0004327 3300046511 Bacteria 10173
708 Ga0495618_0001935 3300046514 Bacteria 13569
709 Ga0495618_0157414 3300046514 Unclassified 1449
710 Ga0495618_0632432 3300046514 Bacteria 634
711 Ga0495628_0000016 3300046516 Bacteria 170260
712 Ga0495628_0073325 3300046516 Bacteria 2667
713 Ga0495628_0094887 3300046516 Bacteria 2305
714 Ga0495630_0045205 3300046517 Bacteria 3290
715 Ga0495630_0049241 3300046517 Bacteria 3154
716 Ga0495630_0139944 3300046517 Unclassified 1840
717 Ga0495630_0537494 3300046517 Bacteria 896
718 Ga0495630_1124873 3300046517 Bacteria 595
719 Ga0495644_0050042 3300046523 Bacteria 1568
720 Ga0495644_0169650 3300046523 Bacteria 838
721 Ga0495663_0225661 3300046525 Bacteria 660
722 Ga0495642_0117259 3300046528 Bacteria 1141
723 Ga0495652_0001228 3300046529 Bacteria 28728
724 Ga0495652_0037452 3300046529 Bacteria 4208
725 Ga0495652_0091507 3300046529 Bacteria 2486
726 Ga0495652_0157880 3300046529 Bacteria 1764
727 Ga0495652_0562398 3300046529 Bacteria 783
728 Ga0495640_0210480 3300046533 Bacteria 1229
729 Ga0495586_0079888 3300046535 Bacteria 1796
730 Ga0495586_0202148 3300046535 Bacteria 1126
731 Ga0495587_0000434 3300046536 Bacteria 29352
732 Ga0495587_0430646 3300046536 Unclassified 732
733 Ga0495645_0000367 3300046543 Bacteria 31425
734 Ga0495645_0096485 3300046543 Bacteria 2106
735 Ga0495645_0344535 3300046543 Bacteria 961
736 Ga0495633_0295740 3300046558 Bacteria 736
737 Ga0495667_0056732 3300046559 Bacteria 2575
738 Ga0495667_0062029 3300046559 Bacteria 2450
739 Ga0495667_0062037 3300046559 Bacteria 2450
740 Ga0495667_0090591 3300046559 Bacteria 1981
741 Ga0495667_0122966 3300046559 Bacteria 1675
742 Ga0495667_0333940 3300046559 Bacteria 959
743 Ga0495656_0001482 3300046615 Bacteria 7677
744 Ga0495634_0015712 3300046642 Bacteria 5429
745 Ga0495634_0245756 3300046642 Unclassified 1096
746 Ga0495634_0415343 3300046642 Bacteria 797
747 Ga0495611_0067422 3300046648 Bacteria 1633
748 Ga0495635_0047562 3300046663 Bacteria 2958
749 Ga0495661_0212988 3300046665 Bacteria 1005
750 Ga0495657_0005282 3300046675 Bacteria 10223
751 Ga0495657_0073618 3300046675 Bacteria 2224
752 Ga0495657_0116583 3300046675 Archaea 1686
753 Ga0495657_0133210 3300046675 Bacteria 1555
754 Ga0495599_0000187 3300046678 Bacteria 40807
755 Ga0495599_0020779 3300046678 Bacteria 4090
756 Ga0495623_0000121 3300046679 Bacteria 47882
757 Ga0495646_0025332 3300046680 Bacteria 3731
758 Ga0495646_0057372 3300046680 Bacteria 2331
759 Ga0495646_0121485 3300046680 Bacteria 1477
760 Ga0495647_0027244 3300046681 Bacteria 2099
761 Ga0495658_0056370 3300046683 Bacteria 2241
762 Ga0495613_0006994 3300046689 Bacteria 8405
763 Ga0495613_0274624 3300046689 Bacteria 1171
764 Ga0495613_1096376 3300046689 Unclassified 508
765 Ga0495624_0014162 3300046690 Bacteria 5421
766 Ga0495589_0041834 3300046794 Bacteria 2285
767 Ga0495600_0085761 3300046809 Bacteria 2054
768 Ga0495581_0065178 3300047315 Bacteria 2106
769 Ga0495604_0000628 3300047317 Bacteria 30365
770 Ga0495674_0222904 3300047319 Bacteria 1558
771 Ga0495676_0023206 3300047321 Bacteria 5388
772 Ga0495680_0002048 3300047322 Bacteria 21061
773 Ga0495680_0143711 3300047322 Archaea 1744
774 Ga0495680_0662748 3300047322 Bacteria 692
775 Ga0495675_0000031 3300047444 Bacteria 99240
776 Ga0495675_0081670 3300047444 Bacteria 2035
777 Ga0495685_083212 3300047447 Bacteria 1065
778 Ga0495684_0208753 3300047471 Bacteria 1437
779 Ga0495684_0728392 3300047471 Unclassified 655
780 Ga0495602_0000133 3300048088 Bacteria 69392
781 Ga0495602_0090849 3300048088 Unclassified 2535
782 Ga0495602_0189574 3300048088 Bacteria 1578
783 Ga0495602_0278109 3300048088 Bacteria 1234
784 Ga0495602_0318424 3300048088 Bacteria 1132
785 Ga0495615_0054597 3300048090 Bacteria 1038
786 Ga0496100_0276661 3300048903 Unclassified 1250
787 Ga0496100_1077898 3300048903 Bacteria 633
788 Ga0496101_0022844 3300048904 Bacteria 4312
789 Ga0496101_0063633 3300048904 Bacteria 2686
790 Ga0496101_0087614 3300048904 Bacteria 2311
791 Ga0496101_0112509 3300048904 Bacteria 2051
792 Ga0496101_0220725 3300048904 Bacteria 1471
793 Ga0496101_0354016 3300048904 Unclassified 1154
794 Ga0496101_0396021 3300048904 Bacteria 1087
795 Ga0496101_0421988 3300048904 Bacteria 1051
796 Ga0496102_0072024 3300048905 Bacteria 3174
797 Ga0496102_0076014 3300048905 Bacteria 3088
798 Ga0496102_0258959 3300048905 Bacteria 1640
799 Ga0496102_0368532 3300048905 Bacteria 1352
800 Ga0496103_0084153 3300048906 Bacteria 2003
801 Ga0496103_0229255 3300048906 Bacteria 1195
802 Ga0496103_0831652 3300048906 Bacteria 581
803 Ga0496104_0122313 3300048907 Bacteria 2499
804 Ga0496104_0173486 3300048907 Bacteria 2067
805 Ga0496104_0181134 3300048907 Unclassified 2017
806 Ga0496104_0499867 3300048907 Bacteria 1127
807 Ga0496104_0527974 3300048907 Bacteria 1091
808 Ga0496104_0604752 3300048907 Bacteria 1006
809 Ga0496104_1701089 3300048907 Unclassified 533
810 Ga0496105_0023043 3300048908 Bacteria 5049
811 Ga0496105_0031873 3300048908 Bacteria 4322
812 Ga0496105_0054893 3300048908 Bacteria 3289
813 Ga0496105_0189969 3300048908 Bacteria 1680
814 Ga0496106_0123596 3300048909 Bacteria 2025
815 Ga0496106_0148189 3300048909 Bacteria 1850
816 Ga0496106_0274547 3300048909 Bacteria 1350
817 Ga0496106_0291659 3300048909 Bacteria 1308
818 Ga0496106_0376575 3300048909 Bacteria 1141
819 Ga0496106_0824665 3300048909 Unclassified 735
820 Ga0496107_0064067 3300048910 Bacteria 2664
821 Ga0496107_0169901 3300048910 Unclassified 1618
822 Ga0496107_0253321 3300048910 Bacteria 1310
823 Ga0496107_0289463 3300048910 Bacteria 1219
824 Ga0496107_0432830 3300048910 Bacteria 978
825 Ga0496107_0631538 3300048910 Bacteria 790
826 Ga0496108_0006504 3300048911 Bacteria 9478
827 Ga0496108_0040454 3300048911 Bacteria 3887
828 Ga0496108_0051123 3300048911 Bacteria 3462
829 Ga0496108_0060419 3300048911 Bacteria 3189
830 Ga0496108_0083291 3300048911 Bacteria 2713
831 Ga0496108_0094102 3300048911 Bacteria 2550
832 Ga0496108_0175087 3300048911 Bacteria 1857
833 Ga0496108_0204985 3300048911 Unclassified 1711
834 Ga0496108_0500021 3300048911 Bacteria 1062
835 Ga0496109_0004548 3300048912 Bacteria 11588
836 Ga0496109_0033113 3300048912 Bacteria 4649
837 Ga0496109_0050623 3300048912 Bacteria 3782
838 Ga0496109_0063809 3300048912 Bacteria 3369
839 Ga0496109_0154556 3300048912 Unclassified 2149
840 Ga0496109_0176637 3300048912 Unclassified 2005
841 Ga0496109_0213436 3300048912 Bacteria 1815
842 Ga0496109_0258788 3300048912 Bacteria 1639
843 Ga0496109_0385272 3300048912 Unclassified 1325
844 Ga0496110_0013143 3300048913 Bacteria 6835
845 Ga0496110_0091180 3300048913 Bacteria 2726
846 Ga0496110_0127356 3300048913 Unclassified 2298
847 Ga0496110_0134743 3300048913 Unclassified 2232
848 Ga0496110_0137530 3300048913 Bacteria 2208
849 Ga0496110_0256424 3300048913 Bacteria 1592
850 Ga0496110_0306503 3300048913 Bacteria 1446
851 Ga0496110_0581390 3300048913 Bacteria 1017
852 Ga0496110_1142366 3300048913 Bacteria 687
853 Ga0496111_0002951 3300048914 Bacteria 10408
854 Ga0496111_0076252 3300048914 Bacteria 2444
855 Ga0496111_0100914 3300048914 Bacteria 2120
856 Ga0496111_0106585 3300048914 Bacteria 2063
857 Ga0496111_0285657 3300048914 Bacteria 1224
858 Ga0496111_0403163 3300048914 Bacteria 1010
859 Ga0496111_0476187 3300048914 Unclassified 920
860 Ga0496112_0000720 3300048915 Bacteria 22965
861 Ga0496112_0003665 3300048915 Bacteria 12803
862 Ga0496112_0006839 3300048915 Bacteria 10052
863 Ga0496112_0016198 3300048915 Bacteria 6975
864 Ga0496112_0084870 3300048915 Bacteria 3133
865 Ga0496112_0086167 3300048915 Bacteria 3108
866 Ga0496112_0110864 3300048915 Bacteria 2714
867 Ga0496112_0204049 3300048915 Bacteria 1935
868 Ga0496112_0221458 3300048915 Bacteria 1848
869 Ga0496112_0604821 3300048915 Bacteria 1028
870 Ga0496112_1097166 3300048915 Bacteria 714
871 Ga0496112_1372219 3300048915 Bacteria 622
872 Ga0496113_0019216 3300048916 Bacteria 4776
873 Ga0496113_0050512 3300048916 Bacteria 3101
874 Ga0496113_0069451 3300048916 Bacteria 2676
875 Ga0496113_0085623 3300048916 Bacteria 2421
876 Ga0496113_0113480 3300048916 Bacteria 2112
877 Ga0496113_0199406 3300048916 Bacteria 1591
878 Ga0496113_0316648 3300048916 Bacteria 1250
879 Ga0496113_0518232 3300048916 Bacteria 957
880 Ga0496113_0658285 3300048916 Bacteria 837
881 Ga0496113_0696164 3300048916 Unclassified 811
882 Ga0496113_0791058 3300048916 Bacteria 754
883 Ga0496113_1095409 3300048916 Bacteria 625
884 Ga0496114_0016663 3300048917 Bacteria 5926
885 Ga0496114_0023362 3300048917 Bacteria 5045
886 Ga0496114_0029580 3300048917 Bacteria 4505
887 Ga0496114_0058250 3300048917 Bacteria 3225
888 Ga0496114_0132984 3300048917 Bacteria 2149
889 Ga0496114_0198861 3300048917 Bacteria 1755
890 Ga0496114_0270748 3300048917 Bacteria 1496
891 Ga0496114_0354604 3300048917 Unclassified 1298
892 Ga0496115_0002049 3300048918 Bacteria 14422
893 Ga0496115_0231014 3300048918 Unclassified 1525
894 Ga0496115_0264290 3300048918 Bacteria 1415
895 Ga0496115_0680437 3300048918 Bacteria 810
896 Ga0501031_0073730 3300049568 Bacteria 2222
897 Ga0501031_0120507 3300049568 Bacteria 1714
898 Ga0501031_0293840 3300049568 Bacteria 1053
899 Ga0501032_0012583 3300049569 Bacteria 6040
900 Ga0501033_0110157 3300049570 Bacteria 2004
901 Ga0501034_0510141 3300049571 Unclassified 1115
902 Ga0501036_0102459 3300049572 Bacteria 2421
903 Ga0501037_0155190 3300049573 Bacteria 1634
904 Ga0501038_0010922 3300049574 Bacteria 8295
905 Ga0501038_1011522 3300049574 Unclassified 610
906 Ga0501039_0006374 3300049575 Bacteria 8964
907 Ga0501039_0044426 3300049575 Bacteria 3431
908 Ga0501039_0217914 3300049575 Bacteria 1501
909 Ga0501039_0312183 3300049575 Bacteria 1236
910 Ga0501040_0116536 3300049576 Bacteria 1871
911 Ga0501040_0220435 3300049576 Bacteria 1349
912 Ga0501041_0022834 3300049577 Bacteria 3748
913 Ga0501041_0026041 3300049577 Bacteria 3515
914 Ga0501041_0234751 3300049577 Bacteria 1152
915 Ga0501041_0488357 3300049577 Bacteria 783
916 Ga0501042_0007698 3300049578 Bacteria 7073
917 Ga0501042_0008751 3300049578 Bacteria 6714
918 Ga0501042_0382134 3300049578 Bacteria 1020
919 Ga0501043_0090432 3300049579 Bacteria 2407
920 Ga0501043_1129210 3300049579 Bacteria 553
921 Ga0501046_0008561 3300049580 Bacteria 8904
922 Ga0501046_0346840 3300049580 Bacteria 1078
923 Ga0501048_0080734 3300049582 Bacteria 2294
924 Ga0501048_0096625 3300049582 Bacteria 2083
925 Ga0501067_0002804 3300049583 Bacteria 9587
926 Ga0501067_0002965 3300049583 Bacteria 9362
927 Ga0501067_0099360 3300049583 Unclassified 1616
928 Ga0501068_0011617 3300049584 Bacteria 4975
929 Ga0501068_0016962 3300049584 Bacteria 4207
930 Ga0501068_0083778 3300049584 Bacteria 1960
931 Ga0501068_0153665 3300049584 Bacteria 1447
932 Ga0501069_0023483 3300049585 Bacteria 3363
933 Ga0501069_0035622 3300049585 Bacteria 2743
934 Ga0501069_0036725 3300049585 Bacteria 2702
935 Ga0501069_0074069 3300049585 Bacteria 1910
936 Ga0501069_0461598 3300049585 Unclassified 755
937 Ga0501070_0019851 3300049586 Bacteria 5635
938 Ga0501070_0068804 3300049586 Bacteria 2931
939 Ga0501070_0251789 3300049586 Bacteria 1445
940 Ga0501071_0016213 3300049587 Bacteria 5122
941 Ga0501071_0088291 3300049587 Bacteria 2275
942 Ga0501071_0868642 3300049587 Unclassified 696
943 Ga0501072_0003835 3300049588 Bacteria 11357
944 Ga0501072_0100526 3300049588 Bacteria 2299
945 Ga0501072_0451265 3300049588 Bacteria 1018
946 Ga0501072_0836280 3300049588 Bacteria 720
947 Ga0501073_0031712 3300049589 Bacteria 3770
948 Ga0501073_0457343 3300049589 Bacteria 882
949 Ga0501074_0014813 3300049590 Bacteria 5671
950 Ga0501075_0084674 3300049591 Bacteria 2401
951 Ga0501075_0114590 3300049591 Bacteria 2050
952 Ga0501075_0147794 3300049591 Bacteria 1791
953 Ga0501075_0846829 3300049591 Unclassified 696
954 Ga0501076_0013005 3300049592 Bacteria 6230
955 Ga0501076_0136482 3300049592 Bacteria 1991
956 Ga0501076_0185714 3300049592 Bacteria 1696
957 Ga0501076_0764644 3300049592 Bacteria 797
958 Ga0501076_1315756 3300049592 Bacteria 594
959 Ga0501077_0134763 3300049593 Bacteria 1566
960 Ga0501077_0398730 3300049593 Bacteria 879
961 Ga0501079_0005790 3300049741 Bacteria 9236
962 Ga0501079_0041140 3300049741 Bacteria 3566
963 Ga0501079_1035281 3300049741 Unclassified 647
964 Ga0501080_0074455 3300049742 Bacteria 3158
965 Ga0501080_0221249 3300049742 Bacteria 1732
966 Ga0501080_0407259 3300049742 Bacteria 1223
967 Ga0501081_0177045 3300049743 Bacteria 1541
968 Ga0501081_0289824 3300049743 Bacteria 1199
969 Ga0501081_0765512 3300049743 Bacteria 726
970 Ga0501081_0971149 3300049743 Bacteria 641
971 Ga0501035_0142488 3300049822 Bacteria 2083
972 Ga0501035_0246531 3300049822 Bacteria 1518
973 Ga0501044_0254930 3300049823 Bacteria 1694
974 Ga0501044_1191020 3300049823 Bacteria 630
975 Ga0501045_0034406 3300049824 Bacteria 3677
976 Ga0501045_0061970 3300049824 Bacteria 2744
977 nmdc:mga05p37_13210_c1 3300050507 Bacteria 9885
978 nmdc:mga05p37_710891_c1 3300050507 Bacteria 1114
979 nmdc:mga09592_1170905_c1 3300050508 Bacteria 636
980 nmdc:mga06r32_412105_c1 3300050510 Bacteria 1333
981 nmdc:mga08y16_112887_c1 3300050511 Bacteria 2829
982 nmdc:mga0n895_120235_c1 3300050512 Unclassified 2648
983 nmdc:mga0n895_356849_c1 3300050512 Bacteria 1481
984 nmdc:mga0n895_65535_c1 3300050512 Bacteria 3595
985 nmdc:mga0n895_9466_c1 3300050512 Bacteria 8524
986 nmdc:mga0rr50_133592_c1 3300050513 Bacteria 1990
987 nmdc:mga0rr50_275130_c1 3300050513 Unclassified 1404
988 nmdc:mga0rr50_445408_c1 3300050513 Bacteria 1097
989 nmdc:mga08x19_136461_c1 3300050514 Bacteria 1654
990 nmdc:mga08x19_234183_c1 3300050514 Bacteria 1265
991 nmdc:mga08x19_477598_c1 3300050514 Unclassified 879
992 nmdc:mga0a205_1061274_c1 3300050515 Bacteria 657
993 nmdc:mga0a205_185681_c1 3300050515 Bacteria 1972
994 nmdc:mga0a205_190749_c1 3300050515 Bacteria 1942
995 nmdc:mga0a205_202022_c1 3300050515 Bacteria 1878
996 Ga0495601_0001112 3300053077 Bacteria 14736
997 Ga0495601_0217567 3300053077 Bacteria 1247
998 Ga0495612_0013653 3300053078 Bacteria 3271
999 Ga0495655_0001758 3300053083 Bacteria 3363
1000 Ga0495595_0011768 3300053084 Bacteria 3665
1001 Ga0495595_0049184 3300053084 Archaea 1949
1002 Ga0495595_0192421 3300053084 Bacteria 1014
1003 Ga0495595_0391885 3300053084 Bacteria 703
1004 Ga0495619_0001848 3300053085 Bacteria 14098
1005 Ga0495619_0013151 3300053085 Bacteria 5215
1006 Ga0495619_0208461 3300053085 Bacteria 1353
1007 Ga0495619_0208963 3300053085 Bacteria 1352
1008 Ga0495619_0264306 3300053085 Bacteria 1192
1009 Ga0495619_0380583 3300053085 Bacteria 975
1010 Ga0501084_0117814 3300054114 Bacteria 2233
1011 Ga0501084_0146488 3300054114 Bacteria 1989
1012 Ga0501084_0576791 3300054114 Bacteria 950
1013 Ga0501084_0791884 3300054114 Unclassified 798
1014 Ga0501082_0049073 3300060353 Bacteria 3640
1015 Ga0501082_0066763 3300060353 Bacteria 3097
1016 Ga0501082_0069889 3300060353 Bacteria 3024
1017 Ga0501082_0232192 3300060353 Bacteria 1605
1018 Ga0466962_0000794 3300061719 Bacteria 14225
1019 Ga0466962_0006426 3300061719 Bacteria 5641
1020 Ga0466962_0034806 3300061719 Bacteria 2411
1021 Ga0466962_0073765 3300061719 Unclassified 1630
1022 Ga0466962_0092458 3300061719 Unclassified 1450
1023 Ga0466962_0138530 3300061719 Bacteria 1178
1024 Ga0466962_0268158 3300061719 Bacteria 841
1025 Ga0530510_0168889 3300061734 Bacteria 1620
1026 Ga0530510_0277033 3300061734 Bacteria 1252
1027 Ga0530510_0287224 3300061734 Unclassified 1229
1028 Ga0530510_0701213 3300061734 Bacteria 771
1029 Ga0530510_1458776 3300061734 Bacteria 525

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300020070 Ga0206356_10262733 Ga0206356_102627331 135
2 3300005843 Ga0068860_101349398 Ga0068860_1013493981 149
3 3300009098 Ga0105245_10409629 Ga0105245_104096293 149
4 3300009148 Ga0105243_10855031 Ga0105243_108550312 149
5 3300009176 Ga0105242_10233078 Ga0105242_102330783 149
6 3300013297 Ga0157378_10311335 Ga0157378_103113353 149
7 3300026121 Ga0207683_10818396 Ga0207683_108183962 149
8 3300041452 Ga0451793_0333081 Ga0451793_0333081_134_598 149
9 3300048917 Ga0496114_0354604 Ga0496114_0354604_286_750 149
10 3300025922 Ga0207646_10226230 Ga0207646_102262303 150
11 3300046492 Ga0495585_0443361 Ga0495585_0443361_19_477 150
12 3300048090 Ga0495615_0054597 Ga0495615_0054597_222_680 150
13 3300048908 Ga0496105_0189969 Ga0496105_0189969_65_523 150
14 3300002459 JGI24751J29686_10029864 JGI24751J29686_100298642 151
15 3300005333 Ga0070677_10218021 Ga0070677_102180212 151
16 3300005334 Ga0068869_100186930 Ga0068869_1001869302 151
17 3300005337 Ga0070682_100004862 Ga0070682_1000048623 151
18 3300005338 Ga0068868_100090388 Ga0068868_1000903882 151
19 3300005340 Ga0070689_100007910 Ga0070689_1000079107 151
20 3300005345 Ga0070692_10028248 Ga0070692_100282483 151
21 3300005347 Ga0070668_100236833 Ga0070668_1002368332 151
22 3300005354 Ga0070675_100135730 Ga0070675_1001357303 151
23 3300005355 Ga0070671_100024898 Ga0070671_1000248982 151
24 3300005356 Ga0070674_100420967 Ga0070674_1004209672 151
25 3300005364 Ga0070673_100413504 Ga0070673_1004135043 151
26 3300005365 Ga0070688_100008089 Ga0070688_1000080893 151
27 3300005366 Ga0070659_100078257 Ga0070659_1000782572 151
28 3300005367 Ga0070667_100097501 Ga0070667_1000975012 151
29 3300005434 Ga0070709_10033600 Ga0070709_100336003 151
30 3300005434 Ga0070709_10313801 Ga0070709_103138012 151
31 3300005435 Ga0070714_100350685 Ga0070714_1003506852 151
32 3300005435 Ga0070714_101412513 Ga0070714_1014125132 151
33 3300005436 Ga0070713_100088719 Ga0070713_1000887192 151
34 3300005436 Ga0070713_100729979 Ga0070713_1007299792 151
35 3300005437 Ga0070710_10016281 Ga0070710_100162815 151
36 3300005438 Ga0070701_10066150 Ga0070701_100661502 151
37 3300005439 Ga0070711_100061027 Ga0070711_1000610274 151
38 3300005439 Ga0070711_100133651 Ga0070711_1001336513 151
39 3300005441 Ga0070700_100005657 Ga0070700_1000056574 151
40 3300005441 Ga0070700_100462838 Ga0070700_1004628382 151
41 3300005444 Ga0070694_100010427 Ga0070694_1000104274 151
42 3300005445 Ga0070708_100127815 Ga0070708_1001278153 151
43 3300005445 Ga0070708_100671681 Ga0070708_1006716813 151
44 3300005455 Ga0070663_100028601 Ga0070663_1000286012 151
45 3300005456 Ga0070678_100959910 Ga0070678_1009599102 151
46 3300005458 Ga0070681_10312857 Ga0070681_103128573 151
47 3300005459 Ga0068867_100116194 Ga0068867_1001161942 151
48 3300005466 Ga0070685_10038333 Ga0070685_100383332 151
49 3300005467 Ga0070706_100373835 Ga0070706_1003738353 151
50 3300005468 Ga0070707_100001607 Ga0070707_10000160734 151
51 3300005468 Ga0070707_100003988 Ga0070707_10000398811 151
52 3300005468 Ga0070707_100360090 Ga0070707_1003600903 151
53 3300005468 Ga0070707_100735109 Ga0070707_1007351091 151
54 3300005471 Ga0070698_100052057 Ga0070698_1000520574 151
55 3300005471 Ga0070698_100114603 Ga0070698_1001146033 151
56 3300005471 Ga0070698_100192052 Ga0070698_1001920524 151
57 3300005471 Ga0070698_101142715 Ga0070698_1011427152 151
58 3300005518 Ga0070699_100181543 Ga0070699_1001815434 151
59 3300005518 Ga0070699_100850918 Ga0070699_1008509181 151
60 3300005518 Ga0070699_101042966 Ga0070699_1010429662 151
61 3300005530 Ga0070679_100674825 Ga0070679_1006748251 151
62 3300005536 Ga0070697_100105658 Ga0070697_1001056582 151
63 3300005536 Ga0070697_100679420 Ga0070697_1006794201 151
64 3300005539 Ga0068853_100012336 Ga0068853_1000123367 151
65 3300005543 Ga0070672_100033472 Ga0070672_1000334724 151
66 3300005544 Ga0070686_100007592 Ga0070686_1000075921 151
67 3300005548 Ga0070665_100090983 Ga0070665_1000909834 151
68 3300005548 Ga0070665_100202007 Ga0070665_1002020073 151
69 3300005548 Ga0070665_100870218 Ga0070665_1008702182 151
70 3300005563 Ga0068855_100066978 Ga0068855_1000669784 151
71 3300005563 Ga0068855_100182643 Ga0068855_1001826432 151
72 3300005614 Ga0068856_100035377 Ga0068856_1000353773 151
73 3300005616 Ga0068852_100022989 Ga0068852_1000229895 151
74 3300005617 Ga0068859_100266234 Ga0068859_1002662341 151
75 3300005618 Ga0068864_100130691 Ga0068864_1001306912 151
76 3300005618 Ga0068864_100259900 Ga0068864_1002599002 151
77 3300005718 Ga0068866_10003027 Ga0068866_100030274 151
78 3300005843 Ga0068860_100188377 Ga0068860_1001883773 151
79 3300005844 Ga0068862_101099954 Ga0068862_1010999542 151
80 3300005981 Ga0081538_10079840 Ga0081538_100798402 151
81 3300006173 Ga0070716_101050683 Ga0070716_1010506832 151
82 3300006175 Ga0070712_100041602 Ga0070712_1000416024 151
83 3300006237 Ga0097621_100021679 Ga0097621_1000216795 151
84 3300006358 Ga0068871_100040618 Ga0068871_1000406182 151
85 3300006844 Ga0075428_100388149 Ga0075428_1003881492 151
86 3300006846 Ga0075430_100003551 Ga0075430_1000035512 151
87 3300006847 Ga0075431_100056106 Ga0075431_1000561065 151
88 3300006871 Ga0075434_100003532 Ga0075434_10000353213 151
89 3300006871 Ga0075434_100095449 Ga0075434_1000954493 151
90 3300006871 Ga0075434_100439384 Ga0075434_1004393841 151
91 3300006880 Ga0075429_100177152 Ga0075429_1001771523 151
92 3300006880 Ga0075429_100283676 Ga0075429_1002836762 151
93 3300006881 Ga0068865_100002392 Ga0068865_1000023923 151
94 3300006881 Ga0068865_100073604 Ga0068865_1000736042 151
95 3300006914 Ga0075436_101021753 Ga0075436_1010217531 151
96 3300006931 Ga0097620_100266227 Ga0097620_1002662274 151
97 3300007076 Ga0075435_100011506 Ga0075435_1000115067 151
98 3300007076 Ga0075435_100174150 Ga0075435_1001741502 151
99 3300009093 Ga0105240_10355716 Ga0105240_103557163 151
100 3300009094 Ga0111539_10014355 Ga0111539_100143559 151
101 3300009094 Ga0111539_10086472 Ga0111539_100864722 151
102 3300009094 Ga0111539_10821363 Ga0111539_108213632 151
103 3300009094 Ga0111539_12519810 Ga0111539_125198102 151
104 3300009098 Ga0105245_10033732 Ga0105245_100337323 151
105 3300009098 Ga0105245_10116058 Ga0105245_101160583 151
106 3300009147 Ga0114129_10046212 Ga0114129_100462126 151
107 3300009147 Ga0114129_10794502 Ga0114129_107945021 151
108 3300009148 Ga0105243_10033294 Ga0105243_100332942 151
109 3300009148 Ga0105243_11106201 Ga0105243_111062012 151
110 3300009174 Ga0105241_10062546 Ga0105241_100625464 151
111 3300009176 Ga0105242_10003093 Ga0105242_100030932 151
112 3300009177 Ga0105248_10026898 Ga0105248_100268987 151
113 3300009545 Ga0105237_10033527 Ga0105237_100335275 151
114 3300009551 Ga0105238_10071537 Ga0105238_100715372 151
115 3300009553 Ga0105249_10001129 Ga0105249_1000112924 151
116 3300010375 Ga0105239_10114040 Ga0105239_101140405 151
117 3300011119 Ga0105246_10082381 Ga0105246_100823812 151
118 3300012502 Ga0157347_1014097 Ga0157347_10140971 151
119 3300012510 Ga0157316_1026975 Ga0157316_10269752 151
120 3300013102 Ga0157371_10048863 Ga0157371_100488635 151
121 3300013296 Ga0157374_10035553 Ga0157374_100355534 151
122 3300013296 Ga0157374_10275441 Ga0157374_102754413 151
123 3300013306 Ga0163162_10006515 Ga0163162_1000651512 151
124 3300013308 Ga0157375_10104469 Ga0157375_101044692 151
125 3300014325 Ga0163163_11279269 Ga0163163_112792692 151
126 3300014326 Ga0157380_10150608 Ga0157380_101506082 151
127 3300014326 Ga0157380_10423646 Ga0157380_104236462 151
128 3300014745 Ga0157377_10009433 Ga0157377_100094335 151
129 3300014745 Ga0157377_10070806 Ga0157377_100708063 151
130 3300014968 Ga0157379_10250686 Ga0157379_102506862 151
131 3300014968 Ga0157379_10442200 Ga0157379_104422003 151
132 3300014969 Ga0157376_10037609 Ga0157376_100376092 151
133 3300014969 Ga0157376_11085808 Ga0157376_110858082 151
134 3300031548 Ga0307408_101099614 Ga0307408_1010996141 151
135 3300032126 Ga0307415_100320294 Ga0307415_1003202941 151
136 3300048911 Ga0496108_0500021 Ga0496108_0500021_137_595 151
137 3300048912 Ga0496109_0213436 Ga0496109_0213436_943_1401 151
138 3300005336 Ga0070680_100086399 Ga0070680_1000863992 152
139 3300005339 Ga0070660_100067598 Ga0070660_1000675984 152
140 3300005339 Ga0070660_100220390 Ga0070660_1002203903 152
141 3300005341 Ga0070691_10150460 Ga0070691_101504602 152
142 3300005345 Ga0070692_10394693 Ga0070692_103946931 152
143 3300005366 Ga0070659_100075498 Ga0070659_1000754982 152
144 3300005435 Ga0070714_100041880 Ga0070714_1000418804 152
145 3300005435 Ga0070714_100055569 Ga0070714_1000555694 152
146 3300005435 Ga0070714_100155133 Ga0070714_1001551332 152
147 3300005435 Ga0070714_100300780 Ga0070714_1003007801 152
148 3300005435 Ga0070714_101019294 Ga0070714_1010192941 152
149 3300005436 Ga0070713_100039071 Ga0070713_1000390715 152
150 3300005457 Ga0070662_100813402 Ga0070662_1008134021 152
151 3300005458 Ga0070681_10026696 Ga0070681_100266962 152
152 3300005458 Ga0070681_10112138 Ga0070681_101121383 152
153 3300005518 Ga0070699_101515277 Ga0070699_1015152772 152
154 3300005530 Ga0070679_100120417 Ga0070679_1001204172 152
155 3300005530 Ga0070679_100794012 Ga0070679_1007940122 152
156 3300005535 Ga0070684_100049801 Ga0070684_1000498013 152
157 3300005545 Ga0070695_100015857 Ga0070695_1000158576 152
158 3300005546 Ga0070696_100114749 Ga0070696_1001147492 152
159 3300005614 Ga0068856_100431644 Ga0068856_1004316442 152
160 3300005841 Ga0068863_100081637 Ga0068863_1000816372 152
161 3300005937 Ga0081455_10078009 Ga0081455_100780093 152
162 3300005985 Ga0081539_10026936 Ga0081539_100269361 152
163 3300006028 Ga0070717_10010680 Ga0070717_100106804 152
164 3300006028 Ga0070717_10186870 Ga0070717_101868701 152
165 3300006028 Ga0070717_10383940 Ga0070717_103839402 152
166 3300006028 Ga0070717_10619643 Ga0070717_106196432 152
167 3300006173 Ga0070716_100254273 Ga0070716_1002542732 152
168 3300006173 Ga0070716_100408304 Ga0070716_1004083042 152
169 3300006175 Ga0070712_100218667 Ga0070712_1002186672 152
170 3300006175 Ga0070712_100501332 Ga0070712_1005013322 152
171 3300006852 Ga0075433_10255570 Ga0075433_102555702 152
172 3300006852 Ga0075433_10270432 Ga0075433_102704323 152
173 3300006871 Ga0075434_100013149 Ga0075434_1000131495 152
174 3300006871 Ga0075434_100089619 Ga0075434_1000896193 152
175 3300006881 Ga0068865_100647113 Ga0068865_1006471132 152
176 3300006914 Ga0075436_100148767 Ga0075436_1001487674 152
177 3300006914 Ga0075436_100338492 Ga0075436_1003384923 152
178 3300006914 Ga0075436_100495690 Ga0075436_1004956902 152
179 3300007076 Ga0075435_100103392 Ga0075435_1001033923 152
180 3300009093 Ga0105240_10018876 Ga0105240_100188765 152
181 3300009176 Ga0105242_12301201 Ga0105242_123012011 152
182 3300009545 Ga0105237_10017342 Ga0105237_100173427 152
183 3300011119 Ga0105246_10334365 Ga0105246_103343651 152
184 3300013104 Ga0157370_10825476 Ga0157370_108254761 152
185 3300013105 Ga0157369_10665272 Ga0157369_106652722 152
186 3300013306 Ga0163162_10254301 Ga0163162_102543012 152
187 3300013307 Ga0157372_10040194 Ga0157372_100401943 152
188 3300013307 Ga0157372_10373262 Ga0157372_103732622 152
189 3300014968 Ga0157379_11251788 Ga0157379_112517882 152
190 3300015262 Ga0182007_10053513 Ga0182007_100535132 152
191 3300021441 Ga0213871_10007472 Ga0213871_100074723 152
192 3300025905 Ga0207685_10027301 Ga0207685_100273011 152
193 3300025905 Ga0207685_10077729 Ga0207685_100777291 152
194 3300025906 Ga0207699_10013206 Ga0207699_100132064 152
195 3300025906 Ga0207699_10679624 Ga0207699_106796242 152
196 3300025912 Ga0207707_10438598 Ga0207707_104385982 152
197 3300025915 Ga0207693_10829848 Ga0207693_108298482 152
198 3300025917 Ga0207660_10142593 Ga0207660_101425932 152
199 3300025921 Ga0207652_10780469 Ga0207652_107804692 152
200 3300025922 Ga0207646_10054237 Ga0207646_100542373 152
201 3300025928 Ga0207700_10000002 Ga0207700_10000002192 152
202 3300025928 Ga0207700_10511879 Ga0207700_105118791 152
203 3300025929 Ga0207664_10043236 Ga0207664_100432364 152
204 3300025929 Ga0207664_10333495 Ga0207664_103334952 152
205 3300025929 Ga0207664_10535490 Ga0207664_105354902 152
206 3300025934 Ga0207686_10198033 Ga0207686_101980332 152
207 3300025939 Ga0207665_10006081 Ga0207665_100060812 152
208 3300025939 Ga0207665_10035443 Ga0207665_100354434 152
209 3300025939 Ga0207665_10695347 Ga0207665_106953472 152
210 3300025941 Ga0207711_10385571 Ga0207711_103855712 152
211 3300026067 Ga0207678_10510420 Ga0207678_105104202 152
212 3300026078 Ga0207702_10223826 Ga0207702_102238262 152
213 3300028563 Ga0265319_1039088 Ga0265319_10390881 152
214 3300028573 Ga0265334_10057525 Ga0265334_100575253 152
215 3300028577 Ga0265318_10094314 Ga0265318_100943141 152
216 3300028577 Ga0265318_10205284 Ga0265318_102052842 152
217 3300028654 Ga0265322_10026972 Ga0265322_100269724 152
218 3300028654 Ga0265322_10222877 Ga0265322_102228771 152
219 3300028800 Ga0265338_10006871 Ga0265338_1000687110 152
220 3300028800 Ga0265338_10021008 Ga0265338_100210084 152
221 3300028800 Ga0265338_10033213 Ga0265338_100332134 152
222 3300028800 Ga0265338_10283550 Ga0265338_102835501 152
223 3300029957 Ga0265324_10021263 Ga0265324_100212634 152
224 3300029957 Ga0265324_10046211 Ga0265324_100462112 152
225 3300031241 Ga0265325_10115133 Ga0265325_101151332 152
226 3300031249 Ga0265339_10003596 Ga0265339_1000359610 152
227 3300031249 Ga0265339_10250913 Ga0265339_102509132 152
228 3300031344 Ga0265316_10034471 Ga0265316_100344719 152
229 3300031595 Ga0265313_10005266 Ga0265313_100052666 152
230 3300031595 Ga0265313_10035236 Ga0265313_100352365 152
231 3300031595 Ga0265313_10074298 Ga0265313_100742981 152
232 3300031711 Ga0265314_10018946 Ga0265314_1001894611 152
233 3300031711 Ga0265314_10264730 Ga0265314_102647301 152
234 3300031712 Ga0265342_10020754 Ga0265342_100207545 152
235 3300032133 Ga0316583_10211054 Ga0316583_102110542 152
236 3300035089 Ga0373944_0175340 Ga0373944_0175340_145_603 152
237 3300035117 Ga0373953_0144906 Ga0373953_0144906_60_518 152
238 3300035692 Ga0373935_0749894 Ga0373935_0749894_58_516 152
239 3300035724 Ga0373933_0106457 Ga0373933_0106457_990_1448 152
240 3300036401 Ga0373937_1145695 Ga0373937_1145695_44_502 152
241 3300037312 Ga0395899_0122086 Ga0395899_0122086_797_1270 152
242 3300037312 Ga0395899_0788968 Ga0395899_0788968_52_525 152
243 3300037418 Ga0395900_0311147 Ga0395900_0311147_583_1056 152
244 3300037466 Ga0395898_0054213 Ga0395898_0054213_782_1255 152
245 3300037466 Ga0395898_0616071 Ga0395898_0616071_496_954 152
246 3300037471 Ga0395905_0494968 Ga0395905_0494968_378_851 152
247 3300038443 Ga0395901_0238432 Ga0395901_0238432_936_1409 152
248 3300038443 Ga0395901_0335626 Ga0395901_0335626_843_1301 152
249 3300038443 Ga0395901_0449821 Ga0395901_0449821_415_888 152
250 3300038996 Ga0242420_048160 Ga0242420_048160_195_653 152
251 3300039438 Ga0436360_0128350 Ga0436360_0128350_7709_8167 152
252 3300039438 Ga0436360_0322959 Ga0436360_0322959_204_662 152
253 3300039453 Ga0436362_0303237 Ga0436362_0303237_104_562 152
254 3300039453 Ga0436362_1041280 Ga0436362_1041280_187_645 152
255 3300044656 Ga0466969_0010882 Ga0466969_0010882_3191_3649 152
256 3300044656 Ga0466969_0102123 Ga0466969_0102123_97_555 152
257 3300044683 Ga0466965_0068408 Ga0466965_0068408_103_561 152
258 3300044683 Ga0466965_0140309 Ga0466965_0140309_254_712 152
259 3300044684 Ga0466966_0003367 Ga0466966_0003367_3261_3719 152
260 3300044684 Ga0466966_0069894 Ga0466966_0069894_569_1027 152
261 3300044684 Ga0466966_0101116 Ga0466966_0101116_680_1159 152
262 3300044684 Ga0466966_0142777 Ga0466966_0142777_209_667 152
263 3300044684 Ga0466966_0502419 Ga0466966_0502419_193_669 152
264 3300044693 Ga0466961_0115468 Ga0466961_0115468_562_1020 152
265 3300044693 Ga0466961_0242394 Ga0466961_0242394_346_804 152
266 3300044694 Ga0466963_0000037 Ga0466963_0000037_24497_24976 152
267 3300044694 Ga0466963_0002985 Ga0466963_0002985_8534_8992 152
268 3300044694 Ga0466963_0011378 Ga0466963_0011378_1578_2036 152
269 3300044694 Ga0466963_0030930 Ga0466963_0030930_319_777 152
270 3300044694 Ga0466963_0031901 Ga0466963_0031901_2188_2646 152
271 3300044694 Ga0466963_0070698 Ga0466963_0070698_389_847 152
272 3300044694 Ga0466963_0499285 Ga0466963_0499285_379_837 152
273 3300044706 Ga0466964_0008661 Ga0466964_0008661_1447_1926 152
274 3300044706 Ga0466964_0010906 Ga0466964_0010906_1135_1593 152
275 3300044706 Ga0466964_0275354 Ga0466964_0275354_202_660 152
276 3300044706 Ga0466964_0350581 Ga0466964_0350581_272_730 152
277 3300044719 Ga0466971_0000254 Ga0466971_0000254_12644_13123 152
278 3300044719 Ga0466971_0021103 Ga0466971_0021103_1381_1839 152
279 3300044719 Ga0466971_0026637 Ga0466971_0026637_1801_2259 152
280 3300044719 Ga0466971_0051717 Ga0466971_0051717_1328_1786 152
281 3300044719 Ga0466971_0480601 Ga0466971_0480601_70_528 152
282 3300044735 Ga0466968_0002132 Ga0466968_0002132_3107_3565 152
283 3300044735 Ga0466968_0029866 Ga0466968_0029866_758_1216 152
284 3300044735 Ga0466968_0142724 Ga0466968_0142724_382_840 152
285 3300044735 Ga0466968_0430099 Ga0466968_0430099_10_486 152
286 3300044765 Ga0466970_0035543 Ga0466970_0035543_769_1248 152
287 3300044765 Ga0466970_0194649 Ga0466970_0194649_472_930 152
288 3300044842 Ga0466957_0000448 Ga0466957_0000448_13522_14001 152
289 3300044842 Ga0466957_0001829 Ga0466957_0001829_1613_2071 152
290 3300044842 Ga0466957_0037381 Ga0466957_0037381_1911_2369 152
291 3300044842 Ga0466957_0108072 Ga0466957_0108072_1073_1531 152
292 3300044901 Ga0466960_0518787 Ga0466960_0518787_162_620 152
293 3300045049 Ga0466959_0007249 Ga0466959_0007249_6206_6664 152
294 3300045049 Ga0466959_0044436 Ga0466959_0044436_2674_3132 152
295 3300045049 Ga0466959_0054810 Ga0466959_0054810_1214_1672 152
296 3300045049 Ga0466959_0084847 Ga0466959_0084847_1279_1755 152
297 3300045049 Ga0466959_0156558 Ga0466959_0156558_312_791 152
298 3300045049 Ga0466959_0387342 Ga0466959_0387342_406_864 152
299 3300045049 Ga0466959_0468185 Ga0466959_0468185_212_688 152
300 3300045049 Ga0466959_0808790 Ga0466959_0808790_134_592 152
301 3300045836 Ga0466958_0000148 Ga0466958_0000148_617_1096 152
302 3300045836 Ga0466958_0003106 Ga0466958_0003106_660_1118 152
303 3300045836 Ga0466958_0011254 Ga0466958_0011254_1350_1808 152
304 3300045836 Ga0466958_0054158 Ga0466958_0054158_337_795 152
305 3300045836 Ga0466958_0054184 Ga0466958_0054184_152_610 152
306 3300045836 Ga0466958_0075009 Ga0466958_0075009_694_1152 152
307 3300045836 Ga0466958_0102200 Ga0466958_0102200_1027_1503 152
308 3300045976 Ga0466967_0001347 Ga0466967_0001347_6426_6905 152
309 3300045976 Ga0466967_0009541 Ga0466967_0009541_226_684 152
310 3300045976 Ga0466967_0018176 Ga0466967_0018176_3912_4370 152
311 3300045976 Ga0466967_0070089 Ga0466967_0070089_708_1166 152
312 3300045976 Ga0466967_0077176 Ga0466967_0077176_1018_1476 152
313 3300045976 Ga0466967_0245960 Ga0466967_0245960_565_1047 152
314 3300045976 Ga0466967_0252204 Ga0466967_0252204_882_1340 152
315 3300045976 Ga0466967_0682903 Ga0466967_0682903_417_875 152
316 3300045976 Ga0466967_1253520 Ga0466967_1253520_67_525 152
317 3300046459 Ga0495629_0033665 Ga0495629_0033665_1438_1911 152
318 3300046459 Ga0495629_0692992 Ga0495629_0692992_66_524 152
319 3300046461 Ga0495641_0053659 Ga0495641_0053659_1349_1807 152
320 3300046462 Ga0495651_0086910 Ga0495651_0086910_291_749 152
321 3300046463 Ga0495653_0028900 Ga0495653_0028900_2997_3455 152
322 3300046514 Ga0495618_0157414 Ga0495618_0157414_383_841 152
323 3300046517 Ga0495630_0049241 Ga0495630_0049241_1144_1602 152
324 3300046517 Ga0495630_0139944 Ga0495630_0139944_517_975 152
325 3300046517 Ga0495630_0537494 Ga0495630_0537494_193_651 152
326 3300046517 Ga0495630_1124873 Ga0495630_1124873_64_522 152
327 3300046523 Ga0495644_0169650 Ga0495644_0169650_263_721 152
328 3300046525 Ga0495663_0225661 Ga0495663_0225661_179_637 152
329 3300046529 Ga0495652_0157880 Ga0495652_0157880_100_558 152
330 3300046529 Ga0495652_0562398 Ga0495652_0562398_37_522 152
331 3300046536 Ga0495587_0430646 Ga0495587_0430646_264_722 152
332 3300046543 Ga0495645_0096485 Ga0495645_0096485_200_658 152
333 3300046559 Ga0495667_0062029 Ga0495667_0062029_1138_1596 152
334 3300046559 Ga0495667_0062037 Ga0495667_0062037_1237_1695 152
335 3300046559 Ga0495667_0090591 Ga0495667_0090591_1275_1733 152
336 3300046559 Ga0495667_0333940 Ga0495667_0333940_437_895 152
337 3300046642 Ga0495634_0245756 Ga0495634_0245756_411_869 152
338 3300046675 Ga0495657_0073618 Ga0495657_0073618_769_1227 152
339 3300046675 Ga0495657_0116583 Ga0495657_0116583_348_806 152
340 3300046689 Ga0495613_0274624 Ga0495613_0274624_139_597 152
341 3300046689 Ga0495613_1096376 Ga0495613_1096376_38_496 152
342 3300047322 Ga0495680_0143711 Ga0495680_0143711_384_842 152
343 3300047444 Ga0495675_0081670 Ga0495675_0081670_1421_1879 152
344 3300047471 Ga0495684_0208753 Ga0495684_0208753_141_599 152
345 3300048088 Ga0495602_0090849 Ga0495602_0090849_223_708 152
346 3300048088 Ga0495602_0189574 Ga0495602_0189574_189_647 152
347 3300048904 Ga0496101_0022844 Ga0496101_0022844_918_1394 152
348 3300048904 Ga0496101_0087614 Ga0496101_0087614_800_1273 152
349 3300048905 Ga0496102_0258959 Ga0496102_0258959_599_1072 152
350 3300048906 Ga0496103_0831652 Ga0496103_0831652_23_481 152
351 3300048907 Ga0496104_0181134 Ga0496104_0181134_422_880 152
352 3300048907 Ga0496104_0527974 Ga0496104_0527974_529_1002 152
353 3300048909 Ga0496106_0123596 Ga0496106_0123596_1094_1552 152
354 3300048909 Ga0496106_0274547 Ga0496106_0274547_412_870 152
355 3300048909 Ga0496106_0824665 Ga0496106_0824665_205_663 152
356 3300048910 Ga0496107_0064067 Ga0496107_0064067_1358_1834 152
357 3300048911 Ga0496108_0040454 Ga0496108_0040454_578_1036 152
358 3300048912 Ga0496109_0154556 Ga0496109_0154556_934_1392 152
359 3300048913 Ga0496110_0091180 Ga0496110_0091180_845_1303 152
360 3300048913 Ga0496110_0134743 Ga0496110_0134743_583_1041 152
361 3300048914 Ga0496111_0285657 Ga0496111_0285657_363_821 152
362 3300048915 Ga0496112_0003665 Ga0496112_0003665_3193_3651 152
363 3300048915 Ga0496112_0006839 Ga0496112_0006839_9296_9754 152
364 3300048915 Ga0496112_0084870 Ga0496112_0084870_629_1087 152
365 3300048915 Ga0496112_0604821 Ga0496112_0604821_90_548 152
366 3300048915 Ga0496112_1097166 Ga0496112_1097166_200_658 152
367 3300048916 Ga0496113_0069451 Ga0496113_0069451_1141_1599 152
368 3300048916 Ga0496113_0085623 Ga0496113_0085623_570_1028 152
369 3300048916 Ga0496113_0316648 Ga0496113_0316648_63_539 152
370 3300048916 Ga0496113_0696164 Ga0496113_0696164_122_580 152
371 3300048917 Ga0496114_0058250 Ga0496114_0058250_759_1232 152
372 3300048918 Ga0496115_0002049 Ga0496115_0002049_10650_11123 152
373 3300048918 Ga0496115_0264290 Ga0496115_0264290_561_1019 152
374 3300049577 Ga0501041_0234751 Ga0501041_0234751_641_1099 152
375 3300049578 Ga0501042_0382134 Ga0501042_0382134_94_552 152
376 3300049579 Ga0501043_1129210 Ga0501043_1129210_55_513 152
377 3300049583 Ga0501067_0002804 Ga0501067_0002804_490_948 152
378 3300049583 Ga0501067_0002965 Ga0501067_0002965_963_1421 152
379 3300049583 Ga0501067_0099360 Ga0501067_0099360_985_1443 152
380 3300049584 Ga0501068_0011617 Ga0501068_0011617_1812_2270 152
381 3300049585 Ga0501069_0035622 Ga0501069_0035622_805_1263 152
382 3300049585 Ga0501069_0461598 Ga0501069_0461598_168_626 152
383 3300049586 Ga0501070_0251789 Ga0501070_0251789_519_977 152
384 3300049588 Ga0501072_0100526 Ga0501072_0100526_1730_2188 152
385 3300049591 Ga0501075_0147794 Ga0501075_0147794_555_1013 152
386 3300049591 Ga0501075_0846829 Ga0501075_0846829_155_613 152
387 3300049592 Ga0501076_0185714 Ga0501076_0185714_1119_1577 152
388 3300049593 Ga0501077_0134763 Ga0501077_0134763_843_1301 152
389 3300049741 Ga0501079_1035281 Ga0501079_1035281_33_491 152
390 3300049742 Ga0501080_0407259 Ga0501080_0407259_270_728 152
391 3300049823 Ga0501044_1191020 Ga0501044_1191020_138_614 152
392 3300050512 nmdc:mga0n895_65535_c1 nmdc:mga0n895_65535_c1_453_911 152
393 3300050513 nmdc:mga0rr50_445408_c1 nmdc:mga0rr50_445408_c1_213_671 152
394 3300050514 nmdc:mga08x19_136461_c1 nmdc:mga08x19_136461_c1_559_1017 152
395 3300050514 nmdc:mga08x19_477598_c1 nmdc:mga08x19_477598_c1_135_593 152
396 3300050515 nmdc:mga0a205_1061274_c1 nmdc:mga0a205_1061274_c1_131_589 152
397 3300050515 nmdc:mga0a205_185681_c1 nmdc:mga0a205_185681_c1_861_1319 152
398 3300053083 Ga0495655_0001758 Ga0495655_0001758_1407_1883 152
399 3300053084 Ga0495595_0049184 Ga0495595_0049184_177_635 152
400 3300053084 Ga0495595_0192421 Ga0495595_0192421_126_584 152
401 3300053085 Ga0495619_0013151 Ga0495619_0013151_3822_4280 152
402 3300053085 Ga0495619_0208963 Ga0495619_0208963_618_1076 152
403 3300054114 Ga0501084_0117814 Ga0501084_0117814_685_1143 152
404 3300054114 Ga0501084_0146488 Ga0501084_0146488_111_569 152
405 3300060353 Ga0501082_0049073 Ga0501082_0049073_1481_1939 152
406 3300061719 Ga0466962_0000794 Ga0466962_0000794_6542_7021 152
407 3300061719 Ga0466962_0006426 Ga0466962_0006426_193_651 152
408 3300061719 Ga0466962_0034806 Ga0466962_0034806_1939_2397 152
409 3300061719 Ga0466962_0092458 Ga0466962_0092458_331_789 152
410 3300061734 Ga0530510_0168889 Ga0530510_0168889_937_1395 152
411 3300005327 Ga0070658_10160868 Ga0070658_101608683 153
412 3300005329 Ga0070683_100003039 Ga0070683_1000030395 153
413 3300005329 Ga0070683_100238961 Ga0070683_1002389613 153
414 3300005336 Ga0070680_100420930 Ga0070680_1004209302 153
415 3300005337 Ga0070682_100076428 Ga0070682_1000764282 153
416 3300005338 Ga0068868_100426691 Ga0068868_1004266912 153
417 3300005366 Ga0070659_101004060 Ga0070659_1010040601 153
418 3300005434 Ga0070709_10231665 Ga0070709_102316652 153
419 3300005436 Ga0070713_100392050 Ga0070713_1003920502 153
420 3300005437 Ga0070710_10447774 Ga0070710_104477741 153
421 3300005439 Ga0070711_100008896 Ga0070711_1000088963 153
422 3300005439 Ga0070711_100295805 Ga0070711_1002958051 153
423 3300005440 Ga0070705_100164040 Ga0070705_1001640401 153
424 3300005445 Ga0070708_100035231 Ga0070708_1000352316 153
425 3300005445 Ga0070708_100099088 Ga0070708_1000990882 153
426 3300005455 Ga0070663_100911941 Ga0070663_1009119411 153
427 3300005457 Ga0070662_100363614 Ga0070662_1003636143 153
428 3300005458 Ga0070681_10054579 Ga0070681_100545794 153
429 3300005467 Ga0070706_100079146 Ga0070706_1000791463 153
430 3300005468 Ga0070707_100000419 Ga0070707_10000041958 153
431 3300005468 Ga0070707_100236109 Ga0070707_1002361092 153
432 3300005471 Ga0070698_100045939 Ga0070698_1000459393 153
433 3300005471 Ga0070698_100193050 Ga0070698_1001930502 153
434 3300005518 Ga0070699_100372920 Ga0070699_1003729202 153
435 3300005530 Ga0070679_100041373 Ga0070679_1000413732 153
436 3300005535 Ga0070684_100037440 Ga0070684_1000374403 153
437 3300005544 Ga0070686_101019007 Ga0070686_1010190072 153
438 3300005563 Ga0068855_100244501 Ga0068855_1002445013 153
439 3300005563 Ga0068855_100727697 Ga0068855_1007276973 153
440 3300005577 Ga0068857_100121899 Ga0068857_1001218993 153
441 3300005578 Ga0068854_101034569 Ga0068854_1010345691 153
442 3300005614 Ga0068856_100341942 Ga0068856_1003419422 153
443 3300005718 Ga0068866_10494740 Ga0068866_104947402 153
444 3300005834 Ga0068851_10808382 Ga0068851_108083821 153
445 3300005841 Ga0068863_100272785 Ga0068863_1002727851 153
446 3300005985 Ga0081539_10055432 Ga0081539_100554323 153
447 3300006028 Ga0070717_10019680 Ga0070717_100196805 153
448 3300006028 Ga0070717_10029685 Ga0070717_100296852 153
449 3300006058 Ga0075432_10015184 Ga0075432_100151843 153
450 3300006173 Ga0070716_100064676 Ga0070716_1000646763 153
451 3300006175 Ga0070712_100040223 Ga0070712_1000402235 153
452 3300006175 Ga0070712_100115633 Ga0070712_1001156334 153
453 3300006178 Ga0075367_10161378 Ga0075367_101613782 153
454 3300006353 Ga0075370_10386093 Ga0075370_103860932 153
455 3300006847 Ga0075431_100065229 Ga0075431_1000652293 153
456 3300006852 Ga0075433_10003167 Ga0075433_1000316714 153
457 3300006852 Ga0075433_10032871 Ga0075433_100328713 153
458 3300006871 Ga0075434_100022158 Ga0075434_1000221582 153
459 3300006871 Ga0075434_100027641 Ga0075434_1000276412 153
460 3300006881 Ga0068865_101687097 Ga0068865_1016870971 153
461 3300006914 Ga0075436_100026821 Ga0075436_1000268215 153
462 3300007076 Ga0075435_100050093 Ga0075435_1000500932 153
463 3300009093 Ga0105240_10206915 Ga0105240_102069154 153
464 3300009094 Ga0111539_10459599 Ga0111539_104595992 153
465 3300009094 Ga0111539_10523362 Ga0111539_105233622 153
466 3300009098 Ga0105245_10184692 Ga0105245_101846923 153
467 3300009098 Ga0105245_10214751 Ga0105245_102147512 153
468 3300009147 Ga0114129_10002076 Ga0114129_100020768 153
469 3300009147 Ga0114129_10047402 Ga0114129_100474022 153
470 3300009147 Ga0114129_10682440 Ga0114129_106824403 153
471 3300009147 Ga0114129_12249354 Ga0114129_122493542 153
472 3300009148 Ga0105243_10189386 Ga0105243_101893862 153
473 3300009177 Ga0105248_10088812 Ga0105248_100888122 153
474 3300009177 Ga0105248_11844089 Ga0105248_118440891 153
475 3300009551 Ga0105238_10054416 Ga0105238_100544162 153
476 3300009553 Ga0105249_11876665 Ga0105249_118766651 153
477 3300010375 Ga0105239_10910247 Ga0105239_109102471 153
478 3300011119 Ga0105246_10291556 Ga0105246_102915563 153
479 3300013104 Ga0157370_10367683 Ga0157370_103676832 153
480 3300013105 Ga0157369_10038160 Ga0157369_100381604 153
481 3300013296 Ga0157374_11103443 Ga0157374_111034432 153
482 3300013307 Ga0157372_11485226 Ga0157372_114852262 153
483 3300013308 Ga0157375_10387811 Ga0157375_103878112 153
484 3300014325 Ga0163163_12136958 Ga0163163_121369581 153
485 3300014969 Ga0157376_10007904 Ga0157376_100079047 153
486 3300014969 Ga0157376_10264839 Ga0157376_102648392 153
487 3300020070 Ga0206356_10787478 Ga0206356_107874783 153
488 3300020070 Ga0206356_11730020 Ga0206356_117300201 153
489 3300020081 Ga0206354_10520745 Ga0206354_105207453 153
490 3300020081 Ga0206354_10569858 Ga0206354_105698582 153
491 3300020082 Ga0206353_11087294 Ga0206353_110872943 153
492 3300025898 Ga0207692_10038360 Ga0207692_100383603 153
493 3300025906 Ga0207699_10035692 Ga0207699_100356924 153
494 3300025906 Ga0207699_10040944 Ga0207699_100409443 153
495 3300025906 Ga0207699_10065567 Ga0207699_100655674 153
496 3300025909 Ga0207705_10385289 Ga0207705_103852892 153
497 3300025912 Ga0207707_10047170 Ga0207707_100471705 153
498 3300025912 Ga0207707_10169485 Ga0207707_101694852 153
499 3300025913 Ga0207695_10152810 Ga0207695_101528102 153
500 3300025915 Ga0207693_10011542 Ga0207693_100115426 153
501 3300025915 Ga0207693_10012563 Ga0207693_100125633 153
502 3300025916 Ga0207663_10420265 Ga0207663_104202652 153
503 3300025916 Ga0207663_10449672 Ga0207663_104496722 153
504 3300025919 Ga0207657_10007057 Ga0207657_100070576 153
505 3300025920 Ga0207649_10086997 Ga0207649_100869972 153
506 3300025921 Ga0207652_10022340 Ga0207652_100223406 153
507 3300025921 Ga0207652_10815415 Ga0207652_108154151 153
508 3300025922 Ga0207646_10003186 Ga0207646_1000318614 153
509 3300025924 Ga0207694_10311660 Ga0207694_103116602 153
510 3300025927 Ga0207687_10115735 Ga0207687_101157353 153
511 3300025927 Ga0207687_10607600 Ga0207687_106076002 153
512 3300025928 Ga0207700_10245302 Ga0207700_102453022 153
513 3300025929 Ga0207664_10129302 Ga0207664_101293023 153
514 3300025929 Ga0207664_10153151 Ga0207664_101531513 153
515 3300025929 Ga0207664_10293460 Ga0207664_102934602 153
516 3300025933 Ga0207706_11112823 Ga0207706_111128231 153
517 3300025937 Ga0207669_10138624 Ga0207669_101386243 153
518 3300025938 Ga0207704_10274267 Ga0207704_102742673 153
519 3300025939 Ga0207665_10034021 Ga0207665_100340212 153
520 3300025939 Ga0207665_10063722 Ga0207665_100637222 153
521 3300025941 Ga0207711_10421677 Ga0207711_104216771 153
522 3300025944 Ga0207661_10028822 Ga0207661_100288225 153
523 3300025944 Ga0207661_10243765 Ga0207661_102437652 153
524 3300025944 Ga0207661_10277722 Ga0207661_102777222 153
525 3300025945 Ga0207679_10111311 Ga0207679_101113113 153
526 3300025949 Ga0207667_10292677 Ga0207667_102926772 153
527 3300025981 Ga0207640_11420574 Ga0207640_114205742 153
528 3300025986 Ga0207658_10945171 Ga0207658_109451712 153
529 3300026078 Ga0207702_10261651 Ga0207702_102616512 153
530 3300026078 Ga0207702_10482675 Ga0207702_104826752 153
531 3300026078 Ga0207702_10604575 Ga0207702_106045752 153
532 3300026116 Ga0207674_11273260 Ga0207674_112732602 153
533 3300026121 Ga0207683_10297370 Ga0207683_102973703 153
534 3300026142 Ga0207698_10403011 Ga0207698_104030111 153
535 3300027907 Ga0207428_10197966 Ga0207428_101979663 153
536 3300034957 Ga0373938_0216897 Ga0373938_0216897_11_484 153
537 3300035086 Ga0373934_0052817 Ga0373934_0052817_817_1299 153
538 3300035172 Ga0373955_0229676 Ga0373955_0229676_260_742 153
539 3300035410 Ga0373924_0021732 Ga0373924_0021732_312_794 153
540 3300035724 Ga0373933_0321505 Ga0373933_0321505_413_895 153
541 3300036401 Ga0373937_0000355 Ga0373937_0000355_37925_38407 153
542 3300036401 Ga0373937_0091047 Ga0373937_0091047_1355_1837 153
543 3300036401 Ga0373937_0298173 Ga0373937_0298173_402_884 153
544 3300037312 Ga0395899_0071039 Ga0395899_0071039_1601_2083 153
545 3300037312 Ga0395899_0708601 Ga0395899_0708601_146_613 153
546 3300037418 Ga0395900_0002117 Ga0395900_0002117_17441_17908 153
547 3300037418 Ga0395900_0059737 Ga0395900_0059737_19_501 153
548 3300037418 Ga0395900_0077708 Ga0395900_0077708_2506_2973 153
549 3300037466 Ga0395898_0001862 Ga0395898_0001862_24418_24885 153
550 3300037466 Ga0395898_0012734 Ga0395898_0012734_5172_5639 153
551 3300037466 Ga0395898_0043527 Ga0395898_0043527_3406_3888 153
552 3300037466 Ga0395898_0197609 Ga0395898_0197609_1160_1633 153
553 3300037466 Ga0395898_0484565 Ga0395898_0484565_549_1031 153
554 3300037471 Ga0395905_0006129 Ga0395905_0006129_9456_9923 153
555 3300037471 Ga0395905_0029868 Ga0395905_0029868_1783_2250 153
556 3300037471 Ga0395905_0083375 Ga0395905_0083375_1064_1537 153
557 3300037471 Ga0395905_0414010 Ga0395905_0414010_186_668 153
558 3300038443 Ga0395901_0002058 Ga0395901_0002058_15548_16015 153
559 3300038443 Ga0395901_0006996 Ga0395901_0006996_2094_2561 153
560 3300038443 Ga0395901_0207248 Ga0395901_0207248_315_788 153
561 3300038443 Ga0395901_0611650 Ga0395901_0611650_542_1021 153
562 3300038996 Ga0242420_021660 Ga0242420_021660_353_820 153
563 3300039450 Ga0436363_0954544 Ga0436363_0954544_259_741 153
564 3300041406 Ga0439439_0003235 Ga0439439_0003235_2434_2949 153
565 3300041410 Ga0439461_0041228 Ga0439461_0041228_331_846 153
566 3300041997 Ga0439431_0055587 Ga0439431_0055587_59_574 153
567 3300041999 Ga0439433_0001716 Ga0439433_0001716_1149_1664 153
568 3300042002 Ga0439442_032183 Ga0439442_032183_314_829 153
569 3300042007 Ga0439449_0008224 Ga0439449_0008224_1913_2428 153
570 3300042011 Ga0439454_019439 Ga0439454_019439_407_892 153
571 3300042015 Ga0439462_0017304 Ga0439462_0017304_280_795 153
572 3300042122 Ga0450920_011767 Ga0450920_011767_183_668 153
573 3300042156 Ga0439446_0009557 Ga0439446_0009557_2044_2559 153
574 3300044656 Ga0466969_0000591 Ga0466969_0000591_405_887 153
575 3300044683 Ga0466965_0032491 Ga0466965_0032491_1762_2244 153
576 3300044683 Ga0466965_0056596 Ga0466965_0056596_1166_1648 153
577 3300044693 Ga0466961_0008344 Ga0466961_0008344_3636_4118 153
578 3300044693 Ga0466961_0115240 Ga0466961_0115240_1195_1677 153
579 3300044694 Ga0466963_0000670 Ga0466963_0000670_5386_5868 153
580 3300044694 Ga0466963_0001565 Ga0466963_0001565_5401_5883 153
581 3300044694 Ga0466963_0001933 Ga0466963_0001933_6878_7360 153
582 3300044694 Ga0466963_0006848 Ga0466963_0006848_3451_3933 153
583 3300044694 Ga0466963_0058286 Ga0466963_0058286_691_1173 153
584 3300044694 Ga0466963_0069923 Ga0466963_0069923_653_1135 153
585 3300044694 Ga0466963_0080094 Ga0466963_0080094_408_890 153
586 3300044706 Ga0466964_0044673 Ga0466964_0044673_1192_1674 153
587 3300044706 Ga0466964_0055534 Ga0466964_0055534_493_975 153
588 3300044706 Ga0466964_0058045 Ga0466964_0058045_813_1295 153
589 3300044719 Ga0466971_0002846 Ga0466971_0002846_421_903 153
590 3300044719 Ga0466971_0083352 Ga0466971_0083352_719_1201 153
591 3300044735 Ga0466968_0013032 Ga0466968_0013032_2697_3179 153
592 3300044735 Ga0466968_0029981 Ga0466968_0029981_430_912 153
593 3300044735 Ga0466968_0037552 Ga0466968_0037552_181_663 153
594 3300044765 Ga0466970_0011341 Ga0466970_0011341_242_724 153
595 3300044765 Ga0466970_0077360 Ga0466970_0077360_1132_1614 153
596 3300044842 Ga0466957_0006041 Ga0466957_0006041_5507_5989 153
597 3300044842 Ga0466957_0010913 Ga0466957_0010913_224_706 153
598 3300044842 Ga0466957_0031644 Ga0466957_0031644_1414_1896 153
599 3300044842 Ga0466957_0053228 Ga0466957_0053228_1209_1691 153
600 3300044901 Ga0466960_0339899 Ga0466960_0339899_185_667 153
601 3300045049 Ga0466959_0050486 Ga0466959_0050486_1203_1685 153
602 3300045049 Ga0466959_0268038 Ga0466959_0268038_52_534 153
603 3300045836 Ga0466958_0007030 Ga0466958_0007030_4185_4667 153
604 3300045836 Ga0466958_0021374 Ga0466958_0021374_651_1133 153
605 3300045836 Ga0466958_0048556 Ga0466958_0048556_126_608 153
606 3300045836 Ga0466958_0122974 Ga0466958_0122974_338_820 153
607 3300045976 Ga0466967_0000173 Ga0466967_0000173_18901_19383 153
608 3300045976 Ga0466967_0023676 Ga0466967_0023676_1320_1802 153
609 3300045976 Ga0466967_0027634 Ga0466967_0027634_111_593 153
610 3300045976 Ga0466967_0035273 Ga0466967_0035273_1091_1573 153
611 3300045976 Ga0466967_0035961 Ga0466967_0035961_2385_2867 153
612 3300045976 Ga0466967_0058650 Ga0466967_0058650_2658_3140 153
613 3300045976 Ga0466967_0070749 Ga0466967_0070749_733_1215 153
614 3300045976 Ga0466967_0077614 Ga0466967_0077614_1926_2408 153
615 3300045976 Ga0466967_0186982 Ga0466967_0186982_806_1288 153
616 3300045976 Ga0466967_0315563 Ga0466967_0315563_595_1077 153
617 3300045976 Ga0466967_0633642 Ga0466967_0633642_183_665 153
618 3300046454 Ga0495592_0000635 Ga0495592_0000635_1132_1614 153
619 3300046454 Ga0495592_0000769 Ga0495592_0000769_10205_10687 153
620 3300046454 Ga0495592_0068268 Ga0495592_0068268_1611_2093 153
621 3300046454 Ga0495592_0099960 Ga0495592_0099960_1522_2004 153
622 3300046455 Ga0495603_0086996 Ga0495603_0086996_469_942 153
623 3300046459 Ga0495629_0016265 Ga0495629_0016265_1941_2414 153
624 3300046461 Ga0495641_0015557 Ga0495641_0015557_2186_2668 153
625 3300046461 Ga0495641_0108458 Ga0495641_0108458_553_1026 153
626 3300046461 Ga0495641_0135945 Ga0495641_0135945_177_659 153
627 3300046461 Ga0495641_0314608 Ga0495641_0314608_182_664 153
628 3300046462 Ga0495651_0000029 Ga0495651_0000029_10206_10688 153
629 3300046462 Ga0495651_0772579 Ga0495651_0772579_86_568 153
630 3300046463 Ga0495653_0003221 Ga0495653_0003221_5034_5516 153
631 3300046463 Ga0495653_0069379 Ga0495653_0069379_1777_2259 153
632 3300046473 Ga0495582_0173928 Ga0495582_0173928_248_730 153
633 3300046473 Ga0495582_0244091 Ga0495582_0244091_240_722 153
634 3300046476 Ga0495662_0129371 Ga0495662_0129371_364_846 153
635 3300046477 Ga0495664_0157772 Ga0495664_0157772_170_652 153
636 3300046491 Ga0495584_0134281 Ga0495584_0134281_543_1025 153
637 3300046492 Ga0495585_0381145 Ga0495585_0381145_159_641 153
638 3300046511 Ga0495608_0004327 Ga0495608_0004327_5412_5894 153
639 3300046514 Ga0495618_0001935 Ga0495618_0001935_2076_2558 153
640 3300046514 Ga0495618_0632432 Ga0495618_0632432_42_524 153
641 3300046516 Ga0495628_0000016 Ga0495628_0000016_10179_10661 153
642 3300046516 Ga0495628_0073325 Ga0495628_0073325_90_572 153
643 3300046516 Ga0495628_0094887 Ga0495628_0094887_719_1201 153
644 3300046517 Ga0495630_0045205 Ga0495630_0045205_2276_2758 153
645 3300046523 Ga0495644_0050042 Ga0495644_0050042_485_967 153
646 3300046528 Ga0495642_0117259 Ga0495642_0117259_121_603 153
647 3300046529 Ga0495652_0001228 Ga0495652_0001228_10206_10688 153
648 3300046529 Ga0495652_0037452 Ga0495652_0037452_1523_2005 153
649 3300046529 Ga0495652_0091507 Ga0495652_0091507_605_1087 153
650 3300046533 Ga0495640_0210480 Ga0495640_0210480_251_733 153
651 3300046535 Ga0495586_0079888 Ga0495586_0079888_1007_1480 153
652 3300046535 Ga0495586_0202148 Ga0495586_0202148_385_867 153
653 3300046536 Ga0495587_0000434 Ga0495587_0000434_10206_10688 153
654 3300046543 Ga0495645_0000367 Ga0495645_0000367_10180_10662 153
655 3300046543 Ga0495645_0344535 Ga0495645_0344535_185_667 153
656 3300046558 Ga0495633_0295740 Ga0495633_0295740_123_605 153
657 3300046559 Ga0495667_0056732 Ga0495667_0056732_1786_2268 153
658 3300046559 Ga0495667_0122966 Ga0495667_0122966_998_1480 153
659 3300046615 Ga0495656_0001482 Ga0495656_0001482_3922_4404 153
660 3300046642 Ga0495634_0015712 Ga0495634_0015712_2194_2667 153
661 3300046642 Ga0495634_0415343 Ga0495634_0415343_130_612 153
662 3300046648 Ga0495611_0067422 Ga0495611_0067422_474_956 153
663 3300046663 Ga0495635_0047562 Ga0495635_0047562_2007_2489 153
664 3300046665 Ga0495661_0212988 Ga0495661_0212988_287_769 153
665 3300046675 Ga0495657_0005282 Ga0495657_0005282_8600_9082 153
666 3300046675 Ga0495657_0133210 Ga0495657_0133210_37_519 153
667 3300046678 Ga0495599_0000187 Ga0495599_0000187_32705_33187 153
668 3300046678 Ga0495599_0020779 Ga0495599_0020779_1586_2068 153
669 3300046679 Ga0495623_0000121 Ga0495623_0000121_10198_10680 153
670 3300046680 Ga0495646_0025332 Ga0495646_0025332_2599_3081 153
671 3300046680 Ga0495646_0057372 Ga0495646_0057372_1021_1503 153
672 3300046680 Ga0495646_0121485 Ga0495646_0121485_370_852 153
673 3300046681 Ga0495647_0027244 Ga0495647_0027244_163_636 153
674 3300046683 Ga0495658_0056370 Ga0495658_0056370_318_800 153
675 3300046689 Ga0495613_0006994 Ga0495613_0006994_4002_4475 153
676 3300046690 Ga0495624_0014162 Ga0495624_0014162_2893_3375 153
677 3300046794 Ga0495589_0041834 Ga0495589_0041834_1595_2077 153
678 3300046809 Ga0495600_0085761 Ga0495600_0085761_765_1247 153
679 3300047315 Ga0495581_0065178 Ga0495581_0065178_1378_1860 153
680 3300047317 Ga0495604_0000628 Ga0495604_0000628_19706_20188 153
681 3300047319 Ga0495674_0222904 Ga0495674_0222904_868_1350 153
682 3300047321 Ga0495676_0023206 Ga0495676_0023206_1856_2329 153
683 3300047322 Ga0495680_0002048 Ga0495680_0002048_18716_19198 153
684 3300047322 Ga0495680_0662748 Ga0495680_0662748_37_519 153
685 3300047444 Ga0495675_0000031 Ga0495675_0000031_93168_93650 153
686 3300047447 Ga0495685_083212 Ga0495685_083212_483_965 153
687 3300047471 Ga0495684_0728392 Ga0495684_0728392_12_494 153
688 3300048088 Ga0495602_0000133 Ga0495602_0000133_10206_10688 153
689 3300048088 Ga0495602_0278109 Ga0495602_0278109_419_901 153
690 3300048088 Ga0495602_0318424 Ga0495602_0318424_32_514 153
691 3300048903 Ga0496100_0276661 Ga0496100_0276661_540_1022 153
692 3300048903 Ga0496100_1077898 Ga0496100_1077898_11_493 153
693 3300048904 Ga0496101_0063633 Ga0496101_0063633_356_829 153
694 3300048904 Ga0496101_0112509 Ga0496101_0112509_1557_2039 153
695 3300048904 Ga0496101_0220725 Ga0496101_0220725_662_1129 153
696 3300048904 Ga0496101_0354016 Ga0496101_0354016_424_906 153
697 3300048904 Ga0496101_0421988 Ga0496101_0421988_485_967 153
698 3300048905 Ga0496102_0072024 Ga0496102_0072024_1023_1490 153
699 3300048905 Ga0496102_0076014 Ga0496102_0076014_46_537 153
700 3300048905 Ga0496102_0368532 Ga0496102_0368532_464_937 153
701 3300048906 Ga0496103_0084153 Ga0496103_0084153_1412_1879 153
702 3300048907 Ga0496104_0122313 Ga0496104_0122313_1475_1957 153
703 3300048907 Ga0496104_0499867 Ga0496104_0499867_270_743 153
704 3300048907 Ga0496104_0604752 Ga0496104_0604752_276_749 153
705 3300048907 Ga0496104_1701089 Ga0496104_1701089_13_480 153
706 3300048908 Ga0496105_0023043 Ga0496105_0023043_1745_2218 153
707 3300048908 Ga0496105_0031873 Ga0496105_0031873_3750_4232 153
708 3300048908 Ga0496105_0054893 Ga0496105_0054893_579_1046 153
709 3300048909 Ga0496106_0148189 Ga0496106_0148189_1198_1671 153
710 3300048909 Ga0496106_0291659 Ga0496106_0291659_674_1141 153
711 3300048910 Ga0496107_0169901 Ga0496107_0169901_198_680 153
712 3300048910 Ga0496107_0253321 Ga0496107_0253321_46_528 153
713 3300048910 Ga0496107_0289463 Ga0496107_0289463_30_503 153
714 3300048910 Ga0496107_0432830 Ga0496107_0432830_114_605 153
715 3300048910 Ga0496107_0631538 Ga0496107_0631538_74_541 153
716 3300048911 Ga0496108_0006504 Ga0496108_0006504_4502_4975 153
717 3300048911 Ga0496108_0051123 Ga0496108_0051123_290_772 153
718 3300048911 Ga0496108_0060419 Ga0496108_0060419_2466_2933 153
719 3300048911 Ga0496108_0083291 Ga0496108_0083291_867_1358 153
720 3300048911 Ga0496108_0094102 Ga0496108_0094102_241_726 153
721 3300048911 Ga0496108_0175087 Ga0496108_0175087_279_752 153
722 3300048911 Ga0496108_0204985 Ga0496108_0204985_685_1167 153
723 3300048912 Ga0496109_0004548 Ga0496109_0004548_7400_7873 153
724 3300048912 Ga0496109_0033113 Ga0496109_0033113_683_1174 153
725 3300048912 Ga0496109_0063809 Ga0496109_0063809_118_585 153
726 3300048912 Ga0496109_0176637 Ga0496109_0176637_249_716 153
727 3300048912 Ga0496109_0258788 Ga0496109_0258788_284_757 153
728 3300048912 Ga0496109_0385272 Ga0496109_0385272_503_985 153
729 3300048913 Ga0496110_0013143 Ga0496110_0013143_5262_5735 153
730 3300048913 Ga0496110_0127356 Ga0496110_0127356_93_560 153
731 3300048913 Ga0496110_0137530 Ga0496110_0137530_528_1013 153
732 3300048913 Ga0496110_0256424 Ga0496110_0256424_118_585 153
733 3300048913 Ga0496110_0581390 Ga0496110_0581390_476_949 153
734 3300048914 Ga0496111_0002951 Ga0496111_0002951_8083_8556 153
735 3300048914 Ga0496111_0076252 Ga0496111_0076252_374_856 153
736 3300048914 Ga0496111_0106585 Ga0496111_0106585_1196_1669 153
737 3300048914 Ga0496111_0403163 Ga0496111_0403163_259_726 153
738 3300048914 Ga0496111_0476187 Ga0496111_0476187_404_886 153
739 3300048915 Ga0496112_0000720 Ga0496112_0000720_18767_19234 153
740 3300048915 Ga0496112_0016198 Ga0496112_0016198_1143_1610 153
741 3300048915 Ga0496112_0086167 Ga0496112_0086167_1254_1736 153
742 3300048915 Ga0496112_0110864 Ga0496112_0110864_76_558 153
743 3300048915 Ga0496112_0204049 Ga0496112_0204049_42_524 153
744 3300048915 Ga0496112_0221458 Ga0496112_0221458_897_1379 153
745 3300048916 Ga0496113_0019216 Ga0496113_0019216_3928_4401 153
746 3300048916 Ga0496113_0050512 Ga0496113_0050512_322_813 153
747 3300048916 Ga0496113_0113480 Ga0496113_0113480_318_800 153
748 3300048916 Ga0496113_0199406 Ga0496113_0199406_61_534 153
749 3300048916 Ga0496113_0658285 Ga0496113_0658285_296_763 153
750 3300048916 Ga0496113_0791058 Ga0496113_0791058_249_734 153
751 3300048916 Ga0496113_1095409 Ga0496113_1095409_69_551 153
752 3300048917 Ga0496114_0016663 Ga0496114_0016663_4612_5079 153
753 3300048917 Ga0496114_0029580 Ga0496114_0029580_3778_4251 153
754 3300048917 Ga0496114_0132984 Ga0496114_0132984_1278_1763 153
755 3300048917 Ga0496114_0198861 Ga0496114_0198861_646_1119 153
756 3300048917 Ga0496114_0270748 Ga0496114_0270748_846_1328 153
757 3300048918 Ga0496115_0231014 Ga0496115_0231014_672_1154 153
758 3300048918 Ga0496115_0680437 Ga0496115_0680437_199_681 153
759 3300049568 Ga0501031_0120507 Ga0501031_0120507_973_1434 153
760 3300049574 Ga0501038_1011522 Ga0501038_1011522_55_540 153
761 3300049575 Ga0501039_0312183 Ga0501039_0312183_669_1154 153
762 3300049577 Ga0501041_0488357 Ga0501041_0488357_209_670 153
763 3300049584 Ga0501068_0016962 Ga0501068_0016962_707_1219 153
764 3300049585 Ga0501069_0023483 Ga0501069_0023483_131_643 153
765 3300049587 Ga0501071_0088291 Ga0501071_0088291_797_1282 153
766 3300049587 Ga0501071_0868642 Ga0501071_0868642_33_494 153
767 3300049588 Ga0501072_0451265 Ga0501072_0451265_325_810 153
768 3300049588 Ga0501072_0836280 Ga0501072_0836280_171_632 153
769 3300049591 Ga0501075_0114590 Ga0501075_0114590_876_1361 153
770 3300049592 Ga0501076_0764644 Ga0501076_0764644_194_679 153
771 3300049592 Ga0501076_1315756 Ga0501076_1315756_106_567 153
772 3300049743 Ga0501081_0765512 Ga0501081_0765512_157_618 153
773 3300049743 Ga0501081_0971149 Ga0501081_0971149_124_585 153
774 3300050507 nmdc:mga05p37_13210_c1 nmdc:mga05p37_13210_c1_436_903 153
775 3300050507 nmdc:mga05p37_710891_c1 nmdc:mga05p37_710891_c1_413_898 153
776 3300050508 nmdc:mga09592_1170905_c1 nmdc:mga09592_1170905_c1_114_599 153
777 3300050510 nmdc:mga06r32_412105_c1 nmdc:mga06r32_412105_c1_849_1316 153
778 3300050512 nmdc:mga0n895_120235_c1 nmdc:mga0n895_120235_c1_1381_1866 153
779 3300050512 nmdc:mga0n895_356849_c1 nmdc:mga0n895_356849_c1_431_898 153
780 3300050512 nmdc:mga0n895_9466_c1 nmdc:mga0n895_9466_c1_1595_2077 153
781 3300050513 nmdc:mga0rr50_133592_c1 nmdc:mga0rr50_133592_c1_1158_1625 153
782 3300050513 nmdc:mga0rr50_275130_c1 nmdc:mga0rr50_275130_c1_756_1241 153
783 3300050514 nmdc:mga08x19_234183_c1 nmdc:mga08x19_234183_c1_579_1046 153
784 3300050515 nmdc:mga0a205_190749_c1 nmdc:mga0a205_190749_c1_409_876 153
785 3300050515 nmdc:mga0a205_202022_c1 nmdc:mga0a205_202022_c1_448_930 153
786 3300053077 Ga0495601_0001112 Ga0495601_0001112_5076_5558 153
787 3300053077 Ga0495601_0217567 Ga0495601_0217567_17_499 153
788 3300053078 Ga0495612_0013653 Ga0495612_0013653_1553_2035 153
789 3300053084 Ga0495595_0011768 Ga0495595_0011768_2602_3084 153
790 3300053084 Ga0495595_0391885 Ga0495595_0391885_139_621 153
791 3300053085 Ga0495619_0001848 Ga0495619_0001848_2014_2496 153
792 3300053085 Ga0495619_0208461 Ga0495619_0208461_389_871 153
793 3300053085 Ga0495619_0264306 Ga0495619_0264306_347_829 153
794 3300053085 Ga0495619_0380583 Ga0495619_0380583_471_953 153
795 3300060353 Ga0501082_0069889 Ga0501082_0069889_1000_1485 153
796 3300061719 Ga0466962_0073765 Ga0466962_0073765_927_1409 153
797 3300061719 Ga0466962_0138530 Ga0466962_0138530_83_565 153
798 3300061719 Ga0466962_0268158 Ga0466962_0268158_301_783 153
799 3300061734 Ga0530510_0701213 Ga0530510_0701213_191_664 153
800 3300061734 Ga0530510_1458776 Ga0530510_1458776_15_497 153
801 3300003203 JGI25406J46586_10082873 JGI25406J46586_100828732 154
802 3300005353 Ga0070669_100399130 Ga0070669_1003991301 154
803 3300005457 Ga0070662_100261437 Ga0070662_1002614372 154
804 3300005535 Ga0070684_100124416 Ga0070684_1001244163 154
805 3300005578 Ga0068854_100025571 Ga0068854_1000255715 154
806 3300005616 Ga0068852_100267557 Ga0068852_1002675572 154
807 3300005985 Ga0081539_10002469 Ga0081539_1000246921 154
808 3300009094 Ga0111539_10054002 Ga0111539_100540023 154
809 3300009098 Ga0105245_10304859 Ga0105245_103048593 154
810 3300009147 Ga0114129_10588614 Ga0114129_105886143 154
811 3300010375 Ga0105239_10035534 Ga0105239_100355342 154
812 3300013307 Ga0157372_10163377 Ga0157372_101633773 154
813 3300014745 Ga0157377_10175965 Ga0157377_101759653 154
814 3300025932 Ga0207690_10085158 Ga0207690_100851583 154
815 3300048906 Ga0496103_0229255 Ga0496103_0229255_266_730 154
816 3300048913 Ga0496110_1142366 Ga0496110_1142366_149_613 154
817 3300049568 Ga0501031_0073730 Ga0501031_0073730_1061_1525 154
818 3300049568 Ga0501031_0293840 Ga0501031_0293840_312_776 154
819 3300049569 Ga0501032_0012583 Ga0501032_0012583_489_953 154
820 3300049570 Ga0501033_0110157 Ga0501033_0110157_1219_1683 154
821 3300049571 Ga0501034_0510141 Ga0501034_0510141_313_777 154
822 3300049572 Ga0501036_0102459 Ga0501036_0102459_1496_1960 154
823 3300049573 Ga0501037_0155190 Ga0501037_0155190_874_1338 154
824 3300049574 Ga0501038_0010922 Ga0501038_0010922_4864_5328 154
825 3300049575 Ga0501039_0006374 Ga0501039_0006374_3220_3684 154
826 3300049575 Ga0501039_0044426 Ga0501039_0044426_207_671 154
827 3300049576 Ga0501040_0116536 Ga0501040_0116536_1373_1837 154
828 3300049576 Ga0501040_0220435 Ga0501040_0220435_424_888 154
829 3300049577 Ga0501041_0022834 Ga0501041_0022834_2738_3202 154
830 3300049577 Ga0501041_0026041 Ga0501041_0026041_57_521 154
831 3300049578 Ga0501042_0007698 Ga0501042_0007698_4034_4498 154
832 3300049578 Ga0501042_0008751 Ga0501042_0008751_718_1182 154
833 3300049579 Ga0501043_0090432 Ga0501043_0090432_262_726 154
834 3300049580 Ga0501046_0008561 Ga0501046_0008561_8279_8743 154
835 3300049580 Ga0501046_0346840 Ga0501046_0346840_547_1011 154
836 3300049582 Ga0501048_0080734 Ga0501048_0080734_186_650 154
837 3300049582 Ga0501048_0096625 Ga0501048_0096625_248_712 154
838 3300049584 Ga0501068_0083778 Ga0501068_0083778_162_626 154
839 3300049584 Ga0501068_0153665 Ga0501068_0153665_514_978 154
840 3300049585 Ga0501069_0036725 Ga0501069_0036725_1906_2370 154
841 3300049585 Ga0501069_0074069 Ga0501069_0074069_954_1418 154
842 3300049586 Ga0501070_0019851 Ga0501070_0019851_4820_5284 154
843 3300049586 Ga0501070_0068804 Ga0501070_0068804_264_728 154
844 3300049587 Ga0501071_0016213 Ga0501071_0016213_3550_4014 154
845 3300049588 Ga0501072_0003835 Ga0501072_0003835_1702_2166 154
846 3300049589 Ga0501073_0031712 Ga0501073_0031712_379_843 154
847 3300049589 Ga0501073_0457343 Ga0501073_0457343_85_549 154
848 3300049590 Ga0501074_0014813 Ga0501074_0014813_5035_5499 154
849 3300049591 Ga0501075_0084674 Ga0501075_0084674_456_920 154
850 3300049592 Ga0501076_0013005 Ga0501076_0013005_4246_4710 154
851 3300049592 Ga0501076_0136482 Ga0501076_0136482_1250_1714 154
852 3300049593 Ga0501077_0398730 Ga0501077_0398730_285_749 154
853 3300049741 Ga0501079_0005790 Ga0501079_0005790_5143_5607 154
854 3300049741 Ga0501079_0041140 Ga0501079_0041140_312_776 154
855 3300049742 Ga0501080_0074455 Ga0501080_0074455_383_847 154
856 3300049742 Ga0501080_0221249 Ga0501080_0221249_483_947 154
857 3300049743 Ga0501081_0177045 Ga0501081_0177045_872_1336 154
858 3300049743 Ga0501081_0289824 Ga0501081_0289824_312_776 154
859 3300049822 Ga0501035_0142488 Ga0501035_0142488_1335_1799 154
860 3300049822 Ga0501035_0246531 Ga0501035_0246531_775_1239 154
861 3300049823 Ga0501044_0254930 Ga0501044_0254930_975_1439 154
862 3300049824 Ga0501045_0034406 Ga0501045_0034406_2342_2806 154
863 3300049824 Ga0501045_0061970 Ga0501045_0061970_1798_2262 154
864 3300050511 nmdc:mga08y16_112887_c1 nmdc:mga08y16_112887_c1_498_962 154
865 3300054114 Ga0501084_0576791 Ga0501084_0576791_174_638 154
866 3300054114 Ga0501084_0791884 Ga0501084_0791884_17_481 154
867 3300060353 Ga0501082_0066763 Ga0501082_0066763_932_1396 154
868 3300060353 Ga0501082_0232192 Ga0501082_0232192_1125_1589 154
869 3300061734 Ga0530510_0277033 Ga0530510_0277033_307_771 154
870 3300061734 Ga0530510_0287224 Ga0530510_0287224_371_835 154
871 3300001991 JGI24743J22301_10033953 JGI24743J22301_100339532 155
872 3300002075 JGI24738J21930_10016802 JGI24738J21930_100168022 155
873 3300005327 Ga0070658_10091921 Ga0070658_100919213 155
874 3300005329 Ga0070683_100594897 Ga0070683_1005948972 155
875 3300005329 Ga0070683_100771131 Ga0070683_1007711312 155
876 3300005330 Ga0070690_100107022 Ga0070690_1001070221 155
877 3300005331 Ga0070670_100073980 Ga0070670_1000739803 155
878 3300005334 Ga0068869_100173843 Ga0068869_1001738432 155
879 3300005337 Ga0070682_100095037 Ga0070682_1000950372 155
880 3300005337 Ga0070682_100332499 Ga0070682_1003324993 155
881 3300005338 Ga0068868_100078672 Ga0068868_1000786723 155
882 3300005338 Ga0068868_100147361 Ga0068868_1001473614 155
883 3300005339 Ga0070660_100011258 Ga0070660_1000112585 155
884 3300005341 Ga0070691_10021455 Ga0070691_100214553 155
885 3300005343 Ga0070687_100367879 Ga0070687_1003678792 155
886 3300005344 Ga0070661_100018221 Ga0070661_1000182214 155
887 3300005345 Ga0070692_10076474 Ga0070692_100764742 155
888 3300005353 Ga0070669_100935013 Ga0070669_1009350132 155
889 3300005354 Ga0070675_100035405 Ga0070675_1000354054 155
890 3300005355 Ga0070671_100032475 Ga0070671_1000324754 155
891 3300005356 Ga0070674_100027096 Ga0070674_1000270965 155
892 3300005356 Ga0070674_100168144 Ga0070674_1001681443 155
893 3300005364 Ga0070673_100018556 Ga0070673_1000185562 155
894 3300005364 Ga0070673_100285605 Ga0070673_1002856053 155
895 3300005365 Ga0070688_101117541 Ga0070688_1011175411 155
896 3300005366 Ga0070659_100034064 Ga0070659_1000340645 155
897 3300005366 Ga0070659_100132956 Ga0070659_1001329564 155
898 3300005367 Ga0070667_100493864 Ga0070667_1004938641 155
899 3300005406 Ga0070703_10015426 Ga0070703_100154263 155
900 3300005438 Ga0070701_10015957 Ga0070701_100159572 155
901 3300005440 Ga0070705_100121785 Ga0070705_1001217853 155
902 3300005441 Ga0070700_100039344 Ga0070700_1000393445 155
903 3300005441 Ga0070700_100276115 Ga0070700_1002761152 155
904 3300005444 Ga0070694_100439867 Ga0070694_1004398672 155
905 3300005455 Ga0070663_100170142 Ga0070663_1001701423 155
906 3300005456 Ga0070678_100143734 Ga0070678_1001437342 155
907 3300005456 Ga0070678_100542388 Ga0070678_1005423882 155
908 3300005457 Ga0070662_100797923 Ga0070662_1007979231 155
909 3300005459 Ga0068867_100269851 Ga0068867_1002698513 155
910 3300005530 Ga0070679_100162589 Ga0070679_1001625893 155
911 3300005535 Ga0070684_100435850 Ga0070684_1004358503 155
912 3300005539 Ga0068853_100034262 Ga0068853_1000342623 155
913 3300005543 Ga0070672_100016613 Ga0070672_1000166135 155
914 3300005543 Ga0070672_100059769 Ga0070672_1000597693 155
915 3300005544 Ga0070686_100464423 Ga0070686_1004644232 155
916 3300005546 Ga0070696_100307116 Ga0070696_1003071163 155
917 3300005547 Ga0070693_100139884 Ga0070693_1001398843 155
918 3300005549 Ga0070704_100034442 Ga0070704_1000344426 155
919 3300005563 Ga0068855_100151728 Ga0068855_1001517283 155
920 3300005564 Ga0070664_100089152 Ga0070664_1000891524 155
921 3300005564 Ga0070664_100109175 Ga0070664_1001091753 155
922 3300005564 Ga0070664_100520854 Ga0070664_1005208542 155
923 3300005577 Ga0068857_100155027 Ga0068857_1001550274 155
924 3300005578 Ga0068854_100073533 Ga0068854_1000735332 155
925 3300005614 Ga0068856_100204018 Ga0068856_1002040183 155
926 3300005616 Ga0068852_100031104 Ga0068852_1000311046 155
927 3300005840 Ga0068870_10232310 Ga0068870_102323103 155
928 3300005840 Ga0068870_10481742 Ga0068870_104817422 155
929 3300005841 Ga0068863_100152411 Ga0068863_1001524113 155
930 3300005842 Ga0068858_100280118 Ga0068858_1002801183 155
931 3300005843 Ga0068860_100074245 Ga0068860_1000742453 155
932 3300006237 Ga0097621_100005668 Ga0097621_1000056686 155
933 3300006358 Ga0068871_100380635 Ga0068871_1003806352 155
934 3300006881 Ga0068865_100226748 Ga0068865_1002267483 155
935 3300006881 Ga0068865_100422365 Ga0068865_1004223651 155
936 3300009098 Ga0105245_10288822 Ga0105245_102888222 155
937 3300009098 Ga0105245_10315925 Ga0105245_103159253 155
938 3300009148 Ga0105243_10006669 Ga0105243_100066697 155
939 3300009174 Ga0105241_10068970 Ga0105241_100689703 155
940 3300009176 Ga0105242_10040521 Ga0105242_100405213 155
941 3300009551 Ga0105238_10118699 Ga0105238_101186993 155
942 3300009551 Ga0105238_10255943 Ga0105238_102559432 155
943 3300013102 Ga0157371_10150922 Ga0157371_101509222 155
944 3300013296 Ga0157374_10271973 Ga0157374_102719732 155
945 3300013297 Ga0157378_10741838 Ga0157378_107418382 155
946 3300013307 Ga0157372_10126490 Ga0157372_101264901 155
947 3300014326 Ga0157380_10645474 Ga0157380_106454742 155
948 3300014745 Ga0157377_10023413 Ga0157377_100234132 155
949 3300017792 Ga0163161_10083494 Ga0163161_100834943 155
950 3300020081 Ga0206354_11504563 Ga0206354_115045631 155
951 3300025321 Ga0207656_10010697 Ga0207656_100106974 155
952 3300025885 Ga0207653_10004869 Ga0207653_100048693 155
953 3300025893 Ga0207682_10288945 Ga0207682_102889452 155
954 3300025899 Ga0207642_10038947 Ga0207642_100389474 155
955 3300025900 Ga0207710_10265134 Ga0207710_102651342 155
956 3300025901 Ga0207688_10079267 Ga0207688_100792673 155
957 3300025901 Ga0207688_10089230 Ga0207688_100892303 155
958 3300025904 Ga0207647_10349624 Ga0207647_103496242 155
959 3300025908 Ga0207643_10215433 Ga0207643_102154332 155
960 3300025909 Ga0207705_10030691 Ga0207705_100306915 155
961 3300025912 Ga0207707_10522633 Ga0207707_105226333 155
962 3300025918 Ga0207662_10036570 Ga0207662_100365705 155
963 3300025919 Ga0207657_10020965 Ga0207657_100209656 155
964 3300025919 Ga0207657_10235007 Ga0207657_102350071 155
965 3300025920 Ga0207649_10550527 Ga0207649_105505272 155
966 3300025922 Ga0207646_10774641 Ga0207646_107746412 155
967 3300025923 Ga0207681_10187838 Ga0207681_101878383 155
968 3300025924 Ga0207694_10150732 Ga0207694_101507323 155
969 3300025925 Ga0207650_10481011 Ga0207650_104810113 155
970 3300025926 Ga0207659_10014776 Ga0207659_100147764 155
971 3300025926 Ga0207659_10419313 Ga0207659_104193132 155
972 3300025931 Ga0207644_10771867 Ga0207644_107718672 155
973 3300025932 Ga0207690_10019099 Ga0207690_100190993 155
974 3300025933 Ga0207706_10036043 Ga0207706_100360434 155
975 3300025934 Ga0207686_10164275 Ga0207686_101642753 155
976 3300025934 Ga0207686_10479608 Ga0207686_104796082 155
977 3300025935 Ga0207709_10011741 Ga0207709_100117413 155
978 3300025937 Ga0207669_10029973 Ga0207669_100299732 155
979 3300025938 Ga0207704_10101339 Ga0207704_101013393 155
980 3300025938 Ga0207704_10411163 Ga0207704_104111633 155
981 3300025940 Ga0207691_10180133 Ga0207691_101801332 155
982 3300025940 Ga0207691_10192148 Ga0207691_101921483 155
983 3300025941 Ga0207711_10752494 Ga0207711_107524942 155
984 3300025942 Ga0207689_10043039 Ga0207689_100430393 155
985 3300025942 Ga0207689_10711119 Ga0207689_107111192 155
986 3300025944 Ga0207661_10064208 Ga0207661_100642081 155
987 3300025944 Ga0207661_11704212 Ga0207661_117042121 155
988 3300025945 Ga0207679_10099881 Ga0207679_100998813 155
989 3300025945 Ga0207679_11002182 Ga0207679_110021822 155
990 3300025949 Ga0207667_10232490 Ga0207667_102324903 155
991 3300025960 Ga0207651_10017093 Ga0207651_100170936 155
992 3300025961 Ga0207712_10581302 Ga0207712_105813022 155
993 3300026023 Ga0207677_10202239 Ga0207677_102022393 155
994 3300026035 Ga0207703_10561277 Ga0207703_105612773 155
995 3300026041 Ga0207639_10064181 Ga0207639_100641815 155
996 3300026067 Ga0207678_10039230 Ga0207678_100392306 155
997 3300026075 Ga0207708_10005647 Ga0207708_100056478 155
998 3300026075 Ga0207708_10345608 Ga0207708_103456083 155
999 3300026078 Ga0207702_10315278 Ga0207702_103152783 155
1000 3300026088 Ga0207641_10447263 Ga0207641_104472631 155
1001 3300026089 Ga0207648_10014192 Ga0207648_100141925 155
1002 3300026089 Ga0207648_10182953 Ga0207648_101829533 155
1003 3300026095 Ga0207676_11372407 Ga0207676_113724071 155
1004 3300026118 Ga0207675_100216861 Ga0207675_1002168613 155
1005 3300026121 Ga0207683_10038100 Ga0207683_100381005 155
1006 3300028381 Ga0268264_10244547 Ga0268264_102445473 155
1007 3300031901 Ga0307406_10459983 Ga0307406_104599832 155
1008 3300032002 Ga0307416_100089371 Ga0307416_1000893712 155
1009 3300035088 Ga0373940_0108164 Ga0373940_0108164_119_589 155
1010 3300035092 Ga0373952_0129280 Ga0373952_0129280_132_602 155
1011 3300035112 Ga0373932_0342790 Ga0373932_0342790_84_554 155
1012 3300035114 Ga0373939_0265191 Ga0373939_0265191_113_583 155
1013 3300035242 Ga0373962_0041658 Ga0373962_0041658_659_1129 155
1014 3300035691 Ga0373931_0629565 Ga0373931_0629565_49_519 155
1015 3300038443 Ga0395901_1240299 Ga0395901_1240299_228_695 155
1016 3300041443 Ga0451789_0326424 Ga0451789_0326424_104_571 155
1017 3300041460 Ga0451802_1810917 Ga0451802_1810917_125_592 155
1018 3300041486 Ga0451807_2160026 Ga0451807_2160026_605_1072 155
1019 3300041501 Ga0451845_0901567 Ga0451845_0901567_121_588 155
1020 3300048904 Ga0496101_0396021 Ga0496101_0396021_498_968 155
1021 3300048907 Ga0496104_0173486 Ga0496104_0173486_1187_1657 155
1022 3300048909 Ga0496106_0376575 Ga0496106_0376575_238_705 155
1023 3300048912 Ga0496109_0050623 Ga0496109_0050623_2779_3249 155
1024 3300048913 Ga0496110_0306503 Ga0496110_0306503_514_984 155
1025 3300048914 Ga0496111_0100914 Ga0496111_0100914_433_903 155
1026 3300048915 Ga0496112_1372219 Ga0496112_1372219_111_581 155
1027 3300048916 Ga0496113_0518232 Ga0496113_0518232_49_519 155
1028 3300048917 Ga0496114_0023362 Ga0496114_0023362_3004_3474 155
1029 3300049575 Ga0501039_0217914 Ga0501039_0217914_70_540 155

Structural Annotation

Top 5 Hits

ID Description Score Start End
4d5l-assembly1.cif.gz_Z cryo-em structures of ribosomal 80s complexes with termination factors and cricket paralysis virus ires reveal the ires in the translocated state 0.7148 98 132
8a98-assembly1.cif.gz_Sa cryo-em structure of leishmania major 80s ribosome : snorna mutant 0.6669 93 128
4ce4-assembly1.cif.gz_Y 39s large subunit of the porcine mitochondrial ribosome 0.6047 114 135
4v3p-assembly1.cif.gz_SV the molecular structure of the left-handed supra-molecular helix of eukaryotic polyribosomes 0.4788 91 134
4gcv-assembly1.cif.gz_A structure of a putative transcription factor (pa1374)from pseudomonas aeruginosa 0.4705 77 128
ID Description Score Start End Superfamily
1w7pA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7693 98 130 1.10.10.10
af_G3XA30_282_372_2.20.70.10 Mainly Beta;Single Sheet;Ubiquitin Ligase Nedd4; Chain: W;; 0.5585 85 128 2.20.70.10
5d1pB03 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.5199 114 137 3.30.470.30
af_Q4CL09_91_139_3.30.30.30 Alpha Beta;2-Layer Sandwich;Defensin A-like; 0.5024 106 137 3.30.30.30
af_O94663_173_242_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.479 74 128 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1Q6XAZ9-F1-model_v4 Uncharacterized protein 0.9651 3 120
AF-A0A538BMM1-F1-model_v4 Uncharacterized protein 0.9532 4 90
AF-A0A1Q6XAZ9-F1-model_v4 Uncharacterized protein 0.9417 3 120
AF-A0A7V8YUX2-F1-model_v4 Uncharacterized protein 0.9364 1 135
AF-A0A7X7E639-F1-model_v4 Uncharacterized protein 0.9331 1 150

Feature Viewer

pLDDT pTM Quality
91.82 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map