F488567

General Info

Members Datasets Scaffolds Average Seq Length
1029 362 1029 127

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100104531|Ga0068856_1001045312
Length 137
Sequence MDKLDKSGTLPEVAAKLGIGAYHRHVFLCTGDKCCTAEVGAAAWDVLKRELKDRGLSLLTGPNACYRTKVNCLRICQGGPIAVVYPEGTWYSGLTAERIPLFVRQHLVEGRPVAEWVFADNPLPNPADEPPKTPGPG

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
189 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
194 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
195 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
196 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
209 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
210 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
211 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
213 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
215 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
216 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
217 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
218 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
219 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
220 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
221 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
222 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
223 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
224 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
233 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
234 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
235 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
236 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
237 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
238 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
239 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
240 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
241 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
242 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
243 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
244 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
251 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
254 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
255 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
256 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
257 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
258 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
259 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
260 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
261 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
262 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
263 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
264 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
265 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
266 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
267 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
268 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
269 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
270 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
271 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
272 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
273 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
274 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
275 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
278 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
279 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
280 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
281 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
282 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
283 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
284 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
285 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
286 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
287 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
288 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
289 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
290 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
291 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
292 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
293 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
294 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
295 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
296 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
297 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
298 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
301 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
302 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
303 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
304 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
305 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
306 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
318 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
319 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
320 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
321 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
322 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
323 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
324 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
325 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
326 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
327 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
328 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
329 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
330 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
331 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
333 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
334 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
335 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
336 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
337 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
338 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
339 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
340 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
341 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
342 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
343 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
344 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
345 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
346 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
347 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
348 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
349 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
350 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
351 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
352 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
353 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
354 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
355 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
356 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
357 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
358 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
359 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
360 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
361 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
362 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.14
Nodule 0
Rhizoplane 2.53
Rhizosphere 95.04
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10006594 3300002459 Bacteria 2366
2 JGI24751J29686_10052539 3300002459 Unclassified 840
3 JGI25406J46586_10000248 3300003203 Bacteria 24008
4 JGI25406J46586_10126970 3300003203 Bacteria 749
5 Ga0065714_10127719 3300005288 Unclassified 1279
6 Ga0065712_10001548 3300005290 Bacteria 12566
7 Ga0065712_10077635 3300005290 Bacteria 3464
8 Ga0065712_10079198 3300005290 Bacteria 3247
9 Ga0065712_10163377 3300005290 Bacteria 1288
10 Ga0065712_10683715 3300005290 Bacteria 553
11 Ga0065715_10018291 3300005293 Bacteria 3300
12 Ga0065715_10095978 3300005293 Bacteria 3966
13 Ga0065715_10172584 3300005293 Bacteria 1535
14 Ga0065715_10179017 3300005293 Unclassified 1490
15 Ga0065715_10548009 3300005293 Unclassified 743
16 Ga0065707_10506285 3300005295 Bacteria 750
17 Ga0065707_11101634 3300005295 Bacteria 504
18 Ga0070658_10848456 3300005327 Bacteria 794
19 Ga0070676_10155330 3300005328 Bacteria 1468
20 Ga0070676_10209847 3300005328 Bacteria 1281
21 Ga0070690_100004503 3300005330 Bacteria 7750
22 Ga0070690_100080496 3300005330 Bacteria 2131
23 Ga0070690_100536427 3300005330 Bacteria 880
24 Ga0070690_100674151 3300005330 Bacteria 792
25 Ga0070670_100014409 3300005331 Bacteria 6785
26 Ga0070670_102191482 3300005331 Bacteria 509
27 Ga0070677_10156520 3300005333 Bacteria 1065
28 Ga0070677_10280675 3300005333 Bacteria 839
29 Ga0068869_100179391 3300005334 Unclassified 1660
30 Ga0068869_100358559 3300005334 Bacteria 1190
31 Ga0068869_100426904 3300005334 Bacteria 1095
32 Ga0068869_101839424 3300005334 Bacteria 542
33 Ga0070666_10057567 3300005335 Bacteria 2627
34 Ga0070666_10305212 3300005335 Bacteria 1134
35 Ga0070666_10700490 3300005335 Bacteria 743
36 Ga0070666_10785532 3300005335 Bacteria 701
37 Ga0070666_10816782 3300005335 Bacteria 687
38 Ga0070680_100394798 3300005336 Bacteria 1179
39 Ga0070680_100446842 3300005336 Bacteria 1104
40 Ga0070680_100609710 3300005336 Unclassified 937
41 Ga0070680_101462553 3300005336 Unclassified 592
42 Ga0070682_100273060 3300005337 Bacteria 1229
43 Ga0070682_100787575 3300005337 Bacteria 771
44 Ga0070682_101998506 3300005337 Unclassified 510
45 Ga0068868_100105604 3300005338 Bacteria 2284
46 Ga0068868_100236938 3300005338 Bacteria 1532
47 Ga0070660_100056197 3300005339 Bacteria 3044
48 Ga0070660_100222973 3300005339 Bacteria 1533
49 Ga0070689_100074592 3300005340 Bacteria 2654
50 Ga0070689_101436049 3300005340 Bacteria 624
51 Ga0070691_10025543 3300005341 Bacteria 2750
52 Ga0070687_100213093 3300005343 Bacteria 1178
53 Ga0070687_100773152 3300005343 Unclassified 678
54 Ga0070692_10007969 3300005345 Bacteria 4699
55 Ga0070692_10061545 3300005345 Bacteria 1979
56 Ga0070692_10147036 3300005345 Unclassified 1339
57 Ga0070692_10229849 3300005345 Unclassified 1101
58 Ga0070692_10667186 3300005345 Unclassified 696
59 Ga0070692_11009642 3300005345 Bacteria 582
60 Ga0070668_100263317 3300005347 Bacteria 1434
61 Ga0070668_101208751 3300005347 Bacteria 685
62 Ga0070669_100003388 3300005353 Bacteria 11468
63 Ga0070669_100068286 3300005353 Bacteria 2624
64 Ga0070669_100132753 3300005353 Bacteria 1912
65 Ga0070669_100193748 3300005353 Bacteria 1595
66 Ga0070669_100297443 3300005353 Unclassified 1297
67 Ga0070669_100370309 3300005353 Unclassified 1167
68 Ga0070675_100000751 3300005354 Bacteria 22584
69 Ga0070675_100029068 3300005354 Bacteria 4455
70 Ga0070675_100058207 3300005354 Bacteria 3187
71 Ga0070675_100061685 3300005354 Bacteria 3096
72 Ga0070675_100065156 3300005354 Bacteria 3012
73 Ga0070675_100363005 3300005354 Bacteria 1286
74 Ga0070675_100475068 3300005354 Bacteria 1124
75 Ga0070675_100785606 3300005354 Bacteria 870
76 Ga0070671_100782237 3300005355 Bacteria 830
77 Ga0070671_101160985 3300005355 Unclassified 679
78 Ga0070674_100000091 3300005356 Bacteria 41986
79 Ga0070674_100004723 3300005356 Bacteria 7798
80 Ga0070674_100061123 3300005356 Bacteria 2628
81 Ga0070674_100976164 3300005356 Bacteria 742
82 Ga0070674_101006195 3300005356 Bacteria 732
83 Ga0070673_100064090 3300005364 Bacteria 2926
84 Ga0070673_100115693 3300005364 Bacteria 2230
85 Ga0070673_100119771 3300005364 Unclassified 2194
86 Ga0070673_100256640 3300005364 Unclassified 1526
87 Ga0070673_100413409 3300005364 Unclassified 1208
88 Ga0070688_100035670 3300005365 Bacteria 3022
89 Ga0070688_100764252 3300005365 Unclassified 753
90 Ga0070659_100064104 3300005366 Bacteria 2908
91 Ga0070659_100884994 3300005366 Bacteria 780
92 Ga0070659_101226091 3300005366 Unclassified 664
93 Ga0070667_102366990 3300005367 Bacteria 500
94 Ga0070703_10411627 3300005406 Bacteria 591
95 Ga0070709_10052217 3300005434 Unclassified 2568
96 Ga0070714_100052603 3300005435 Bacteria 3474
97 Ga0070713_100084183 3300005436 Bacteria 2720
98 Ga0070713_100920896 3300005436 Bacteria 841
99 Ga0070701_10013001 3300005438 Bacteria 3775
100 Ga0070701_10175578 3300005438 Bacteria 1250
101 Ga0070701_10278317 3300005438 Bacteria 1021
102 Ga0070701_10848691 3300005438 Bacteria 627
103 Ga0070711_100471901 3300005439 Bacteria 1030
104 Ga0070711_100526269 3300005439 Unclassified 978
105 Ga0070705_100001204 3300005440 Bacteria 14089
106 Ga0070705_100005883 3300005440 Bacteria 5996
107 Ga0070705_100143667 3300005440 Bacteria 1574
108 Ga0070705_100146809 3300005440 Bacteria 1559
109 Ga0070705_100268547 3300005440 Unclassified 1207
110 Ga0070705_101888596 3300005440 Bacteria 508
111 Ga0070700_100008279 3300005441 Bacteria 5659
112 Ga0070700_100206662 3300005441 Bacteria 1383
113 Ga0070700_100246215 3300005441 Bacteria 1280
114 Ga0070700_100280663 3300005441 Bacteria 1208
115 Ga0070700_100512674 3300005441 Bacteria 925
116 Ga0070700_100988232 3300005441 Unclassified 691
117 Ga0070700_101291097 3300005441 Bacteria 613
118 Ga0070694_100000199 3300005444 Bacteria 31924
119 Ga0070694_100001846 3300005444 Bacteria 12549
120 Ga0070694_100004226 3300005444 Bacteria 8637
121 Ga0070694_100113500 3300005444 Bacteria 1933
122 Ga0070694_100414031 3300005444 Bacteria 1058
123 Ga0070694_100488410 3300005444 Unclassified 978
124 Ga0070694_100878893 3300005444 Unclassified 739
125 Ga0070694_100907374 3300005444 Bacteria 728
126 Ga0070708_100260540 3300005445 Bacteria 1630
127 Ga0070708_100790962 3300005445 Bacteria 892
128 Ga0070708_101383389 3300005445 Unclassified 657
129 Ga0070663_101718454 3300005455 Bacteria 561
130 Ga0070678_100885776 3300005456 Bacteria 815
131 Ga0070678_101327445 3300005456 Bacteria 670
132 Ga0070662_100299493 3300005457 Unclassified 1306
133 Ga0070662_100483752 3300005457 Bacteria 1031
134 Ga0070662_100515026 3300005457 Bacteria 999
135 Ga0070662_100868438 3300005457 Bacteria 769
136 Ga0070662_101507269 3300005457 Bacteria 580
137 Ga0070662_101999921 3300005457 Bacteria 501
138 Ga0070681_10046585 3300005458 Unclassified 4335
139 Ga0070681_10163198 3300005458 Bacteria 2152
140 Ga0070681_10936329 3300005458 Bacteria 785
141 Ga0068867_100066459 3300005459 Bacteria 2686
142 Ga0068867_100098119 3300005459 Bacteria 2234
143 Ga0068867_100438783 3300005459 Bacteria 1110
144 Ga0070685_10000594 3300005466 Bacteria 20041
145 Ga0070685_10001074 3300005466 Bacteria 14636
146 Ga0070685_10066483 3300005466 Bacteria 2124
147 Ga0070706_100009661 3300005467 Bacteria 8969
148 Ga0070706_100286341 3300005467 Bacteria 1538
149 Ga0070706_100453045 3300005467 Bacteria 1194
150 Ga0070706_100753472 3300005467 Unclassified 902
151 Ga0070707_100048198 3300005468 Bacteria 4081
152 Ga0070707_100443789 3300005468 Unclassified 1258
153 Ga0070707_101321307 3300005468 Bacteria 687
154 Ga0070698_100003898 3300005471 Bacteria 16406
155 Ga0070698_100015144 3300005471 Bacteria 8153
156 Ga0070698_100035117 3300005471 Bacteria 5185
157 Ga0070698_100263705 3300005471 Bacteria 1655
158 Ga0070698_100698258 3300005471 Bacteria 956
159 Ga0070698_100855633 3300005471 Bacteria 854
160 Ga0070698_100885765 3300005471 Bacteria 838
161 Ga0070698_102045601 3300005471 Bacteria 526
162 Ga0070699_100000172 3300005518 Bacteria 62043
163 Ga0070699_100029044 3300005518 Bacteria 4767
164 Ga0070699_100044641 3300005518 Bacteria 3837
165 Ga0070699_100251862 3300005518 Unclassified 1578
166 Ga0070699_100670639 3300005518 Unclassified 947
167 Ga0070699_100691403 3300005518 Bacteria 932
168 Ga0070679_100269725 3300005530 Bacteria 1656
169 Ga0070679_100295033 3300005530 Bacteria 1572
170 Ga0070679_100639277 3300005530 Bacteria 1007
171 Ga0070679_101016677 3300005530 Bacteria 773
172 Ga0070697_100143099 3300005536 Bacteria 2012
173 Ga0070697_100309850 3300005536 Archaea 1358
174 Ga0070697_100434398 3300005536 Bacteria 1142
175 Ga0070697_100918821 3300005536 Unclassified 777
176 Ga0070697_101151830 3300005536 Bacteria 691
177 Ga0070697_101242850 3300005536 Bacteria 664
178 Ga0070697_101568853 3300005536 Bacteria 589
179 Ga0068853_102099929 3300005539 Unclassified 548
180 Ga0070672_100111434 3300005543 Bacteria 2231
181 Ga0070672_100221817 3300005543 Bacteria 1586
182 Ga0070672_101076358 3300005543 Unclassified 714
183 Ga0070686_100000502 3300005544 Bacteria 23516
184 Ga0070686_100048973 3300005544 Bacteria 2679
185 Ga0070686_100167695 3300005544 Bacteria 1551
186 Ga0070695_100000734 3300005545 Bacteria 17507
187 Ga0070695_100009912 3300005545 Bacteria 5677
188 Ga0070695_100019613 3300005545 Bacteria 4120
189 Ga0070695_100036742 3300005545 Bacteria 3083
190 Ga0070695_100405574 3300005545 Unclassified 1034
191 Ga0070695_100791193 3300005545 Bacteria 759
192 Ga0070696_100000175 3300005546 Bacteria 36851
193 Ga0070696_100008142 3300005546 Bacteria 7012
194 Ga0070696_100028771 3300005546 Bacteria 3792
195 Ga0070696_100028838 3300005546 Bacteria 3788
196 Ga0070696_100465175 3300005546 Bacteria 1000
197 Ga0070665_100000734 3300005548 Bacteria 43660
198 Ga0070665_100574112 3300005548 Bacteria 1140
199 Ga0070704_100001693 3300005549 Bacteria 12006
200 Ga0070704_100004420 3300005549 Bacteria 8119
201 Ga0070704_100010100 3300005549 Bacteria 5740
202 Ga0070704_100048652 3300005549 Bacteria 2969
203 Ga0070704_100095094 3300005549 Bacteria 2231
204 Ga0070704_100183958 3300005549 Bacteria 1674
205 Ga0070704_100567072 3300005549 Unclassified 994
206 Ga0070704_101256039 3300005549 Bacteria 677
207 Ga0070704_101290213 3300005549 Unclassified 668
208 Ga0070704_101294147 3300005549 Bacteria 667
209 Ga0070704_101359871 3300005549 Unclassified 651
210 Ga0068855_100029227 3300005563 Bacteria 6592
211 Ga0068855_100108401 3300005563 Unclassified 3190
212 Ga0068855_101854580 3300005563 Bacteria 612
213 Ga0068855_102177151 3300005563 Bacteria 557
214 Ga0070664_100020626 3300005564 Bacteria 5428
215 Ga0070664_100319159 3300005564 Unclassified 1407
216 Ga0068857_100260748 3300005577 Bacteria 1591
217 Ga0068857_101560764 3300005577 Unclassified 644
218 Ga0068857_102498385 3300005577 Bacteria 507
219 Ga0068854_100126345 3300005578 Unclassified 1948
220 Ga0068854_100497605 3300005578 Bacteria 1026
221 Ga0068854_101292596 3300005578 Unclassified 656
222 Ga0068856_100104531 3300005614 Bacteria 2826
223 Ga0068856_102240776 3300005614 Bacteria 555
224 Ga0070702_100000625 3300005615 Bacteria 13043
225 Ga0070702_100010911 3300005615 Bacteria 4498
226 Ga0070702_100225134 3300005615 Bacteria 1257
227 Ga0068852_100223378 3300005616 Bacteria 1792
228 Ga0068852_100584081 3300005616 Unclassified 1120
229 Ga0068859_100000008 3300005617 Bacteria 383750
230 Ga0068859_100006458 3300005617 Bacteria 11893
231 Ga0068859_100006797 3300005617 Bacteria 11624
232 Ga0068859_100093941 3300005617 Unclassified 3051
233 Ga0068859_100109529 3300005617 Bacteria 2823
234 Ga0068859_100401093 3300005617 Bacteria 1467
235 Ga0068859_100466709 3300005617 Unclassified 1358
236 Ga0068859_100532814 3300005617 Unclassified 1269
237 Ga0068859_100948359 3300005617 Bacteria 944
238 Ga0068859_101778746 3300005617 Bacteria 681
239 Ga0068864_100010624 3300005618 Bacteria 7609
240 Ga0068864_100091080 3300005618 Bacteria 2689
241 Ga0068864_100404833 3300005618 Bacteria 1297
242 Ga0068864_102206686 3300005618 Unclassified 557
243 Ga0068866_10538031 3300005718 Unclassified 779
244 Ga0068866_11006828 3300005718 Bacteria 592
245 Ga0068861_100001159 3300005719 Bacteria 16417
246 Ga0068861_100004292 3300005719 Bacteria 9564
247 Ga0068861_100028621 3300005719 Bacteria 4067
248 Ga0068861_100044659 3300005719 Bacteria 3333
249 Ga0068861_100154551 3300005719 Bacteria 1886
250 Ga0068861_100260019 3300005719 Unclassified 1486
251 Ga0068861_100302041 3300005719 Bacteria 1387
252 Ga0068861_100647014 3300005719 Unclassified 976
253 Ga0068861_101154897 3300005719 Bacteria 747
254 Ga0068861_101693108 3300005719 Bacteria 625
255 Ga0068851_10137939 3300005834 Bacteria 1324
256 Ga0068851_10429922 3300005834 Bacteria 781
257 Ga0068870_10154125 3300005840 Unclassified 1356
258 Ga0068870_10392479 3300005840 Unclassified 901
259 Ga0068863_100073259 3300005841 Bacteria 3240
260 Ga0068863_100237071 3300005841 Bacteria 1761
261 Ga0068863_100295672 3300005841 Bacteria 1570
262 Ga0068863_100521966 3300005841 Unclassified 1171
263 Ga0068863_100639108 3300005841 Bacteria 1055
264 Ga0068863_100895698 3300005841 Unclassified 887
265 Ga0068858_100010813 3300005842 Bacteria 8628
266 Ga0068858_100018287 3300005842 Bacteria 6562
267 Ga0068858_100049229 3300005842 Bacteria 3903
268 Ga0068858_100119856 3300005842 Unclassified 2460
269 Ga0068858_100241085 3300005842 Bacteria 1716
270 Ga0068858_101580208 3300005842 Bacteria 647
271 Ga0068860_100059006 3300005843 Bacteria 3649
272 Ga0068860_100119367 3300005843 Bacteria 2524
273 Ga0068860_100137849 3300005843 Bacteria 2344
274 Ga0068860_100182395 3300005843 Bacteria 2029
275 Ga0068860_100257094 3300005843 Bacteria 1702
276 Ga0068860_100403694 3300005843 Bacteria 1352
277 Ga0068860_101870211 3300005843 Unclassified 622
278 Ga0068860_102063357 3300005843 Bacteria 591
279 Ga0068860_102254153 3300005843 Bacteria 565
280 Ga0068862_100026207 3300005844 Bacteria 4900
281 Ga0068862_100064665 3300005844 Bacteria 3149
282 Ga0068862_101490565 3300005844 Unclassified 682
283 Ga0068862_101534607 3300005844 Bacteria 672
284 Ga0081455_10056302 3300005937 Unclassified 3340
285 Ga0081539_10000090 3300005985 Bacteria 212006
286 Ga0081539_10000649 3300005985 Bacteria 69909
287 Ga0081539_10005585 3300005985 Bacteria 12705
288 Ga0070717_10672534 3300006028 Bacteria 940
289 Ga0070717_10722868 3300006028 Bacteria 905
290 Ga0075368_10053612 3300006042 Bacteria 1606
291 Ga0075363_100330301 3300006048 Bacteria 888
292 Ga0075364_10063700 3300006051 Bacteria 2421
293 Ga0070715_10017875 3300006163 Bacteria 2691
294 Ga0070715_10158890 3300006163 Bacteria 1115
295 Ga0070716_100106522 3300006173 Unclassified 1729
296 Ga0070716_100338310 3300006173 Unclassified 1061
297 Ga0070712_100547834 3300006175 Bacteria 974
298 Ga0075367_10038545 3300006178 Bacteria 2782
299 Ga0075366_10079063 3300006195 Bacteria 1963
300 Ga0075366_10647477 3300006195 Unclassified 656
301 Ga0097621_100005878 3300006237 Bacteria 8668
302 Ga0097621_100026029 3300006237 Bacteria 4584
303 Ga0097621_100040163 3300006237 Bacteria 3761
304 Ga0097621_100100709 3300006237 Bacteria 2430
305 Ga0097621_100154032 3300006237 Bacteria 1972
306 Ga0097621_100754788 3300006237 Bacteria 899
307 Ga0097621_100759185 3300006237 Unclassified 896
308 Ga0097621_101034887 3300006237 Bacteria 769
309 Ga0097621_101176887 3300006237 Unclassified 722
310 Ga0068871_100000602 3300006358 Bacteria 24717
311 Ga0068871_100251826 3300006358 Bacteria 1538
312 Ga0068871_100306734 3300006358 Bacteria 1395
313 Ga0075428_100000034 3300006844 Bacteria 115982
314 Ga0075428_100015342 3300006844 Bacteria 8496
315 Ga0075428_100019087 3300006844 Bacteria 7582
316 Ga0075428_100023619 3300006844 Bacteria 6806
317 Ga0075428_100058014 3300006844 Bacteria 4238
318 Ga0075428_100068181 3300006844 Bacteria 3892
319 Ga0075428_100083818 3300006844 Bacteria 3478
320 Ga0075430_100004097 3300006846 Bacteria 12298
321 Ga0075430_100012800 3300006846 Bacteria 7147
322 Ga0075430_100174248 3300006846 Unclassified 1790
323 Ga0075430_100311079 3300006846 Bacteria 1303
324 Ga0075430_100412544 3300006846 Bacteria 1115
325 Ga0075431_100025373 3300006847 Bacteria 6076
326 Ga0075431_100032521 3300006847 Bacteria 5375
327 Ga0075431_100072066 3300006847 Bacteria 3565
328 Ga0075431_100075412 3300006847 Unclassified 3480
329 Ga0075431_100631749 3300006847 Bacteria 1052
330 Ga0075431_100905560 3300006847 Bacteria 851
331 Ga0075431_101630017 3300006847 Bacteria 603
332 Ga0075433_10051253 3300006852 Bacteria 3594
333 Ga0075433_10059425 3300006852 Unclassified 3345
334 Ga0075433_10069622 3300006852 Bacteria 3090
335 Ga0075433_10104324 3300006852 Bacteria 2512
336 Ga0075433_10164534 3300006852 Bacteria 1974
337 Ga0075433_10337038 3300006852 Unclassified 1333
338 Ga0075433_10380038 3300006852 Bacteria 1247
339 Ga0075433_10397966 3300006852 Unclassified 1215
340 Ga0075433_10569701 3300006852 Bacteria 995
341 Ga0075433_11086375 3300006852 Unclassified 696
342 Ga0075434_100044278 3300006871 Bacteria 4415
343 Ga0075434_100058856 3300006871 Bacteria 3819
344 Ga0075434_100064759 3300006871 Bacteria 3640
345 Ga0075434_100097090 3300006871 Bacteria 2951
346 Ga0075434_100105006 3300006871 Unclassified 2835
347 Ga0075434_100197349 3300006871 Bacteria 2032
348 Ga0075434_101589033 3300006871 Bacteria 662
349 Ga0075429_100022058 3300006880 Bacteria 5522
350 Ga0075429_100031390 3300006880 Bacteria 4616
351 Ga0075429_100038481 3300006880 Bacteria 4164
352 Ga0075429_100039747 3300006880 Bacteria 4094
353 Ga0075429_100129403 3300006880 Bacteria 2208
354 Ga0075429_100199037 3300006880 Bacteria 1755
355 Ga0075429_100236033 3300006880 Bacteria 1602
356 Ga0075429_100605818 3300006880 Bacteria 960
357 Ga0075429_100970906 3300006880 Bacteria 743
358 Ga0075429_100984728 3300006880 Bacteria 737
359 Ga0075429_101507501 3300006880 Unclassified 585
360 Ga0075429_101759165 3300006880 Bacteria 538
361 Ga0068865_100143856 3300006881 Bacteria 1801
362 Ga0068865_100153523 3300006881 Bacteria 1749
363 Ga0068865_100708334 3300006881 Unclassified 861
364 Ga0075436_100002680 3300006914 Bacteria 12249
365 Ga0075436_100034208 3300006914 Bacteria 3504
366 Ga0075436_100035265 3300006914 Bacteria 3452
367 Ga0075436_100212250 3300006914 Unclassified 1372
368 Ga0097620_100000008 3300006931 Bacteria 383750
369 Ga0097620_100006458 3300006931 Bacteria 11893
370 Ga0097620_100006797 3300006931 Bacteria 11624
371 Ga0097620_100093938 3300006931 Unclassified 3051
372 Ga0097620_100109528 3300006931 Bacteria 2823
373 Ga0097620_100296245 3300006931 Bacteria 1711
374 Ga0097620_100401074 3300006931 Bacteria 1467
375 Ga0097620_100466733 3300006931 Unclassified 1358
376 Ga0097620_100532784 3300006931 Unclassified 1269
377 Ga0097620_100948153 3300006931 Bacteria 944
378 Ga0097620_101778745 3300006931 Bacteria 681
379 Ga0075435_100000698 3300007076 Bacteria 20815
380 Ga0075435_100009571 3300007076 Bacteria 7029
381 Ga0075435_100056808 3300007076 Bacteria 3164
382 Ga0075435_100072244 3300007076 Bacteria 2818
383 Ga0075435_100111403 3300007076 Bacteria 2277
384 Ga0075435_100900372 3300007076 Bacteria 771
385 Ga0075435_101309132 3300007076 Bacteria 635
386 Ga0075435_101963055 3300007076 Unclassified 514
387 Ga0105240_10006149 3300009093 Bacteria 17704
388 Ga0105240_10093322 3300009093 Bacteria 3674
389 Ga0105240_10143693 3300009093 Bacteria 2850
390 Ga0111539_10000014 3300009094 Bacteria 307501
391 Ga0111539_10000556 3300009094 Bacteria 47801
392 Ga0111539_10000736 3300009094 Bacteria 42606
393 Ga0111539_10000850 3300009094 Bacteria 39822
394 Ga0111539_10015286 3300009094 Bacteria 9561
395 Ga0111539_10078739 3300009094 Bacteria 3877
396 Ga0111539_10303238 3300009094 Unclassified 1859
397 Ga0111539_10754590 3300009094 Bacteria 1132
398 Ga0111539_11479312 3300009094 Bacteria 788
399 Ga0105245_11212716 3300009098 Unclassified 802
400 Ga0105245_11346693 3300009098 Unclassified 763
401 Ga0105247_10017021 3300009101 Bacteria 4362
402 Ga0105247_10037495 3300009101 Bacteria 2958
403 Ga0105247_10039681 3300009101 Unclassified 2876
404 Ga0105247_10217180 3300009101 Bacteria 1292
405 Ga0105247_10369425 3300009101 Bacteria 1014
406 Ga0105247_10941423 3300009101 Bacteria 670
407 Ga0114129_10001136 3300009147 Bacteria 35167
408 Ga0114129_10001786 3300009147 Bacteria 29296
409 Ga0114129_10003695 3300009147 Bacteria 21549
410 Ga0114129_10003962 3300009147 Bacteria 20914
411 Ga0114129_10028396 3300009147 Bacteria 7928
412 Ga0114129_10034877 3300009147 Bacteria 7108
413 Ga0114129_10063645 3300009147 Bacteria 5149
414 Ga0114129_10095887 3300009147 Bacteria 4108
415 Ga0114129_10105734 3300009147 Bacteria 3889
416 Ga0114129_10156623 3300009147 Bacteria 3114
417 Ga0114129_10240663 3300009147 Bacteria 2433
418 Ga0114129_10303454 3300009147 Unclassified 2127
419 Ga0114129_10464335 3300009147 Bacteria 1659
420 Ga0114129_10644141 3300009147 Bacteria 1368
421 Ga0114129_11317187 3300009147 Bacteria 894
422 Ga0114129_12059081 3300009147 Bacteria 689
423 Ga0114129_12835565 3300009147 Unclassified 575
424 Ga0105243_10155273 3300009148 Bacteria 1967
425 Ga0105243_10620224 3300009148 Bacteria 1044
426 Ga0105243_10632052 3300009148 Unclassified 1035
427 Ga0105241_10047313 3300009174 Bacteria 3271
428 Ga0105241_10381023 3300009174 Unclassified 1232
429 Ga0105241_10680023 3300009174 Unclassified 937
430 Ga0105242_10004812 3300009176 Bacteria 10448
431 Ga0105242_10292282 3300009176 Bacteria 1484
432 Ga0105242_10395084 3300009176 Bacteria 1289
433 Ga0105242_11026511 3300009176 Bacteria 834
434 Ga0105242_11051655 3300009176 Unclassified 825
435 Ga0105242_11444150 3300009176 Bacteria 717
436 Ga0105242_11473318 3300009176 Bacteria 710
437 Ga0105248_10008693 3300009177 Bacteria 11159
438 Ga0105248_10051306 3300009177 Bacteria 4629
439 Ga0105248_10254620 3300009177 Bacteria 1976
440 Ga0105248_10299874 3300009177 Bacteria 1809
441 Ga0105248_10424999 3300009177 Bacteria 1496
442 Ga0105248_10472716 3300009177 Bacteria 1413
443 Ga0105248_10511882 3300009177 Bacteria 1353
444 Ga0105248_10726233 3300009177 Bacteria 1121
445 Ga0105248_10797074 3300009177 Bacteria 1066
446 Ga0105248_12047897 3300009177 Bacteria 651
447 Ga0105248_12123984 3300009177 Bacteria 639
448 Ga0105248_12177349 3300009177 Unclassified 631
449 Ga0105237_10547776 3300009545 Bacteria 1163
450 Ga0105237_10791424 3300009545 Bacteria 955
451 Ga0105237_12258382 3300009545 Unclassified 554
452 Ga0105238_10247606 3300009551 Bacteria 1760
453 Ga0105238_10567153 3300009551 Bacteria 1141
454 Ga0105238_12618648 3300009551 Bacteria 541
455 Ga0105238_12775976 3300009551 Bacteria 526
456 Ga0105249_10099145 3300009553 Bacteria 2738
457 Ga0105249_10144827 3300009553 Bacteria 2281
458 Ga0105249_10446545 3300009553 Bacteria 1331
459 Ga0105249_10891252 3300009553 Bacteria 956
460 Ga0105249_10945030 3300009553 Bacteria 930
461 Ga0105249_11504478 3300009553 Bacteria 745
462 Ga0105239_12294227 3300010375 Bacteria 628
463 Ga0105246_10339378 3300011119 Bacteria 1227
464 Ga0105246_10451649 3300011119 Bacteria 1080
465 Ga0105246_11095589 3300011119 Unclassified 727
466 Ga0157373_10667413 3300013100 Bacteria 760
467 Ga0157369_11833230 3300013105 Unclassified 616
468 Ga0157374_10008967 3300013296 Bacteria 8573
469 Ga0157374_10592825 3300013296 Unclassified 1118
470 Ga0157378_10311311 3300013297 Bacteria 1527
471 Ga0157378_10841609 3300013297 Bacteria 945
472 Ga0163162_10974178 3300013306 Bacteria 958
473 Ga0163162_11728544 3300013306 Bacteria 715
474 Ga0157372_10465805 3300013307 Bacteria 1473
475 Ga0157372_10653397 3300013307 Unclassified 1224
476 Ga0157375_10304377 3300013308 Bacteria 1758
477 Ga0157375_10308011 3300013308 Bacteria 1748
478 Ga0157375_10500284 3300013308 Unclassified 1379
479 Ga0157375_10537265 3300013308 Bacteria 1332
480 Ga0157375_10966561 3300013308 Unclassified 993
481 Ga0163163_10013902 3300014325 Bacteria 7383
482 Ga0163163_10026560 3300014325 Bacteria 5537
483 Ga0163163_10026633 3300014325 Bacteria 5530
484 Ga0163163_10106347 3300014325 Bacteria 2832
485 Ga0163163_10145562 3300014325 Bacteria 2413
486 Ga0157380_10001120 3300014326 Bacteria 17286
487 Ga0157380_10045494 3300014326 Bacteria 3444
488 Ga0157380_10051365 3300014326 Bacteria 3261
489 Ga0157380_10067340 3300014326 Bacteria 2883
490 Ga0157380_10153171 3300014326 Bacteria 1995
491 Ga0157380_10161020 3300014326 Bacteria 1950
492 Ga0157379_10012857 3300014968 Bacteria 7320
493 Ga0157379_10051258 3300014968 Bacteria 3686
494 Ga0157379_10279199 3300014968 Bacteria 1520
495 Ga0157379_10289830 3300014968 Bacteria 1491
496 Ga0157379_10331196 3300014968 Bacteria 1391
497 Ga0157379_10419308 3300014968 Unclassified 1232
498 Ga0157379_12090542 3300014968 Unclassified 561
499 Ga0157376_10123596 3300014969 Bacteria 2298
500 Ga0157376_10169760 3300014969 Bacteria 1985
501 Ga0157376_10177326 3300014969 Unclassified 1945
502 Ga0157376_10353454 3300014969 Bacteria 1407
503 Ga0163161_10318839 3300017792 Bacteria 1228
504 Ga0207697_10038545 3300025315 Bacteria 1960
505 Ga0207656_10297123 3300025321 Unclassified 799
506 Ga0207653_10078964 3300025885 Bacteria 1136
507 Ga0207682_10007672 3300025893 Bacteria 4294
508 Ga0207692_10436519 3300025898 Bacteria 822
509 Ga0207642_10098183 3300025899 Bacteria 1464
510 Ga0207710_10027842 3300025900 Unclassified 2451
511 Ga0207688_10478104 3300025901 Bacteria 779
512 Ga0207680_10094918 3300025903 Bacteria 1905
513 Ga0207685_10182534 3300025905 Bacteria 974
514 Ga0207699_10044251 3300025906 Bacteria 2591
515 Ga0207645_10004409 3300025907 Bacteria 10419
516 Ga0207645_10030979 3300025907 Bacteria 3445
517 Ga0207645_10092452 3300025907 Bacteria 1946
518 Ga0207645_10102441 3300025907 Bacteria 1848
519 Ga0207645_10126660 3300025907 Unclassified 1660
520 Ga0207643_10213277 3300025908 Bacteria 1179
521 Ga0207643_10363404 3300025908 Unclassified 910
522 Ga0207705_10118300 3300025909 Bacteria 1964
523 Ga0207684_10008764 3300025910 Bacteria 8980
524 Ga0207684_10595146 3300025910 Unclassified 945
525 Ga0207684_10887641 3300025910 Unclassified 750
526 Ga0207654_10731068 3300025911 Unclassified 712
527 Ga0207707_10026199 3300025912 Bacteria 5097
528 Ga0207707_10036682 3300025912 Bacteria 4285
529 Ga0207707_10927489 3300025912 Unclassified 718
530 Ga0207695_10133316 3300025913 Unclassified 2440
531 Ga0207695_10455243 3300025913 Bacteria 1163
532 Ga0207671_10391763 3300025914 Bacteria 1104
533 Ga0207671_10845904 3300025914 Unclassified 724
534 Ga0207693_10510436 3300025915 Bacteria 938
535 Ga0207663_10822571 3300025916 Bacteria 740
536 Ga0207663_10897576 3300025916 Unclassified 708
537 Ga0207660_10276408 3300025917 Bacteria 1332
538 Ga0207660_10281074 3300025917 Bacteria 1321
539 Ga0207660_10825420 3300025917 Bacteria 757
540 Ga0207660_10955996 3300025917 Unclassified 699
541 Ga0207660_11397061 3300025917 Unclassified 567
542 Ga0207662_10043871 3300025918 Unclassified 2639
543 Ga0207662_10510275 3300025918 Unclassified 829
544 Ga0207657_10140279 3300025919 Bacteria 1975
545 Ga0207657_10342007 3300025919 Unclassified 1181
546 Ga0207657_10524204 3300025919 Bacteria 927
547 Ga0207649_10306477 3300025920 Bacteria 1163
548 Ga0207649_11089690 3300025920 Bacteria 630
549 Ga0207652_10049212 3300025921 Unclassified 3607
550 Ga0207652_10099452 3300025921 Bacteria 2566
551 Ga0207652_10592423 3300025921 Bacteria 995
552 Ga0207652_11075327 3300025921 Bacteria 704
553 Ga0207652_11111077 3300025921 Bacteria 691
554 Ga0207646_10189461 3300025922 Bacteria 1857
555 Ga0207681_10015905 3300025923 Bacteria 4697
556 Ga0207681_10046170 3300025923 Bacteria 2929
557 Ga0207681_10057138 3300025923 Bacteria 2665
558 Ga0207681_10089547 3300025923 Bacteria 2194
559 Ga0207681_10266637 3300025923 Unclassified 1343
560 Ga0207681_10362062 3300025923 Unclassified 1163
561 Ga0207681_10917123 3300025923 Bacteria 734
562 Ga0207681_11293354 3300025923 Unclassified 612
563 Ga0207694_10921567 3300025924 Bacteria 739
564 Ga0207650_10001357 3300025925 Bacteria 17665
565 Ga0207650_10009031 3300025925 Bacteria 6815
566 Ga0207650_10863256 3300025925 Unclassified 768
567 Ga0207659_10001326 3300025926 Bacteria 14790
568 Ga0207659_10001674 3300025926 Bacteria 13173
569 Ga0207659_10078583 3300025926 Bacteria 2431
570 Ga0207659_10210421 3300025926 Bacteria 1558
571 Ga0207659_10236618 3300025926 Unclassified 1475
572 Ga0207659_10247927 3300025926 Bacteria 1444
573 Ga0207659_10310605 3300025926 Bacteria 1298
574 Ga0207700_10727148 3300025928 Bacteria 887
575 Ga0207644_10198864 3300025931 Bacteria 1580
576 Ga0207690_10340718 3300025932 Bacteria 1183
577 Ga0207690_11396297 3300025932 Bacteria 586
578 Ga0207706_10006351 3300025933 Bacteria 10981
579 Ga0207706_10287602 3300025933 Bacteria 1433
580 Ga0207706_10672061 3300025933 Unclassified 886
581 Ga0207686_10021245 3300025934 Bacteria 3722
582 Ga0207670_10512921 3300025936 Bacteria 975
583 Ga0207670_10934535 3300025936 Bacteria 727
584 Ga0207669_10009114 3300025937 Bacteria 4707
585 Ga0207669_10084560 3300025937 Bacteria 2045
586 Ga0207669_10310856 3300025937 Bacteria 1202
587 Ga0207669_10749921 3300025937 Unclassified 806
588 Ga0207669_11148462 3300025937 Bacteria 657
589 Ga0207704_10029133 3300025938 Bacteria 3074
590 Ga0207704_10172031 3300025938 Bacteria 1555
591 Ga0207704_10594861 3300025938 Unclassified 905
592 Ga0207704_11092153 3300025938 Unclassified 678
593 Ga0207665_10230644 3300025939 Bacteria 1360
594 Ga0207691_10136581 3300025940 Bacteria 2162
595 Ga0207691_10385754 3300025940 Bacteria 1196
596 Ga0207711_10042075 3300025941 Bacteria 3892
597 Ga0207711_10570936 3300025941 Bacteria 1055
598 Ga0207711_10603451 3300025941 Bacteria 1024
599 Ga0207711_10646907 3300025941 Unclassified 986
600 Ga0207711_10819025 3300025941 Bacteria 867
601 Ga0207711_11365127 3300025941 Bacteria 651
602 Ga0207711_11730472 3300025941 Bacteria 568
603 Ga0207689_10126295 3300025942 Bacteria 2104
604 Ga0207689_10168743 3300025942 Bacteria 1803
605 Ga0207689_10270130 3300025942 Bacteria 1408
606 Ga0207689_10599422 3300025942 Bacteria 927
607 Ga0207689_11405692 3300025942 Bacteria 585
608 Ga0207679_10024525 3300025945 Bacteria 4136
609 Ga0207667_10273595 3300025949 Bacteria 1726
610 Ga0207667_11668369 3300025949 Bacteria 605
611 Ga0207651_10008548 3300025960 Bacteria 5536
612 Ga0207651_10077267 3300025960 Bacteria 2383
613 Ga0207651_10646127 3300025960 Bacteria 928
614 Ga0207712_10068046 3300025961 Bacteria 2550
615 Ga0207712_10942657 3300025961 Bacteria 764
616 Ga0207668_10073257 3300025972 Bacteria 2454
617 Ga0207668_10100658 3300025972 Bacteria 2147
618 Ga0207677_10362046 3300026023 Bacteria 1219
619 Ga0207677_10987358 3300026023 Bacteria 763
620 Ga0207703_10081327 3300026035 Bacteria 2700
621 Ga0207703_10236208 3300026035 Bacteria 1641
622 Ga0207703_10325234 3300026035 Bacteria 1409
623 Ga0207703_10711778 3300026035 Bacteria 955
624 Ga0207703_11768276 3300026035 Unclassified 594
625 Ga0207639_11476274 3300026041 Bacteria 638
626 Ga0207678_11383117 3300026067 Bacteria 622
627 Ga0207708_10006212 3300026075 Bacteria 8854
628 Ga0207708_10086421 3300026075 Bacteria 2413
629 Ga0207708_10116810 3300026075 Bacteria 2076
630 Ga0207708_10228303 3300026075 Bacteria 1494
631 Ga0207708_10400095 3300026075 Bacteria 1135
632 Ga0207708_10402365 3300026075 Unclassified 1132
633 Ga0207708_10606101 3300026075 Bacteria 928
634 Ga0207708_10731554 3300026075 Bacteria 848
635 Ga0207708_11210787 3300026075 Bacteria 660
636 Ga0207702_10575086 3300026078 Bacteria 1104
637 Ga0207702_11056544 3300026078 Bacteria 806
638 Ga0207641_10147915 3300026088 Bacteria 2126
639 Ga0207641_10217180 3300026088 Bacteria 1771
640 Ga0207641_10376796 3300026088 Bacteria 1358
641 Ga0207641_10521286 3300026088 Bacteria 1156
642 Ga0207641_11344892 3300026088 Bacteria 715
643 Ga0207648_10089858 3300026089 Bacteria 2684
644 Ga0207648_10134346 3300026089 Bacteria 2178
645 Ga0207648_10380901 3300026089 Unclassified 1275
646 Ga0207676_10036492 3300026095 Bacteria 3740
647 Ga0207676_11880085 3300026095 Bacteria 597
648 Ga0207676_11915693 3300026095 Unclassified 591
649 Ga0207674_10103741 3300026116 Bacteria 2822
650 Ga0207674_10375909 3300026116 Bacteria 1373
651 Ga0207674_10630925 3300026116 Unclassified 1035
652 Ga0207674_10632100 3300026116 Unclassified 1034
653 Ga0207674_11524729 3300026116 Unclassified 637
654 Ga0207675_100001984 3300026118 Bacteria 20408
655 Ga0207675_100002093 3300026118 Bacteria 19819
656 Ga0207675_100039599 3300026118 Bacteria 4399
657 Ga0207675_100107470 3300026118 Bacteria 2631
658 Ga0207675_100426787 3300026118 Bacteria 1310
659 Ga0207675_101361243 3300026118 Unclassified 730
660 Ga0207683_10714932 3300026121 Bacteria 929
661 Ga0207698_10196373 3300026142 Bacteria 1803
662 Ga0210000_1069327 3300027462 Unclassified 574
663 Ga0209813_10217466 3300027866 Bacteria 714
664 Ga0207428_10000005 3300027907 Bacteria 520045
665 Ga0207428_10010580 3300027907 Bacteria 8232
666 Ga0207428_10338042 3300027907 Bacteria 1109
667 Ga0207428_10365403 3300027907 Bacteria 1060
668 Ga0268266_10011577 3300028379 Bacteria 7658
669 Ga0268265_10028514 3300028380 Bacteria 3997
670 Ga0268265_10241827 3300028380 Bacteria 1593
671 Ga0268265_10458522 3300028380 Bacteria 1192
672 Ga0268265_10820668 3300028380 Bacteria 908
673 Ga0268265_10912867 3300028380 Bacteria 863
674 Ga0268264_10056317 3300028381 Bacteria 3287
675 Ga0268264_10771695 3300028381 Bacteria 959
676 Ga0268264_10806797 3300028381 Bacteria 938
677 Ga0268264_10827074 3300028381 Bacteria 926
678 Ga0268264_11384091 3300028381 Bacteria 714
679 Ga0265338_10070820 3300028800 Bacteria 2987
680 Ga0265324_10000538 3300029957 Bacteria 25978
681 Ga0265325_10039062 3300031241 Bacteria 2501
682 Ga0265339_10000120 3300031249 Bacteria 64460
683 Ga0307408_100988936 3300031548 Unclassified 775
684 Ga0307408_101142503 3300031548 Bacteria 724
685 Ga0265313_10009483 3300031595 Bacteria 6315
686 Ga0307405_10037889 3300031731 Unclassified 2902
687 Ga0307413_10435117 3300031824 Bacteria 1037
688 Ga0307413_11420431 3300031824 Unclassified 611
689 Ga0307410_10035658 3300031852 Bacteria 3233
690 Ga0307410_10259844 3300031852 Unclassified 1354
691 Ga0307406_10387113 3300031901 Bacteria 1104
692 Ga0307407_10107635 3300031903 Unclassified 1744
693 Ga0307416_100170863 3300032002 Unclassified 2023
694 Ga0307416_102505290 3300032002 Bacteria 614
695 Ga0307414_11389598 3300032004 Bacteria 652
696 Ga0307411_10039398 3300032005 Bacteria 2989
697 Ga0307411_10145071 3300032005 Unclassified 1756
698 Ga0307411_10523133 3300032005 Unclassified 1007
699 Ga0307411_10682661 3300032005 Unclassified 893
700 Ga0307411_11606139 3300032005 Bacteria 600
701 Ga0307415_100085752 3300032126 Unclassified 2264
702 Ga0307415_100476789 3300032126 Bacteria 1085
703 Ga0373959_0000033 3300034820 Bacteria 30368
704 Ga0373938_0050918 3300034957 Bacteria 946
705 Ga0373934_0342087 3300035086 Bacteria 622
706 Ga0373923_0017689 3300035111 Unclassified 2730
707 Ga0373932_0101387 3300035112 Bacteria 937
708 Ga0373936_0295020 3300035113 Bacteria 731
709 Ga0373939_0218076 3300035114 Bacteria 729
710 Ga0373945_0029110 3300035116 Bacteria 1939
711 Ga0373953_0088554 3300035117 Bacteria 1293
712 Ga0373953_0476259 3300035117 Unclassified 553
713 Ga0373954_0279309 3300035118 Unclassified 823
714 Ga0373954_0564195 3300035118 Bacteria 564
715 Ga0373956_0021764 3300035119 Bacteria 2737
716 Ga0373956_0124247 3300035119 Unclassified 1206
717 Ga0373956_0283840 3300035119 Bacteria 788
718 Ga0373957_0144152 3300035120 Bacteria 975
719 Ga0373957_0252072 3300035120 Bacteria 743
720 Ga0373943_0023781 3300035170 Bacteria 2851
721 Ga0373946_0243773 3300035171 Bacteria 875
722 Ga0373946_0301340 3300035171 Bacteria 792
723 Ga0373955_0133041 3300035172 Bacteria 1453
724 Ga0373955_0140934 3300035172 Bacteria 1414
725 Ga0373955_0189045 3300035172 Bacteria 1224
726 Ga0373955_0229437 3300035172 Bacteria 1110
727 Ga0373955_0261993 3300035172 Archaea 1038
728 Ga0373955_0411331 3300035172 Bacteria 822
729 Ga0373955_0589039 3300035172 Unclassified 681
730 Ga0373955_0778766 3300035172 Unclassified 588
731 Ga0373942_0084394 3300035207 Unclassified 948
732 Ga0373924_0013649 3300035410 Bacteria 3055
733 Ga0373924_0399003 3300035410 Bacteria 615
734 Ga0373931_0521377 3300035691 Unclassified 769
735 Ga0373935_0058303 3300035692 Bacteria 2466
736 Ga0373935_0587622 3300035692 Unclassified 814
737 Ga0373935_0899219 3300035692 Unclassified 656
738 Ga0373927_0199571 3300035695 Unclassified 1313
739 Ga0373927_0391430 3300035695 Unclassified 917
740 Ga0373933_0139824 3300035724 Unclassified 1528
741 Ga0373933_0207445 3300035724 Bacteria 1255
742 Ga0373947_0034582 3300035725 Unclassified 2989
743 Ga0373947_0917258 3300035725 Bacteria 598
744 Ga0373937_0154959 3300036401 Bacteria 2147
745 Ga0373937_0303068 3300036401 Unclassified 1510
746 Ga0373937_0758928 3300036401 Bacteria 917
747 Ga0373937_1203240 3300036401 Bacteria 706
748 Ga0373937_1511974 3300036401 Bacteria 619
749 Ga0373925_0035857 3300037068 Unclassified 3661
750 Ga0373925_0304817 3300037068 Bacteria 1287
751 Ga0373925_1281841 3300037068 Bacteria 601
752 Ga0436364_1424755 3300037853 Bacteria 1674
753 Ga0436365_0298694 3300039437 Bacteria 500
754 Ga0436360_0085243 3300039438 Unclassified 588
755 Ga0436360_0188929 3300039438 Unclassified 602
756 Ga0436360_0945317 3300039438 Unclassified 1185
757 Ga0436363_1164207 3300039450 Bacteria 783
758 Ga0436362_1222382 3300039453 Unclassified 837
759 Ga0439431_0027667 3300041997 Unclassified 1394
760 Ga0439431_0245609 3300041997 Unclassified 530
761 Ga0439445_0043161 3300042004 Unclassified 1203
762 Ga0439435_0084294 3300042436 Unclassified 958
763 Ga0439444_0123752 3300042437 Unclassified 606
764 Ga0451577_0043520 3300042876 Bacteria 4022
765 Ga0466963_0053920 3300044694 Bacteria 2671
766 Ga0453684_0261948 3300044712 Bacteria 1980
767 Ga0453684_0356274 3300044712 Bacteria 1648
768 Ga0466959_1154913 3300045049 Bacteria 515
769 Ga0451576_0012591 3300045051 Bacteria 9496
770 Ga0451576_0221949 3300045051 Bacteria 1973
771 Ga0451576_0482414 3300045051 Unclassified 1302
772 Ga0451576_1281538 3300045051 Bacteria 764
773 Ga0451576_1320859 3300045051 Unclassified 752
774 Ga0451576_2450582 3300045051 Bacteria 533
775 Ga0466958_0327142 3300045836 Unclassified 985
776 Ga0495592_0045926 3300046454 Unclassified 3257
777 Ga0495603_0047369 3300046455 Bacteria 2560
778 Ga0495603_0154718 3300046455 Bacteria 1331
779 Ga0495629_0039644 3300046459 Bacteria 3315
780 Ga0495638_0030093 3300046460 Bacteria 3497
781 Ga0495651_0104066 3300046462 Bacteria 2108
782 Ga0495580_0037523 3300046472 Bacteria 3477
783 Ga0495580_0684233 3300046472 Unclassified 672
784 Ga0495582_0127085 3300046473 Bacteria 1439
785 Ga0495662_0123636 3300046476 Bacteria 1271
786 Ga0495662_0459287 3300046476 Unclassified 625
787 Ga0495664_0168536 3300046477 Bacteria 1329
788 Ga0495594_0298887 3300046499 Unclassified 917
789 Ga0495608_0007294 3300046511 Bacteria 7817
790 Ga0495608_0009303 3300046511 Bacteria 6871
791 Ga0495618_0330891 3300046514 Unclassified 942
792 Ga0495618_0411394 3300046514 Bacteria 826
793 Ga0495628_0098276 3300046516 Bacteria 2261
794 Ga0495628_0153628 3300046516 Bacteria 1752
795 Ga0495628_0361711 3300046516 Bacteria 1065
796 Ga0495630_0020785 3300046517 Bacteria 4844
797 Ga0495643_0129231 3300046522 Unclassified 1269
798 Ga0495644_0115927 3300046523 Bacteria 1018
799 Ga0495644_0388096 3300046523 Unclassified 552
800 Ga0495652_0043389 3300046529 Bacteria 3874
801 Ga0495640_0429030 3300046533 Bacteria 809
802 Ga0495586_0667073 3300046535 Bacteria 601
803 Ga0495586_0852160 3300046535 Bacteria 525
804 Ga0495587_0398052 3300046536 Unclassified 765
805 Ga0495621_0012653 3300046539 Bacteria 2634
806 Ga0495621_0081706 3300046539 Bacteria 1206
807 Ga0495621_0161290 3300046539 Bacteria 887
808 Ga0495667_0017615 3300046559 Bacteria 4825
809 Ga0495667_0061625 3300046559 Bacteria 2459
810 Ga0495667_0791394 3300046559 Bacteria 585
811 Ga0495634_0132800 3300046642 Unclassified 1586
812 Ga0495659_0196109 3300046664 Unclassified 827
813 Ga0495588_0016972 3300046674 Bacteria 3527
814 Ga0495657_0112692 3300046675 Bacteria 1722
815 Ga0495599_0128426 3300046678 Bacteria 1575
816 Ga0495623_0333677 3300046679 Bacteria 830
817 Ga0495647_0146596 3300046681 Bacteria 1010
818 Ga0495658_0114695 3300046683 Bacteria 1624
819 Ga0495658_0188754 3300046683 Bacteria 1281
820 Ga0495658_1041918 3300046683 Unclassified 522
821 Ga0495669_0000953 3300046684 Bacteria 12080
822 Ga0495669_0170400 3300046684 Bacteria 1035
823 Ga0495613_0026797 3300046689 Bacteria 4292
824 Ga0495670_0312830 3300046691 Bacteria 843
825 Ga0495600_0181287 3300046809 Bacteria 1357
826 Ga0495604_0015903 3300047317 Bacteria 6008
827 Ga0495604_0124825 3300047317 Bacteria 1858
828 Ga0495674_0030010 3300047319 Bacteria 4947
829 Ga0495672_0031959 3300047320 Bacteria 3281
830 Ga0495672_0136882 3300047320 Unclassified 1283
831 Ga0495680_0788567 3300047322 Unclassified 621
832 Ga0495675_0320265 3300047444 Bacteria 917
833 Ga0495677_0344431 3300047445 Bacteria 588
834 Ga0495684_0000462 3300047471 Bacteria 33252
835 Ga0495602_0160499 3300048088 Bacteria 1756
836 Ga0496100_0018741 3300048903 Bacteria 4113
837 Ga0496101_0555387 3300048904 Unclassified 908
838 Ga0496102_0845352 3300048905 Bacteria 837
839 Ga0496102_0903228 3300048905 Unclassified 805
840 Ga0496103_0372961 3300048906 Bacteria 917
841 Ga0496104_0030376 3300048907 Bacteria 5021
842 Ga0496104_0208307 3300048907 Bacteria 1867
843 Ga0496104_0560735 3300048907 Bacteria 1053
844 Ga0496104_0905721 3300048907 Bacteria 787
845 Ga0496105_0607282 3300048908 Bacteria 848
846 Ga0496106_0129552 3300048909 Bacteria 1978
847 Ga0496107_0107652 3300048910 Bacteria 2047
848 Ga0496107_0584194 3300048910 Unclassified 826
849 Ga0496108_0396358 3300048911 Bacteria 1206
850 Ga0496109_0042376 3300048912 Bacteria 4123
851 Ga0496109_0114683 3300048912 Bacteria 2507
852 Ga0496110_0306643 3300048913 Bacteria 1446
853 Ga0496111_0352835 3300048914 Unclassified 1089
854 Ga0496112_0152291 3300048915 Bacteria 2280
855 Ga0496112_1652313 3300048915 Unclassified 553
856 Ga0496113_0385631 3300048916 Bacteria 1125
857 Ga0496113_0998546 3300048916 Unclassified 659
858 Ga0496114_0000226 3300048917 Bacteria 40968
859 Ga0496114_0077423 3300048917 Bacteria 2804
860 Ga0496114_0667892 3300048917 Bacteria 913
861 Ga0496115_0288584 3300048918 Bacteria 1346
862 Ga0501298_169502 3300049521 Bacteria 543
863 Ga0501033_0166664 3300049570 Bacteria 1584
864 Ga0501036_0301954 3300049572 Unclassified 1339
865 Ga0501038_0213541 3300049574 Bacteria 1542
866 Ga0501038_0454229 3300049574 Unclassified 985
867 Ga0501039_0027416 3300049575 Bacteria 4380
868 Ga0501039_0087056 3300049575 Bacteria 2433
869 Ga0501040_0013356 3300049576 Bacteria 5396
870 Ga0501040_0014780 3300049576 Bacteria 5151
871 Ga0501040_0412101 3300049576 Bacteria 971
872 Ga0501041_0011828 3300049577 Bacteria 5165
873 Ga0501041_0025933 3300049577 Unclassified 3524
874 Ga0501042_0015080 3300049578 Bacteria 5285
875 Ga0501042_0027346 3300049578 Bacteria 4011
876 Ga0501042_0061267 3300049578 Bacteria 2688
877 Ga0501043_0044653 3300049579 Bacteria 3485
878 Ga0501046_0012446 3300049580 Bacteria 7242
879 Ga0501046_0048808 3300049580 Unclassified 3351
880 Ga0501047_1003840 3300049581 Bacteria 648
881 Ga0501048_0161423 3300049582 Unclassified 1586
882 Ga0501048_0222047 3300049582 Bacteria 1340
883 Ga0501068_0068848 3300049584 Bacteria 2157
884 Ga0501071_0054536 3300049587 Bacteria 2884
885 Ga0501071_0213607 3300049587 Bacteria 1451
886 Ga0501072_0036855 3300049588 Bacteria 3835
887 Ga0501072_0081480 3300049588 Bacteria 2565
888 Ga0501073_0133983 3300049589 Bacteria 1717
889 Ga0501074_0160452 3300049590 Bacteria 1606
890 Ga0501075_0013330 3300049591 Bacteria 5865
891 Ga0501075_0039322 3300049591 Bacteria 3540
892 Ga0501075_0095218 3300049591 Bacteria 2259
893 Ga0501075_0607778 3300049591 Unclassified 834
894 Ga0501076_0015807 3300049592 Bacteria 5709
895 Ga0501077_0082486 3300049593 Bacteria 2037
896 Ga0501077_0422962 3300049593 Unclassified 852
897 Ga0501249_025503 3300049679 Bacteria 1305
898 Ga0501229_011645 3300049706 Bacteria 1117
899 Ga0501079_0035544 3300049741 Bacteria 3836
900 Ga0501079_0045235 3300049741 Bacteria 3397
901 Ga0501079_0182407 3300049741 Bacteria 1638
902 Ga0501080_0540579 3300049742 Bacteria 1038
903 Ga0501081_0016297 3300049743 Bacteria 4911
904 Ga0501081_0035672 3300049743 Bacteria 3386
905 Ga0501083_0203036 3300049744 Bacteria 1293
906 Ga0501083_0424744 3300049744 Bacteria 865
907 Ga0501083_0781504 3300049744 Bacteria 621
908 Ga0501083_1011684 3300049744 Unclassified 541
909 Ga0501035_0490541 3300049822 Bacteria 1012
910 Ga0501045_0006013 3300049824 Bacteria 8400
911 Ga0501045_0007712 3300049824 Bacteria 7487
912 Ga0501045_0069253 3300049824 Bacteria 2593
913 Ga0501045_0547542 3300049824 Unclassified 858
914 nmdc:mga00v17_112166_c1 3300050491 Unclassified 1730
915 nmdc:mga00v17_68561_c1 3300050491 Bacteria 2193
916 nmdc:mga00v17_886298_c1 3300050491 Bacteria 565
917 nmdc:mga0k408_136798_c1 3300050493 Bacteria 1456
918 nmdc:mga06z11_132588_c1 3300050494 Bacteria 1400
919 nmdc:mga06z11_33068_c1 3300050494 Bacteria 2527
920 nmdc:mga06z11_47870_c1 3300050494 Unclassified 2173
921 nmdc:mga04h51_94307_c1 3300050495 Bacteria 1082
922 nmdc:mga05p37_1215570_c1 3300050507 Bacteria 777
923 nmdc:mga05p37_12236_c1 3300050507 Bacteria 10247
924 nmdc:mga05p37_137872_c1 3300050507 Unclassified 2990
925 nmdc:mga05p37_2083_c1 3300050507 Bacteria 23353
926 nmdc:mga05p37_21375_c1 3300050507 Bacteria 7836
927 nmdc:mga05p37_26077_c1 3300050507 Bacteria 7107
928 nmdc:mga05p37_2699_c1 3300050507 Bacteria 20635
929 nmdc:mga05p37_67043_c1 3300050507 Bacteria 4415
930 nmdc:mga05p37_743957_c1 3300050507 Bacteria 1082
931 nmdc:mga05p37_763643_c1 3300050507 Bacteria 1064
932 nmdc:mga05p37_93364_c1 3300050507 Bacteria 3708
933 nmdc:mga09592_1495004_c1 3300050508 Bacteria 550
934 nmdc:mga09592_21353_c1 3300050508 Bacteria 5336
935 nmdc:mga09592_23509_c1 3300050508 Bacteria 5091
936 nmdc:mga09592_257964_c1 3300050508 Bacteria 1511
937 nmdc:mga09592_32662_c1 3300050508 Bacteria 3082
938 nmdc:mga09592_47513_c1 3300050508 Bacteria 3617
939 nmdc:mga09592_65218_c1 3300050508 Bacteria 3084
940 nmdc:mga09592_702093_c1 3300050508 Bacteria 861
941 nmdc:mga09592_740066_c1 3300050508 Bacteria 835
942 nmdc:mga0qj67_126142_c1 3300050509 Bacteria 2071
943 nmdc:mga0qj67_303095_c1 3300050509 Bacteria 1294
944 nmdc:mga0qj67_357818_c1 3300050509 Bacteria 1180
945 nmdc:mga0qj67_43508_c1 3300050509 Bacteria 3537
946 nmdc:mga0qj67_48387_c1 3300050509 Bacteria 3359
947 nmdc:mga0qj67_813866_c1 3300050509 Bacteria 739
948 nmdc:mga0qj67_976194_c1 3300050509 Bacteria 665
949 nmdc:mga06r32_24197_c1 3300050510 Bacteria 5632
950 nmdc:mga06r32_24482_c1 3300050510 Bacteria 5604
951 nmdc:mga06r32_50145_c1 3300050510 Bacteria 3993
952 nmdc:mga06r32_59692_c1 3300050510 Bacteria 3669
953 nmdc:mga06r32_671152_c1 3300050510 Bacteria 1003
954 nmdc:mga06r32_706315_c1 3300050510 Bacteria 974
955 nmdc:mga08y16_194128_c1 3300050511 Bacteria 2105
956 nmdc:mga08y16_240822_c1 3300050511 Bacteria 1870
957 nmdc:mga08y16_5349_c1 3300050511 Bacteria 13429
958 nmdc:mga08y16_536_c1 3300050511 Bacteria 35219
959 nmdc:mga08y16_57296_c1 3300050511 Bacteria 4072
960 nmdc:mga08y16_58599_c1 3300050511 Unclassified 2473
961 nmdc:mga08y16_804290_c1 3300050511 Bacteria 933
962 nmdc:mga08y16_9_c1 3300050511 Bacteria 566088
963 nmdc:mga0n895_10215_c1 3300050512 Bacteria 8270
964 nmdc:mga0n895_117712_c1 3300050512 Unclassified 2676
965 nmdc:mga0n895_124596_c1 3300050512 Bacteria 2600
966 nmdc:mga0n895_1925053_c1 3300050512 Bacteria 550
967 nmdc:mga0n895_21724_c1 3300050512 Bacteria 6006
968 nmdc:mga0n895_234274_c1 3300050512 Bacteria 1863
969 nmdc:mga0n895_35_c1 3300050512 Bacteria 79696
970 nmdc:mga0n895_43411_c1 3300050512 Bacteria 4381
971 nmdc:mga0n895_507715_c1 3300050512 Bacteria 1214
972 nmdc:mga0n895_79940_c1 3300050512 Bacteria 3257
973 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
974 nmdc:mga0rr50_220592_c1 3300050513 Bacteria 1566
975 nmdc:mga0rr50_272586_c1 3300050513 Bacteria 1411
976 nmdc:mga0rr50_480202_c1 3300050513 Bacteria 1055
977 nmdc:mga0rr50_564067_c1 3300050513 Bacteria 970
978 nmdc:mga0rr50_81970_c1 3300050513 Bacteria 2491
979 nmdc:mga0rr50_843060_c1 3300050513 Bacteria 782
980 nmdc:mga0rr50_949671_c1 3300050513 Unclassified 733
981 nmdc:mga08x19_118_c1 3300050514 Bacteria 70300
982 nmdc:mga08x19_124725_c1 3300050514 Bacteria 1729
983 nmdc:mga08x19_173140_c1 3300050514 Bacteria 1471
984 nmdc:mga08x19_47864_c1 3300050514 Bacteria 2738
985 nmdc:mga08x19_79399_c1 3300050514 Bacteria 2152
986 nmdc:mga0a205_103441_c1 3300050515 Bacteria 2746
987 nmdc:mga0a205_188382_c1 3300050515 Bacteria 1956
988 nmdc:mga0a205_27615_c1 3300050515 Bacteria 5420
989 nmdc:mga0a205_27753_c1 3300050515 Bacteria 5407
990 nmdc:mga0a205_30084_c1 3300050515 Bacteria 5198
991 nmdc:mga0a205_340181_c1 3300050515 Bacteria 1369
992 nmdc:mga0a205_411460_c1 3300050515 Unclassified 1215
993 nmdc:mga0a205_41338_c1 3300050515 Bacteria 4439
994 nmdc:mga0a205_418782_c1 3300050515 Unclassified 1202
995 nmdc:mga0a205_659071_c1 3300050515 Bacteria 898
996 Ga0495601_0001625 3300053077 Bacteria 12372
997 Ga0495601_0018399 3300053077 Bacteria 4252
998 Ga0495601_0051170 3300053077 Bacteria 2607
999 Ga0495601_0172563 3300053077 Unclassified 1413
1000 Ga0495601_0230088 3300053077 Bacteria 1211
1001 Ga0495612_0360478 3300053078 Unclassified 657
1002 Ga0500610_0235387 3300053079 Bacteria 856
1003 Ga0495595_0059057 3300053084 Unclassified 1792
1004 Ga0495595_0201711 3300053084 Bacteria 990
1005 Ga0495619_0003403 3300053085 Bacteria 10279
1006 Ga0495619_0020908 3300053085 Bacteria 4174
1007 Ga0495619_0170015 3300053085 Bacteria 1507
1008 Ga0495619_0240922 3300053085 Bacteria 1253
1009 Ga0495619_0382337 3300053085 Unclassified 973
1010 Ga0495619_0982521 3300053085 Unclassified 565
1011 Ga0500555_000534 3300053103 Bacteria 15161
1012 Ga0500592_038539 3300053116 Bacteria 773
1013 Ga0500568_0001551 3300053139 Bacteria 14594
1014 Ga0500616_0001234 3300053153 Bacteria 25666
1015 Ga0500645_000765 3300053730 Bacteria 19561
1016 Ga0500599_004568 3300053736 Bacteria 1716
1017 Ga0501084_0020123 3300054114 Bacteria 5564
1018 Ga0501084_0119412 3300054114 Bacteria 2216
1019 Ga0501084_0289560 3300054114 Bacteria 1383
1020 Ga0501084_0309844 3300054114 Bacteria 1333
1021 Ga0501084_1200912 3300054114 Unclassified 636
1022 Ga0590074_005514 3300059423 Unclassified 2097
1023 Ga0590075_000399 3300059424 Bacteria 11905
1024 Ga0590077_000076 3300059426 Bacteria 24905
1025 Ga0501082_0050575 3300060353 Bacteria 3583
1026 Ga0501082_0077672 3300060353 Bacteria 2863
1027 Ga0530510_0034897 3300061734 Bacteria 3624
1028 Ga0530510_0075353 3300061734 Bacteria 2450
1029 Ga0530510_0088788 3300061734 Bacteria 2254

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10001136 Ga0114129_1000113620 100
2 3300005549 Ga0070704_100183958 Ga0070704_1001839582 105
3 3300006846 Ga0075430_100412544 Ga0075430_1004125442 105
4 3300006847 Ga0075431_100032521 Ga0075431_1000325219 105
5 3300006880 Ga0075429_100031390 Ga0075429_1000313905 105
6 3300009094 Ga0111539_10754590 Ga0111539_107545902 105
7 3300009147 Ga0114129_10034877 Ga0114129_100348775 105
8 3300027907 Ga0207428_10365403 Ga0207428_103654032 105
9 3300050507 nmdc:mga05p37_26077_c1 nmdc:mga05p37_26077_c1_3915_4328 105
10 3300050508 nmdc:mga09592_23509_c1 nmdc:mga09592_23509_c1_1638_2051 105
11 3300050509 nmdc:mga0qj67_126142_c1 nmdc:mga0qj67_126142_c1_991_1404 105
12 3300050510 nmdc:mga06r32_24197_c1 nmdc:mga06r32_24197_c1_949_1362 105
13 3300050511 nmdc:mga08y16_804290_c1 nmdc:mga08y16_804290_c1_331_744 105
14 3300006844 Ga0075428_100068181 Ga0075428_1000681815 107
15 3300006852 Ga0075433_10059425 Ga0075433_100594252 107
16 3300006880 Ga0075429_100022058 Ga0075429_1000220583 107
17 3300042436 Ga0439435_0084294 Ga0439435_0084294_493_909 107
18 3300050507 nmdc:mga05p37_2699_c1 nmdc:mga05p37_2699_c1_3236_3697 107
19 3300050508 nmdc:mga09592_47513_c1 nmdc:mga09592_47513_c1_828_1289 107
20 3300050512 nmdc:mga0n895_10215_c1 nmdc:mga0n895_10215_c1_1429_1890 107
21 3300050515 nmdc:mga0a205_27753_c1 nmdc:mga0a205_27753_c1_3329_3790 107
22 3300054114 Ga0501084_1200912 Ga0501084_1200912_62_478 107
23 3300005617 Ga0068859_100000008 Ga0068859_100000008152 108
24 3300006931 Ga0097620_100000008 Ga0097620_100000008152 108
25 3300049574 Ga0501038_0213541 Ga0501038_0213541_153_569 108
26 3300049575 Ga0501039_0087056 Ga0501039_0087056_228_644 108
27 3300049576 Ga0501040_0014780 Ga0501040_0014780_882_1298 108
28 3300049577 Ga0501041_0025933 Ga0501041_0025933_227_643 108
29 3300049578 Ga0501042_0015080 Ga0501042_0015080_3157_3573 108
30 3300049579 Ga0501043_0044653 Ga0501043_0044653_1181_1597 108
31 3300049580 Ga0501046_0012446 Ga0501046_0012446_5002_5418 108
32 3300049581 Ga0501047_1003840 Ga0501047_1003840_221_637 108
33 3300049582 Ga0501048_0222047 Ga0501048_0222047_804_1220 108
34 3300049584 Ga0501068_0068848 Ga0501068_0068848_38_454 108
35 3300049587 Ga0501071_0054536 Ga0501071_0054536_1796_2212 108
36 3300049588 Ga0501072_0081480 Ga0501072_0081480_358_774 108
37 3300049591 Ga0501075_0039322 Ga0501075_0039322_1295_1711 108
38 3300049592 Ga0501076_0015807 Ga0501076_0015807_2725_3141 108
39 3300049593 Ga0501077_0422962 Ga0501077_0422962_371_787 108
40 3300049741 Ga0501079_0045235 Ga0501079_0045235_2218_2634 108
41 3300049742 Ga0501080_0540579 Ga0501080_0540579_561_977 108
42 3300049743 Ga0501081_0016297 Ga0501081_0016297_1843_2259 108
43 3300049744 Ga0501083_0424744 Ga0501083_0424744_423_839 108
44 3300049822 Ga0501035_0490541 Ga0501035_0490541_146_562 108
45 3300049824 Ga0501045_0007712 Ga0501045_0007712_1858_2274 108
46 3300054114 Ga0501084_0020123 Ga0501084_0020123_407_823 108
47 3300060353 Ga0501082_0050575 Ga0501082_0050575_1279_1695 108
48 3300061734 Ga0530510_0075353 Ga0530510_0075353_421_837 108
49 3300005345 Ga0070692_10061545 Ga0070692_100615452 109
50 3300005466 Ga0070685_10000594 Ga0070685_1000059410 109
51 3300026041 Ga0207639_11476274 Ga0207639_114762741 109
52 3300034820 Ga0373959_0000033 Ga0373959_0000033_18126_18545 109
53 3300005466 Ga0070685_10001074 Ga0070685_100010748 113
54 3300025923 Ga0207681_10917123 Ga0207681_109171232 113
55 3300039438 Ga0436360_0085243 Ga0436360_0085243_111_473 113
56 3300025885 Ga0207653_10078964 Ga0207653_100789642 114
57 3300039437 Ga0436365_0298694 Ga0436365_0298694_10_375 114
58 3300045049 Ga0466959_1154913 Ga0466959_1154913_109_474 114
59 3300006871 Ga0075434_100097090 Ga0075434_1000970902 115
60 3300007076 Ga0075435_100111403 Ga0075435_1001114032 115
61 3300009176 Ga0105242_11444150 Ga0105242_114441502 115
62 3300039450 Ga0436363_1164207 Ga0436363_1164207_228_596 115
63 3300050512 nmdc:mga0n895_234274_c1 nmdc:mga0n895_234274_c1_334_738 115
64 3300050513 nmdc:mga0rr50_564067_c1 nmdc:mga0rr50_564067_c1_484_888 115
65 3300006844 Ga0075428_100015342 Ga0075428_1000153422 116
66 3300006880 Ga0075429_100605818 Ga0075429_1006058181 116
67 3300039438 Ga0436360_0188929 Ga0436360_0188929_198_569 116
68 3300044712 Ga0453684_0261948 Ga0453684_0261948_40_411 116
69 3300039438 Ga0436360_0945317 Ga0436360_0945317_56_430 117
70 3300050508 nmdc:mga09592_740066_c1 nmdc:mga09592_740066_c1_388_786 117
71 3300005328 Ga0070676_10155330 Ga0070676_101553302 118
72 3300005330 Ga0070690_100004503 Ga0070690_1000045033 118
73 3300005335 Ga0070666_10057567 Ga0070666_100575672 118
74 3300005335 Ga0070666_10700490 Ga0070666_107004901 118
75 3300005347 Ga0070668_100263317 Ga0070668_1002633172 118
76 3300005353 Ga0070669_100193748 Ga0070669_1001937482 118
77 3300005354 Ga0070675_100785606 Ga0070675_1007856061 118
78 3300005356 Ga0070674_101006195 Ga0070674_1010061952 118
79 3300005457 Ga0070662_100483752 Ga0070662_1004837521 118
80 3300005543 Ga0070672_101076358 Ga0070672_1010763582 118
81 3300005544 Ga0070686_100000502 Ga0070686_1000005022 118
82 3300005563 Ga0068855_100108401 Ga0068855_1001084012 118
83 3300005578 Ga0068854_100126345 Ga0068854_1001263452 118
84 3300005617 Ga0068859_101778746 Ga0068859_1017787461 118
85 3300005719 Ga0068861_100154551 Ga0068861_1001545512 118
86 3300005719 Ga0068861_100302041 Ga0068861_1003020412 118
87 3300005719 Ga0068861_101154897 Ga0068861_1011548972 118
88 3300005843 Ga0068860_102063357 Ga0068860_1020633572 118
89 3300005844 Ga0068862_100064665 Ga0068862_1000646652 118
90 3300006358 Ga0068871_100000602 Ga0068871_10000060215 118
91 3300006931 Ga0097620_101778745 Ga0097620_1017787451 118
92 3300009093 Ga0105240_10093322 Ga0105240_100933222 118
93 3300009093 Ga0105240_10143693 Ga0105240_101436932 118
94 3300009094 Ga0111539_10000556 Ga0111539_100005563 118
95 3300009174 Ga0105241_10047313 Ga0105241_100473133 118
96 3300009176 Ga0105242_10395084 Ga0105242_103950843 118
97 3300009176 Ga0105242_11051655 Ga0105242_110516552 118
98 3300009177 Ga0105248_10472716 Ga0105248_104727162 118
99 3300009177 Ga0105248_10726233 Ga0105248_107262331 118
100 3300014969 Ga0157376_10177326 Ga0157376_101773263 118
101 3300025315 Ga0207697_10038545 Ga0207697_100385452 118
102 3300025907 Ga0207645_10092452 Ga0207645_100924522 118
103 3300025910 Ga0207684_10887641 Ga0207684_108876412 118
104 3300025923 Ga0207681_11293354 Ga0207681_112933541 118
105 3300025926 Ga0207659_10210421 Ga0207659_102104211 118
106 3300025938 Ga0207704_10172031 Ga0207704_101720312 118
107 3300025941 Ga0207711_10819025 Ga0207711_108190252 118
108 3300025942 Ga0207689_10168743 Ga0207689_101687432 118
109 3300025972 Ga0207668_10073257 Ga0207668_100732571 118
110 3300026075 Ga0207708_10086421 Ga0207708_100864212 118
111 3300026116 Ga0207674_10632100 Ga0207674_106321002 118
112 3300026118 Ga0207675_100107470 Ga0207675_1001074702 118
113 3300026118 Ga0207675_100426787 Ga0207675_1004267872 118
114 3300028379 Ga0268266_10011577 Ga0268266_100115773 118
115 3300028800 Ga0265338_10070820 Ga0265338_100708203 118
116 3300029957 Ga0265324_10000538 Ga0265324_100005388 118
117 3300031241 Ga0265325_10039062 Ga0265325_100390623 118
118 3300031249 Ga0265339_10000120 Ga0265339_1000012015 118
119 3300031548 Ga0307408_100988936 Ga0307408_1009889362 118
120 3300031595 Ga0265313_10009483 Ga0265313_100094831 118
121 3300034957 Ga0373938_0050918 Ga0373938_0050918_407_808 118
122 3300035112 Ga0373932_0101387 Ga0373932_0101387_226_627 118
123 3300035114 Ga0373939_0218076 Ga0373939_0218076_109_510 118
124 3300036401 Ga0373937_0154959 Ga0373937_0154959_843_1244 118
125 3300039453 Ga0436362_1222382 Ga0436362_1222382_39_416 118
126 3300045051 Ga0451576_0482414 Ga0451576_0482414_59_460 118
127 3300046559 Ga0495667_0791394 Ga0495667_0791394_40_417 118
128 3300048917 Ga0496114_0077423 Ga0496114_0077423_983_1363 118
129 3300049570 Ga0501033_0166664 Ga0501033_0166664_585_962 118
130 3300049578 Ga0501042_0061267 Ga0501042_0061267_1377_1754 118
131 3300049741 Ga0501079_0035544 Ga0501079_0035544_1618_1995 118
132 3300049744 Ga0501083_0781504 Ga0501083_0781504_119_496 118
133 3300050511 nmdc:mga08y16_5349_c1 nmdc:mga08y16_5349_c1_2643_3020 118
134 3300050511 nmdc:mga08y16_58599_c1 nmdc:mga08y16_58599_c1_1812_2186 118
135 3300053085 Ga0495619_0170015 Ga0495619_0170015_461_838 118
136 3300060353 Ga0501082_0077672 Ga0501082_0077672_2290_2667 118
137 3300061734 Ga0530510_0088788 Ga0530510_0088788_579_956 118
138 3300003203 JGI25406J46586_10126970 JGI25406J46586_101269702 119
139 3300005290 Ga0065712_10163377 Ga0065712_101633773 119
140 3300005293 Ga0065715_10095978 Ga0065715_100959783 119
141 3300005293 Ga0065715_10548009 Ga0065715_105480092 119
142 3300005295 Ga0065707_11101634 Ga0065707_111016341 119
143 3300005334 Ga0068869_100179391 Ga0068869_1001793912 119
144 3300005336 Ga0070680_101462553 Ga0070680_1014625531 119
145 3300005345 Ga0070692_10147036 Ga0070692_101470362 119
146 3300005355 Ga0070671_101160985 Ga0070671_1011609851 119
147 3300005364 Ga0070673_100119771 Ga0070673_1001197712 119
148 3300005438 Ga0070701_10013001 Ga0070701_100130013 119
149 3300005440 Ga0070705_100001204 Ga0070705_10000120415 119
150 3300005440 Ga0070705_100268547 Ga0070705_1002685471 119
151 3300005444 Ga0070694_100000199 Ga0070694_10000019913 119
152 3300005444 Ga0070694_100113500 Ga0070694_1001135002 119
153 3300005444 Ga0070694_100878893 Ga0070694_1008788931 119
154 3300005445 Ga0070708_100790962 Ga0070708_1007909622 119
155 3300005445 Ga0070708_101383389 Ga0070708_1013833891 119
156 3300005467 Ga0070706_100286341 Ga0070706_1002863412 119
157 3300005467 Ga0070706_100753472 Ga0070706_1007534721 119
158 3300005468 Ga0070707_100048198 Ga0070707_1000481983 119
159 3300005471 Ga0070698_100885765 Ga0070698_1008857652 119
160 3300005518 Ga0070699_100044641 Ga0070699_1000446414 119
161 3300005518 Ga0070699_100251862 Ga0070699_1002518622 119
162 3300005518 Ga0070699_100691403 Ga0070699_1006914031 119
163 3300005536 Ga0070697_100143099 Ga0070697_1001430992 119
164 3300005536 Ga0070697_100309850 Ga0070697_1003098501 119
165 3300005536 Ga0070697_100918821 Ga0070697_1009188211 119
166 3300005536 Ga0070697_101151830 Ga0070697_1011518302 119
167 3300005536 Ga0070697_101568853 Ga0070697_1015688532 119
168 3300005545 Ga0070695_100009912 Ga0070695_1000099126 119
169 3300005545 Ga0070695_100019613 Ga0070695_1000196133 119
170 3300005545 Ga0070695_100791193 Ga0070695_1007911932 119
171 3300005546 Ga0070696_100000175 Ga0070696_10000017512 119
172 3300005549 Ga0070704_100095094 Ga0070704_1000950943 119
173 3300005549 Ga0070704_101256039 Ga0070704_1012560392 119
174 3300005549 Ga0070704_101290213 Ga0070704_1012902131 119
175 3300005577 Ga0068857_100260748 Ga0068857_1002607483 119
176 3300005615 Ga0070702_100010911 Ga0070702_1000109116 119
177 3300005617 Ga0068859_100006797 Ga0068859_10000679712 119
178 3300005617 Ga0068859_100401093 Ga0068859_1004010932 119
179 3300005617 Ga0068859_100532814 Ga0068859_1005328143 119
180 3300005618 Ga0068864_100091080 Ga0068864_1000910802 119
181 3300005719 Ga0068861_100044659 Ga0068861_1000446594 119
182 3300005841 Ga0068863_100895698 Ga0068863_1008956982 119
183 3300005842 Ga0068858_100018287 Ga0068858_1000182873 119
184 3300005842 Ga0068858_100119856 Ga0068858_1001198564 119
185 3300005842 Ga0068858_101580208 Ga0068858_1015802082 119
186 3300005843 Ga0068860_100182395 Ga0068860_1001823952 119
187 3300005843 Ga0068860_100257094 Ga0068860_1002570942 119
188 3300005844 Ga0068862_101490565 Ga0068862_1014905652 119
189 3300005985 Ga0081539_10005585 Ga0081539_100055852 119
190 3300006173 Ga0070716_100338310 Ga0070716_1003383102 119
191 3300006871 Ga0075434_101589033 Ga0075434_1015890331 119
192 3300006914 Ga0075436_100212250 Ga0075436_1002122502 119
193 3300006931 Ga0097620_100006797 Ga0097620_10000679712 119
194 3300006931 Ga0097620_100401074 Ga0097620_1004010742 119
195 3300006931 Ga0097620_100532784 Ga0097620_1005327842 119
196 3300007076 Ga0075435_100009571 Ga0075435_1000095715 119
197 3300007076 Ga0075435_100072244 Ga0075435_1000722442 119
198 3300009098 Ga0105245_11212716 Ga0105245_112127162 119
199 3300009101 Ga0105247_10037495 Ga0105247_100374952 119
200 3300009101 Ga0105247_10369425 Ga0105247_103694252 119
201 3300009147 Ga0114129_10156623 Ga0114129_101566232 119
202 3300009174 Ga0105241_10381023 Ga0105241_103810232 119
203 3300009177 Ga0105248_10008693 Ga0105248_1000869312 119
204 3300009177 Ga0105248_10511882 Ga0105248_105118822 119
205 3300009551 Ga0105238_10247606 Ga0105238_102476062 119
206 3300009551 Ga0105238_12775976 Ga0105238_127759761 119
207 3300014325 Ga0163163_10026633 Ga0163163_100266335 119
208 3300014968 Ga0157379_10279199 Ga0157379_102791992 119
209 3300014968 Ga0157379_10419308 Ga0157379_104193082 119
210 3300025907 Ga0207645_10126660 Ga0207645_101266602 119
211 3300025910 Ga0207684_10595146 Ga0207684_105951461 119
212 3300025922 Ga0207646_10189461 Ga0207646_101894613 119
213 3300025939 Ga0207665_10230644 Ga0207665_102306442 119
214 3300025941 Ga0207711_10646907 Ga0207711_106469072 119
215 3300025960 Ga0207651_10008548 Ga0207651_100085483 119
216 3300026035 Ga0207703_10236208 Ga0207703_102362084 119
217 3300026075 Ga0207708_10116810 Ga0207708_101168102 119
218 3300026095 Ga0207676_11880085 Ga0207676_118800852 119
219 3300026116 Ga0207674_10630925 Ga0207674_106309252 119
220 3300026118 Ga0207675_100039599 Ga0207675_1000395994 119
221 3300028380 Ga0268265_10241827 Ga0268265_102418272 119
222 3300037853 Ga0436364_1424755 Ga0436364_1424755_713_1096 119
223 3300045836 Ga0466958_0327142 Ga0466958_0327142_77_448 119
224 3300046514 Ga0495618_0330891 Ga0495618_0330891_127_510 119
225 3300046516 Ga0495628_0098276 Ga0495628_0098276_1615_1998 119
226 3300046523 Ga0495644_0388096 Ga0495644_0388096_74_445 119
227 3300046678 Ga0495599_0128426 Ga0495599_0128426_527_910 119
228 3300046683 Ga0495658_0114695 Ga0495658_0114695_1013_1420 119
229 3300046684 Ga0495669_0000953 Ga0495669_0000953_992_1363 119
230 3300048910 Ga0496107_0584194 Ga0496107_0584194_420_794 119
231 3300048915 Ga0496112_1652313 Ga0496112_1652313_156_530 119
232 3300049589 Ga0501073_0133983 Ga0501073_0133983_54_431 119
233 3300049824 Ga0501045_0547542 Ga0501045_0547542_427_822 119
234 3300050512 nmdc:mga0n895_1925053_c1 nmdc:mga0n895_1925053_c1_30_401 119
235 3300050514 nmdc:mga08x19_173140_c1 nmdc:mga08x19_173140_c1_415_786 119
236 3300050514 nmdc:mga08x19_47864_c1 nmdc:mga08x19_47864_c1_1854_2225 119
237 3300053077 Ga0495601_0051170 Ga0495601_0051170_381_764 119
238 3300053077 Ga0495601_0172563 Ga0495601_0172563_276_647 119
239 3300053085 Ga0495619_0240922 Ga0495619_0240922_621_1004 119
240 3300054114 Ga0501084_0309844 Ga0501084_0309844_873_1262 119
241 3300005345 Ga0070692_10667186 Ga0070692_106671862 120
242 3300005353 Ga0070669_100297443 Ga0070669_1002974431 120
243 3300005406 Ga0070703_10411627 Ga0070703_104116271 120
244 3300005444 Ga0070694_100488410 Ga0070694_1004884102 120
245 3300005458 Ga0070681_10936329 Ga0070681_109363291 120
246 3300005467 Ga0070706_100009661 Ga0070706_1000096612 120
247 3300005471 Ga0070698_100035117 Ga0070698_1000351172 120
248 3300005530 Ga0070679_101016677 Ga0070679_1010166772 120
249 3300005549 Ga0070704_100567072 Ga0070704_1005670722 120
250 3300005578 Ga0068854_101292596 Ga0068854_1012925961 120
251 3300005616 Ga0068852_100584081 Ga0068852_1005840812 120
252 3300005719 Ga0068861_100001159 Ga0068861_1000011592 120
253 3300005841 Ga0068863_100639108 Ga0068863_1006391081 120
254 3300005843 Ga0068860_100137849 Ga0068860_1001378491 120
255 3300006237 Ga0097621_100100709 Ga0097621_1001007093 120
256 3300006844 Ga0075428_100083818 Ga0075428_1000838182 120
257 3300006846 Ga0075430_100174248 Ga0075430_1001742482 120
258 3300006847 Ga0075431_100905560 Ga0075431_1009055601 120
259 3300006852 Ga0075433_10051253 Ga0075433_100512532 120
260 3300006852 Ga0075433_10380038 Ga0075433_103800382 120
261 3300006871 Ga0075434_100058856 Ga0075434_1000588562 120
262 3300006880 Ga0075429_100039747 Ga0075429_1000397472 120
263 3300006914 Ga0075436_100035265 Ga0075436_1000352652 120
264 3300009147 Ga0114129_10003962 Ga0114129_1000396220 120
265 3300009177 Ga0105248_10051306 Ga0105248_100513066 120
266 3300009545 Ga0105237_12258382 Ga0105237_122583821 120
267 3300013306 Ga0163162_10974178 Ga0163162_109741781 120
268 3300013308 Ga0157375_10500284 Ga0157375_105002842 120
269 3300025910 Ga0207684_10008764 Ga0207684_100087649 120
270 3300025921 Ga0207652_11075327 Ga0207652_110753272 120
271 3300025923 Ga0207681_10266637 Ga0207681_102666371 120
272 3300025925 Ga0207650_10863256 Ga0207650_108632562 120
273 3300025941 Ga0207711_11365127 Ga0207711_113651272 120
274 3300025941 Ga0207711_11730472 Ga0207711_117304721 120
275 3300026118 Ga0207675_100002093 Ga0207675_10000209315 120
276 3300045051 Ga0451576_1281538 Ga0451576_1281538_295_684 120
277 3300045051 Ga0451576_1320859 Ga0451576_1320859_227_598 120
278 3300050507 nmdc:mga05p37_2083_c1 nmdc:mga05p37_2083_c1_21729_22124 120
279 3300050507 nmdc:mga05p37_67043_c1 nmdc:mga05p37_67043_c1_319_693 120
280 3300050508 nmdc:mga09592_21353_c1 nmdc:mga09592_21353_c1_1399_1788 120
281 3300050509 nmdc:mga0qj67_813866_c1 nmdc:mga0qj67_813866_c1_76_465 120
282 3300050510 nmdc:mga06r32_50145_c1 nmdc:mga06r32_50145_c1_3297_3686 120
283 3300050512 nmdc:mga0n895_79940_c1 nmdc:mga0n895_79940_c1_2745_3119 120
284 3300050513 nmdc:mga0rr50_220592_c1 nmdc:mga0rr50_220592_c1_684_1058 120
285 3300050514 nmdc:mga08x19_79399_c1 nmdc:mga08x19_79399_c1_124_498 120
286 3300050515 nmdc:mga0a205_103441_c1 nmdc:mga0a205_103441_c1_123_518 120
287 3300050515 nmdc:mga0a205_27615_c1 nmdc:mga0a205_27615_c1_2602_2976 120
288 3300005290 Ga0065712_10683715 Ga0065712_106837151 121
289 3300005333 Ga0070677_10280675 Ga0070677_102806752 121
290 3300005335 Ga0070666_10305212 Ga0070666_103052122 121
291 3300005338 Ga0068868_100105604 Ga0068868_1001056042 121
292 3300005353 Ga0070669_100370309 Ga0070669_1003703091 121
293 3300005354 Ga0070675_100363005 Ga0070675_1003630052 121
294 3300005356 Ga0070674_100004723 Ga0070674_1000047239 121
295 3300005435 Ga0070714_100052603 Ga0070714_1000526033 121
296 3300005436 Ga0070713_100084183 Ga0070713_1000841832 121
297 3300005441 Ga0070700_100512674 Ga0070700_1005126741 121
298 3300005441 Ga0070700_100988232 Ga0070700_1009882321 121
299 3300005455 Ga0070663_101718454 Ga0070663_1017184542 121
300 3300005456 Ga0070678_101327445 Ga0070678_1013274451 121
301 3300005457 Ga0070662_101507269 Ga0070662_1015072691 121
302 3300005459 Ga0068867_100098119 Ga0068867_1000981192 121
303 3300005518 Ga0070699_100670639 Ga0070699_1006706392 121
304 3300005548 Ga0070665_100000734 Ga0070665_10000073431 121
305 3300005614 Ga0068856_100104531 Ga0068856_1001045312 121
306 3300005614 Ga0068856_102240776 Ga0068856_1022407761 121
307 3300005719 Ga0068861_100260019 Ga0068861_1002600192 121
308 3300005834 Ga0068851_10137939 Ga0068851_101379391 121
309 3300005841 Ga0068863_100073259 Ga0068863_1000732592 121
310 3300005841 Ga0068863_100295672 Ga0068863_1002956722 121
311 3300005842 Ga0068858_100049229 Ga0068858_1000492292 121
312 3300005843 Ga0068860_101870211 Ga0068860_1018702112 121
313 3300006028 Ga0070717_10672534 Ga0070717_106725342 121
314 3300006163 Ga0070715_10017875 Ga0070715_100178752 121
315 3300006163 Ga0070715_10158890 Ga0070715_101588902 121
316 3300006173 Ga0070716_100106522 Ga0070716_1001065222 121
317 3300006237 Ga0097621_100005878 Ga0097621_1000058785 121
318 3300006237 Ga0097621_100026029 Ga0097621_1000260293 121
319 3300006237 Ga0097621_100754788 Ga0097621_1007547882 121
320 3300006358 Ga0068871_100306734 Ga0068871_1003067342 121
321 3300006844 Ga0075428_100019087 Ga0075428_1000190874 121
322 3300006844 Ga0075428_100058014 Ga0075428_1000580142 121
323 3300006846 Ga0075430_100012800 Ga0075430_1000128006 121
324 3300006846 Ga0075430_100311079 Ga0075430_1003110792 121
325 3300006847 Ga0075431_100631749 Ga0075431_1006317492 121
326 3300006852 Ga0075433_10337038 Ga0075433_103370381 121
327 3300006871 Ga0075434_100105006 Ga0075434_1001050062 121
328 3300006880 Ga0075429_100970906 Ga0075429_1009709062 121
329 3300006880 Ga0075429_101507501 Ga0075429_1015075012 121
330 3300006881 Ga0068865_100153523 Ga0068865_1001535232 121
331 3300009094 Ga0111539_10000736 Ga0111539_1000073629 121
332 3300009094 Ga0111539_10000850 Ga0111539_1000085036 121
333 3300009094 Ga0111539_10303238 Ga0111539_103032382 121
334 3300009101 Ga0105247_10217180 Ga0105247_102171802 121
335 3300009101 Ga0105247_10941423 Ga0105247_109414231 121
336 3300009147 Ga0114129_10001786 Ga0114129_100017865 121
337 3300009147 Ga0114129_10095887 Ga0114129_100958872 121
338 3300009176 Ga0105242_10004812 Ga0105242_1000481211 121
339 3300009177 Ga0105248_10299874 Ga0105248_102998743 121
340 3300009177 Ga0105248_10424999 Ga0105248_104249992 121
341 3300009545 Ga0105237_10547776 Ga0105237_105477762 121
342 3300009553 Ga0105249_10144827 Ga0105249_101448272 121
343 3300011119 Ga0105246_10451649 Ga0105246_104516492 121
344 3300013296 Ga0157374_10008967 Ga0157374_100089675 121
345 3300013308 Ga0157375_10537265 Ga0157375_105372652 121
346 3300014325 Ga0163163_10106347 Ga0163163_101063474 121
347 3300014326 Ga0157380_10161020 Ga0157380_101610203 121
348 3300014968 Ga0157379_10012857 Ga0157379_100128572 121
349 3300014969 Ga0157376_10123596 Ga0157376_101235961 121
350 3300025905 Ga0207685_10182534 Ga0207685_101825342 121
351 3300025914 Ga0207671_10391763 Ga0207671_103917632 121
352 3300025917 Ga0207660_11397061 Ga0207660_113970612 121
353 3300025923 Ga0207681_10362062 Ga0207681_103620622 121
354 3300025926 Ga0207659_10310605 Ga0207659_103106052 121
355 3300025933 Ga0207706_10672061 Ga0207706_106720612 121
356 3300025934 Ga0207686_10021245 Ga0207686_100212452 121
357 3300026023 Ga0207677_10987358 Ga0207677_109873582 121
358 3300026035 Ga0207703_10325234 Ga0207703_103252341 121
359 3300026067 Ga0207678_11383117 Ga0207678_113831172 121
360 3300026078 Ga0207702_11056544 Ga0207702_110565442 121
361 3300026088 Ga0207641_10376796 Ga0207641_103767962 121
362 3300026089 Ga0207648_10134346 Ga0207648_101343462 121
363 3300026089 Ga0207648_10380901 Ga0207648_103809012 121
364 3300026121 Ga0207683_10714932 Ga0207683_107149322 121
365 3300027907 Ga0207428_10010580 Ga0207428_100105809 121
366 3300028381 Ga0268264_10771695 Ga0268264_107716951 121
367 3300031548 Ga0307408_101142503 Ga0307408_1011425032 121
368 3300031731 Ga0307405_10037889 Ga0307405_100378892 121
369 3300031824 Ga0307413_11420431 Ga0307413_114204312 121
370 3300031852 Ga0307410_10035658 Ga0307410_100356583 121
371 3300031901 Ga0307406_10387113 Ga0307406_103871132 121
372 3300031903 Ga0307407_10107635 Ga0307407_101076352 121
373 3300032002 Ga0307416_100170863 Ga0307416_1001708632 121
374 3300032002 Ga0307416_102505290 Ga0307416_1025052902 121
375 3300032004 Ga0307414_11389598 Ga0307414_113895981 121
376 3300032005 Ga0307411_10039398 Ga0307411_100393983 121
377 3300032005 Ga0307411_10523133 Ga0307411_105231331 121
378 3300032005 Ga0307411_11606139 Ga0307411_116061391 121
379 3300032126 Ga0307415_100085752 Ga0307415_1000857522 121
380 3300032126 Ga0307415_100476789 Ga0307415_1004767892 121
381 3300035113 Ga0373936_0295020 Ga0373936_0295020_126_506 121
382 3300035118 Ga0373954_0564195 Ga0373954_0564195_41_454 121
383 3300035120 Ga0373957_0144152 Ga0373957_0144152_389_769 121
384 3300035171 Ga0373946_0243773 Ga0373946_0243773_368_748 121
385 3300035172 Ga0373955_0133041 Ga0373955_0133041_978_1358 121
386 3300035172 Ga0373955_0189045 Ga0373955_0189045_176_556 121
387 3300035207 Ga0373942_0084394 Ga0373942_0084394_170_556 121
388 3300035692 Ga0373935_0899219 Ga0373935_0899219_178_558 121
389 3300035695 Ga0373927_0391430 Ga0373927_0391430_492_872 121
390 3300035724 Ga0373933_0207445 Ga0373933_0207445_574_954 121
391 3300037068 Ga0373925_0304817 Ga0373925_0304817_349_729 121
392 3300037068 Ga0373925_1281841 Ga0373925_1281841_57_437 121
393 3300042876 Ga0451577_0043520 Ga0451577_0043520_590_982 121
394 3300044712 Ga0453684_0356274 Ga0453684_0356274_432_824 121
395 3300045051 Ga0451576_0012591 Ga0451576_0012591_635_1039 121
396 3300045051 Ga0451576_0221949 Ga0451576_0221949_1329_1715 121
397 3300046460 Ga0495638_0030093 Ga0495638_0030093_1359_1736 121
398 3300046476 Ga0495662_0459287 Ga0495662_0459287_33_413 121
399 3300046511 Ga0495608_0007294 Ga0495608_0007294_929_1342 121
400 3300046522 Ga0495643_0129231 Ga0495643_0129231_156_527 121
401 3300046559 Ga0495667_0061625 Ga0495667_0061625_1232_1645 121
402 3300046681 Ga0495647_0146596 Ga0495647_0146596_542_922 121
403 3300046683 Ga0495658_1041918 Ga0495658_1041918_126_506 121
404 3300047317 Ga0495604_0124825 Ga0495604_0124825_413_826 121
405 3300048903 Ga0496100_0018741 Ga0496100_0018741_3190_3570 121
406 3300048905 Ga0496102_0845352 Ga0496102_0845352_372_752 121
407 3300048905 Ga0496102_0903228 Ga0496102_0903228_379_780 121
408 3300048906 Ga0496103_0372961 Ga0496103_0372961_410_790 121
409 3300048907 Ga0496104_0030376 Ga0496104_0030376_1452_1832 121
410 3300048907 Ga0496104_0560735 Ga0496104_0560735_47_421 121
411 3300048908 Ga0496105_0607282 Ga0496105_0607282_165_545 121
412 3300048910 Ga0496107_0107652 Ga0496107_0107652_765_1145 121
413 3300048915 Ga0496112_0152291 Ga0496112_0152291_1690_2166 121
414 3300048917 Ga0496114_0000226 Ga0496114_0000226_845_1225 121
415 3300048918 Ga0496115_0288584 Ga0496115_0288584_324_698 121
416 3300050509 nmdc:mga0qj67_357818_c1 nmdc:mga0qj67_357818_c1_480_854 121
417 3300050509 nmdc:mga0qj67_976194_c1 nmdc:mga0qj67_976194_c1_216_605 121
418 3300050511 nmdc:mga08y16_194128_c1 nmdc:mga08y16_194128_c1_1702_2091 121
419 3300050511 nmdc:mga08y16_536_c1 nmdc:mga08y16_536_c1_3163_3567 121
420 3300053077 Ga0495601_0001625 Ga0495601_0001625_7798_8211 121
421 3300053078 Ga0495612_0360478 Ga0495612_0360478_134_547 121
422 3300053079 Ga0500610_0235387 Ga0500610_0235387_162_560 121
423 3300053085 Ga0495619_0003403 Ga0495619_0003403_4002_4415 121
424 3300053085 Ga0495619_0382337 Ga0495619_0382337_208_588 121
425 3300005295 Ga0065707_10506285 Ga0065707_105062852 122
426 3300005330 Ga0070690_100536427 Ga0070690_1005364272 122
427 3300005334 Ga0068869_100426904 Ga0068869_1004269042 122
428 3300005340 Ga0070689_101436049 Ga0070689_1014360492 122
429 3300005345 Ga0070692_10007969 Ga0070692_100079697 122
430 3300005353 Ga0070669_100068286 Ga0070669_1000682862 122
431 3300005354 Ga0070675_100000751 Ga0070675_1000007517 122
432 3300005354 Ga0070675_100029068 Ga0070675_1000290682 122
433 3300005356 Ga0070674_100061123 Ga0070674_1000611234 122
434 3300005364 Ga0070673_100413409 Ga0070673_1004134092 122
435 3300005438 Ga0070701_10175578 Ga0070701_101755782 122
436 3300005440 Ga0070705_100143667 Ga0070705_1001436672 122
437 3300005440 Ga0070705_100146809 Ga0070705_1001468093 122
438 3300005441 Ga0070700_100206662 Ga0070700_1002066622 122
439 3300005444 Ga0070694_100001846 Ga0070694_1000018467 122
440 3300005444 Ga0070694_100004226 Ga0070694_1000042262 122
441 3300005444 Ga0070694_100414031 Ga0070694_1004140312 122
442 3300005445 Ga0070708_100260540 Ga0070708_1002605402 122
443 3300005456 Ga0070678_100885776 Ga0070678_1008857762 122
444 3300005457 Ga0070662_101999921 Ga0070662_1019999211 122
445 3300005467 Ga0070706_100453045 Ga0070706_1004530451 122
446 3300005468 Ga0070707_100443789 Ga0070707_1004437892 122
447 3300005471 Ga0070698_100003898 Ga0070698_10000389815 122
448 3300005471 Ga0070698_100015144 Ga0070698_1000151447 122
449 3300005471 Ga0070698_100263705 Ga0070698_1002637052 122
450 3300005471 Ga0070698_100698258 Ga0070698_1006982582 122
451 3300005471 Ga0070698_100855633 Ga0070698_1008556332 122
452 3300005518 Ga0070699_100000172 Ga0070699_10000017262 122
453 3300005518 Ga0070699_100029044 Ga0070699_1000290447 122
454 3300005536 Ga0070697_100434398 Ga0070697_1004343982 122
455 3300005536 Ga0070697_101242850 Ga0070697_1012428502 122
456 3300005545 Ga0070695_100000734 Ga0070695_1000007349 122
457 3300005545 Ga0070695_100405574 Ga0070695_1004055741 122
458 3300005546 Ga0070696_100008142 Ga0070696_1000081424 122
459 3300005546 Ga0070696_100028771 Ga0070696_1000287712 122
460 3300005546 Ga0070696_100465175 Ga0070696_1004651751 122
461 3300005549 Ga0070704_100001693 Ga0070704_1000016936 122
462 3300005549 Ga0070704_100004420 Ga0070704_1000044207 122
463 3300005549 Ga0070704_100048652 Ga0070704_1000486524 122
464 3300005577 Ga0068857_101560764 Ga0068857_1015607642 122
465 3300005615 Ga0070702_100225134 Ga0070702_1002251342 122
466 3300005617 Ga0068859_100466709 Ga0068859_1004667092 122
467 3300005719 Ga0068861_100028621 Ga0068861_1000286214 122
468 3300005719 Ga0068861_100647014 Ga0068861_1006470141 122
469 3300005840 Ga0068870_10154125 Ga0068870_101541252 122
470 3300005843 Ga0068860_100059006 Ga0068860_1000590063 122
471 3300006175 Ga0070712_100547834 Ga0070712_1005478342 122
472 3300006237 Ga0097621_100154032 Ga0097621_1001540322 122
473 3300006237 Ga0097621_101034887 Ga0097621_1010348872 122
474 3300006358 Ga0068871_100251826 Ga0068871_1002518262 122
475 3300006844 Ga0075428_100000034 Ga0075428_10000003441 122
476 3300006852 Ga0075433_10104324 Ga0075433_101043242 122
477 3300006852 Ga0075433_10164534 Ga0075433_101645343 122
478 3300006852 Ga0075433_10569701 Ga0075433_105697012 122
479 3300006871 Ga0075434_100197349 Ga0075434_1001973493 122
480 3300006880 Ga0075429_100129403 Ga0075429_1001294033 122
481 3300006881 Ga0068865_100708334 Ga0068865_1007083342 122
482 3300006914 Ga0075436_100002680 Ga0075436_1000026808 122
483 3300006931 Ga0097620_100466733 Ga0097620_1004667332 122
484 3300007076 Ga0075435_100000698 Ga0075435_10000069814 122
485 3300007076 Ga0075435_100056808 Ga0075435_1000568085 122
486 3300007076 Ga0075435_100900372 Ga0075435_1009003722 122
487 3300007076 Ga0075435_101963055 Ga0075435_1019630551 122
488 3300009093 Ga0105240_10006149 Ga0105240_100061495 122
489 3300009094 Ga0111539_10000014 Ga0111539_10000014196 122
490 3300009098 Ga0105245_11346693 Ga0105245_113466931 122
491 3300009147 Ga0114129_10003695 Ga0114129_100036952 122
492 3300009147 Ga0114129_10028396 Ga0114129_100283968 122
493 3300009147 Ga0114129_10063645 Ga0114129_100636452 122
494 3300009147 Ga0114129_10240663 Ga0114129_102406634 122
495 3300009147 Ga0114129_11317187 Ga0114129_113171872 122
496 3300009147 Ga0114129_12059081 Ga0114129_120590812 122
497 3300009147 Ga0114129_12835565 Ga0114129_128355652 122
498 3300009148 Ga0105243_10620224 Ga0105243_106202243 122
499 3300009148 Ga0105243_10632052 Ga0105243_106320522 122
500 3300009176 Ga0105242_10292282 Ga0105242_102922822 122
501 3300009553 Ga0105249_10446545 Ga0105249_104465452 122
502 3300009553 Ga0105249_11504478 Ga0105249_115044782 122
503 3300010375 Ga0105239_12294227 Ga0105239_122942272 122
504 3300011119 Ga0105246_10339378 Ga0105246_103393782 122
505 3300013307 Ga0157372_10653397 Ga0157372_106533971 122
506 3300014326 Ga0157380_10067340 Ga0157380_100673404 122
507 3300014326 Ga0157380_10153171 Ga0157380_101531713 122
508 3300014968 Ga0157379_12090542 Ga0157379_120905421 122
509 3300017792 Ga0163161_10318839 Ga0163161_103188393 122
510 3300025321 Ga0207656_10297123 Ga0207656_102971232 122
511 3300025901 Ga0207688_10478104 Ga0207688_104781042 122
512 3300025913 Ga0207695_10133316 Ga0207695_101333162 122
513 3300025915 Ga0207693_10510436 Ga0207693_105104361 122
514 3300025916 Ga0207663_10822571 Ga0207663_108225712 122
515 3300025923 Ga0207681_10046170 Ga0207681_100461703 122
516 3300025926 Ga0207659_10001326 Ga0207659_100013265 122
517 3300025933 Ga0207706_10006351 Ga0207706_100063512 122
518 3300025936 Ga0207670_10934535 Ga0207670_109345352 122
519 3300025937 Ga0207669_10084560 Ga0207669_100845603 122
520 3300025937 Ga0207669_10310856 Ga0207669_103108562 122
521 3300025938 Ga0207704_10594861 Ga0207704_105948612 122
522 3300025938 Ga0207704_11092153 Ga0207704_110921532 122
523 3300025942 Ga0207689_10126295 Ga0207689_101262952 122
524 3300025942 Ga0207689_10270130 Ga0207689_102701302 122
525 3300026075 Ga0207708_11210787 Ga0207708_112107872 122
526 3300026088 Ga0207641_10217180 Ga0207641_102171804 122
527 3300026116 Ga0207674_11524729 Ga0207674_115247292 122
528 3300027462 Ga0210000_1069327 Ga0210000_10693271 122
529 3300027907 Ga0207428_10000005 Ga0207428_1000000550 122
530 3300028380 Ga0268265_10820668 Ga0268265_108206682 122
531 3300028381 Ga0268264_10056317 Ga0268264_100563173 122
532 3300035086 Ga0373934_0342087 Ga0373934_0342087_34_414 122
533 3300035111 Ga0373923_0017689 Ga0373923_0017689_534_914 122
534 3300035116 Ga0373945_0029110 Ga0373945_0029110_347_727 122
535 3300035117 Ga0373953_0088554 Ga0373953_0088554_465_845 122
536 3300035118 Ga0373954_0279309 Ga0373954_0279309_357_737 122
537 3300035119 Ga0373956_0021764 Ga0373956_0021764_913_1293 122
538 3300035119 Ga0373956_0124247 Ga0373956_0124247_718_1098 122
539 3300035170 Ga0373943_0023781 Ga0373943_0023781_1851_2231 122
540 3300035171 Ga0373946_0301340 Ga0373946_0301340_363_743 122
541 3300035172 Ga0373955_0229437 Ga0373955_0229437_385_765 122
542 3300035172 Ga0373955_0411331 Ga0373955_0411331_347_727 122
543 3300035172 Ga0373955_0589039 Ga0373955_0589039_289_660 122
544 3300035410 Ga0373924_0013649 Ga0373924_0013649_1198_1578 122
545 3300035692 Ga0373935_0058303 Ga0373935_0058303_1087_1467 122
546 3300035695 Ga0373927_0199571 Ga0373927_0199571_912_1292 122
547 3300035724 Ga0373933_0139824 Ga0373933_0139824_967_1347 122
548 3300035725 Ga0373947_0034582 Ga0373947_0034582_2235_2615 122
549 3300036401 Ga0373937_0758928 Ga0373937_0758928_62_442 122
550 3300037068 Ga0373925_0035857 Ga0373925_0035857_840_1220 122
551 3300041997 Ga0439431_0245609 Ga0439431_0245609_124_507 122
552 3300042437 Ga0439444_0123752 Ga0439444_0123752_43_426 122
553 3300044694 Ga0466963_0053920 Ga0466963_0053920_772_1152 122
554 3300045051 Ga0451576_2450582 Ga0451576_2450582_93_473 122
555 3300046454 Ga0495592_0045926 Ga0495592_0045926_2712_3092 122
556 3300046455 Ga0495603_0047369 Ga0495603_0047369_1709_2080 122
557 3300046462 Ga0495651_0104066 Ga0495651_0104066_742_1122 122
558 3300046472 Ga0495580_0037523 Ga0495580_0037523_1785_2165 122
559 3300046472 Ga0495580_0684233 Ga0495580_0684233_250_630 122
560 3300046473 Ga0495582_0127085 Ga0495582_0127085_688_1068 122
561 3300046476 Ga0495662_0123636 Ga0495662_0123636_122_502 122
562 3300046477 Ga0495664_0168536 Ga0495664_0168536_738_1118 122
563 3300046499 Ga0495594_0298887 Ga0495594_0298887_134_505 122
564 3300046511 Ga0495608_0009303 Ga0495608_0009303_280_660 122
565 3300046514 Ga0495618_0411394 Ga0495618_0411394_11_391 122
566 3300046516 Ga0495628_0153628 Ga0495628_0153628_27_407 122
567 3300046517 Ga0495630_0020785 Ga0495630_0020785_415_795 122
568 3300046523 Ga0495644_0115927 Ga0495644_0115927_203_577 122
569 3300046529 Ga0495652_0043389 Ga0495652_0043389_493_873 122
570 3300046533 Ga0495640_0429030 Ga0495640_0429030_223_603 122
571 3300046535 Ga0495586_0852160 Ga0495586_0852160_51_422 122
572 3300046536 Ga0495587_0398052 Ga0495587_0398052_56_436 122
573 3300046559 Ga0495667_0017615 Ga0495667_0017615_1578_1958 122
574 3300046642 Ga0495634_0132800 Ga0495634_0132800_503_883 122
575 3300046664 Ga0495659_0196109 Ga0495659_0196109_121_492 122
576 3300046674 Ga0495588_0016972 Ga0495588_0016972_1835_2206 122
577 3300046675 Ga0495657_0112692 Ga0495657_0112692_688_1068 122
578 3300046679 Ga0495623_0333677 Ga0495623_0333677_433_813 122
579 3300046683 Ga0495658_0188754 Ga0495658_0188754_877_1248 122
580 3300046684 Ga0495669_0170400 Ga0495669_0170400_163_597 122
581 3300046689 Ga0495613_0026797 Ga0495613_0026797_3266_3646 122
582 3300046809 Ga0495600_0181287 Ga0495600_0181287_318_698 122
583 3300047317 Ga0495604_0015903 Ga0495604_0015903_4349_4738 122
584 3300047319 Ga0495674_0030010 Ga0495674_0030010_3587_3967 122
585 3300047320 Ga0495672_0136882 Ga0495672_0136882_897_1268 122
586 3300047322 Ga0495680_0788567 Ga0495680_0788567_221_601 122
587 3300047444 Ga0495675_0320265 Ga0495675_0320265_479_859 122
588 3300047445 Ga0495677_0344431 Ga0495677_0344431_44_418 122
589 3300047471 Ga0495684_0000462 Ga0495684_0000462_1789_2169 122
590 3300048088 Ga0495602_0160499 Ga0495602_0160499_1343_1723 122
591 3300049572 Ga0501036_0301954 Ga0501036_0301954_625_1017 122
592 3300049574 Ga0501038_0454229 Ga0501038_0454229_570_962 122
593 3300049575 Ga0501039_0027416 Ga0501039_0027416_496_888 122
594 3300049576 Ga0501040_0013356 Ga0501040_0013356_316_708 122
595 3300049577 Ga0501041_0011828 Ga0501041_0011828_1710_2102 122
596 3300049578 Ga0501042_0027346 Ga0501042_0027346_777_1169 122
597 3300049580 Ga0501046_0048808 Ga0501046_0048808_588_980 122
598 3300049582 Ga0501048_0161423 Ga0501048_0161423_1026_1418 122
599 3300049587 Ga0501071_0213607 Ga0501071_0213607_90_482 122
600 3300049588 Ga0501072_0036855 Ga0501072_0036855_2413_2805 122
601 3300049591 Ga0501075_0095218 Ga0501075_0095218_68_460 122
602 3300049593 Ga0501077_0082486 Ga0501077_0082486_1372_1764 122
603 3300049741 Ga0501079_0182407 Ga0501079_0182407_1175_1567 122
604 3300049744 Ga0501083_1011684 Ga0501083_1011684_128_520 122
605 3300049824 Ga0501045_0006013 Ga0501045_0006013_3040_3432 122
606 3300050491 nmdc:mga00v17_886298_c1 nmdc:mga00v17_886298_c1_104_484 122
607 3300050507 nmdc:mga05p37_12236_c1 nmdc:mga05p37_12236_c1_1381_1761 122
608 3300050507 nmdc:mga05p37_21375_c1 nmdc:mga05p37_21375_c1_5715_6092 122
609 3300050507 nmdc:mga05p37_743957_c1 nmdc:mga05p37_743957_c1_135_509 122
610 3300050507 nmdc:mga05p37_763643_c1 nmdc:mga05p37_763643_c1_540_917 122
611 3300050508 nmdc:mga09592_32662_c1 nmdc:mga09592_32662_c1_1142_1525 122
612 3300050511 nmdc:mga08y16_9_c1 nmdc:mga08y16_9_c1_499253_499636 122
613 3300050512 nmdc:mga0n895_124596_c1 nmdc:mga0n895_124596_c1_479_853 122
614 3300050512 nmdc:mga0n895_35_c1 nmdc:mga0n895_35_c1_70777_71148 122
615 3300050512 nmdc:mga0n895_507715_c1 nmdc:mga0n895_507715_c1_16_414 122
616 3300050513 nmdc:mga0rr50_1_c1 nmdc:mga0rr50_1_c1_70777_71148 122
617 3300050513 nmdc:mga0rr50_272586_c1 nmdc:mga0rr50_272586_c1_457_831 122
618 3300050513 nmdc:mga0rr50_843060_c1 nmdc:mga0rr50_843060_c1_77_451 122
619 3300050514 nmdc:mga08x19_118_c1 nmdc:mga08x19_118_c1_24324_24695 122
620 3300050515 nmdc:mga0a205_188382_c1 nmdc:mga0a205_188382_c1_926_1300 122
621 3300050515 nmdc:mga0a205_30084_c1 nmdc:mga0a205_30084_c1_786_1163 122
622 3300050515 nmdc:mga0a205_340181_c1 nmdc:mga0a205_340181_c1_458_835 122
623 3300050515 nmdc:mga0a205_659071_c1 nmdc:mga0a205_659071_c1_305_688 122
624 3300053077 Ga0495601_0018399 Ga0495601_0018399_666_1046 122
625 3300053084 Ga0495595_0059057 Ga0495595_0059057_645_1025 122
626 3300053085 Ga0495619_0020908 Ga0495619_0020908_1783_2163 122
627 3300054114 Ga0501084_0289560 Ga0501084_0289560_762_1154 122
628 3300059423 Ga0590074_005514 Ga0590074_005514_994_1383 122
629 3300059424 Ga0590075_000399 Ga0590075_000399_921_1310 122
630 3300059426 Ga0590077_000076 Ga0590077_000076_7664_8053 122
631 3300061734 Ga0530510_0034897 Ga0530510_0034897_1270_1662 122
632 3300005327 Ga0070658_10848456 Ga0070658_108484562 123
633 3300005335 Ga0070666_10816782 Ga0070666_108167821 123
634 3300005336 Ga0070680_100394798 Ga0070680_1003947981 123
635 3300005336 Ga0070680_100609710 Ga0070680_1006097101 123
636 3300005338 Ga0068868_100236938 Ga0068868_1002369382 123
637 3300005339 Ga0070660_100222973 Ga0070660_1002229732 123
638 3300005343 Ga0070687_100773152 Ga0070687_1007731521 123
639 3300005354 Ga0070675_100475068 Ga0070675_1004750682 123
640 3300005355 Ga0070671_100782237 Ga0070671_1007822372 123
641 3300005366 Ga0070659_100884994 Ga0070659_1008849942 123
642 3300005458 Ga0070681_10163198 Ga0070681_101631983 123
643 3300005530 Ga0070679_100295033 Ga0070679_1002950332 123
644 3300005530 Ga0070679_100639277 Ga0070679_1006392772 123
645 3300005543 Ga0070672_100221817 Ga0070672_1002218172 123
646 3300005548 Ga0070665_100574112 Ga0070665_1005741122 123
647 3300005563 Ga0068855_100029227 Ga0068855_1000292275 123
648 3300005578 Ga0068854_100497605 Ga0068854_1004976051 123
649 3300005616 Ga0068852_100223378 Ga0068852_1002233784 123
650 3300005617 Ga0068859_100948359 Ga0068859_1009483592 123
651 3300005618 Ga0068864_102206686 Ga0068864_1022066861 123
652 3300005834 Ga0068851_10429922 Ga0068851_104299222 123
653 3300005842 Ga0068858_100241085 Ga0068858_1002410852 123
654 3300005843 Ga0068860_100119367 Ga0068860_1001193672 123
655 3300005844 Ga0068862_101534607 Ga0068862_1015346072 123
656 3300006237 Ga0097621_100040163 Ga0097621_1000401632 123
657 3300006237 Ga0097621_101176887 Ga0097621_1011768872 123
658 3300006931 Ga0097620_100948153 Ga0097620_1009481531 123
659 3300009101 Ga0105247_10039681 Ga0105247_100396812 123
660 3300009176 Ga0105242_11026511 Ga0105242_110265111 123
661 3300009177 Ga0105248_10797074 Ga0105248_107970742 123
662 3300009551 Ga0105238_12618648 Ga0105238_126186481 123
663 3300013296 Ga0157374_10592825 Ga0157374_105928251 123
664 3300013297 Ga0157378_10311311 Ga0157378_103113111 123
665 3300013297 Ga0157378_10841609 Ga0157378_108416092 123
666 3300013306 Ga0163162_11728544 Ga0163162_117285442 123
667 3300013308 Ga0157375_10308011 Ga0157375_103080113 123
668 3300013308 Ga0157375_10966561 Ga0157375_109665612 123
669 3300014325 Ga0163163_10013902 Ga0163163_100139023 123
670 3300014968 Ga0157379_10051258 Ga0157379_100512583 123
671 3300014968 Ga0157379_10289830 Ga0157379_102898302 123
672 3300014969 Ga0157376_10169760 Ga0157376_101697603 123
673 3300014969 Ga0157376_10353454 Ga0157376_103534542 123
674 3300025900 Ga0207710_10027842 Ga0207710_100278421 123
675 3300025903 Ga0207680_10094918 Ga0207680_100949182 123
676 3300025909 Ga0207705_10118300 Ga0207705_101183002 123
677 3300025912 Ga0207707_10036682 Ga0207707_100366824 123
678 3300025912 Ga0207707_10927489 Ga0207707_109274892 123
679 3300025917 Ga0207660_10276408 Ga0207660_102764082 123
680 3300025917 Ga0207660_10825420 Ga0207660_108254202 123
681 3300025917 Ga0207660_10955996 Ga0207660_109559963 123
682 3300025918 Ga0207662_10510275 Ga0207662_105102752 123
683 3300025919 Ga0207657_10140279 Ga0207657_101402792 123
684 3300025919 Ga0207657_10342007 Ga0207657_103420072 123
685 3300025921 Ga0207652_10099452 Ga0207652_100994522 123
686 3300025921 Ga0207652_10592423 Ga0207652_105924232 123
687 3300025921 Ga0207652_11111077 Ga0207652_111110772 123
688 3300025924 Ga0207694_10921567 Ga0207694_109215672 123
689 3300025926 Ga0207659_10001674 Ga0207659_1000167413 123
690 3300025926 Ga0207659_10247927 Ga0207659_102479272 123
691 3300025932 Ga0207690_11396297 Ga0207690_113962971 123
692 3300025940 Ga0207691_10385754 Ga0207691_103857542 123
693 3300025941 Ga0207711_10570936 Ga0207711_105709362 123
694 3300025941 Ga0207711_10603451 Ga0207711_106034512 123
695 3300025942 Ga0207689_10599422 Ga0207689_105994222 123
696 3300025949 Ga0207667_10273595 Ga0207667_102735953 123
697 3300026023 Ga0207677_10362046 Ga0207677_103620462 123
698 3300026035 Ga0207703_11768276 Ga0207703_117682761 123
699 3300026075 Ga0207708_10400095 Ga0207708_104000952 123
700 3300026088 Ga0207641_11344892 Ga0207641_113448921 123
701 3300026142 Ga0207698_10196373 Ga0207698_101963731 123
702 3300028381 Ga0268264_10827074 Ga0268264_108270741 123
703 3300031824 Ga0307413_10435117 Ga0307413_104351172 123
704 3300031852 Ga0307410_10259844 Ga0307410_102598442 123
705 3300032005 Ga0307411_10145071 Ga0307411_101450712 123
706 3300035117 Ga0373953_0476259 Ga0373953_0476259_162_533 123
707 3300035119 Ga0373956_0283840 Ga0373956_0283840_39_425 123
708 3300035120 Ga0373957_0252072 Ga0373957_0252072_118_513 123
709 3300035172 Ga0373955_0140934 Ga0373955_0140934_574_966 123
710 3300035172 Ga0373955_0261993 Ga0373955_0261993_430_804 123
711 3300035172 Ga0373955_0778766 Ga0373955_0778766_49_420 123
712 3300035410 Ga0373924_0399003 Ga0373924_0399003_11_397 123
713 3300035692 Ga0373935_0587622 Ga0373935_0587622_264_653 123
714 3300035725 Ga0373947_0917258 Ga0373947_0917258_204_575 123
715 3300036401 Ga0373937_0303068 Ga0373937_0303068_159_530 123
716 3300036401 Ga0373937_1203240 Ga0373937_1203240_88_480 123
717 3300036401 Ga0373937_1511974 Ga0373937_1511974_60_458 123
718 3300046516 Ga0495628_0361711 Ga0495628_0361711_475_867 123
719 3300046691 Ga0495670_0312830 Ga0495670_0312830_409_786 123
720 3300048904 Ga0496101_0555387 Ga0496101_0555387_143_517 123
721 3300048907 Ga0496104_0905721 Ga0496104_0905721_360_734 123
722 3300048917 Ga0496114_0667892 Ga0496114_0667892_245_619 123
723 3300049521 Ga0501298_169502 Ga0501298_169502_86_463 123
724 3300049576 Ga0501040_0412101 Ga0501040_0412101_331_717 123
725 3300049590 Ga0501074_0160452 Ga0501074_0160452_396_782 123
726 3300049591 Ga0501075_0013330 Ga0501075_0013330_2618_3004 123
727 3300049679 Ga0501249_025503 Ga0501249_025503_536_910 123
728 3300049706 Ga0501229_011645 Ga0501229_011645_95_469 123
729 3300049743 Ga0501081_0035672 Ga0501081_0035672_363_749 123
730 3300049744 Ga0501083_0203036 Ga0501083_0203036_102_476 123
731 3300049824 Ga0501045_0069253 Ga0501045_0069253_795_1181 123
732 3300053077 Ga0495601_0230088 Ga0495601_0230088_380_751 123
733 3300053084 Ga0495595_0201711 Ga0495595_0201711_167_538 123
734 3300053085 Ga0495619_0982521 Ga0495619_0982521_162_533 123
735 3300054114 Ga0501084_0119412 Ga0501084_0119412_79_465 123
736 3300002459 JGI24751J29686_10006594 JGI24751J29686_100065943 124
737 3300002459 JGI24751J29686_10052539 JGI24751J29686_100525391 124
738 3300003203 JGI25406J46586_10000248 JGI25406J46586_1000024817 124
739 3300005288 Ga0065714_10127719 Ga0065714_101277192 124
740 3300005290 Ga0065712_10001548 Ga0065712_1000154812 124
741 3300005290 Ga0065712_10077635 Ga0065712_100776352 124
742 3300005290 Ga0065712_10079198 Ga0065712_100791982 124
743 3300005293 Ga0065715_10018291 Ga0065715_100182911 124
744 3300005293 Ga0065715_10172584 Ga0065715_101725842 124
745 3300005293 Ga0065715_10179017 Ga0065715_101790171 124
746 3300005328 Ga0070676_10209847 Ga0070676_102098472 124
747 3300005330 Ga0070690_100080496 Ga0070690_1000804961 124
748 3300005330 Ga0070690_100674151 Ga0070690_1006741512 124
749 3300005331 Ga0070670_100014409 Ga0070670_1000144097 124
750 3300005331 Ga0070670_102191482 Ga0070670_1021914821 124
751 3300005333 Ga0070677_10156520 Ga0070677_101565202 124
752 3300005334 Ga0068869_100358559 Ga0068869_1003585591 124
753 3300005334 Ga0068869_101839424 Ga0068869_1018394242 124
754 3300005335 Ga0070666_10785532 Ga0070666_107855321 124
755 3300005336 Ga0070680_100446842 Ga0070680_1004468422 124
756 3300005337 Ga0070682_100273060 Ga0070682_1002730602 124
757 3300005337 Ga0070682_100787575 Ga0070682_1007875752 124
758 3300005337 Ga0070682_101998506 Ga0070682_1019985062 124
759 3300005339 Ga0070660_100056197 Ga0070660_1000561972 124
760 3300005340 Ga0070689_100074592 Ga0070689_1000745922 124
761 3300005341 Ga0070691_10025543 Ga0070691_100255432 124
762 3300005343 Ga0070687_100213093 Ga0070687_1002130931 124
763 3300005345 Ga0070692_10229849 Ga0070692_102298491 124
764 3300005345 Ga0070692_11009642 Ga0070692_110096421 124
765 3300005347 Ga0070668_101208751 Ga0070668_1012087511 124
766 3300005353 Ga0070669_100003388 Ga0070669_10000338812 124
767 3300005353 Ga0070669_100132753 Ga0070669_1001327532 124
768 3300005354 Ga0070675_100058207 Ga0070675_1000582072 124
769 3300005354 Ga0070675_100061685 Ga0070675_1000616852 124
770 3300005354 Ga0070675_100065156 Ga0070675_1000651564 124
771 3300005356 Ga0070674_100000091 Ga0070674_10000009119 124
772 3300005356 Ga0070674_100976164 Ga0070674_1009761642 124
773 3300005364 Ga0070673_100064090 Ga0070673_1000640902 124
774 3300005364 Ga0070673_100115693 Ga0070673_1001156932 124
775 3300005364 Ga0070673_100256640 Ga0070673_1002566401 124
776 3300005365 Ga0070688_100035670 Ga0070688_1000356702 124
777 3300005365 Ga0070688_100764252 Ga0070688_1007642522 124
778 3300005366 Ga0070659_100064104 Ga0070659_1000641044 124
779 3300005366 Ga0070659_101226091 Ga0070659_1012260911 124
780 3300005367 Ga0070667_102366990 Ga0070667_1023669901 124
781 3300005434 Ga0070709_10052217 Ga0070709_100522173 124
782 3300005436 Ga0070713_100920896 Ga0070713_1009208963 124
783 3300005438 Ga0070701_10278317 Ga0070701_102783171 124
784 3300005438 Ga0070701_10848691 Ga0070701_108486911 124
785 3300005439 Ga0070711_100471901 Ga0070711_1004719012 124
786 3300005439 Ga0070711_100526269 Ga0070711_1005262692 124
787 3300005440 Ga0070705_100005883 Ga0070705_1000058835 124
788 3300005440 Ga0070705_101888596 Ga0070705_1018885961 124
789 3300005441 Ga0070700_100008279 Ga0070700_1000082792 124
790 3300005441 Ga0070700_100246215 Ga0070700_1002462152 124
791 3300005441 Ga0070700_100280663 Ga0070700_1002806632 124
792 3300005441 Ga0070700_101291097 Ga0070700_1012910971 124
793 3300005444 Ga0070694_100907374 Ga0070694_1009073741 124
794 3300005457 Ga0070662_100299493 Ga0070662_1002994931 124
795 3300005457 Ga0070662_100515026 Ga0070662_1005150263 124
796 3300005457 Ga0070662_100868438 Ga0070662_1008684382 124
797 3300005458 Ga0070681_10046585 Ga0070681_100465857 124
798 3300005459 Ga0068867_100066459 Ga0068867_1000664592 124
799 3300005459 Ga0068867_100438783 Ga0068867_1004387832 124
800 3300005466 Ga0070685_10066483 Ga0070685_100664833 124
801 3300005468 Ga0070707_101321307 Ga0070707_1013213071 124
802 3300005471 Ga0070698_102045601 Ga0070698_1020456011 124
803 3300005530 Ga0070679_100269725 Ga0070679_1002697252 124
804 3300005539 Ga0068853_102099929 Ga0068853_1020999292 124
805 3300005543 Ga0070672_100111434 Ga0070672_1001114342 124
806 3300005544 Ga0070686_100048973 Ga0070686_1000489733 124
807 3300005544 Ga0070686_100167695 Ga0070686_1001676952 124
808 3300005545 Ga0070695_100036742 Ga0070695_1000367422 124
809 3300005546 Ga0070696_100028838 Ga0070696_1000288382 124
810 3300005549 Ga0070704_100010100 Ga0070704_1000101003 124
811 3300005549 Ga0070704_101294147 Ga0070704_1012941472 124
812 3300005549 Ga0070704_101359871 Ga0070704_1013598712 124
813 3300005563 Ga0068855_101854580 Ga0068855_1018545802 124
814 3300005563 Ga0068855_102177151 Ga0068855_1021771512 124
815 3300005564 Ga0070664_100020626 Ga0070664_1000206264 124
816 3300005564 Ga0070664_100319159 Ga0070664_1003191592 124
817 3300005577 Ga0068857_102498385 Ga0068857_1024983851 124
818 3300005615 Ga0070702_100000625 Ga0070702_1000006252 124
819 3300005617 Ga0068859_100006458 Ga0068859_10000645813 124
820 3300005617 Ga0068859_100093941 Ga0068859_1000939414 124
821 3300005617 Ga0068859_100109529 Ga0068859_1001095293 124
822 3300005618 Ga0068864_100010624 Ga0068864_1000106242 124
823 3300005618 Ga0068864_100404833 Ga0068864_1004048332 124
824 3300005718 Ga0068866_10538031 Ga0068866_105380312 124
825 3300005718 Ga0068866_11006828 Ga0068866_110068282 124
826 3300005719 Ga0068861_100004292 Ga0068861_10000429211 124
827 3300005719 Ga0068861_101693108 Ga0068861_1016931081 124
828 3300005840 Ga0068870_10392479 Ga0068870_103924792 124
829 3300005841 Ga0068863_100237071 Ga0068863_1002370712 124
830 3300005841 Ga0068863_100521966 Ga0068863_1005219661 124
831 3300005842 Ga0068858_100010813 Ga0068858_1000108132 124
832 3300005843 Ga0068860_100403694 Ga0068860_1004036941 124
833 3300005843 Ga0068860_102254153 Ga0068860_1022541532 124
834 3300005844 Ga0068862_100026207 Ga0068862_1000262076 124
835 3300005937 Ga0081455_10056302 Ga0081455_100563022 124
836 3300005985 Ga0081539_10000090 Ga0081539_10000090183 124
837 3300005985 Ga0081539_10000649 Ga0081539_1000064936 124
838 3300006028 Ga0070717_10722868 Ga0070717_107228682 124
839 3300006042 Ga0075368_10053612 Ga0075368_100536122 124
840 3300006048 Ga0075363_100330301 Ga0075363_1003303011 124
841 3300006051 Ga0075364_10063700 Ga0075364_100637002 124
842 3300006178 Ga0075367_10038545 Ga0075367_100385453 124
843 3300006195 Ga0075366_10079063 Ga0075366_100790632 124
844 3300006195 Ga0075366_10647477 Ga0075366_106474772 124
845 3300006237 Ga0097621_100759185 Ga0097621_1007591852 124
846 3300006844 Ga0075428_100023619 Ga0075428_1000236193 124
847 3300006846 Ga0075430_100004097 Ga0075430_1000040974 124
848 3300006847 Ga0075431_100025373 Ga0075431_1000253734 124
849 3300006847 Ga0075431_100072066 Ga0075431_1000720663 124
850 3300006847 Ga0075431_100075412 Ga0075431_1000754123 124
851 3300006847 Ga0075431_101630017 Ga0075431_1016300172 124
852 3300006852 Ga0075433_10069622 Ga0075433_100696222 124
853 3300006852 Ga0075433_10397966 Ga0075433_103979661 124
854 3300006852 Ga0075433_11086375 Ga0075433_110863751 124
855 3300006871 Ga0075434_100044278 Ga0075434_1000442782 124
856 3300006871 Ga0075434_100064759 Ga0075434_1000647592 124
857 3300006880 Ga0075429_100038481 Ga0075429_1000384813 124
858 3300006880 Ga0075429_100199037 Ga0075429_1001990372 124
859 3300006880 Ga0075429_100236033 Ga0075429_1002360333 124
860 3300006880 Ga0075429_100984728 Ga0075429_1009847282 124
861 3300006880 Ga0075429_101759165 Ga0075429_1017591652 124
862 3300006881 Ga0068865_100143856 Ga0068865_1001438562 124
863 3300006914 Ga0075436_100034208 Ga0075436_1000342082 124
864 3300006931 Ga0097620_100006458 Ga0097620_10000645813 124
865 3300006931 Ga0097620_100093938 Ga0097620_1000939384 124
866 3300006931 Ga0097620_100109528 Ga0097620_1001095283 124
867 3300006931 Ga0097620_100296245 Ga0097620_1002962453 124
868 3300007076 Ga0075435_101309132 Ga0075435_1013091322 124
869 3300009094 Ga0111539_10015286 Ga0111539_100152863 124
870 3300009094 Ga0111539_10078739 Ga0111539_100787394 124
871 3300009094 Ga0111539_11479312 Ga0111539_114793122 124
872 3300009101 Ga0105247_10017021 Ga0105247_100170211 124
873 3300009147 Ga0114129_10105734 Ga0114129_101057343 124
874 3300009147 Ga0114129_10303454 Ga0114129_103034543 124
875 3300009147 Ga0114129_10464335 Ga0114129_104643352 124
876 3300009147 Ga0114129_10644141 Ga0114129_106441412 124
877 3300009148 Ga0105243_10155273 Ga0105243_101552732 124
878 3300009174 Ga0105241_10680023 Ga0105241_106800232 124
879 3300009176 Ga0105242_11473318 Ga0105242_114733181 124
880 3300009177 Ga0105248_10254620 Ga0105248_102546202 124
881 3300009177 Ga0105248_12047897 Ga0105248_120478971 124
882 3300009177 Ga0105248_12123984 Ga0105248_121239842 124
883 3300009177 Ga0105248_12177349 Ga0105248_121773492 124
884 3300009545 Ga0105237_10791424 Ga0105237_107914242 124
885 3300009551 Ga0105238_10567153 Ga0105238_105671532 124
886 3300009553 Ga0105249_10099145 Ga0105249_100991453 124
887 3300009553 Ga0105249_10891252 Ga0105249_108912522 124
888 3300009553 Ga0105249_10945030 Ga0105249_109450301 124
889 3300011119 Ga0105246_11095589 Ga0105246_110955892 124
890 3300013100 Ga0157373_10667413 Ga0157373_106674131 124
891 3300013105 Ga0157369_11833230 Ga0157369_118332301 124
892 3300013307 Ga0157372_10465805 Ga0157372_104658052 124
893 3300013308 Ga0157375_10304377 Ga0157375_103043772 124
894 3300014325 Ga0163163_10026560 Ga0163163_100265605 124
895 3300014325 Ga0163163_10145562 Ga0163163_101455622 124
896 3300014326 Ga0157380_10001120 Ga0157380_100011202 124
897 3300014326 Ga0157380_10045494 Ga0157380_100454941 124
898 3300014326 Ga0157380_10051365 Ga0157380_100513653 124
899 3300014968 Ga0157379_10331196 Ga0157379_103311963 124
900 3300025893 Ga0207682_10007672 Ga0207682_100076724 124
901 3300025898 Ga0207692_10436519 Ga0207692_104365191 124
902 3300025899 Ga0207642_10098183 Ga0207642_100981832 124
903 3300025906 Ga0207699_10044251 Ga0207699_100442513 124
904 3300025907 Ga0207645_10004409 Ga0207645_100044095 124
905 3300025907 Ga0207645_10030979 Ga0207645_100309794 124
906 3300025907 Ga0207645_10102441 Ga0207645_101024412 124
907 3300025908 Ga0207643_10213277 Ga0207643_102132771 124
908 3300025908 Ga0207643_10363404 Ga0207643_103634043 124
909 3300025911 Ga0207654_10731068 Ga0207654_107310681 124
910 3300025912 Ga0207707_10026199 Ga0207707_100261994 124
911 3300025913 Ga0207695_10455243 Ga0207695_104552432 124
912 3300025914 Ga0207671_10845904 Ga0207671_108459041 124
913 3300025916 Ga0207663_10897576 Ga0207663_108975762 124
914 3300025917 Ga0207660_10281074 Ga0207660_102810743 124
915 3300025918 Ga0207662_10043871 Ga0207662_100438712 124
916 3300025919 Ga0207657_10524204 Ga0207657_105242042 124
917 3300025920 Ga0207649_10306477 Ga0207649_103064772 124
918 3300025920 Ga0207649_11089690 Ga0207649_110896902 124
919 3300025921 Ga0207652_10049212 Ga0207652_100492125 124
920 3300025923 Ga0207681_10015905 Ga0207681_100159052 124
921 3300025923 Ga0207681_10057138 Ga0207681_100571383 124
922 3300025923 Ga0207681_10089547 Ga0207681_100895473 124
923 3300025925 Ga0207650_10001357 Ga0207650_100013572 124
924 3300025925 Ga0207650_10009031 Ga0207650_100090312 124
925 3300025926 Ga0207659_10078583 Ga0207659_100785832 124
926 3300025926 Ga0207659_10236618 Ga0207659_102366182 124
927 3300025928 Ga0207700_10727148 Ga0207700_107271481 124
928 3300025931 Ga0207644_10198864 Ga0207644_101988642 124
929 3300025932 Ga0207690_10340718 Ga0207690_103407182 124
930 3300025933 Ga0207706_10287602 Ga0207706_102876022 124
931 3300025936 Ga0207670_10512921 Ga0207670_105129211 124
932 3300025937 Ga0207669_10009114 Ga0207669_100091146 124
933 3300025937 Ga0207669_10749921 Ga0207669_107499211 124
934 3300025937 Ga0207669_11148462 Ga0207669_111484622 124
935 3300025938 Ga0207704_10029133 Ga0207704_100291332 124
936 3300025940 Ga0207691_10136581 Ga0207691_101365812 124
937 3300025941 Ga0207711_10042075 Ga0207711_100420753 124
938 3300025942 Ga0207689_11405692 Ga0207689_114056922 124
939 3300025945 Ga0207679_10024525 Ga0207679_100245252 124
940 3300025949 Ga0207667_11668369 Ga0207667_116683692 124
941 3300025960 Ga0207651_10077267 Ga0207651_100772672 124
942 3300025960 Ga0207651_10646127 Ga0207651_106461272 124
943 3300025961 Ga0207712_10068046 Ga0207712_100680463 124
944 3300025961 Ga0207712_10942657 Ga0207712_109426572 124
945 3300025972 Ga0207668_10100658 Ga0207668_101006583 124
946 3300026035 Ga0207703_10081327 Ga0207703_100813272 124
947 3300026035 Ga0207703_10711778 Ga0207703_107117782 124
948 3300026075 Ga0207708_10006212 Ga0207708_100062123 124
949 3300026075 Ga0207708_10228303 Ga0207708_102283032 124
950 3300026075 Ga0207708_10402365 Ga0207708_104023651 124
951 3300026075 Ga0207708_10606101 Ga0207708_106061012 124
952 3300026075 Ga0207708_10731554 Ga0207708_107315542 124
953 3300026078 Ga0207702_10575086 Ga0207702_105750861 124
954 3300026088 Ga0207641_10147915 Ga0207641_101479152 124
955 3300026088 Ga0207641_10521286 Ga0207641_105212862 124
956 3300026089 Ga0207648_10089858 Ga0207648_100898582 124
957 3300026095 Ga0207676_10036492 Ga0207676_100364921 124
958 3300026095 Ga0207676_11915693 Ga0207676_119156932 124
959 3300026116 Ga0207674_10103741 Ga0207674_101037413 124
960 3300026116 Ga0207674_10375909 Ga0207674_103759092 124
961 3300026118 Ga0207675_100001984 Ga0207675_1000019842 124
962 3300026118 Ga0207675_101361243 Ga0207675_1013612432 124
963 3300027866 Ga0209813_10217466 Ga0209813_102174661 124
964 3300027907 Ga0207428_10338042 Ga0207428_103380422 124
965 3300028380 Ga0268265_10028514 Ga0268265_100285144 124
966 3300028380 Ga0268265_10458522 Ga0268265_104585221 124
967 3300028380 Ga0268265_10912867 Ga0268265_109128672 124
968 3300028381 Ga0268264_10806797 Ga0268264_108067971 124
969 3300028381 Ga0268264_11384091 Ga0268264_113840912 124
970 3300032005 Ga0307411_10682661 Ga0307411_106826612 124
971 3300035691 Ga0373931_0521377 Ga0373931_0521377_103_477 124
972 3300041997 Ga0439431_0027667 Ga0439431_0027667_205_609 124
973 3300042004 Ga0439445_0043161 Ga0439445_0043161_92_496 124
974 3300046455 Ga0495603_0154718 Ga0495603_0154718_741_1121 124
975 3300046459 Ga0495629_0039644 Ga0495629_0039644_616_996 124
976 3300046535 Ga0495586_0667073 Ga0495586_0667073_175_552 124
977 3300046539 Ga0495621_0012653 Ga0495621_0012653_1015_1395 124
978 3300046539 Ga0495621_0081706 Ga0495621_0081706_790_1167 124
979 3300046539 Ga0495621_0161290 Ga0495621_0161290_134_523 124
980 3300047320 Ga0495672_0031959 Ga0495672_0031959_413_820 124
981 3300048907 Ga0496104_0208307 Ga0496104_0208307_822_1196 124
982 3300048909 Ga0496106_0129552 Ga0496106_0129552_1223_1597 124
983 3300048911 Ga0496108_0396358 Ga0496108_0396358_268_657 124
984 3300048912 Ga0496109_0042376 Ga0496109_0042376_1922_2305 124
985 3300048912 Ga0496109_0114683 Ga0496109_0114683_1537_1911 124
986 3300048913 Ga0496110_0306643 Ga0496110_0306643_850_1224 124
987 3300048914 Ga0496111_0352835 Ga0496111_0352835_284_658 124
988 3300048916 Ga0496113_0385631 Ga0496113_0385631_242_616 124
989 3300048916 Ga0496113_0998546 Ga0496113_0998546_260_643 124
990 3300049591 Ga0501075_0607778 Ga0501075_0607778_211_591 124
991 3300050491 nmdc:mga00v17_112166_c1 nmdc:mga00v17_112166_c1_1061_1468 124
992 3300050491 nmdc:mga00v17_68561_c1 nmdc:mga00v17_68561_c1_452_859 124
993 3300050493 nmdc:mga0k408_136798_c1 nmdc:mga0k408_136798_c1_780_1187 124
994 3300050494 nmdc:mga06z11_132588_c1 nmdc:mga06z11_132588_c1_711_1112 124
995 3300050494 nmdc:mga06z11_33068_c1 nmdc:mga06z11_33068_c1_1426_1833 124
996 3300050494 nmdc:mga06z11_47870_c1 nmdc:mga06z11_47870_c1_1359_1766 124
997 3300050495 nmdc:mga04h51_94307_c1 nmdc:mga04h51_94307_c1_629_1036 124
998 3300050507 nmdc:mga05p37_1215570_c1 nmdc:mga05p37_1215570_c1_178_561 124
999 3300050507 nmdc:mga05p37_137872_c1 nmdc:mga05p37_137872_c1_398_778 124
1000 3300050507 nmdc:mga05p37_93364_c1 nmdc:mga05p37_93364_c1_90_467 124
1001 3300050508 nmdc:mga09592_1495004_c1 nmdc:mga09592_1495004_c1_114_497 124
1002 3300050508 nmdc:mga09592_257964_c1 nmdc:mga09592_257964_c1_62_454 124
1003 3300050508 nmdc:mga09592_65218_c1 nmdc:mga09592_65218_c1_2341_2718 124
1004 3300050508 nmdc:mga09592_702093_c1 nmdc:mga09592_702093_c1_360_740 124
1005 3300050509 nmdc:mga0qj67_303095_c1 nmdc:mga0qj67_303095_c1_511_903 124
1006 3300050509 nmdc:mga0qj67_43508_c1 nmdc:mga0qj67_43508_c1_3034_3414 124
1007 3300050509 nmdc:mga0qj67_48387_c1 nmdc:mga0qj67_48387_c1_2361_2750 124
1008 3300050510 nmdc:mga06r32_24482_c1 nmdc:mga06r32_24482_c1_2604_2984 124
1009 3300050510 nmdc:mga06r32_59692_c1 nmdc:mga06r32_59692_c1_1560_1943 124
1010 3300050510 nmdc:mga06r32_671152_c1 nmdc:mga06r32_671152_c1_544_927 124
1011 3300050510 nmdc:mga06r32_706315_c1 nmdc:mga06r32_706315_c1_427_804 124
1012 3300050511 nmdc:mga08y16_240822_c1 nmdc:mga08y16_240822_c1_138_539 124
1013 3300050511 nmdc:mga08y16_57296_c1 nmdc:mga08y16_57296_c1_387_770 124
1014 3300050512 nmdc:mga0n895_117712_c1 nmdc:mga0n895_117712_c1_1375_1758 124
1015 3300050512 nmdc:mga0n895_21724_c1 nmdc:mga0n895_21724_c1_4387_4779 124
1016 3300050512 nmdc:mga0n895_43411_c1 nmdc:mga0n895_43411_c1_821_1246 124
1017 3300050513 nmdc:mga0rr50_480202_c1 nmdc:mga0rr50_480202_c1_99_497 124
1018 3300050513 nmdc:mga0rr50_81970_c1 nmdc:mga0rr50_81970_c1_1837_2262 124
1019 3300050513 nmdc:mga0rr50_949671_c1 nmdc:mga0rr50_949671_c1_29_421 124
1020 3300050514 nmdc:mga08x19_124725_c1 nmdc:mga08x19_124725_c1_1287_1712 124
1021 3300050515 nmdc:mga0a205_411460_c1 nmdc:mga0a205_411460_c1_244_618 124
1022 3300050515 nmdc:mga0a205_41338_c1 nmdc:mga0a205_41338_c1_453_845 124
1023 3300050515 nmdc:mga0a205_418782_c1 nmdc:mga0a205_418782_c1_112_489 124
1024 3300053103 Ga0500555_000534 Ga0500555_000534_8497_8889 124
1025 3300053116 Ga0500592_038539 Ga0500592_038539_157_549 124
1026 3300053139 Ga0500568_0001551 Ga0500568_0001551_11882_12289 124
1027 3300053153 Ga0500616_0001234 Ga0500616_0001234_8056_8475 124
1028 3300053730 Ga0500645_000765 Ga0500645_000765_14753_15145 124
1029 3300053736 Ga0500599_004568 Ga0500599_004568_1212_1637 124

Structural Annotation

Top 5 Hits

ID Description Score Start End
1m2d-assembly1.cif.gz_B crystal structure at 1.05 angstroms resolution of the cys59ser variant of the thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus 0.867 19 114
1m2b-assembly1.cif.gz_B crystal structure at 1.25 angstroms resolution of the cys55ser variant of the thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus 0.8611 19 114
8oh5-assembly1.cif.gz_B cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) 0.8582 20 115
5abr-assembly1.cif.gz_B structure of fesi protein from azotobacter vinelandii 0.85 19 114
1m2d-assembly1.cif.gz_B crystal structure at 1.05 angstroms resolution of the cys59ser variant of the thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus 0.8195 19 114
ID Description Score Start End Superfamily
af_Q55BP2_216_308_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8785 19 114 3.40.30.10
1m2dB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.867 19 114 3.40.30.10
af_Q55BP2_216_308_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8616 19 114 3.40.30.10
5abrB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.85 19 114 3.40.30.10
af_I1M6F2_186_285_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8388 19 112 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2V8GVT4-F1-model_v4 Ferredoxin 0.9918 1 118
AF-A0A3N5ZH83-F1-model_v4 (2Fe-2S) ferredoxin domain-containing protein 0.981 1 118
AF-A0A7W0FX34-F1-model_v4 (2Fe-2S) ferredoxin domain-containing protein 0.9807 5 118
AF-A0A2E5M0T9-F1-model_v4 Ferredoxin 0.9801 1 118
AF-A0A482UP77-F1-model_v4 Ferredoxin 0.9791 8 114

Feature Viewer

pLDDT pTM Quality
92.39 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map