F488567
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1029 | 362 | 1029 | 127 |
Family's Representative Sequence
| Representative Sequence | 3300005614|Ga0068856_100104531|Ga0068856_1001045312 |
| Length | 137 |
| Sequence | MDKLDKSGTLPEVAAKLGIGAYHRHVFLCTGDKCCTAEVGAAAWDVLKRELKDRGLSLLTGPNACYRTKVNCLRICQGGPIAVVYPEGTWYSGLTAERIPLFVRQHLVEGRPVAEWVFADNPLPNPADEPPKTPGPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 196 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 198 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 201 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 202 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 203 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 204 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 205 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 208 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 209 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 210 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 215 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 218 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 220 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 225 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 228 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 229 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 230 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 233 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 234 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 235 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 236 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 237 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 238 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 239 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 240 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 241 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 242 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 243 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 244 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 245 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 246 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 247 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 292 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 293 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 294 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 295 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 296 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 297 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 300 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 301 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 302 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 303 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 304 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 305 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 306 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 326 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 327 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 334 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 335 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 336 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 337 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 349 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 352 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 353 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 354 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 355 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 356 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 357 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 359 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 360 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 361 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.14 |
| Nodule | 0 |
| Rhizoplane | 2.53 |
| Rhizosphere | 95.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10006594 | 3300002459 | Bacteria | 2366 |
| 2 | JGI24751J29686_10052539 | 3300002459 | Unclassified | 840 |
| 3 | JGI25406J46586_10000248 | 3300003203 | Bacteria | 24008 |
| 4 | JGI25406J46586_10126970 | 3300003203 | Bacteria | 749 |
| 5 | Ga0065714_10127719 | 3300005288 | Unclassified | 1279 |
| 6 | Ga0065712_10001548 | 3300005290 | Bacteria | 12566 |
| 7 | Ga0065712_10077635 | 3300005290 | Bacteria | 3464 |
| 8 | Ga0065712_10079198 | 3300005290 | Bacteria | 3247 |
| 9 | Ga0065712_10163377 | 3300005290 | Bacteria | 1288 |
| 10 | Ga0065712_10683715 | 3300005290 | Bacteria | 553 |
| 11 | Ga0065715_10018291 | 3300005293 | Bacteria | 3300 |
| 12 | Ga0065715_10095978 | 3300005293 | Bacteria | 3966 |
| 13 | Ga0065715_10172584 | 3300005293 | Bacteria | 1535 |
| 14 | Ga0065715_10179017 | 3300005293 | Unclassified | 1490 |
| 15 | Ga0065715_10548009 | 3300005293 | Unclassified | 743 |
| 16 | Ga0065707_10506285 | 3300005295 | Bacteria | 750 |
| 17 | Ga0065707_11101634 | 3300005295 | Bacteria | 504 |
| 18 | Ga0070658_10848456 | 3300005327 | Bacteria | 794 |
| 19 | Ga0070676_10155330 | 3300005328 | Bacteria | 1468 |
| 20 | Ga0070676_10209847 | 3300005328 | Bacteria | 1281 |
| 21 | Ga0070690_100004503 | 3300005330 | Bacteria | 7750 |
| 22 | Ga0070690_100080496 | 3300005330 | Bacteria | 2131 |
| 23 | Ga0070690_100536427 | 3300005330 | Bacteria | 880 |
| 24 | Ga0070690_100674151 | 3300005330 | Bacteria | 792 |
| 25 | Ga0070670_100014409 | 3300005331 | Bacteria | 6785 |
| 26 | Ga0070670_102191482 | 3300005331 | Bacteria | 509 |
| 27 | Ga0070677_10156520 | 3300005333 | Bacteria | 1065 |
| 28 | Ga0070677_10280675 | 3300005333 | Bacteria | 839 |
| 29 | Ga0068869_100179391 | 3300005334 | Unclassified | 1660 |
| 30 | Ga0068869_100358559 | 3300005334 | Bacteria | 1190 |
| 31 | Ga0068869_100426904 | 3300005334 | Bacteria | 1095 |
| 32 | Ga0068869_101839424 | 3300005334 | Bacteria | 542 |
| 33 | Ga0070666_10057567 | 3300005335 | Bacteria | 2627 |
| 34 | Ga0070666_10305212 | 3300005335 | Bacteria | 1134 |
| 35 | Ga0070666_10700490 | 3300005335 | Bacteria | 743 |
| 36 | Ga0070666_10785532 | 3300005335 | Bacteria | 701 |
| 37 | Ga0070666_10816782 | 3300005335 | Bacteria | 687 |
| 38 | Ga0070680_100394798 | 3300005336 | Bacteria | 1179 |
| 39 | Ga0070680_100446842 | 3300005336 | Bacteria | 1104 |
| 40 | Ga0070680_100609710 | 3300005336 | Unclassified | 937 |
| 41 | Ga0070680_101462553 | 3300005336 | Unclassified | 592 |
| 42 | Ga0070682_100273060 | 3300005337 | Bacteria | 1229 |
| 43 | Ga0070682_100787575 | 3300005337 | Bacteria | 771 |
| 44 | Ga0070682_101998506 | 3300005337 | Unclassified | 510 |
| 45 | Ga0068868_100105604 | 3300005338 | Bacteria | 2284 |
| 46 | Ga0068868_100236938 | 3300005338 | Bacteria | 1532 |
| 47 | Ga0070660_100056197 | 3300005339 | Bacteria | 3044 |
| 48 | Ga0070660_100222973 | 3300005339 | Bacteria | 1533 |
| 49 | Ga0070689_100074592 | 3300005340 | Bacteria | 2654 |
| 50 | Ga0070689_101436049 | 3300005340 | Bacteria | 624 |
| 51 | Ga0070691_10025543 | 3300005341 | Bacteria | 2750 |
| 52 | Ga0070687_100213093 | 3300005343 | Bacteria | 1178 |
| 53 | Ga0070687_100773152 | 3300005343 | Unclassified | 678 |
| 54 | Ga0070692_10007969 | 3300005345 | Bacteria | 4699 |
| 55 | Ga0070692_10061545 | 3300005345 | Bacteria | 1979 |
| 56 | Ga0070692_10147036 | 3300005345 | Unclassified | 1339 |
| 57 | Ga0070692_10229849 | 3300005345 | Unclassified | 1101 |
| 58 | Ga0070692_10667186 | 3300005345 | Unclassified | 696 |
| 59 | Ga0070692_11009642 | 3300005345 | Bacteria | 582 |
| 60 | Ga0070668_100263317 | 3300005347 | Bacteria | 1434 |
| 61 | Ga0070668_101208751 | 3300005347 | Bacteria | 685 |
| 62 | Ga0070669_100003388 | 3300005353 | Bacteria | 11468 |
| 63 | Ga0070669_100068286 | 3300005353 | Bacteria | 2624 |
| 64 | Ga0070669_100132753 | 3300005353 | Bacteria | 1912 |
| 65 | Ga0070669_100193748 | 3300005353 | Bacteria | 1595 |
| 66 | Ga0070669_100297443 | 3300005353 | Unclassified | 1297 |
| 67 | Ga0070669_100370309 | 3300005353 | Unclassified | 1167 |
| 68 | Ga0070675_100000751 | 3300005354 | Bacteria | 22584 |
| 69 | Ga0070675_100029068 | 3300005354 | Bacteria | 4455 |
| 70 | Ga0070675_100058207 | 3300005354 | Bacteria | 3187 |
| 71 | Ga0070675_100061685 | 3300005354 | Bacteria | 3096 |
| 72 | Ga0070675_100065156 | 3300005354 | Bacteria | 3012 |
| 73 | Ga0070675_100363005 | 3300005354 | Bacteria | 1286 |
| 74 | Ga0070675_100475068 | 3300005354 | Bacteria | 1124 |
| 75 | Ga0070675_100785606 | 3300005354 | Bacteria | 870 |
| 76 | Ga0070671_100782237 | 3300005355 | Bacteria | 830 |
| 77 | Ga0070671_101160985 | 3300005355 | Unclassified | 679 |
| 78 | Ga0070674_100000091 | 3300005356 | Bacteria | 41986 |
| 79 | Ga0070674_100004723 | 3300005356 | Bacteria | 7798 |
| 80 | Ga0070674_100061123 | 3300005356 | Bacteria | 2628 |
| 81 | Ga0070674_100976164 | 3300005356 | Bacteria | 742 |
| 82 | Ga0070674_101006195 | 3300005356 | Bacteria | 732 |
| 83 | Ga0070673_100064090 | 3300005364 | Bacteria | 2926 |
| 84 | Ga0070673_100115693 | 3300005364 | Bacteria | 2230 |
| 85 | Ga0070673_100119771 | 3300005364 | Unclassified | 2194 |
| 86 | Ga0070673_100256640 | 3300005364 | Unclassified | 1526 |
| 87 | Ga0070673_100413409 | 3300005364 | Unclassified | 1208 |
| 88 | Ga0070688_100035670 | 3300005365 | Bacteria | 3022 |
| 89 | Ga0070688_100764252 | 3300005365 | Unclassified | 753 |
| 90 | Ga0070659_100064104 | 3300005366 | Bacteria | 2908 |
| 91 | Ga0070659_100884994 | 3300005366 | Bacteria | 780 |
| 92 | Ga0070659_101226091 | 3300005366 | Unclassified | 664 |
| 93 | Ga0070667_102366990 | 3300005367 | Bacteria | 500 |
| 94 | Ga0070703_10411627 | 3300005406 | Bacteria | 591 |
| 95 | Ga0070709_10052217 | 3300005434 | Unclassified | 2568 |
| 96 | Ga0070714_100052603 | 3300005435 | Bacteria | 3474 |
| 97 | Ga0070713_100084183 | 3300005436 | Bacteria | 2720 |
| 98 | Ga0070713_100920896 | 3300005436 | Bacteria | 841 |
| 99 | Ga0070701_10013001 | 3300005438 | Bacteria | 3775 |
| 100 | Ga0070701_10175578 | 3300005438 | Bacteria | 1250 |
| 101 | Ga0070701_10278317 | 3300005438 | Bacteria | 1021 |
| 102 | Ga0070701_10848691 | 3300005438 | Bacteria | 627 |
| 103 | Ga0070711_100471901 | 3300005439 | Bacteria | 1030 |
| 104 | Ga0070711_100526269 | 3300005439 | Unclassified | 978 |
| 105 | Ga0070705_100001204 | 3300005440 | Bacteria | 14089 |
| 106 | Ga0070705_100005883 | 3300005440 | Bacteria | 5996 |
| 107 | Ga0070705_100143667 | 3300005440 | Bacteria | 1574 |
| 108 | Ga0070705_100146809 | 3300005440 | Bacteria | 1559 |
| 109 | Ga0070705_100268547 | 3300005440 | Unclassified | 1207 |
| 110 | Ga0070705_101888596 | 3300005440 | Bacteria | 508 |
| 111 | Ga0070700_100008279 | 3300005441 | Bacteria | 5659 |
| 112 | Ga0070700_100206662 | 3300005441 | Bacteria | 1383 |
| 113 | Ga0070700_100246215 | 3300005441 | Bacteria | 1280 |
| 114 | Ga0070700_100280663 | 3300005441 | Bacteria | 1208 |
| 115 | Ga0070700_100512674 | 3300005441 | Bacteria | 925 |
| 116 | Ga0070700_100988232 | 3300005441 | Unclassified | 691 |
| 117 | Ga0070700_101291097 | 3300005441 | Bacteria | 613 |
| 118 | Ga0070694_100000199 | 3300005444 | Bacteria | 31924 |
| 119 | Ga0070694_100001846 | 3300005444 | Bacteria | 12549 |
| 120 | Ga0070694_100004226 | 3300005444 | Bacteria | 8637 |
| 121 | Ga0070694_100113500 | 3300005444 | Bacteria | 1933 |
| 122 | Ga0070694_100414031 | 3300005444 | Bacteria | 1058 |
| 123 | Ga0070694_100488410 | 3300005444 | Unclassified | 978 |
| 124 | Ga0070694_100878893 | 3300005444 | Unclassified | 739 |
| 125 | Ga0070694_100907374 | 3300005444 | Bacteria | 728 |
| 126 | Ga0070708_100260540 | 3300005445 | Bacteria | 1630 |
| 127 | Ga0070708_100790962 | 3300005445 | Bacteria | 892 |
| 128 | Ga0070708_101383389 | 3300005445 | Unclassified | 657 |
| 129 | Ga0070663_101718454 | 3300005455 | Bacteria | 561 |
| 130 | Ga0070678_100885776 | 3300005456 | Bacteria | 815 |
| 131 | Ga0070678_101327445 | 3300005456 | Bacteria | 670 |
| 132 | Ga0070662_100299493 | 3300005457 | Unclassified | 1306 |
| 133 | Ga0070662_100483752 | 3300005457 | Bacteria | 1031 |
| 134 | Ga0070662_100515026 | 3300005457 | Bacteria | 999 |
| 135 | Ga0070662_100868438 | 3300005457 | Bacteria | 769 |
| 136 | Ga0070662_101507269 | 3300005457 | Bacteria | 580 |
| 137 | Ga0070662_101999921 | 3300005457 | Bacteria | 501 |
| 138 | Ga0070681_10046585 | 3300005458 | Unclassified | 4335 |
| 139 | Ga0070681_10163198 | 3300005458 | Bacteria | 2152 |
| 140 | Ga0070681_10936329 | 3300005458 | Bacteria | 785 |
| 141 | Ga0068867_100066459 | 3300005459 | Bacteria | 2686 |
| 142 | Ga0068867_100098119 | 3300005459 | Bacteria | 2234 |
| 143 | Ga0068867_100438783 | 3300005459 | Bacteria | 1110 |
| 144 | Ga0070685_10000594 | 3300005466 | Bacteria | 20041 |
| 145 | Ga0070685_10001074 | 3300005466 | Bacteria | 14636 |
| 146 | Ga0070685_10066483 | 3300005466 | Bacteria | 2124 |
| 147 | Ga0070706_100009661 | 3300005467 | Bacteria | 8969 |
| 148 | Ga0070706_100286341 | 3300005467 | Bacteria | 1538 |
| 149 | Ga0070706_100453045 | 3300005467 | Bacteria | 1194 |
| 150 | Ga0070706_100753472 | 3300005467 | Unclassified | 902 |
| 151 | Ga0070707_100048198 | 3300005468 | Bacteria | 4081 |
| 152 | Ga0070707_100443789 | 3300005468 | Unclassified | 1258 |
| 153 | Ga0070707_101321307 | 3300005468 | Bacteria | 687 |
| 154 | Ga0070698_100003898 | 3300005471 | Bacteria | 16406 |
| 155 | Ga0070698_100015144 | 3300005471 | Bacteria | 8153 |
| 156 | Ga0070698_100035117 | 3300005471 | Bacteria | 5185 |
| 157 | Ga0070698_100263705 | 3300005471 | Bacteria | 1655 |
| 158 | Ga0070698_100698258 | 3300005471 | Bacteria | 956 |
| 159 | Ga0070698_100855633 | 3300005471 | Bacteria | 854 |
| 160 | Ga0070698_100885765 | 3300005471 | Bacteria | 838 |
| 161 | Ga0070698_102045601 | 3300005471 | Bacteria | 526 |
| 162 | Ga0070699_100000172 | 3300005518 | Bacteria | 62043 |
| 163 | Ga0070699_100029044 | 3300005518 | Bacteria | 4767 |
| 164 | Ga0070699_100044641 | 3300005518 | Bacteria | 3837 |
| 165 | Ga0070699_100251862 | 3300005518 | Unclassified | 1578 |
| 166 | Ga0070699_100670639 | 3300005518 | Unclassified | 947 |
| 167 | Ga0070699_100691403 | 3300005518 | Bacteria | 932 |
| 168 | Ga0070679_100269725 | 3300005530 | Bacteria | 1656 |
| 169 | Ga0070679_100295033 | 3300005530 | Bacteria | 1572 |
| 170 | Ga0070679_100639277 | 3300005530 | Bacteria | 1007 |
| 171 | Ga0070679_101016677 | 3300005530 | Bacteria | 773 |
| 172 | Ga0070697_100143099 | 3300005536 | Bacteria | 2012 |
| 173 | Ga0070697_100309850 | 3300005536 | Archaea | 1358 |
| 174 | Ga0070697_100434398 | 3300005536 | Bacteria | 1142 |
| 175 | Ga0070697_100918821 | 3300005536 | Unclassified | 777 |
| 176 | Ga0070697_101151830 | 3300005536 | Bacteria | 691 |
| 177 | Ga0070697_101242850 | 3300005536 | Bacteria | 664 |
| 178 | Ga0070697_101568853 | 3300005536 | Bacteria | 589 |
| 179 | Ga0068853_102099929 | 3300005539 | Unclassified | 548 |
| 180 | Ga0070672_100111434 | 3300005543 | Bacteria | 2231 |
| 181 | Ga0070672_100221817 | 3300005543 | Bacteria | 1586 |
| 182 | Ga0070672_101076358 | 3300005543 | Unclassified | 714 |
| 183 | Ga0070686_100000502 | 3300005544 | Bacteria | 23516 |
| 184 | Ga0070686_100048973 | 3300005544 | Bacteria | 2679 |
| 185 | Ga0070686_100167695 | 3300005544 | Bacteria | 1551 |
| 186 | Ga0070695_100000734 | 3300005545 | Bacteria | 17507 |
| 187 | Ga0070695_100009912 | 3300005545 | Bacteria | 5677 |
| 188 | Ga0070695_100019613 | 3300005545 | Bacteria | 4120 |
| 189 | Ga0070695_100036742 | 3300005545 | Bacteria | 3083 |
| 190 | Ga0070695_100405574 | 3300005545 | Unclassified | 1034 |
| 191 | Ga0070695_100791193 | 3300005545 | Bacteria | 759 |
| 192 | Ga0070696_100000175 | 3300005546 | Bacteria | 36851 |
| 193 | Ga0070696_100008142 | 3300005546 | Bacteria | 7012 |
| 194 | Ga0070696_100028771 | 3300005546 | Bacteria | 3792 |
| 195 | Ga0070696_100028838 | 3300005546 | Bacteria | 3788 |
| 196 | Ga0070696_100465175 | 3300005546 | Bacteria | 1000 |
| 197 | Ga0070665_100000734 | 3300005548 | Bacteria | 43660 |
| 198 | Ga0070665_100574112 | 3300005548 | Bacteria | 1140 |
| 199 | Ga0070704_100001693 | 3300005549 | Bacteria | 12006 |
| 200 | Ga0070704_100004420 | 3300005549 | Bacteria | 8119 |
| 201 | Ga0070704_100010100 | 3300005549 | Bacteria | 5740 |
| 202 | Ga0070704_100048652 | 3300005549 | Bacteria | 2969 |
| 203 | Ga0070704_100095094 | 3300005549 | Bacteria | 2231 |
| 204 | Ga0070704_100183958 | 3300005549 | Bacteria | 1674 |
| 205 | Ga0070704_100567072 | 3300005549 | Unclassified | 994 |
| 206 | Ga0070704_101256039 | 3300005549 | Bacteria | 677 |
| 207 | Ga0070704_101290213 | 3300005549 | Unclassified | 668 |
| 208 | Ga0070704_101294147 | 3300005549 | Bacteria | 667 |
| 209 | Ga0070704_101359871 | 3300005549 | Unclassified | 651 |
| 210 | Ga0068855_100029227 | 3300005563 | Bacteria | 6592 |
| 211 | Ga0068855_100108401 | 3300005563 | Unclassified | 3190 |
| 212 | Ga0068855_101854580 | 3300005563 | Bacteria | 612 |
| 213 | Ga0068855_102177151 | 3300005563 | Bacteria | 557 |
| 214 | Ga0070664_100020626 | 3300005564 | Bacteria | 5428 |
| 215 | Ga0070664_100319159 | 3300005564 | Unclassified | 1407 |
| 216 | Ga0068857_100260748 | 3300005577 | Bacteria | 1591 |
| 217 | Ga0068857_101560764 | 3300005577 | Unclassified | 644 |
| 218 | Ga0068857_102498385 | 3300005577 | Bacteria | 507 |
| 219 | Ga0068854_100126345 | 3300005578 | Unclassified | 1948 |
| 220 | Ga0068854_100497605 | 3300005578 | Bacteria | 1026 |
| 221 | Ga0068854_101292596 | 3300005578 | Unclassified | 656 |
| 222 | Ga0068856_100104531 | 3300005614 | Bacteria | 2826 |
| 223 | Ga0068856_102240776 | 3300005614 | Bacteria | 555 |
| 224 | Ga0070702_100000625 | 3300005615 | Bacteria | 13043 |
| 225 | Ga0070702_100010911 | 3300005615 | Bacteria | 4498 |
| 226 | Ga0070702_100225134 | 3300005615 | Bacteria | 1257 |
| 227 | Ga0068852_100223378 | 3300005616 | Bacteria | 1792 |
| 228 | Ga0068852_100584081 | 3300005616 | Unclassified | 1120 |
| 229 | Ga0068859_100000008 | 3300005617 | Bacteria | 383750 |
| 230 | Ga0068859_100006458 | 3300005617 | Bacteria | 11893 |
| 231 | Ga0068859_100006797 | 3300005617 | Bacteria | 11624 |
| 232 | Ga0068859_100093941 | 3300005617 | Unclassified | 3051 |
| 233 | Ga0068859_100109529 | 3300005617 | Bacteria | 2823 |
| 234 | Ga0068859_100401093 | 3300005617 | Bacteria | 1467 |
| 235 | Ga0068859_100466709 | 3300005617 | Unclassified | 1358 |
| 236 | Ga0068859_100532814 | 3300005617 | Unclassified | 1269 |
| 237 | Ga0068859_100948359 | 3300005617 | Bacteria | 944 |
| 238 | Ga0068859_101778746 | 3300005617 | Bacteria | 681 |
| 239 | Ga0068864_100010624 | 3300005618 | Bacteria | 7609 |
| 240 | Ga0068864_100091080 | 3300005618 | Bacteria | 2689 |
| 241 | Ga0068864_100404833 | 3300005618 | Bacteria | 1297 |
| 242 | Ga0068864_102206686 | 3300005618 | Unclassified | 557 |
| 243 | Ga0068866_10538031 | 3300005718 | Unclassified | 779 |
| 244 | Ga0068866_11006828 | 3300005718 | Bacteria | 592 |
| 245 | Ga0068861_100001159 | 3300005719 | Bacteria | 16417 |
| 246 | Ga0068861_100004292 | 3300005719 | Bacteria | 9564 |
| 247 | Ga0068861_100028621 | 3300005719 | Bacteria | 4067 |
| 248 | Ga0068861_100044659 | 3300005719 | Bacteria | 3333 |
| 249 | Ga0068861_100154551 | 3300005719 | Bacteria | 1886 |
| 250 | Ga0068861_100260019 | 3300005719 | Unclassified | 1486 |
| 251 | Ga0068861_100302041 | 3300005719 | Bacteria | 1387 |
| 252 | Ga0068861_100647014 | 3300005719 | Unclassified | 976 |
| 253 | Ga0068861_101154897 | 3300005719 | Bacteria | 747 |
| 254 | Ga0068861_101693108 | 3300005719 | Bacteria | 625 |
| 255 | Ga0068851_10137939 | 3300005834 | Bacteria | 1324 |
| 256 | Ga0068851_10429922 | 3300005834 | Bacteria | 781 |
| 257 | Ga0068870_10154125 | 3300005840 | Unclassified | 1356 |
| 258 | Ga0068870_10392479 | 3300005840 | Unclassified | 901 |
| 259 | Ga0068863_100073259 | 3300005841 | Bacteria | 3240 |
| 260 | Ga0068863_100237071 | 3300005841 | Bacteria | 1761 |
| 261 | Ga0068863_100295672 | 3300005841 | Bacteria | 1570 |
| 262 | Ga0068863_100521966 | 3300005841 | Unclassified | 1171 |
| 263 | Ga0068863_100639108 | 3300005841 | Bacteria | 1055 |
| 264 | Ga0068863_100895698 | 3300005841 | Unclassified | 887 |
| 265 | Ga0068858_100010813 | 3300005842 | Bacteria | 8628 |
| 266 | Ga0068858_100018287 | 3300005842 | Bacteria | 6562 |
| 267 | Ga0068858_100049229 | 3300005842 | Bacteria | 3903 |
| 268 | Ga0068858_100119856 | 3300005842 | Unclassified | 2460 |
| 269 | Ga0068858_100241085 | 3300005842 | Bacteria | 1716 |
| 270 | Ga0068858_101580208 | 3300005842 | Bacteria | 647 |
| 271 | Ga0068860_100059006 | 3300005843 | Bacteria | 3649 |
| 272 | Ga0068860_100119367 | 3300005843 | Bacteria | 2524 |
| 273 | Ga0068860_100137849 | 3300005843 | Bacteria | 2344 |
| 274 | Ga0068860_100182395 | 3300005843 | Bacteria | 2029 |
| 275 | Ga0068860_100257094 | 3300005843 | Bacteria | 1702 |
| 276 | Ga0068860_100403694 | 3300005843 | Bacteria | 1352 |
| 277 | Ga0068860_101870211 | 3300005843 | Unclassified | 622 |
| 278 | Ga0068860_102063357 | 3300005843 | Bacteria | 591 |
| 279 | Ga0068860_102254153 | 3300005843 | Bacteria | 565 |
| 280 | Ga0068862_100026207 | 3300005844 | Bacteria | 4900 |
| 281 | Ga0068862_100064665 | 3300005844 | Bacteria | 3149 |
| 282 | Ga0068862_101490565 | 3300005844 | Unclassified | 682 |
| 283 | Ga0068862_101534607 | 3300005844 | Bacteria | 672 |
| 284 | Ga0081455_10056302 | 3300005937 | Unclassified | 3340 |
| 285 | Ga0081539_10000090 | 3300005985 | Bacteria | 212006 |
| 286 | Ga0081539_10000649 | 3300005985 | Bacteria | 69909 |
| 287 | Ga0081539_10005585 | 3300005985 | Bacteria | 12705 |
| 288 | Ga0070717_10672534 | 3300006028 | Bacteria | 940 |
| 289 | Ga0070717_10722868 | 3300006028 | Bacteria | 905 |
| 290 | Ga0075368_10053612 | 3300006042 | Bacteria | 1606 |
| 291 | Ga0075363_100330301 | 3300006048 | Bacteria | 888 |
| 292 | Ga0075364_10063700 | 3300006051 | Bacteria | 2421 |
| 293 | Ga0070715_10017875 | 3300006163 | Bacteria | 2691 |
| 294 | Ga0070715_10158890 | 3300006163 | Bacteria | 1115 |
| 295 | Ga0070716_100106522 | 3300006173 | Unclassified | 1729 |
| 296 | Ga0070716_100338310 | 3300006173 | Unclassified | 1061 |
| 297 | Ga0070712_100547834 | 3300006175 | Bacteria | 974 |
| 298 | Ga0075367_10038545 | 3300006178 | Bacteria | 2782 |
| 299 | Ga0075366_10079063 | 3300006195 | Bacteria | 1963 |
| 300 | Ga0075366_10647477 | 3300006195 | Unclassified | 656 |
| 301 | Ga0097621_100005878 | 3300006237 | Bacteria | 8668 |
| 302 | Ga0097621_100026029 | 3300006237 | Bacteria | 4584 |
| 303 | Ga0097621_100040163 | 3300006237 | Bacteria | 3761 |
| 304 | Ga0097621_100100709 | 3300006237 | Bacteria | 2430 |
| 305 | Ga0097621_100154032 | 3300006237 | Bacteria | 1972 |
| 306 | Ga0097621_100754788 | 3300006237 | Bacteria | 899 |
| 307 | Ga0097621_100759185 | 3300006237 | Unclassified | 896 |
| 308 | Ga0097621_101034887 | 3300006237 | Bacteria | 769 |
| 309 | Ga0097621_101176887 | 3300006237 | Unclassified | 722 |
| 310 | Ga0068871_100000602 | 3300006358 | Bacteria | 24717 |
| 311 | Ga0068871_100251826 | 3300006358 | Bacteria | 1538 |
| 312 | Ga0068871_100306734 | 3300006358 | Bacteria | 1395 |
| 313 | Ga0075428_100000034 | 3300006844 | Bacteria | 115982 |
| 314 | Ga0075428_100015342 | 3300006844 | Bacteria | 8496 |
| 315 | Ga0075428_100019087 | 3300006844 | Bacteria | 7582 |
| 316 | Ga0075428_100023619 | 3300006844 | Bacteria | 6806 |
| 317 | Ga0075428_100058014 | 3300006844 | Bacteria | 4238 |
| 318 | Ga0075428_100068181 | 3300006844 | Bacteria | 3892 |
| 319 | Ga0075428_100083818 | 3300006844 | Bacteria | 3478 |
| 320 | Ga0075430_100004097 | 3300006846 | Bacteria | 12298 |
| 321 | Ga0075430_100012800 | 3300006846 | Bacteria | 7147 |
| 322 | Ga0075430_100174248 | 3300006846 | Unclassified | 1790 |
| 323 | Ga0075430_100311079 | 3300006846 | Bacteria | 1303 |
| 324 | Ga0075430_100412544 | 3300006846 | Bacteria | 1115 |
| 325 | Ga0075431_100025373 | 3300006847 | Bacteria | 6076 |
| 326 | Ga0075431_100032521 | 3300006847 | Bacteria | 5375 |
| 327 | Ga0075431_100072066 | 3300006847 | Bacteria | 3565 |
| 328 | Ga0075431_100075412 | 3300006847 | Unclassified | 3480 |
| 329 | Ga0075431_100631749 | 3300006847 | Bacteria | 1052 |
| 330 | Ga0075431_100905560 | 3300006847 | Bacteria | 851 |
| 331 | Ga0075431_101630017 | 3300006847 | Bacteria | 603 |
| 332 | Ga0075433_10051253 | 3300006852 | Bacteria | 3594 |
| 333 | Ga0075433_10059425 | 3300006852 | Unclassified | 3345 |
| 334 | Ga0075433_10069622 | 3300006852 | Bacteria | 3090 |
| 335 | Ga0075433_10104324 | 3300006852 | Bacteria | 2512 |
| 336 | Ga0075433_10164534 | 3300006852 | Bacteria | 1974 |
| 337 | Ga0075433_10337038 | 3300006852 | Unclassified | 1333 |
| 338 | Ga0075433_10380038 | 3300006852 | Bacteria | 1247 |
| 339 | Ga0075433_10397966 | 3300006852 | Unclassified | 1215 |
| 340 | Ga0075433_10569701 | 3300006852 | Bacteria | 995 |
| 341 | Ga0075433_11086375 | 3300006852 | Unclassified | 696 |
| 342 | Ga0075434_100044278 | 3300006871 | Bacteria | 4415 |
| 343 | Ga0075434_100058856 | 3300006871 | Bacteria | 3819 |
| 344 | Ga0075434_100064759 | 3300006871 | Bacteria | 3640 |
| 345 | Ga0075434_100097090 | 3300006871 | Bacteria | 2951 |
| 346 | Ga0075434_100105006 | 3300006871 | Unclassified | 2835 |
| 347 | Ga0075434_100197349 | 3300006871 | Bacteria | 2032 |
| 348 | Ga0075434_101589033 | 3300006871 | Bacteria | 662 |
| 349 | Ga0075429_100022058 | 3300006880 | Bacteria | 5522 |
| 350 | Ga0075429_100031390 | 3300006880 | Bacteria | 4616 |
| 351 | Ga0075429_100038481 | 3300006880 | Bacteria | 4164 |
| 352 | Ga0075429_100039747 | 3300006880 | Bacteria | 4094 |
| 353 | Ga0075429_100129403 | 3300006880 | Bacteria | 2208 |
| 354 | Ga0075429_100199037 | 3300006880 | Bacteria | 1755 |
| 355 | Ga0075429_100236033 | 3300006880 | Bacteria | 1602 |
| 356 | Ga0075429_100605818 | 3300006880 | Bacteria | 960 |
| 357 | Ga0075429_100970906 | 3300006880 | Bacteria | 743 |
| 358 | Ga0075429_100984728 | 3300006880 | Bacteria | 737 |
| 359 | Ga0075429_101507501 | 3300006880 | Unclassified | 585 |
| 360 | Ga0075429_101759165 | 3300006880 | Bacteria | 538 |
| 361 | Ga0068865_100143856 | 3300006881 | Bacteria | 1801 |
| 362 | Ga0068865_100153523 | 3300006881 | Bacteria | 1749 |
| 363 | Ga0068865_100708334 | 3300006881 | Unclassified | 861 |
| 364 | Ga0075436_100002680 | 3300006914 | Bacteria | 12249 |
| 365 | Ga0075436_100034208 | 3300006914 | Bacteria | 3504 |
| 366 | Ga0075436_100035265 | 3300006914 | Bacteria | 3452 |
| 367 | Ga0075436_100212250 | 3300006914 | Unclassified | 1372 |
| 368 | Ga0097620_100000008 | 3300006931 | Bacteria | 383750 |
| 369 | Ga0097620_100006458 | 3300006931 | Bacteria | 11893 |
| 370 | Ga0097620_100006797 | 3300006931 | Bacteria | 11624 |
| 371 | Ga0097620_100093938 | 3300006931 | Unclassified | 3051 |
| 372 | Ga0097620_100109528 | 3300006931 | Bacteria | 2823 |
| 373 | Ga0097620_100296245 | 3300006931 | Bacteria | 1711 |
| 374 | Ga0097620_100401074 | 3300006931 | Bacteria | 1467 |
| 375 | Ga0097620_100466733 | 3300006931 | Unclassified | 1358 |
| 376 | Ga0097620_100532784 | 3300006931 | Unclassified | 1269 |
| 377 | Ga0097620_100948153 | 3300006931 | Bacteria | 944 |
| 378 | Ga0097620_101778745 | 3300006931 | Bacteria | 681 |
| 379 | Ga0075435_100000698 | 3300007076 | Bacteria | 20815 |
| 380 | Ga0075435_100009571 | 3300007076 | Bacteria | 7029 |
| 381 | Ga0075435_100056808 | 3300007076 | Bacteria | 3164 |
| 382 | Ga0075435_100072244 | 3300007076 | Bacteria | 2818 |
| 383 | Ga0075435_100111403 | 3300007076 | Bacteria | 2277 |
| 384 | Ga0075435_100900372 | 3300007076 | Bacteria | 771 |
| 385 | Ga0075435_101309132 | 3300007076 | Bacteria | 635 |
| 386 | Ga0075435_101963055 | 3300007076 | Unclassified | 514 |
| 387 | Ga0105240_10006149 | 3300009093 | Bacteria | 17704 |
| 388 | Ga0105240_10093322 | 3300009093 | Bacteria | 3674 |
| 389 | Ga0105240_10143693 | 3300009093 | Bacteria | 2850 |
| 390 | Ga0111539_10000014 | 3300009094 | Bacteria | 307501 |
| 391 | Ga0111539_10000556 | 3300009094 | Bacteria | 47801 |
| 392 | Ga0111539_10000736 | 3300009094 | Bacteria | 42606 |
| 393 | Ga0111539_10000850 | 3300009094 | Bacteria | 39822 |
| 394 | Ga0111539_10015286 | 3300009094 | Bacteria | 9561 |
| 395 | Ga0111539_10078739 | 3300009094 | Bacteria | 3877 |
| 396 | Ga0111539_10303238 | 3300009094 | Unclassified | 1859 |
| 397 | Ga0111539_10754590 | 3300009094 | Bacteria | 1132 |
| 398 | Ga0111539_11479312 | 3300009094 | Bacteria | 788 |
| 399 | Ga0105245_11212716 | 3300009098 | Unclassified | 802 |
| 400 | Ga0105245_11346693 | 3300009098 | Unclassified | 763 |
| 401 | Ga0105247_10017021 | 3300009101 | Bacteria | 4362 |
| 402 | Ga0105247_10037495 | 3300009101 | Bacteria | 2958 |
| 403 | Ga0105247_10039681 | 3300009101 | Unclassified | 2876 |
| 404 | Ga0105247_10217180 | 3300009101 | Bacteria | 1292 |
| 405 | Ga0105247_10369425 | 3300009101 | Bacteria | 1014 |
| 406 | Ga0105247_10941423 | 3300009101 | Bacteria | 670 |
| 407 | Ga0114129_10001136 | 3300009147 | Bacteria | 35167 |
| 408 | Ga0114129_10001786 | 3300009147 | Bacteria | 29296 |
| 409 | Ga0114129_10003695 | 3300009147 | Bacteria | 21549 |
| 410 | Ga0114129_10003962 | 3300009147 | Bacteria | 20914 |
| 411 | Ga0114129_10028396 | 3300009147 | Bacteria | 7928 |
| 412 | Ga0114129_10034877 | 3300009147 | Bacteria | 7108 |
| 413 | Ga0114129_10063645 | 3300009147 | Bacteria | 5149 |
| 414 | Ga0114129_10095887 | 3300009147 | Bacteria | 4108 |
| 415 | Ga0114129_10105734 | 3300009147 | Bacteria | 3889 |
| 416 | Ga0114129_10156623 | 3300009147 | Bacteria | 3114 |
| 417 | Ga0114129_10240663 | 3300009147 | Bacteria | 2433 |
| 418 | Ga0114129_10303454 | 3300009147 | Unclassified | 2127 |
| 419 | Ga0114129_10464335 | 3300009147 | Bacteria | 1659 |
| 420 | Ga0114129_10644141 | 3300009147 | Bacteria | 1368 |
| 421 | Ga0114129_11317187 | 3300009147 | Bacteria | 894 |
| 422 | Ga0114129_12059081 | 3300009147 | Bacteria | 689 |
| 423 | Ga0114129_12835565 | 3300009147 | Unclassified | 575 |
| 424 | Ga0105243_10155273 | 3300009148 | Bacteria | 1967 |
| 425 | Ga0105243_10620224 | 3300009148 | Bacteria | 1044 |
| 426 | Ga0105243_10632052 | 3300009148 | Unclassified | 1035 |
| 427 | Ga0105241_10047313 | 3300009174 | Bacteria | 3271 |
| 428 | Ga0105241_10381023 | 3300009174 | Unclassified | 1232 |
| 429 | Ga0105241_10680023 | 3300009174 | Unclassified | 937 |
| 430 | Ga0105242_10004812 | 3300009176 | Bacteria | 10448 |
| 431 | Ga0105242_10292282 | 3300009176 | Bacteria | 1484 |
| 432 | Ga0105242_10395084 | 3300009176 | Bacteria | 1289 |
| 433 | Ga0105242_11026511 | 3300009176 | Bacteria | 834 |
| 434 | Ga0105242_11051655 | 3300009176 | Unclassified | 825 |
| 435 | Ga0105242_11444150 | 3300009176 | Bacteria | 717 |
| 436 | Ga0105242_11473318 | 3300009176 | Bacteria | 710 |
| 437 | Ga0105248_10008693 | 3300009177 | Bacteria | 11159 |
| 438 | Ga0105248_10051306 | 3300009177 | Bacteria | 4629 |
| 439 | Ga0105248_10254620 | 3300009177 | Bacteria | 1976 |
| 440 | Ga0105248_10299874 | 3300009177 | Bacteria | 1809 |
| 441 | Ga0105248_10424999 | 3300009177 | Bacteria | 1496 |
| 442 | Ga0105248_10472716 | 3300009177 | Bacteria | 1413 |
| 443 | Ga0105248_10511882 | 3300009177 | Bacteria | 1353 |
| 444 | Ga0105248_10726233 | 3300009177 | Bacteria | 1121 |
| 445 | Ga0105248_10797074 | 3300009177 | Bacteria | 1066 |
| 446 | Ga0105248_12047897 | 3300009177 | Bacteria | 651 |
| 447 | Ga0105248_12123984 | 3300009177 | Bacteria | 639 |
| 448 | Ga0105248_12177349 | 3300009177 | Unclassified | 631 |
| 449 | Ga0105237_10547776 | 3300009545 | Bacteria | 1163 |
| 450 | Ga0105237_10791424 | 3300009545 | Bacteria | 955 |
| 451 | Ga0105237_12258382 | 3300009545 | Unclassified | 554 |
| 452 | Ga0105238_10247606 | 3300009551 | Bacteria | 1760 |
| 453 | Ga0105238_10567153 | 3300009551 | Bacteria | 1141 |
| 454 | Ga0105238_12618648 | 3300009551 | Bacteria | 541 |
| 455 | Ga0105238_12775976 | 3300009551 | Bacteria | 526 |
| 456 | Ga0105249_10099145 | 3300009553 | Bacteria | 2738 |
| 457 | Ga0105249_10144827 | 3300009553 | Bacteria | 2281 |
| 458 | Ga0105249_10446545 | 3300009553 | Bacteria | 1331 |
| 459 | Ga0105249_10891252 | 3300009553 | Bacteria | 956 |
| 460 | Ga0105249_10945030 | 3300009553 | Bacteria | 930 |
| 461 | Ga0105249_11504478 | 3300009553 | Bacteria | 745 |
| 462 | Ga0105239_12294227 | 3300010375 | Bacteria | 628 |
| 463 | Ga0105246_10339378 | 3300011119 | Bacteria | 1227 |
| 464 | Ga0105246_10451649 | 3300011119 | Bacteria | 1080 |
| 465 | Ga0105246_11095589 | 3300011119 | Unclassified | 727 |
| 466 | Ga0157373_10667413 | 3300013100 | Bacteria | 760 |
| 467 | Ga0157369_11833230 | 3300013105 | Unclassified | 616 |
| 468 | Ga0157374_10008967 | 3300013296 | Bacteria | 8573 |
| 469 | Ga0157374_10592825 | 3300013296 | Unclassified | 1118 |
| 470 | Ga0157378_10311311 | 3300013297 | Bacteria | 1527 |
| 471 | Ga0157378_10841609 | 3300013297 | Bacteria | 945 |
| 472 | Ga0163162_10974178 | 3300013306 | Bacteria | 958 |
| 473 | Ga0163162_11728544 | 3300013306 | Bacteria | 715 |
| 474 | Ga0157372_10465805 | 3300013307 | Bacteria | 1473 |
| 475 | Ga0157372_10653397 | 3300013307 | Unclassified | 1224 |
| 476 | Ga0157375_10304377 | 3300013308 | Bacteria | 1758 |
| 477 | Ga0157375_10308011 | 3300013308 | Bacteria | 1748 |
| 478 | Ga0157375_10500284 | 3300013308 | Unclassified | 1379 |
| 479 | Ga0157375_10537265 | 3300013308 | Bacteria | 1332 |
| 480 | Ga0157375_10966561 | 3300013308 | Unclassified | 993 |
| 481 | Ga0163163_10013902 | 3300014325 | Bacteria | 7383 |
| 482 | Ga0163163_10026560 | 3300014325 | Bacteria | 5537 |
| 483 | Ga0163163_10026633 | 3300014325 | Bacteria | 5530 |
| 484 | Ga0163163_10106347 | 3300014325 | Bacteria | 2832 |
| 485 | Ga0163163_10145562 | 3300014325 | Bacteria | 2413 |
| 486 | Ga0157380_10001120 | 3300014326 | Bacteria | 17286 |
| 487 | Ga0157380_10045494 | 3300014326 | Bacteria | 3444 |
| 488 | Ga0157380_10051365 | 3300014326 | Bacteria | 3261 |
| 489 | Ga0157380_10067340 | 3300014326 | Bacteria | 2883 |
| 490 | Ga0157380_10153171 | 3300014326 | Bacteria | 1995 |
| 491 | Ga0157380_10161020 | 3300014326 | Bacteria | 1950 |
| 492 | Ga0157379_10012857 | 3300014968 | Bacteria | 7320 |
| 493 | Ga0157379_10051258 | 3300014968 | Bacteria | 3686 |
| 494 | Ga0157379_10279199 | 3300014968 | Bacteria | 1520 |
| 495 | Ga0157379_10289830 | 3300014968 | Bacteria | 1491 |
| 496 | Ga0157379_10331196 | 3300014968 | Bacteria | 1391 |
| 497 | Ga0157379_10419308 | 3300014968 | Unclassified | 1232 |
| 498 | Ga0157379_12090542 | 3300014968 | Unclassified | 561 |
| 499 | Ga0157376_10123596 | 3300014969 | Bacteria | 2298 |
| 500 | Ga0157376_10169760 | 3300014969 | Bacteria | 1985 |
| 501 | Ga0157376_10177326 | 3300014969 | Unclassified | 1945 |
| 502 | Ga0157376_10353454 | 3300014969 | Bacteria | 1407 |
| 503 | Ga0163161_10318839 | 3300017792 | Bacteria | 1228 |
| 504 | Ga0207697_10038545 | 3300025315 | Bacteria | 1960 |
| 505 | Ga0207656_10297123 | 3300025321 | Unclassified | 799 |
| 506 | Ga0207653_10078964 | 3300025885 | Bacteria | 1136 |
| 507 | Ga0207682_10007672 | 3300025893 | Bacteria | 4294 |
| 508 | Ga0207692_10436519 | 3300025898 | Bacteria | 822 |
| 509 | Ga0207642_10098183 | 3300025899 | Bacteria | 1464 |
| 510 | Ga0207710_10027842 | 3300025900 | Unclassified | 2451 |
| 511 | Ga0207688_10478104 | 3300025901 | Bacteria | 779 |
| 512 | Ga0207680_10094918 | 3300025903 | Bacteria | 1905 |
| 513 | Ga0207685_10182534 | 3300025905 | Bacteria | 974 |
| 514 | Ga0207699_10044251 | 3300025906 | Bacteria | 2591 |
| 515 | Ga0207645_10004409 | 3300025907 | Bacteria | 10419 |
| 516 | Ga0207645_10030979 | 3300025907 | Bacteria | 3445 |
| 517 | Ga0207645_10092452 | 3300025907 | Bacteria | 1946 |
| 518 | Ga0207645_10102441 | 3300025907 | Bacteria | 1848 |
| 519 | Ga0207645_10126660 | 3300025907 | Unclassified | 1660 |
| 520 | Ga0207643_10213277 | 3300025908 | Bacteria | 1179 |
| 521 | Ga0207643_10363404 | 3300025908 | Unclassified | 910 |
| 522 | Ga0207705_10118300 | 3300025909 | Bacteria | 1964 |
| 523 | Ga0207684_10008764 | 3300025910 | Bacteria | 8980 |
| 524 | Ga0207684_10595146 | 3300025910 | Unclassified | 945 |
| 525 | Ga0207684_10887641 | 3300025910 | Unclassified | 750 |
| 526 | Ga0207654_10731068 | 3300025911 | Unclassified | 712 |
| 527 | Ga0207707_10026199 | 3300025912 | Bacteria | 5097 |
| 528 | Ga0207707_10036682 | 3300025912 | Bacteria | 4285 |
| 529 | Ga0207707_10927489 | 3300025912 | Unclassified | 718 |
| 530 | Ga0207695_10133316 | 3300025913 | Unclassified | 2440 |
| 531 | Ga0207695_10455243 | 3300025913 | Bacteria | 1163 |
| 532 | Ga0207671_10391763 | 3300025914 | Bacteria | 1104 |
| 533 | Ga0207671_10845904 | 3300025914 | Unclassified | 724 |
| 534 | Ga0207693_10510436 | 3300025915 | Bacteria | 938 |
| 535 | Ga0207663_10822571 | 3300025916 | Bacteria | 740 |
| 536 | Ga0207663_10897576 | 3300025916 | Unclassified | 708 |
| 537 | Ga0207660_10276408 | 3300025917 | Bacteria | 1332 |
| 538 | Ga0207660_10281074 | 3300025917 | Bacteria | 1321 |
| 539 | Ga0207660_10825420 | 3300025917 | Bacteria | 757 |
| 540 | Ga0207660_10955996 | 3300025917 | Unclassified | 699 |
| 541 | Ga0207660_11397061 | 3300025917 | Unclassified | 567 |
| 542 | Ga0207662_10043871 | 3300025918 | Unclassified | 2639 |
| 543 | Ga0207662_10510275 | 3300025918 | Unclassified | 829 |
| 544 | Ga0207657_10140279 | 3300025919 | Bacteria | 1975 |
| 545 | Ga0207657_10342007 | 3300025919 | Unclassified | 1181 |
| 546 | Ga0207657_10524204 | 3300025919 | Bacteria | 927 |
| 547 | Ga0207649_10306477 | 3300025920 | Bacteria | 1163 |
| 548 | Ga0207649_11089690 | 3300025920 | Bacteria | 630 |
| 549 | Ga0207652_10049212 | 3300025921 | Unclassified | 3607 |
| 550 | Ga0207652_10099452 | 3300025921 | Bacteria | 2566 |
| 551 | Ga0207652_10592423 | 3300025921 | Bacteria | 995 |
| 552 | Ga0207652_11075327 | 3300025921 | Bacteria | 704 |
| 553 | Ga0207652_11111077 | 3300025921 | Bacteria | 691 |
| 554 | Ga0207646_10189461 | 3300025922 | Bacteria | 1857 |
| 555 | Ga0207681_10015905 | 3300025923 | Bacteria | 4697 |
| 556 | Ga0207681_10046170 | 3300025923 | Bacteria | 2929 |
| 557 | Ga0207681_10057138 | 3300025923 | Bacteria | 2665 |
| 558 | Ga0207681_10089547 | 3300025923 | Bacteria | 2194 |
| 559 | Ga0207681_10266637 | 3300025923 | Unclassified | 1343 |
| 560 | Ga0207681_10362062 | 3300025923 | Unclassified | 1163 |
| 561 | Ga0207681_10917123 | 3300025923 | Bacteria | 734 |
| 562 | Ga0207681_11293354 | 3300025923 | Unclassified | 612 |
| 563 | Ga0207694_10921567 | 3300025924 | Bacteria | 739 |
| 564 | Ga0207650_10001357 | 3300025925 | Bacteria | 17665 |
| 565 | Ga0207650_10009031 | 3300025925 | Bacteria | 6815 |
| 566 | Ga0207650_10863256 | 3300025925 | Unclassified | 768 |
| 567 | Ga0207659_10001326 | 3300025926 | Bacteria | 14790 |
| 568 | Ga0207659_10001674 | 3300025926 | Bacteria | 13173 |
| 569 | Ga0207659_10078583 | 3300025926 | Bacteria | 2431 |
| 570 | Ga0207659_10210421 | 3300025926 | Bacteria | 1558 |
| 571 | Ga0207659_10236618 | 3300025926 | Unclassified | 1475 |
| 572 | Ga0207659_10247927 | 3300025926 | Bacteria | 1444 |
| 573 | Ga0207659_10310605 | 3300025926 | Bacteria | 1298 |
| 574 | Ga0207700_10727148 | 3300025928 | Bacteria | 887 |
| 575 | Ga0207644_10198864 | 3300025931 | Bacteria | 1580 |
| 576 | Ga0207690_10340718 | 3300025932 | Bacteria | 1183 |
| 577 | Ga0207690_11396297 | 3300025932 | Bacteria | 586 |
| 578 | Ga0207706_10006351 | 3300025933 | Bacteria | 10981 |
| 579 | Ga0207706_10287602 | 3300025933 | Bacteria | 1433 |
| 580 | Ga0207706_10672061 | 3300025933 | Unclassified | 886 |
| 581 | Ga0207686_10021245 | 3300025934 | Bacteria | 3722 |
| 582 | Ga0207670_10512921 | 3300025936 | Bacteria | 975 |
| 583 | Ga0207670_10934535 | 3300025936 | Bacteria | 727 |
| 584 | Ga0207669_10009114 | 3300025937 | Bacteria | 4707 |
| 585 | Ga0207669_10084560 | 3300025937 | Bacteria | 2045 |
| 586 | Ga0207669_10310856 | 3300025937 | Bacteria | 1202 |
| 587 | Ga0207669_10749921 | 3300025937 | Unclassified | 806 |
| 588 | Ga0207669_11148462 | 3300025937 | Bacteria | 657 |
| 589 | Ga0207704_10029133 | 3300025938 | Bacteria | 3074 |
| 590 | Ga0207704_10172031 | 3300025938 | Bacteria | 1555 |
| 591 | Ga0207704_10594861 | 3300025938 | Unclassified | 905 |
| 592 | Ga0207704_11092153 | 3300025938 | Unclassified | 678 |
| 593 | Ga0207665_10230644 | 3300025939 | Bacteria | 1360 |
| 594 | Ga0207691_10136581 | 3300025940 | Bacteria | 2162 |
| 595 | Ga0207691_10385754 | 3300025940 | Bacteria | 1196 |
| 596 | Ga0207711_10042075 | 3300025941 | Bacteria | 3892 |
| 597 | Ga0207711_10570936 | 3300025941 | Bacteria | 1055 |
| 598 | Ga0207711_10603451 | 3300025941 | Bacteria | 1024 |
| 599 | Ga0207711_10646907 | 3300025941 | Unclassified | 986 |
| 600 | Ga0207711_10819025 | 3300025941 | Bacteria | 867 |
| 601 | Ga0207711_11365127 | 3300025941 | Bacteria | 651 |
| 602 | Ga0207711_11730472 | 3300025941 | Bacteria | 568 |
| 603 | Ga0207689_10126295 | 3300025942 | Bacteria | 2104 |
| 604 | Ga0207689_10168743 | 3300025942 | Bacteria | 1803 |
| 605 | Ga0207689_10270130 | 3300025942 | Bacteria | 1408 |
| 606 | Ga0207689_10599422 | 3300025942 | Bacteria | 927 |
| 607 | Ga0207689_11405692 | 3300025942 | Bacteria | 585 |
| 608 | Ga0207679_10024525 | 3300025945 | Bacteria | 4136 |
| 609 | Ga0207667_10273595 | 3300025949 | Bacteria | 1726 |
| 610 | Ga0207667_11668369 | 3300025949 | Bacteria | 605 |
| 611 | Ga0207651_10008548 | 3300025960 | Bacteria | 5536 |
| 612 | Ga0207651_10077267 | 3300025960 | Bacteria | 2383 |
| 613 | Ga0207651_10646127 | 3300025960 | Bacteria | 928 |
| 614 | Ga0207712_10068046 | 3300025961 | Bacteria | 2550 |
| 615 | Ga0207712_10942657 | 3300025961 | Bacteria | 764 |
| 616 | Ga0207668_10073257 | 3300025972 | Bacteria | 2454 |
| 617 | Ga0207668_10100658 | 3300025972 | Bacteria | 2147 |
| 618 | Ga0207677_10362046 | 3300026023 | Bacteria | 1219 |
| 619 | Ga0207677_10987358 | 3300026023 | Bacteria | 763 |
| 620 | Ga0207703_10081327 | 3300026035 | Bacteria | 2700 |
| 621 | Ga0207703_10236208 | 3300026035 | Bacteria | 1641 |
| 622 | Ga0207703_10325234 | 3300026035 | Bacteria | 1409 |
| 623 | Ga0207703_10711778 | 3300026035 | Bacteria | 955 |
| 624 | Ga0207703_11768276 | 3300026035 | Unclassified | 594 |
| 625 | Ga0207639_11476274 | 3300026041 | Bacteria | 638 |
| 626 | Ga0207678_11383117 | 3300026067 | Bacteria | 622 |
| 627 | Ga0207708_10006212 | 3300026075 | Bacteria | 8854 |
| 628 | Ga0207708_10086421 | 3300026075 | Bacteria | 2413 |
| 629 | Ga0207708_10116810 | 3300026075 | Bacteria | 2076 |
| 630 | Ga0207708_10228303 | 3300026075 | Bacteria | 1494 |
| 631 | Ga0207708_10400095 | 3300026075 | Bacteria | 1135 |
| 632 | Ga0207708_10402365 | 3300026075 | Unclassified | 1132 |
| 633 | Ga0207708_10606101 | 3300026075 | Bacteria | 928 |
| 634 | Ga0207708_10731554 | 3300026075 | Bacteria | 848 |
| 635 | Ga0207708_11210787 | 3300026075 | Bacteria | 660 |
| 636 | Ga0207702_10575086 | 3300026078 | Bacteria | 1104 |
| 637 | Ga0207702_11056544 | 3300026078 | Bacteria | 806 |
| 638 | Ga0207641_10147915 | 3300026088 | Bacteria | 2126 |
| 639 | Ga0207641_10217180 | 3300026088 | Bacteria | 1771 |
| 640 | Ga0207641_10376796 | 3300026088 | Bacteria | 1358 |
| 641 | Ga0207641_10521286 | 3300026088 | Bacteria | 1156 |
| 642 | Ga0207641_11344892 | 3300026088 | Bacteria | 715 |
| 643 | Ga0207648_10089858 | 3300026089 | Bacteria | 2684 |
| 644 | Ga0207648_10134346 | 3300026089 | Bacteria | 2178 |
| 645 | Ga0207648_10380901 | 3300026089 | Unclassified | 1275 |
| 646 | Ga0207676_10036492 | 3300026095 | Bacteria | 3740 |
| 647 | Ga0207676_11880085 | 3300026095 | Bacteria | 597 |
| 648 | Ga0207676_11915693 | 3300026095 | Unclassified | 591 |
| 649 | Ga0207674_10103741 | 3300026116 | Bacteria | 2822 |
| 650 | Ga0207674_10375909 | 3300026116 | Bacteria | 1373 |
| 651 | Ga0207674_10630925 | 3300026116 | Unclassified | 1035 |
| 652 | Ga0207674_10632100 | 3300026116 | Unclassified | 1034 |
| 653 | Ga0207674_11524729 | 3300026116 | Unclassified | 637 |
| 654 | Ga0207675_100001984 | 3300026118 | Bacteria | 20408 |
| 655 | Ga0207675_100002093 | 3300026118 | Bacteria | 19819 |
| 656 | Ga0207675_100039599 | 3300026118 | Bacteria | 4399 |
| 657 | Ga0207675_100107470 | 3300026118 | Bacteria | 2631 |
| 658 | Ga0207675_100426787 | 3300026118 | Bacteria | 1310 |
| 659 | Ga0207675_101361243 | 3300026118 | Unclassified | 730 |
| 660 | Ga0207683_10714932 | 3300026121 | Bacteria | 929 |
| 661 | Ga0207698_10196373 | 3300026142 | Bacteria | 1803 |
| 662 | Ga0210000_1069327 | 3300027462 | Unclassified | 574 |
| 663 | Ga0209813_10217466 | 3300027866 | Bacteria | 714 |
| 664 | Ga0207428_10000005 | 3300027907 | Bacteria | 520045 |
| 665 | Ga0207428_10010580 | 3300027907 | Bacteria | 8232 |
| 666 | Ga0207428_10338042 | 3300027907 | Bacteria | 1109 |
| 667 | Ga0207428_10365403 | 3300027907 | Bacteria | 1060 |
| 668 | Ga0268266_10011577 | 3300028379 | Bacteria | 7658 |
| 669 | Ga0268265_10028514 | 3300028380 | Bacteria | 3997 |
| 670 | Ga0268265_10241827 | 3300028380 | Bacteria | 1593 |
| 671 | Ga0268265_10458522 | 3300028380 | Bacteria | 1192 |
| 672 | Ga0268265_10820668 | 3300028380 | Bacteria | 908 |
| 673 | Ga0268265_10912867 | 3300028380 | Bacteria | 863 |
| 674 | Ga0268264_10056317 | 3300028381 | Bacteria | 3287 |
| 675 | Ga0268264_10771695 | 3300028381 | Bacteria | 959 |
| 676 | Ga0268264_10806797 | 3300028381 | Bacteria | 938 |
| 677 | Ga0268264_10827074 | 3300028381 | Bacteria | 926 |
| 678 | Ga0268264_11384091 | 3300028381 | Bacteria | 714 |
| 679 | Ga0265338_10070820 | 3300028800 | Bacteria | 2987 |
| 680 | Ga0265324_10000538 | 3300029957 | Bacteria | 25978 |
| 681 | Ga0265325_10039062 | 3300031241 | Bacteria | 2501 |
| 682 | Ga0265339_10000120 | 3300031249 | Bacteria | 64460 |
| 683 | Ga0307408_100988936 | 3300031548 | Unclassified | 775 |
| 684 | Ga0307408_101142503 | 3300031548 | Bacteria | 724 |
| 685 | Ga0265313_10009483 | 3300031595 | Bacteria | 6315 |
| 686 | Ga0307405_10037889 | 3300031731 | Unclassified | 2902 |
| 687 | Ga0307413_10435117 | 3300031824 | Bacteria | 1037 |
| 688 | Ga0307413_11420431 | 3300031824 | Unclassified | 611 |
| 689 | Ga0307410_10035658 | 3300031852 | Bacteria | 3233 |
| 690 | Ga0307410_10259844 | 3300031852 | Unclassified | 1354 |
| 691 | Ga0307406_10387113 | 3300031901 | Bacteria | 1104 |
| 692 | Ga0307407_10107635 | 3300031903 | Unclassified | 1744 |
| 693 | Ga0307416_100170863 | 3300032002 | Unclassified | 2023 |
| 694 | Ga0307416_102505290 | 3300032002 | Bacteria | 614 |
| 695 | Ga0307414_11389598 | 3300032004 | Bacteria | 652 |
| 696 | Ga0307411_10039398 | 3300032005 | Bacteria | 2989 |
| 697 | Ga0307411_10145071 | 3300032005 | Unclassified | 1756 |
| 698 | Ga0307411_10523133 | 3300032005 | Unclassified | 1007 |
| 699 | Ga0307411_10682661 | 3300032005 | Unclassified | 893 |
| 700 | Ga0307411_11606139 | 3300032005 | Bacteria | 600 |
| 701 | Ga0307415_100085752 | 3300032126 | Unclassified | 2264 |
| 702 | Ga0307415_100476789 | 3300032126 | Bacteria | 1085 |
| 703 | Ga0373959_0000033 | 3300034820 | Bacteria | 30368 |
| 704 | Ga0373938_0050918 | 3300034957 | Bacteria | 946 |
| 705 | Ga0373934_0342087 | 3300035086 | Bacteria | 622 |
| 706 | Ga0373923_0017689 | 3300035111 | Unclassified | 2730 |
| 707 | Ga0373932_0101387 | 3300035112 | Bacteria | 937 |
| 708 | Ga0373936_0295020 | 3300035113 | Bacteria | 731 |
| 709 | Ga0373939_0218076 | 3300035114 | Bacteria | 729 |
| 710 | Ga0373945_0029110 | 3300035116 | Bacteria | 1939 |
| 711 | Ga0373953_0088554 | 3300035117 | Bacteria | 1293 |
| 712 | Ga0373953_0476259 | 3300035117 | Unclassified | 553 |
| 713 | Ga0373954_0279309 | 3300035118 | Unclassified | 823 |
| 714 | Ga0373954_0564195 | 3300035118 | Bacteria | 564 |
| 715 | Ga0373956_0021764 | 3300035119 | Bacteria | 2737 |
| 716 | Ga0373956_0124247 | 3300035119 | Unclassified | 1206 |
| 717 | Ga0373956_0283840 | 3300035119 | Bacteria | 788 |
| 718 | Ga0373957_0144152 | 3300035120 | Bacteria | 975 |
| 719 | Ga0373957_0252072 | 3300035120 | Bacteria | 743 |
| 720 | Ga0373943_0023781 | 3300035170 | Bacteria | 2851 |
| 721 | Ga0373946_0243773 | 3300035171 | Bacteria | 875 |
| 722 | Ga0373946_0301340 | 3300035171 | Bacteria | 792 |
| 723 | Ga0373955_0133041 | 3300035172 | Bacteria | 1453 |
| 724 | Ga0373955_0140934 | 3300035172 | Bacteria | 1414 |
| 725 | Ga0373955_0189045 | 3300035172 | Bacteria | 1224 |
| 726 | Ga0373955_0229437 | 3300035172 | Bacteria | 1110 |
| 727 | Ga0373955_0261993 | 3300035172 | Archaea | 1038 |
| 728 | Ga0373955_0411331 | 3300035172 | Bacteria | 822 |
| 729 | Ga0373955_0589039 | 3300035172 | Unclassified | 681 |
| 730 | Ga0373955_0778766 | 3300035172 | Unclassified | 588 |
| 731 | Ga0373942_0084394 | 3300035207 | Unclassified | 948 |
| 732 | Ga0373924_0013649 | 3300035410 | Bacteria | 3055 |
| 733 | Ga0373924_0399003 | 3300035410 | Bacteria | 615 |
| 734 | Ga0373931_0521377 | 3300035691 | Unclassified | 769 |
| 735 | Ga0373935_0058303 | 3300035692 | Bacteria | 2466 |
| 736 | Ga0373935_0587622 | 3300035692 | Unclassified | 814 |
| 737 | Ga0373935_0899219 | 3300035692 | Unclassified | 656 |
| 738 | Ga0373927_0199571 | 3300035695 | Unclassified | 1313 |
| 739 | Ga0373927_0391430 | 3300035695 | Unclassified | 917 |
| 740 | Ga0373933_0139824 | 3300035724 | Unclassified | 1528 |
| 741 | Ga0373933_0207445 | 3300035724 | Bacteria | 1255 |
| 742 | Ga0373947_0034582 | 3300035725 | Unclassified | 2989 |
| 743 | Ga0373947_0917258 | 3300035725 | Bacteria | 598 |
| 744 | Ga0373937_0154959 | 3300036401 | Bacteria | 2147 |
| 745 | Ga0373937_0303068 | 3300036401 | Unclassified | 1510 |
| 746 | Ga0373937_0758928 | 3300036401 | Bacteria | 917 |
| 747 | Ga0373937_1203240 | 3300036401 | Bacteria | 706 |
| 748 | Ga0373937_1511974 | 3300036401 | Bacteria | 619 |
| 749 | Ga0373925_0035857 | 3300037068 | Unclassified | 3661 |
| 750 | Ga0373925_0304817 | 3300037068 | Bacteria | 1287 |
| 751 | Ga0373925_1281841 | 3300037068 | Bacteria | 601 |
| 752 | Ga0436364_1424755 | 3300037853 | Bacteria | 1674 |
| 753 | Ga0436365_0298694 | 3300039437 | Bacteria | 500 |
| 754 | Ga0436360_0085243 | 3300039438 | Unclassified | 588 |
| 755 | Ga0436360_0188929 | 3300039438 | Unclassified | 602 |
| 756 | Ga0436360_0945317 | 3300039438 | Unclassified | 1185 |
| 757 | Ga0436363_1164207 | 3300039450 | Bacteria | 783 |
| 758 | Ga0436362_1222382 | 3300039453 | Unclassified | 837 |
| 759 | Ga0439431_0027667 | 3300041997 | Unclassified | 1394 |
| 760 | Ga0439431_0245609 | 3300041997 | Unclassified | 530 |
| 761 | Ga0439445_0043161 | 3300042004 | Unclassified | 1203 |
| 762 | Ga0439435_0084294 | 3300042436 | Unclassified | 958 |
| 763 | Ga0439444_0123752 | 3300042437 | Unclassified | 606 |
| 764 | Ga0451577_0043520 | 3300042876 | Bacteria | 4022 |
| 765 | Ga0466963_0053920 | 3300044694 | Bacteria | 2671 |
| 766 | Ga0453684_0261948 | 3300044712 | Bacteria | 1980 |
| 767 | Ga0453684_0356274 | 3300044712 | Bacteria | 1648 |
| 768 | Ga0466959_1154913 | 3300045049 | Bacteria | 515 |
| 769 | Ga0451576_0012591 | 3300045051 | Bacteria | 9496 |
| 770 | Ga0451576_0221949 | 3300045051 | Bacteria | 1973 |
| 771 | Ga0451576_0482414 | 3300045051 | Unclassified | 1302 |
| 772 | Ga0451576_1281538 | 3300045051 | Bacteria | 764 |
| 773 | Ga0451576_1320859 | 3300045051 | Unclassified | 752 |
| 774 | Ga0451576_2450582 | 3300045051 | Bacteria | 533 |
| 775 | Ga0466958_0327142 | 3300045836 | Unclassified | 985 |
| 776 | Ga0495592_0045926 | 3300046454 | Unclassified | 3257 |
| 777 | Ga0495603_0047369 | 3300046455 | Bacteria | 2560 |
| 778 | Ga0495603_0154718 | 3300046455 | Bacteria | 1331 |
| 779 | Ga0495629_0039644 | 3300046459 | Bacteria | 3315 |
| 780 | Ga0495638_0030093 | 3300046460 | Bacteria | 3497 |
| 781 | Ga0495651_0104066 | 3300046462 | Bacteria | 2108 |
| 782 | Ga0495580_0037523 | 3300046472 | Bacteria | 3477 |
| 783 | Ga0495580_0684233 | 3300046472 | Unclassified | 672 |
| 784 | Ga0495582_0127085 | 3300046473 | Bacteria | 1439 |
| 785 | Ga0495662_0123636 | 3300046476 | Bacteria | 1271 |
| 786 | Ga0495662_0459287 | 3300046476 | Unclassified | 625 |
| 787 | Ga0495664_0168536 | 3300046477 | Bacteria | 1329 |
| 788 | Ga0495594_0298887 | 3300046499 | Unclassified | 917 |
| 789 | Ga0495608_0007294 | 3300046511 | Bacteria | 7817 |
| 790 | Ga0495608_0009303 | 3300046511 | Bacteria | 6871 |
| 791 | Ga0495618_0330891 | 3300046514 | Unclassified | 942 |
| 792 | Ga0495618_0411394 | 3300046514 | Bacteria | 826 |
| 793 | Ga0495628_0098276 | 3300046516 | Bacteria | 2261 |
| 794 | Ga0495628_0153628 | 3300046516 | Bacteria | 1752 |
| 795 | Ga0495628_0361711 | 3300046516 | Bacteria | 1065 |
| 796 | Ga0495630_0020785 | 3300046517 | Bacteria | 4844 |
| 797 | Ga0495643_0129231 | 3300046522 | Unclassified | 1269 |
| 798 | Ga0495644_0115927 | 3300046523 | Bacteria | 1018 |
| 799 | Ga0495644_0388096 | 3300046523 | Unclassified | 552 |
| 800 | Ga0495652_0043389 | 3300046529 | Bacteria | 3874 |
| 801 | Ga0495640_0429030 | 3300046533 | Bacteria | 809 |
| 802 | Ga0495586_0667073 | 3300046535 | Bacteria | 601 |
| 803 | Ga0495586_0852160 | 3300046535 | Bacteria | 525 |
| 804 | Ga0495587_0398052 | 3300046536 | Unclassified | 765 |
| 805 | Ga0495621_0012653 | 3300046539 | Bacteria | 2634 |
| 806 | Ga0495621_0081706 | 3300046539 | Bacteria | 1206 |
| 807 | Ga0495621_0161290 | 3300046539 | Bacteria | 887 |
| 808 | Ga0495667_0017615 | 3300046559 | Bacteria | 4825 |
| 809 | Ga0495667_0061625 | 3300046559 | Bacteria | 2459 |
| 810 | Ga0495667_0791394 | 3300046559 | Bacteria | 585 |
| 811 | Ga0495634_0132800 | 3300046642 | Unclassified | 1586 |
| 812 | Ga0495659_0196109 | 3300046664 | Unclassified | 827 |
| 813 | Ga0495588_0016972 | 3300046674 | Bacteria | 3527 |
| 814 | Ga0495657_0112692 | 3300046675 | Bacteria | 1722 |
| 815 | Ga0495599_0128426 | 3300046678 | Bacteria | 1575 |
| 816 | Ga0495623_0333677 | 3300046679 | Bacteria | 830 |
| 817 | Ga0495647_0146596 | 3300046681 | Bacteria | 1010 |
| 818 | Ga0495658_0114695 | 3300046683 | Bacteria | 1624 |
| 819 | Ga0495658_0188754 | 3300046683 | Bacteria | 1281 |
| 820 | Ga0495658_1041918 | 3300046683 | Unclassified | 522 |
| 821 | Ga0495669_0000953 | 3300046684 | Bacteria | 12080 |
| 822 | Ga0495669_0170400 | 3300046684 | Bacteria | 1035 |
| 823 | Ga0495613_0026797 | 3300046689 | Bacteria | 4292 |
| 824 | Ga0495670_0312830 | 3300046691 | Bacteria | 843 |
| 825 | Ga0495600_0181287 | 3300046809 | Bacteria | 1357 |
| 826 | Ga0495604_0015903 | 3300047317 | Bacteria | 6008 |
| 827 | Ga0495604_0124825 | 3300047317 | Bacteria | 1858 |
| 828 | Ga0495674_0030010 | 3300047319 | Bacteria | 4947 |
| 829 | Ga0495672_0031959 | 3300047320 | Bacteria | 3281 |
| 830 | Ga0495672_0136882 | 3300047320 | Unclassified | 1283 |
| 831 | Ga0495680_0788567 | 3300047322 | Unclassified | 621 |
| 832 | Ga0495675_0320265 | 3300047444 | Bacteria | 917 |
| 833 | Ga0495677_0344431 | 3300047445 | Bacteria | 588 |
| 834 | Ga0495684_0000462 | 3300047471 | Bacteria | 33252 |
| 835 | Ga0495602_0160499 | 3300048088 | Bacteria | 1756 |
| 836 | Ga0496100_0018741 | 3300048903 | Bacteria | 4113 |
| 837 | Ga0496101_0555387 | 3300048904 | Unclassified | 908 |
| 838 | Ga0496102_0845352 | 3300048905 | Bacteria | 837 |
| 839 | Ga0496102_0903228 | 3300048905 | Unclassified | 805 |
| 840 | Ga0496103_0372961 | 3300048906 | Bacteria | 917 |
| 841 | Ga0496104_0030376 | 3300048907 | Bacteria | 5021 |
| 842 | Ga0496104_0208307 | 3300048907 | Bacteria | 1867 |
| 843 | Ga0496104_0560735 | 3300048907 | Bacteria | 1053 |
| 844 | Ga0496104_0905721 | 3300048907 | Bacteria | 787 |
| 845 | Ga0496105_0607282 | 3300048908 | Bacteria | 848 |
| 846 | Ga0496106_0129552 | 3300048909 | Bacteria | 1978 |
| 847 | Ga0496107_0107652 | 3300048910 | Bacteria | 2047 |
| 848 | Ga0496107_0584194 | 3300048910 | Unclassified | 826 |
| 849 | Ga0496108_0396358 | 3300048911 | Bacteria | 1206 |
| 850 | Ga0496109_0042376 | 3300048912 | Bacteria | 4123 |
| 851 | Ga0496109_0114683 | 3300048912 | Bacteria | 2507 |
| 852 | Ga0496110_0306643 | 3300048913 | Bacteria | 1446 |
| 853 | Ga0496111_0352835 | 3300048914 | Unclassified | 1089 |
| 854 | Ga0496112_0152291 | 3300048915 | Bacteria | 2280 |
| 855 | Ga0496112_1652313 | 3300048915 | Unclassified | 553 |
| 856 | Ga0496113_0385631 | 3300048916 | Bacteria | 1125 |
| 857 | Ga0496113_0998546 | 3300048916 | Unclassified | 659 |
| 858 | Ga0496114_0000226 | 3300048917 | Bacteria | 40968 |
| 859 | Ga0496114_0077423 | 3300048917 | Bacteria | 2804 |
| 860 | Ga0496114_0667892 | 3300048917 | Bacteria | 913 |
| 861 | Ga0496115_0288584 | 3300048918 | Bacteria | 1346 |
| 862 | Ga0501298_169502 | 3300049521 | Bacteria | 543 |
| 863 | Ga0501033_0166664 | 3300049570 | Bacteria | 1584 |
| 864 | Ga0501036_0301954 | 3300049572 | Unclassified | 1339 |
| 865 | Ga0501038_0213541 | 3300049574 | Bacteria | 1542 |
| 866 | Ga0501038_0454229 | 3300049574 | Unclassified | 985 |
| 867 | Ga0501039_0027416 | 3300049575 | Bacteria | 4380 |
| 868 | Ga0501039_0087056 | 3300049575 | Bacteria | 2433 |
| 869 | Ga0501040_0013356 | 3300049576 | Bacteria | 5396 |
| 870 | Ga0501040_0014780 | 3300049576 | Bacteria | 5151 |
| 871 | Ga0501040_0412101 | 3300049576 | Bacteria | 971 |
| 872 | Ga0501041_0011828 | 3300049577 | Bacteria | 5165 |
| 873 | Ga0501041_0025933 | 3300049577 | Unclassified | 3524 |
| 874 | Ga0501042_0015080 | 3300049578 | Bacteria | 5285 |
| 875 | Ga0501042_0027346 | 3300049578 | Bacteria | 4011 |
| 876 | Ga0501042_0061267 | 3300049578 | Bacteria | 2688 |
| 877 | Ga0501043_0044653 | 3300049579 | Bacteria | 3485 |
| 878 | Ga0501046_0012446 | 3300049580 | Bacteria | 7242 |
| 879 | Ga0501046_0048808 | 3300049580 | Unclassified | 3351 |
| 880 | Ga0501047_1003840 | 3300049581 | Bacteria | 648 |
| 881 | Ga0501048_0161423 | 3300049582 | Unclassified | 1586 |
| 882 | Ga0501048_0222047 | 3300049582 | Bacteria | 1340 |
| 883 | Ga0501068_0068848 | 3300049584 | Bacteria | 2157 |
| 884 | Ga0501071_0054536 | 3300049587 | Bacteria | 2884 |
| 885 | Ga0501071_0213607 | 3300049587 | Bacteria | 1451 |
| 886 | Ga0501072_0036855 | 3300049588 | Bacteria | 3835 |
| 887 | Ga0501072_0081480 | 3300049588 | Bacteria | 2565 |
| 888 | Ga0501073_0133983 | 3300049589 | Bacteria | 1717 |
| 889 | Ga0501074_0160452 | 3300049590 | Bacteria | 1606 |
| 890 | Ga0501075_0013330 | 3300049591 | Bacteria | 5865 |
| 891 | Ga0501075_0039322 | 3300049591 | Bacteria | 3540 |
| 892 | Ga0501075_0095218 | 3300049591 | Bacteria | 2259 |
| 893 | Ga0501075_0607778 | 3300049591 | Unclassified | 834 |
| 894 | Ga0501076_0015807 | 3300049592 | Bacteria | 5709 |
| 895 | Ga0501077_0082486 | 3300049593 | Bacteria | 2037 |
| 896 | Ga0501077_0422962 | 3300049593 | Unclassified | 852 |
| 897 | Ga0501249_025503 | 3300049679 | Bacteria | 1305 |
| 898 | Ga0501229_011645 | 3300049706 | Bacteria | 1117 |
| 899 | Ga0501079_0035544 | 3300049741 | Bacteria | 3836 |
| 900 | Ga0501079_0045235 | 3300049741 | Bacteria | 3397 |
| 901 | Ga0501079_0182407 | 3300049741 | Bacteria | 1638 |
| 902 | Ga0501080_0540579 | 3300049742 | Bacteria | 1038 |
| 903 | Ga0501081_0016297 | 3300049743 | Bacteria | 4911 |
| 904 | Ga0501081_0035672 | 3300049743 | Bacteria | 3386 |
| 905 | Ga0501083_0203036 | 3300049744 | Bacteria | 1293 |
| 906 | Ga0501083_0424744 | 3300049744 | Bacteria | 865 |
| 907 | Ga0501083_0781504 | 3300049744 | Bacteria | 621 |
| 908 | Ga0501083_1011684 | 3300049744 | Unclassified | 541 |
| 909 | Ga0501035_0490541 | 3300049822 | Bacteria | 1012 |
| 910 | Ga0501045_0006013 | 3300049824 | Bacteria | 8400 |
| 911 | Ga0501045_0007712 | 3300049824 | Bacteria | 7487 |
| 912 | Ga0501045_0069253 | 3300049824 | Bacteria | 2593 |
| 913 | Ga0501045_0547542 | 3300049824 | Unclassified | 858 |
| 914 | nmdc:mga00v17_112166_c1 | 3300050491 | Unclassified | 1730 |
| 915 | nmdc:mga00v17_68561_c1 | 3300050491 | Bacteria | 2193 |
| 916 | nmdc:mga00v17_886298_c1 | 3300050491 | Bacteria | 565 |
| 917 | nmdc:mga0k408_136798_c1 | 3300050493 | Bacteria | 1456 |
| 918 | nmdc:mga06z11_132588_c1 | 3300050494 | Bacteria | 1400 |
| 919 | nmdc:mga06z11_33068_c1 | 3300050494 | Bacteria | 2527 |
| 920 | nmdc:mga06z11_47870_c1 | 3300050494 | Unclassified | 2173 |
| 921 | nmdc:mga04h51_94307_c1 | 3300050495 | Bacteria | 1082 |
| 922 | nmdc:mga05p37_1215570_c1 | 3300050507 | Bacteria | 777 |
| 923 | nmdc:mga05p37_12236_c1 | 3300050507 | Bacteria | 10247 |
| 924 | nmdc:mga05p37_137872_c1 | 3300050507 | Unclassified | 2990 |
| 925 | nmdc:mga05p37_2083_c1 | 3300050507 | Bacteria | 23353 |
| 926 | nmdc:mga05p37_21375_c1 | 3300050507 | Bacteria | 7836 |
| 927 | nmdc:mga05p37_26077_c1 | 3300050507 | Bacteria | 7107 |
| 928 | nmdc:mga05p37_2699_c1 | 3300050507 | Bacteria | 20635 |
| 929 | nmdc:mga05p37_67043_c1 | 3300050507 | Bacteria | 4415 |
| 930 | nmdc:mga05p37_743957_c1 | 3300050507 | Bacteria | 1082 |
| 931 | nmdc:mga05p37_763643_c1 | 3300050507 | Bacteria | 1064 |
| 932 | nmdc:mga05p37_93364_c1 | 3300050507 | Bacteria | 3708 |
| 933 | nmdc:mga09592_1495004_c1 | 3300050508 | Bacteria | 550 |
| 934 | nmdc:mga09592_21353_c1 | 3300050508 | Bacteria | 5336 |
| 935 | nmdc:mga09592_23509_c1 | 3300050508 | Bacteria | 5091 |
| 936 | nmdc:mga09592_257964_c1 | 3300050508 | Bacteria | 1511 |
| 937 | nmdc:mga09592_32662_c1 | 3300050508 | Bacteria | 3082 |
| 938 | nmdc:mga09592_47513_c1 | 3300050508 | Bacteria | 3617 |
| 939 | nmdc:mga09592_65218_c1 | 3300050508 | Bacteria | 3084 |
| 940 | nmdc:mga09592_702093_c1 | 3300050508 | Bacteria | 861 |
| 941 | nmdc:mga09592_740066_c1 | 3300050508 | Bacteria | 835 |
| 942 | nmdc:mga0qj67_126142_c1 | 3300050509 | Bacteria | 2071 |
| 943 | nmdc:mga0qj67_303095_c1 | 3300050509 | Bacteria | 1294 |
| 944 | nmdc:mga0qj67_357818_c1 | 3300050509 | Bacteria | 1180 |
| 945 | nmdc:mga0qj67_43508_c1 | 3300050509 | Bacteria | 3537 |
| 946 | nmdc:mga0qj67_48387_c1 | 3300050509 | Bacteria | 3359 |
| 947 | nmdc:mga0qj67_813866_c1 | 3300050509 | Bacteria | 739 |
| 948 | nmdc:mga0qj67_976194_c1 | 3300050509 | Bacteria | 665 |
| 949 | nmdc:mga06r32_24197_c1 | 3300050510 | Bacteria | 5632 |
| 950 | nmdc:mga06r32_24482_c1 | 3300050510 | Bacteria | 5604 |
| 951 | nmdc:mga06r32_50145_c1 | 3300050510 | Bacteria | 3993 |
| 952 | nmdc:mga06r32_59692_c1 | 3300050510 | Bacteria | 3669 |
| 953 | nmdc:mga06r32_671152_c1 | 3300050510 | Bacteria | 1003 |
| 954 | nmdc:mga06r32_706315_c1 | 3300050510 | Bacteria | 974 |
| 955 | nmdc:mga08y16_194128_c1 | 3300050511 | Bacteria | 2105 |
| 956 | nmdc:mga08y16_240822_c1 | 3300050511 | Bacteria | 1870 |
| 957 | nmdc:mga08y16_5349_c1 | 3300050511 | Bacteria | 13429 |
| 958 | nmdc:mga08y16_536_c1 | 3300050511 | Bacteria | 35219 |
| 959 | nmdc:mga08y16_57296_c1 | 3300050511 | Bacteria | 4072 |
| 960 | nmdc:mga08y16_58599_c1 | 3300050511 | Unclassified | 2473 |
| 961 | nmdc:mga08y16_804290_c1 | 3300050511 | Bacteria | 933 |
| 962 | nmdc:mga08y16_9_c1 | 3300050511 | Bacteria | 566088 |
| 963 | nmdc:mga0n895_10215_c1 | 3300050512 | Bacteria | 8270 |
| 964 | nmdc:mga0n895_117712_c1 | 3300050512 | Unclassified | 2676 |
| 965 | nmdc:mga0n895_124596_c1 | 3300050512 | Bacteria | 2600 |
| 966 | nmdc:mga0n895_1925053_c1 | 3300050512 | Bacteria | 550 |
| 967 | nmdc:mga0n895_21724_c1 | 3300050512 | Bacteria | 6006 |
| 968 | nmdc:mga0n895_234274_c1 | 3300050512 | Bacteria | 1863 |
| 969 | nmdc:mga0n895_35_c1 | 3300050512 | Bacteria | 79696 |
| 970 | nmdc:mga0n895_43411_c1 | 3300050512 | Bacteria | 4381 |
| 971 | nmdc:mga0n895_507715_c1 | 3300050512 | Bacteria | 1214 |
| 972 | nmdc:mga0n895_79940_c1 | 3300050512 | Bacteria | 3257 |
| 973 | nmdc:mga0rr50_1_c1 | 3300050513 | Bacteria | 558123 |
| 974 | nmdc:mga0rr50_220592_c1 | 3300050513 | Bacteria | 1566 |
| 975 | nmdc:mga0rr50_272586_c1 | 3300050513 | Bacteria | 1411 |
| 976 | nmdc:mga0rr50_480202_c1 | 3300050513 | Bacteria | 1055 |
| 977 | nmdc:mga0rr50_564067_c1 | 3300050513 | Bacteria | 970 |
| 978 | nmdc:mga0rr50_81970_c1 | 3300050513 | Bacteria | 2491 |
| 979 | nmdc:mga0rr50_843060_c1 | 3300050513 | Bacteria | 782 |
| 980 | nmdc:mga0rr50_949671_c1 | 3300050513 | Unclassified | 733 |
| 981 | nmdc:mga08x19_118_c1 | 3300050514 | Bacteria | 70300 |
| 982 | nmdc:mga08x19_124725_c1 | 3300050514 | Bacteria | 1729 |
| 983 | nmdc:mga08x19_173140_c1 | 3300050514 | Bacteria | 1471 |
| 984 | nmdc:mga08x19_47864_c1 | 3300050514 | Bacteria | 2738 |
| 985 | nmdc:mga08x19_79399_c1 | 3300050514 | Bacteria | 2152 |
| 986 | nmdc:mga0a205_103441_c1 | 3300050515 | Bacteria | 2746 |
| 987 | nmdc:mga0a205_188382_c1 | 3300050515 | Bacteria | 1956 |
| 988 | nmdc:mga0a205_27615_c1 | 3300050515 | Bacteria | 5420 |
| 989 | nmdc:mga0a205_27753_c1 | 3300050515 | Bacteria | 5407 |
| 990 | nmdc:mga0a205_30084_c1 | 3300050515 | Bacteria | 5198 |
| 991 | nmdc:mga0a205_340181_c1 | 3300050515 | Bacteria | 1369 |
| 992 | nmdc:mga0a205_411460_c1 | 3300050515 | Unclassified | 1215 |
| 993 | nmdc:mga0a205_41338_c1 | 3300050515 | Bacteria | 4439 |
| 994 | nmdc:mga0a205_418782_c1 | 3300050515 | Unclassified | 1202 |
| 995 | nmdc:mga0a205_659071_c1 | 3300050515 | Bacteria | 898 |
| 996 | Ga0495601_0001625 | 3300053077 | Bacteria | 12372 |
| 997 | Ga0495601_0018399 | 3300053077 | Bacteria | 4252 |
| 998 | Ga0495601_0051170 | 3300053077 | Bacteria | 2607 |
| 999 | Ga0495601_0172563 | 3300053077 | Unclassified | 1413 |
| 1000 | Ga0495601_0230088 | 3300053077 | Bacteria | 1211 |
| 1001 | Ga0495612_0360478 | 3300053078 | Unclassified | 657 |
| 1002 | Ga0500610_0235387 | 3300053079 | Bacteria | 856 |
| 1003 | Ga0495595_0059057 | 3300053084 | Unclassified | 1792 |
| 1004 | Ga0495595_0201711 | 3300053084 | Bacteria | 990 |
| 1005 | Ga0495619_0003403 | 3300053085 | Bacteria | 10279 |
| 1006 | Ga0495619_0020908 | 3300053085 | Bacteria | 4174 |
| 1007 | Ga0495619_0170015 | 3300053085 | Bacteria | 1507 |
| 1008 | Ga0495619_0240922 | 3300053085 | Bacteria | 1253 |
| 1009 | Ga0495619_0382337 | 3300053085 | Unclassified | 973 |
| 1010 | Ga0495619_0982521 | 3300053085 | Unclassified | 565 |
| 1011 | Ga0500555_000534 | 3300053103 | Bacteria | 15161 |
| 1012 | Ga0500592_038539 | 3300053116 | Bacteria | 773 |
| 1013 | Ga0500568_0001551 | 3300053139 | Bacteria | 14594 |
| 1014 | Ga0500616_0001234 | 3300053153 | Bacteria | 25666 |
| 1015 | Ga0500645_000765 | 3300053730 | Bacteria | 19561 |
| 1016 | Ga0500599_004568 | 3300053736 | Bacteria | 1716 |
| 1017 | Ga0501084_0020123 | 3300054114 | Bacteria | 5564 |
| 1018 | Ga0501084_0119412 | 3300054114 | Bacteria | 2216 |
| 1019 | Ga0501084_0289560 | 3300054114 | Bacteria | 1383 |
| 1020 | Ga0501084_0309844 | 3300054114 | Bacteria | 1333 |
| 1021 | Ga0501084_1200912 | 3300054114 | Unclassified | 636 |
| 1022 | Ga0590074_005514 | 3300059423 | Unclassified | 2097 |
| 1023 | Ga0590075_000399 | 3300059424 | Bacteria | 11905 |
| 1024 | Ga0590077_000076 | 3300059426 | Bacteria | 24905 |
| 1025 | Ga0501082_0050575 | 3300060353 | Bacteria | 3583 |
| 1026 | Ga0501082_0077672 | 3300060353 | Bacteria | 2863 |
| 1027 | Ga0530510_0034897 | 3300061734 | Bacteria | 3624 |
| 1028 | Ga0530510_0075353 | 3300061734 | Bacteria | 2450 |
| 1029 | Ga0530510_0088788 | 3300061734 | Bacteria | 2254 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009147 | Ga0114129_10001136 | Ga0114129_1000113620 | 100 |
| 2 | 3300005549 | Ga0070704_100183958 | Ga0070704_1001839582 | 105 |
| 3 | 3300006846 | Ga0075430_100412544 | Ga0075430_1004125442 | 105 |
| 4 | 3300006847 | Ga0075431_100032521 | Ga0075431_1000325219 | 105 |
| 5 | 3300006880 | Ga0075429_100031390 | Ga0075429_1000313905 | 105 |
| 6 | 3300009094 | Ga0111539_10754590 | Ga0111539_107545902 | 105 |
| 7 | 3300009147 | Ga0114129_10034877 | Ga0114129_100348775 | 105 |
| 8 | 3300027907 | Ga0207428_10365403 | Ga0207428_103654032 | 105 |
| 9 | 3300050507 | nmdc:mga05p37_26077_c1 | nmdc:mga05p37_26077_c1_3915_4328 | 105 |
| 10 | 3300050508 | nmdc:mga09592_23509_c1 | nmdc:mga09592_23509_c1_1638_2051 | 105 |
| 11 | 3300050509 | nmdc:mga0qj67_126142_c1 | nmdc:mga0qj67_126142_c1_991_1404 | 105 |
| 12 | 3300050510 | nmdc:mga06r32_24197_c1 | nmdc:mga06r32_24197_c1_949_1362 | 105 |
| 13 | 3300050511 | nmdc:mga08y16_804290_c1 | nmdc:mga08y16_804290_c1_331_744 | 105 |
| 14 | 3300006844 | Ga0075428_100068181 | Ga0075428_1000681815 | 107 |
| 15 | 3300006852 | Ga0075433_10059425 | Ga0075433_100594252 | 107 |
| 16 | 3300006880 | Ga0075429_100022058 | Ga0075429_1000220583 | 107 |
| 17 | 3300042436 | Ga0439435_0084294 | Ga0439435_0084294_493_909 | 107 |
| 18 | 3300050507 | nmdc:mga05p37_2699_c1 | nmdc:mga05p37_2699_c1_3236_3697 | 107 |
| 19 | 3300050508 | nmdc:mga09592_47513_c1 | nmdc:mga09592_47513_c1_828_1289 | 107 |
| 20 | 3300050512 | nmdc:mga0n895_10215_c1 | nmdc:mga0n895_10215_c1_1429_1890 | 107 |
| 21 | 3300050515 | nmdc:mga0a205_27753_c1 | nmdc:mga0a205_27753_c1_3329_3790 | 107 |
| 22 | 3300054114 | Ga0501084_1200912 | Ga0501084_1200912_62_478 | 107 |
| 23 | 3300005617 | Ga0068859_100000008 | Ga0068859_100000008152 | 108 |
| 24 | 3300006931 | Ga0097620_100000008 | Ga0097620_100000008152 | 108 |
| 25 | 3300049574 | Ga0501038_0213541 | Ga0501038_0213541_153_569 | 108 |
| 26 | 3300049575 | Ga0501039_0087056 | Ga0501039_0087056_228_644 | 108 |
| 27 | 3300049576 | Ga0501040_0014780 | Ga0501040_0014780_882_1298 | 108 |
| 28 | 3300049577 | Ga0501041_0025933 | Ga0501041_0025933_227_643 | 108 |
| 29 | 3300049578 | Ga0501042_0015080 | Ga0501042_0015080_3157_3573 | 108 |
| 30 | 3300049579 | Ga0501043_0044653 | Ga0501043_0044653_1181_1597 | 108 |
| 31 | 3300049580 | Ga0501046_0012446 | Ga0501046_0012446_5002_5418 | 108 |
| 32 | 3300049581 | Ga0501047_1003840 | Ga0501047_1003840_221_637 | 108 |
| 33 | 3300049582 | Ga0501048_0222047 | Ga0501048_0222047_804_1220 | 108 |
| 34 | 3300049584 | Ga0501068_0068848 | Ga0501068_0068848_38_454 | 108 |
| 35 | 3300049587 | Ga0501071_0054536 | Ga0501071_0054536_1796_2212 | 108 |
| 36 | 3300049588 | Ga0501072_0081480 | Ga0501072_0081480_358_774 | 108 |
| 37 | 3300049591 | Ga0501075_0039322 | Ga0501075_0039322_1295_1711 | 108 |
| 38 | 3300049592 | Ga0501076_0015807 | Ga0501076_0015807_2725_3141 | 108 |
| 39 | 3300049593 | Ga0501077_0422962 | Ga0501077_0422962_371_787 | 108 |
| 40 | 3300049741 | Ga0501079_0045235 | Ga0501079_0045235_2218_2634 | 108 |
| 41 | 3300049742 | Ga0501080_0540579 | Ga0501080_0540579_561_977 | 108 |
| 42 | 3300049743 | Ga0501081_0016297 | Ga0501081_0016297_1843_2259 | 108 |
| 43 | 3300049744 | Ga0501083_0424744 | Ga0501083_0424744_423_839 | 108 |
| 44 | 3300049822 | Ga0501035_0490541 | Ga0501035_0490541_146_562 | 108 |
| 45 | 3300049824 | Ga0501045_0007712 | Ga0501045_0007712_1858_2274 | 108 |
| 46 | 3300054114 | Ga0501084_0020123 | Ga0501084_0020123_407_823 | 108 |
| 47 | 3300060353 | Ga0501082_0050575 | Ga0501082_0050575_1279_1695 | 108 |
| 48 | 3300061734 | Ga0530510_0075353 | Ga0530510_0075353_421_837 | 108 |
| 49 | 3300005345 | Ga0070692_10061545 | Ga0070692_100615452 | 109 |
| 50 | 3300005466 | Ga0070685_10000594 | Ga0070685_1000059410 | 109 |
| 51 | 3300026041 | Ga0207639_11476274 | Ga0207639_114762741 | 109 |
| 52 | 3300034820 | Ga0373959_0000033 | Ga0373959_0000033_18126_18545 | 109 |
| 53 | 3300005466 | Ga0070685_10001074 | Ga0070685_100010748 | 113 |
| 54 | 3300025923 | Ga0207681_10917123 | Ga0207681_109171232 | 113 |
| 55 | 3300039438 | Ga0436360_0085243 | Ga0436360_0085243_111_473 | 113 |
| 56 | 3300025885 | Ga0207653_10078964 | Ga0207653_100789642 | 114 |
| 57 | 3300039437 | Ga0436365_0298694 | Ga0436365_0298694_10_375 | 114 |
| 58 | 3300045049 | Ga0466959_1154913 | Ga0466959_1154913_109_474 | 114 |
| 59 | 3300006871 | Ga0075434_100097090 | Ga0075434_1000970902 | 115 |
| 60 | 3300007076 | Ga0075435_100111403 | Ga0075435_1001114032 | 115 |
| 61 | 3300009176 | Ga0105242_11444150 | Ga0105242_114441502 | 115 |
| 62 | 3300039450 | Ga0436363_1164207 | Ga0436363_1164207_228_596 | 115 |
| 63 | 3300050512 | nmdc:mga0n895_234274_c1 | nmdc:mga0n895_234274_c1_334_738 | 115 |
| 64 | 3300050513 | nmdc:mga0rr50_564067_c1 | nmdc:mga0rr50_564067_c1_484_888 | 115 |
| 65 | 3300006844 | Ga0075428_100015342 | Ga0075428_1000153422 | 116 |
| 66 | 3300006880 | Ga0075429_100605818 | Ga0075429_1006058181 | 116 |
| 67 | 3300039438 | Ga0436360_0188929 | Ga0436360_0188929_198_569 | 116 |
| 68 | 3300044712 | Ga0453684_0261948 | Ga0453684_0261948_40_411 | 116 |
| 69 | 3300039438 | Ga0436360_0945317 | Ga0436360_0945317_56_430 | 117 |
| 70 | 3300050508 | nmdc:mga09592_740066_c1 | nmdc:mga09592_740066_c1_388_786 | 117 |
| 71 | 3300005328 | Ga0070676_10155330 | Ga0070676_101553302 | 118 |
| 72 | 3300005330 | Ga0070690_100004503 | Ga0070690_1000045033 | 118 |
| 73 | 3300005335 | Ga0070666_10057567 | Ga0070666_100575672 | 118 |
| 74 | 3300005335 | Ga0070666_10700490 | Ga0070666_107004901 | 118 |
| 75 | 3300005347 | Ga0070668_100263317 | Ga0070668_1002633172 | 118 |
| 76 | 3300005353 | Ga0070669_100193748 | Ga0070669_1001937482 | 118 |
| 77 | 3300005354 | Ga0070675_100785606 | Ga0070675_1007856061 | 118 |
| 78 | 3300005356 | Ga0070674_101006195 | Ga0070674_1010061952 | 118 |
| 79 | 3300005457 | Ga0070662_100483752 | Ga0070662_1004837521 | 118 |
| 80 | 3300005543 | Ga0070672_101076358 | Ga0070672_1010763582 | 118 |
| 81 | 3300005544 | Ga0070686_100000502 | Ga0070686_1000005022 | 118 |
| 82 | 3300005563 | Ga0068855_100108401 | Ga0068855_1001084012 | 118 |
| 83 | 3300005578 | Ga0068854_100126345 | Ga0068854_1001263452 | 118 |
| 84 | 3300005617 | Ga0068859_101778746 | Ga0068859_1017787461 | 118 |
| 85 | 3300005719 | Ga0068861_100154551 | Ga0068861_1001545512 | 118 |
| 86 | 3300005719 | Ga0068861_100302041 | Ga0068861_1003020412 | 118 |
| 87 | 3300005719 | Ga0068861_101154897 | Ga0068861_1011548972 | 118 |
| 88 | 3300005843 | Ga0068860_102063357 | Ga0068860_1020633572 | 118 |
| 89 | 3300005844 | Ga0068862_100064665 | Ga0068862_1000646652 | 118 |
| 90 | 3300006358 | Ga0068871_100000602 | Ga0068871_10000060215 | 118 |
| 91 | 3300006931 | Ga0097620_101778745 | Ga0097620_1017787451 | 118 |
| 92 | 3300009093 | Ga0105240_10093322 | Ga0105240_100933222 | 118 |
| 93 | 3300009093 | Ga0105240_10143693 | Ga0105240_101436932 | 118 |
| 94 | 3300009094 | Ga0111539_10000556 | Ga0111539_100005563 | 118 |
| 95 | 3300009174 | Ga0105241_10047313 | Ga0105241_100473133 | 118 |
| 96 | 3300009176 | Ga0105242_10395084 | Ga0105242_103950843 | 118 |
| 97 | 3300009176 | Ga0105242_11051655 | Ga0105242_110516552 | 118 |
| 98 | 3300009177 | Ga0105248_10472716 | Ga0105248_104727162 | 118 |
| 99 | 3300009177 | Ga0105248_10726233 | Ga0105248_107262331 | 118 |
| 100 | 3300014969 | Ga0157376_10177326 | Ga0157376_101773263 | 118 |
| 101 | 3300025315 | Ga0207697_10038545 | Ga0207697_100385452 | 118 |
| 102 | 3300025907 | Ga0207645_10092452 | Ga0207645_100924522 | 118 |
| 103 | 3300025910 | Ga0207684_10887641 | Ga0207684_108876412 | 118 |
| 104 | 3300025923 | Ga0207681_11293354 | Ga0207681_112933541 | 118 |
| 105 | 3300025926 | Ga0207659_10210421 | Ga0207659_102104211 | 118 |
| 106 | 3300025938 | Ga0207704_10172031 | Ga0207704_101720312 | 118 |
| 107 | 3300025941 | Ga0207711_10819025 | Ga0207711_108190252 | 118 |
| 108 | 3300025942 | Ga0207689_10168743 | Ga0207689_101687432 | 118 |
| 109 | 3300025972 | Ga0207668_10073257 | Ga0207668_100732571 | 118 |
| 110 | 3300026075 | Ga0207708_10086421 | Ga0207708_100864212 | 118 |
| 111 | 3300026116 | Ga0207674_10632100 | Ga0207674_106321002 | 118 |
| 112 | 3300026118 | Ga0207675_100107470 | Ga0207675_1001074702 | 118 |
| 113 | 3300026118 | Ga0207675_100426787 | Ga0207675_1004267872 | 118 |
| 114 | 3300028379 | Ga0268266_10011577 | Ga0268266_100115773 | 118 |
| 115 | 3300028800 | Ga0265338_10070820 | Ga0265338_100708203 | 118 |
| 116 | 3300029957 | Ga0265324_10000538 | Ga0265324_100005388 | 118 |
| 117 | 3300031241 | Ga0265325_10039062 | Ga0265325_100390623 | 118 |
| 118 | 3300031249 | Ga0265339_10000120 | Ga0265339_1000012015 | 118 |
| 119 | 3300031548 | Ga0307408_100988936 | Ga0307408_1009889362 | 118 |
| 120 | 3300031595 | Ga0265313_10009483 | Ga0265313_100094831 | 118 |
| 121 | 3300034957 | Ga0373938_0050918 | Ga0373938_0050918_407_808 | 118 |
| 122 | 3300035112 | Ga0373932_0101387 | Ga0373932_0101387_226_627 | 118 |
| 123 | 3300035114 | Ga0373939_0218076 | Ga0373939_0218076_109_510 | 118 |
| 124 | 3300036401 | Ga0373937_0154959 | Ga0373937_0154959_843_1244 | 118 |
| 125 | 3300039453 | Ga0436362_1222382 | Ga0436362_1222382_39_416 | 118 |
| 126 | 3300045051 | Ga0451576_0482414 | Ga0451576_0482414_59_460 | 118 |
| 127 | 3300046559 | Ga0495667_0791394 | Ga0495667_0791394_40_417 | 118 |
| 128 | 3300048917 | Ga0496114_0077423 | Ga0496114_0077423_983_1363 | 118 |
| 129 | 3300049570 | Ga0501033_0166664 | Ga0501033_0166664_585_962 | 118 |
| 130 | 3300049578 | Ga0501042_0061267 | Ga0501042_0061267_1377_1754 | 118 |
| 131 | 3300049741 | Ga0501079_0035544 | Ga0501079_0035544_1618_1995 | 118 |
| 132 | 3300049744 | Ga0501083_0781504 | Ga0501083_0781504_119_496 | 118 |
| 133 | 3300050511 | nmdc:mga08y16_5349_c1 | nmdc:mga08y16_5349_c1_2643_3020 | 118 |
| 134 | 3300050511 | nmdc:mga08y16_58599_c1 | nmdc:mga08y16_58599_c1_1812_2186 | 118 |
| 135 | 3300053085 | Ga0495619_0170015 | Ga0495619_0170015_461_838 | 118 |
| 136 | 3300060353 | Ga0501082_0077672 | Ga0501082_0077672_2290_2667 | 118 |
| 137 | 3300061734 | Ga0530510_0088788 | Ga0530510_0088788_579_956 | 118 |
| 138 | 3300003203 | JGI25406J46586_10126970 | JGI25406J46586_101269702 | 119 |
| 139 | 3300005290 | Ga0065712_10163377 | Ga0065712_101633773 | 119 |
| 140 | 3300005293 | Ga0065715_10095978 | Ga0065715_100959783 | 119 |
| 141 | 3300005293 | Ga0065715_10548009 | Ga0065715_105480092 | 119 |
| 142 | 3300005295 | Ga0065707_11101634 | Ga0065707_111016341 | 119 |
| 143 | 3300005334 | Ga0068869_100179391 | Ga0068869_1001793912 | 119 |
| 144 | 3300005336 | Ga0070680_101462553 | Ga0070680_1014625531 | 119 |
| 145 | 3300005345 | Ga0070692_10147036 | Ga0070692_101470362 | 119 |
| 146 | 3300005355 | Ga0070671_101160985 | Ga0070671_1011609851 | 119 |
| 147 | 3300005364 | Ga0070673_100119771 | Ga0070673_1001197712 | 119 |
| 148 | 3300005438 | Ga0070701_10013001 | Ga0070701_100130013 | 119 |
| 149 | 3300005440 | Ga0070705_100001204 | Ga0070705_10000120415 | 119 |
| 150 | 3300005440 | Ga0070705_100268547 | Ga0070705_1002685471 | 119 |
| 151 | 3300005444 | Ga0070694_100000199 | Ga0070694_10000019913 | 119 |
| 152 | 3300005444 | Ga0070694_100113500 | Ga0070694_1001135002 | 119 |
| 153 | 3300005444 | Ga0070694_100878893 | Ga0070694_1008788931 | 119 |
| 154 | 3300005445 | Ga0070708_100790962 | Ga0070708_1007909622 | 119 |
| 155 | 3300005445 | Ga0070708_101383389 | Ga0070708_1013833891 | 119 |
| 156 | 3300005467 | Ga0070706_100286341 | Ga0070706_1002863412 | 119 |
| 157 | 3300005467 | Ga0070706_100753472 | Ga0070706_1007534721 | 119 |
| 158 | 3300005468 | Ga0070707_100048198 | Ga0070707_1000481983 | 119 |
| 159 | 3300005471 | Ga0070698_100885765 | Ga0070698_1008857652 | 119 |
| 160 | 3300005518 | Ga0070699_100044641 | Ga0070699_1000446414 | 119 |
| 161 | 3300005518 | Ga0070699_100251862 | Ga0070699_1002518622 | 119 |
| 162 | 3300005518 | Ga0070699_100691403 | Ga0070699_1006914031 | 119 |
| 163 | 3300005536 | Ga0070697_100143099 | Ga0070697_1001430992 | 119 |
| 164 | 3300005536 | Ga0070697_100309850 | Ga0070697_1003098501 | 119 |
| 165 | 3300005536 | Ga0070697_100918821 | Ga0070697_1009188211 | 119 |
| 166 | 3300005536 | Ga0070697_101151830 | Ga0070697_1011518302 | 119 |
| 167 | 3300005536 | Ga0070697_101568853 | Ga0070697_1015688532 | 119 |
| 168 | 3300005545 | Ga0070695_100009912 | Ga0070695_1000099126 | 119 |
| 169 | 3300005545 | Ga0070695_100019613 | Ga0070695_1000196133 | 119 |
| 170 | 3300005545 | Ga0070695_100791193 | Ga0070695_1007911932 | 119 |
| 171 | 3300005546 | Ga0070696_100000175 | Ga0070696_10000017512 | 119 |
| 172 | 3300005549 | Ga0070704_100095094 | Ga0070704_1000950943 | 119 |
| 173 | 3300005549 | Ga0070704_101256039 | Ga0070704_1012560392 | 119 |
| 174 | 3300005549 | Ga0070704_101290213 | Ga0070704_1012902131 | 119 |
| 175 | 3300005577 | Ga0068857_100260748 | Ga0068857_1002607483 | 119 |
| 176 | 3300005615 | Ga0070702_100010911 | Ga0070702_1000109116 | 119 |
| 177 | 3300005617 | Ga0068859_100006797 | Ga0068859_10000679712 | 119 |
| 178 | 3300005617 | Ga0068859_100401093 | Ga0068859_1004010932 | 119 |
| 179 | 3300005617 | Ga0068859_100532814 | Ga0068859_1005328143 | 119 |
| 180 | 3300005618 | Ga0068864_100091080 | Ga0068864_1000910802 | 119 |
| 181 | 3300005719 | Ga0068861_100044659 | Ga0068861_1000446594 | 119 |
| 182 | 3300005841 | Ga0068863_100895698 | Ga0068863_1008956982 | 119 |
| 183 | 3300005842 | Ga0068858_100018287 | Ga0068858_1000182873 | 119 |
| 184 | 3300005842 | Ga0068858_100119856 | Ga0068858_1001198564 | 119 |
| 185 | 3300005842 | Ga0068858_101580208 | Ga0068858_1015802082 | 119 |
| 186 | 3300005843 | Ga0068860_100182395 | Ga0068860_1001823952 | 119 |
| 187 | 3300005843 | Ga0068860_100257094 | Ga0068860_1002570942 | 119 |
| 188 | 3300005844 | Ga0068862_101490565 | Ga0068862_1014905652 | 119 |
| 189 | 3300005985 | Ga0081539_10005585 | Ga0081539_100055852 | 119 |
| 190 | 3300006173 | Ga0070716_100338310 | Ga0070716_1003383102 | 119 |
| 191 | 3300006871 | Ga0075434_101589033 | Ga0075434_1015890331 | 119 |
| 192 | 3300006914 | Ga0075436_100212250 | Ga0075436_1002122502 | 119 |
| 193 | 3300006931 | Ga0097620_100006797 | Ga0097620_10000679712 | 119 |
| 194 | 3300006931 | Ga0097620_100401074 | Ga0097620_1004010742 | 119 |
| 195 | 3300006931 | Ga0097620_100532784 | Ga0097620_1005327842 | 119 |
| 196 | 3300007076 | Ga0075435_100009571 | Ga0075435_1000095715 | 119 |
| 197 | 3300007076 | Ga0075435_100072244 | Ga0075435_1000722442 | 119 |
| 198 | 3300009098 | Ga0105245_11212716 | Ga0105245_112127162 | 119 |
| 199 | 3300009101 | Ga0105247_10037495 | Ga0105247_100374952 | 119 |
| 200 | 3300009101 | Ga0105247_10369425 | Ga0105247_103694252 | 119 |
| 201 | 3300009147 | Ga0114129_10156623 | Ga0114129_101566232 | 119 |
| 202 | 3300009174 | Ga0105241_10381023 | Ga0105241_103810232 | 119 |
| 203 | 3300009177 | Ga0105248_10008693 | Ga0105248_1000869312 | 119 |
| 204 | 3300009177 | Ga0105248_10511882 | Ga0105248_105118822 | 119 |
| 205 | 3300009551 | Ga0105238_10247606 | Ga0105238_102476062 | 119 |
| 206 | 3300009551 | Ga0105238_12775976 | Ga0105238_127759761 | 119 |
| 207 | 3300014325 | Ga0163163_10026633 | Ga0163163_100266335 | 119 |
| 208 | 3300014968 | Ga0157379_10279199 | Ga0157379_102791992 | 119 |
| 209 | 3300014968 | Ga0157379_10419308 | Ga0157379_104193082 | 119 |
| 210 | 3300025907 | Ga0207645_10126660 | Ga0207645_101266602 | 119 |
| 211 | 3300025910 | Ga0207684_10595146 | Ga0207684_105951461 | 119 |
| 212 | 3300025922 | Ga0207646_10189461 | Ga0207646_101894613 | 119 |
| 213 | 3300025939 | Ga0207665_10230644 | Ga0207665_102306442 | 119 |
| 214 | 3300025941 | Ga0207711_10646907 | Ga0207711_106469072 | 119 |
| 215 | 3300025960 | Ga0207651_10008548 | Ga0207651_100085483 | 119 |
| 216 | 3300026035 | Ga0207703_10236208 | Ga0207703_102362084 | 119 |
| 217 | 3300026075 | Ga0207708_10116810 | Ga0207708_101168102 | 119 |
| 218 | 3300026095 | Ga0207676_11880085 | Ga0207676_118800852 | 119 |
| 219 | 3300026116 | Ga0207674_10630925 | Ga0207674_106309252 | 119 |
| 220 | 3300026118 | Ga0207675_100039599 | Ga0207675_1000395994 | 119 |
| 221 | 3300028380 | Ga0268265_10241827 | Ga0268265_102418272 | 119 |
| 222 | 3300037853 | Ga0436364_1424755 | Ga0436364_1424755_713_1096 | 119 |
| 223 | 3300045836 | Ga0466958_0327142 | Ga0466958_0327142_77_448 | 119 |
| 224 | 3300046514 | Ga0495618_0330891 | Ga0495618_0330891_127_510 | 119 |
| 225 | 3300046516 | Ga0495628_0098276 | Ga0495628_0098276_1615_1998 | 119 |
| 226 | 3300046523 | Ga0495644_0388096 | Ga0495644_0388096_74_445 | 119 |
| 227 | 3300046678 | Ga0495599_0128426 | Ga0495599_0128426_527_910 | 119 |
| 228 | 3300046683 | Ga0495658_0114695 | Ga0495658_0114695_1013_1420 | 119 |
| 229 | 3300046684 | Ga0495669_0000953 | Ga0495669_0000953_992_1363 | 119 |
| 230 | 3300048910 | Ga0496107_0584194 | Ga0496107_0584194_420_794 | 119 |
| 231 | 3300048915 | Ga0496112_1652313 | Ga0496112_1652313_156_530 | 119 |
| 232 | 3300049589 | Ga0501073_0133983 | Ga0501073_0133983_54_431 | 119 |
| 233 | 3300049824 | Ga0501045_0547542 | Ga0501045_0547542_427_822 | 119 |
| 234 | 3300050512 | nmdc:mga0n895_1925053_c1 | nmdc:mga0n895_1925053_c1_30_401 | 119 |
| 235 | 3300050514 | nmdc:mga08x19_173140_c1 | nmdc:mga08x19_173140_c1_415_786 | 119 |
| 236 | 3300050514 | nmdc:mga08x19_47864_c1 | nmdc:mga08x19_47864_c1_1854_2225 | 119 |
| 237 | 3300053077 | Ga0495601_0051170 | Ga0495601_0051170_381_764 | 119 |
| 238 | 3300053077 | Ga0495601_0172563 | Ga0495601_0172563_276_647 | 119 |
| 239 | 3300053085 | Ga0495619_0240922 | Ga0495619_0240922_621_1004 | 119 |
| 240 | 3300054114 | Ga0501084_0309844 | Ga0501084_0309844_873_1262 | 119 |
| 241 | 3300005345 | Ga0070692_10667186 | Ga0070692_106671862 | 120 |
| 242 | 3300005353 | Ga0070669_100297443 | Ga0070669_1002974431 | 120 |
| 243 | 3300005406 | Ga0070703_10411627 | Ga0070703_104116271 | 120 |
| 244 | 3300005444 | Ga0070694_100488410 | Ga0070694_1004884102 | 120 |
| 245 | 3300005458 | Ga0070681_10936329 | Ga0070681_109363291 | 120 |
| 246 | 3300005467 | Ga0070706_100009661 | Ga0070706_1000096612 | 120 |
| 247 | 3300005471 | Ga0070698_100035117 | Ga0070698_1000351172 | 120 |
| 248 | 3300005530 | Ga0070679_101016677 | Ga0070679_1010166772 | 120 |
| 249 | 3300005549 | Ga0070704_100567072 | Ga0070704_1005670722 | 120 |
| 250 | 3300005578 | Ga0068854_101292596 | Ga0068854_1012925961 | 120 |
| 251 | 3300005616 | Ga0068852_100584081 | Ga0068852_1005840812 | 120 |
| 252 | 3300005719 | Ga0068861_100001159 | Ga0068861_1000011592 | 120 |
| 253 | 3300005841 | Ga0068863_100639108 | Ga0068863_1006391081 | 120 |
| 254 | 3300005843 | Ga0068860_100137849 | Ga0068860_1001378491 | 120 |
| 255 | 3300006237 | Ga0097621_100100709 | Ga0097621_1001007093 | 120 |
| 256 | 3300006844 | Ga0075428_100083818 | Ga0075428_1000838182 | 120 |
| 257 | 3300006846 | Ga0075430_100174248 | Ga0075430_1001742482 | 120 |
| 258 | 3300006847 | Ga0075431_100905560 | Ga0075431_1009055601 | 120 |
| 259 | 3300006852 | Ga0075433_10051253 | Ga0075433_100512532 | 120 |
| 260 | 3300006852 | Ga0075433_10380038 | Ga0075433_103800382 | 120 |
| 261 | 3300006871 | Ga0075434_100058856 | Ga0075434_1000588562 | 120 |
| 262 | 3300006880 | Ga0075429_100039747 | Ga0075429_1000397472 | 120 |
| 263 | 3300006914 | Ga0075436_100035265 | Ga0075436_1000352652 | 120 |
| 264 | 3300009147 | Ga0114129_10003962 | Ga0114129_1000396220 | 120 |
| 265 | 3300009177 | Ga0105248_10051306 | Ga0105248_100513066 | 120 |
| 266 | 3300009545 | Ga0105237_12258382 | Ga0105237_122583821 | 120 |
| 267 | 3300013306 | Ga0163162_10974178 | Ga0163162_109741781 | 120 |
| 268 | 3300013308 | Ga0157375_10500284 | Ga0157375_105002842 | 120 |
| 269 | 3300025910 | Ga0207684_10008764 | Ga0207684_100087649 | 120 |
| 270 | 3300025921 | Ga0207652_11075327 | Ga0207652_110753272 | 120 |
| 271 | 3300025923 | Ga0207681_10266637 | Ga0207681_102666371 | 120 |
| 272 | 3300025925 | Ga0207650_10863256 | Ga0207650_108632562 | 120 |
| 273 | 3300025941 | Ga0207711_11365127 | Ga0207711_113651272 | 120 |
| 274 | 3300025941 | Ga0207711_11730472 | Ga0207711_117304721 | 120 |
| 275 | 3300026118 | Ga0207675_100002093 | Ga0207675_10000209315 | 120 |
| 276 | 3300045051 | Ga0451576_1281538 | Ga0451576_1281538_295_684 | 120 |
| 277 | 3300045051 | Ga0451576_1320859 | Ga0451576_1320859_227_598 | 120 |
| 278 | 3300050507 | nmdc:mga05p37_2083_c1 | nmdc:mga05p37_2083_c1_21729_22124 | 120 |
| 279 | 3300050507 | nmdc:mga05p37_67043_c1 | nmdc:mga05p37_67043_c1_319_693 | 120 |
| 280 | 3300050508 | nmdc:mga09592_21353_c1 | nmdc:mga09592_21353_c1_1399_1788 | 120 |
| 281 | 3300050509 | nmdc:mga0qj67_813866_c1 | nmdc:mga0qj67_813866_c1_76_465 | 120 |
| 282 | 3300050510 | nmdc:mga06r32_50145_c1 | nmdc:mga06r32_50145_c1_3297_3686 | 120 |
| 283 | 3300050512 | nmdc:mga0n895_79940_c1 | nmdc:mga0n895_79940_c1_2745_3119 | 120 |
| 284 | 3300050513 | nmdc:mga0rr50_220592_c1 | nmdc:mga0rr50_220592_c1_684_1058 | 120 |
| 285 | 3300050514 | nmdc:mga08x19_79399_c1 | nmdc:mga08x19_79399_c1_124_498 | 120 |
| 286 | 3300050515 | nmdc:mga0a205_103441_c1 | nmdc:mga0a205_103441_c1_123_518 | 120 |
| 287 | 3300050515 | nmdc:mga0a205_27615_c1 | nmdc:mga0a205_27615_c1_2602_2976 | 120 |
| 288 | 3300005290 | Ga0065712_10683715 | Ga0065712_106837151 | 121 |
| 289 | 3300005333 | Ga0070677_10280675 | Ga0070677_102806752 | 121 |
| 290 | 3300005335 | Ga0070666_10305212 | Ga0070666_103052122 | 121 |
| 291 | 3300005338 | Ga0068868_100105604 | Ga0068868_1001056042 | 121 |
| 292 | 3300005353 | Ga0070669_100370309 | Ga0070669_1003703091 | 121 |
| 293 | 3300005354 | Ga0070675_100363005 | Ga0070675_1003630052 | 121 |
| 294 | 3300005356 | Ga0070674_100004723 | Ga0070674_1000047239 | 121 |
| 295 | 3300005435 | Ga0070714_100052603 | Ga0070714_1000526033 | 121 |
| 296 | 3300005436 | Ga0070713_100084183 | Ga0070713_1000841832 | 121 |
| 297 | 3300005441 | Ga0070700_100512674 | Ga0070700_1005126741 | 121 |
| 298 | 3300005441 | Ga0070700_100988232 | Ga0070700_1009882321 | 121 |
| 299 | 3300005455 | Ga0070663_101718454 | Ga0070663_1017184542 | 121 |
| 300 | 3300005456 | Ga0070678_101327445 | Ga0070678_1013274451 | 121 |
| 301 | 3300005457 | Ga0070662_101507269 | Ga0070662_1015072691 | 121 |
| 302 | 3300005459 | Ga0068867_100098119 | Ga0068867_1000981192 | 121 |
| 303 | 3300005518 | Ga0070699_100670639 | Ga0070699_1006706392 | 121 |
| 304 | 3300005548 | Ga0070665_100000734 | Ga0070665_10000073431 | 121 |
| 305 | 3300005614 | Ga0068856_100104531 | Ga0068856_1001045312 | 121 |
| 306 | 3300005614 | Ga0068856_102240776 | Ga0068856_1022407761 | 121 |
| 307 | 3300005719 | Ga0068861_100260019 | Ga0068861_1002600192 | 121 |
| 308 | 3300005834 | Ga0068851_10137939 | Ga0068851_101379391 | 121 |
| 309 | 3300005841 | Ga0068863_100073259 | Ga0068863_1000732592 | 121 |
| 310 | 3300005841 | Ga0068863_100295672 | Ga0068863_1002956722 | 121 |
| 311 | 3300005842 | Ga0068858_100049229 | Ga0068858_1000492292 | 121 |
| 312 | 3300005843 | Ga0068860_101870211 | Ga0068860_1018702112 | 121 |
| 313 | 3300006028 | Ga0070717_10672534 | Ga0070717_106725342 | 121 |
| 314 | 3300006163 | Ga0070715_10017875 | Ga0070715_100178752 | 121 |
| 315 | 3300006163 | Ga0070715_10158890 | Ga0070715_101588902 | 121 |
| 316 | 3300006173 | Ga0070716_100106522 | Ga0070716_1001065222 | 121 |
| 317 | 3300006237 | Ga0097621_100005878 | Ga0097621_1000058785 | 121 |
| 318 | 3300006237 | Ga0097621_100026029 | Ga0097621_1000260293 | 121 |
| 319 | 3300006237 | Ga0097621_100754788 | Ga0097621_1007547882 | 121 |
| 320 | 3300006358 | Ga0068871_100306734 | Ga0068871_1003067342 | 121 |
| 321 | 3300006844 | Ga0075428_100019087 | Ga0075428_1000190874 | 121 |
| 322 | 3300006844 | Ga0075428_100058014 | Ga0075428_1000580142 | 121 |
| 323 | 3300006846 | Ga0075430_100012800 | Ga0075430_1000128006 | 121 |
| 324 | 3300006846 | Ga0075430_100311079 | Ga0075430_1003110792 | 121 |
| 325 | 3300006847 | Ga0075431_100631749 | Ga0075431_1006317492 | 121 |
| 326 | 3300006852 | Ga0075433_10337038 | Ga0075433_103370381 | 121 |
| 327 | 3300006871 | Ga0075434_100105006 | Ga0075434_1001050062 | 121 |
| 328 | 3300006880 | Ga0075429_100970906 | Ga0075429_1009709062 | 121 |
| 329 | 3300006880 | Ga0075429_101507501 | Ga0075429_1015075012 | 121 |
| 330 | 3300006881 | Ga0068865_100153523 | Ga0068865_1001535232 | 121 |
| 331 | 3300009094 | Ga0111539_10000736 | Ga0111539_1000073629 | 121 |
| 332 | 3300009094 | Ga0111539_10000850 | Ga0111539_1000085036 | 121 |
| 333 | 3300009094 | Ga0111539_10303238 | Ga0111539_103032382 | 121 |
| 334 | 3300009101 | Ga0105247_10217180 | Ga0105247_102171802 | 121 |
| 335 | 3300009101 | Ga0105247_10941423 | Ga0105247_109414231 | 121 |
| 336 | 3300009147 | Ga0114129_10001786 | Ga0114129_100017865 | 121 |
| 337 | 3300009147 | Ga0114129_10095887 | Ga0114129_100958872 | 121 |
| 338 | 3300009176 | Ga0105242_10004812 | Ga0105242_1000481211 | 121 |
| 339 | 3300009177 | Ga0105248_10299874 | Ga0105248_102998743 | 121 |
| 340 | 3300009177 | Ga0105248_10424999 | Ga0105248_104249992 | 121 |
| 341 | 3300009545 | Ga0105237_10547776 | Ga0105237_105477762 | 121 |
| 342 | 3300009553 | Ga0105249_10144827 | Ga0105249_101448272 | 121 |
| 343 | 3300011119 | Ga0105246_10451649 | Ga0105246_104516492 | 121 |
| 344 | 3300013296 | Ga0157374_10008967 | Ga0157374_100089675 | 121 |
| 345 | 3300013308 | Ga0157375_10537265 | Ga0157375_105372652 | 121 |
| 346 | 3300014325 | Ga0163163_10106347 | Ga0163163_101063474 | 121 |
| 347 | 3300014326 | Ga0157380_10161020 | Ga0157380_101610203 | 121 |
| 348 | 3300014968 | Ga0157379_10012857 | Ga0157379_100128572 | 121 |
| 349 | 3300014969 | Ga0157376_10123596 | Ga0157376_101235961 | 121 |
| 350 | 3300025905 | Ga0207685_10182534 | Ga0207685_101825342 | 121 |
| 351 | 3300025914 | Ga0207671_10391763 | Ga0207671_103917632 | 121 |
| 352 | 3300025917 | Ga0207660_11397061 | Ga0207660_113970612 | 121 |
| 353 | 3300025923 | Ga0207681_10362062 | Ga0207681_103620622 | 121 |
| 354 | 3300025926 | Ga0207659_10310605 | Ga0207659_103106052 | 121 |
| 355 | 3300025933 | Ga0207706_10672061 | Ga0207706_106720612 | 121 |
| 356 | 3300025934 | Ga0207686_10021245 | Ga0207686_100212452 | 121 |
| 357 | 3300026023 | Ga0207677_10987358 | Ga0207677_109873582 | 121 |
| 358 | 3300026035 | Ga0207703_10325234 | Ga0207703_103252341 | 121 |
| 359 | 3300026067 | Ga0207678_11383117 | Ga0207678_113831172 | 121 |
| 360 | 3300026078 | Ga0207702_11056544 | Ga0207702_110565442 | 121 |
| 361 | 3300026088 | Ga0207641_10376796 | Ga0207641_103767962 | 121 |
| 362 | 3300026089 | Ga0207648_10134346 | Ga0207648_101343462 | 121 |
| 363 | 3300026089 | Ga0207648_10380901 | Ga0207648_103809012 | 121 |
| 364 | 3300026121 | Ga0207683_10714932 | Ga0207683_107149322 | 121 |
| 365 | 3300027907 | Ga0207428_10010580 | Ga0207428_100105809 | 121 |
| 366 | 3300028381 | Ga0268264_10771695 | Ga0268264_107716951 | 121 |
| 367 | 3300031548 | Ga0307408_101142503 | Ga0307408_1011425032 | 121 |
| 368 | 3300031731 | Ga0307405_10037889 | Ga0307405_100378892 | 121 |
| 369 | 3300031824 | Ga0307413_11420431 | Ga0307413_114204312 | 121 |
| 370 | 3300031852 | Ga0307410_10035658 | Ga0307410_100356583 | 121 |
| 371 | 3300031901 | Ga0307406_10387113 | Ga0307406_103871132 | 121 |
| 372 | 3300031903 | Ga0307407_10107635 | Ga0307407_101076352 | 121 |
| 373 | 3300032002 | Ga0307416_100170863 | Ga0307416_1001708632 | 121 |
| 374 | 3300032002 | Ga0307416_102505290 | Ga0307416_1025052902 | 121 |
| 375 | 3300032004 | Ga0307414_11389598 | Ga0307414_113895981 | 121 |
| 376 | 3300032005 | Ga0307411_10039398 | Ga0307411_100393983 | 121 |
| 377 | 3300032005 | Ga0307411_10523133 | Ga0307411_105231331 | 121 |
| 378 | 3300032005 | Ga0307411_11606139 | Ga0307411_116061391 | 121 |
| 379 | 3300032126 | Ga0307415_100085752 | Ga0307415_1000857522 | 121 |
| 380 | 3300032126 | Ga0307415_100476789 | Ga0307415_1004767892 | 121 |
| 381 | 3300035113 | Ga0373936_0295020 | Ga0373936_0295020_126_506 | 121 |
| 382 | 3300035118 | Ga0373954_0564195 | Ga0373954_0564195_41_454 | 121 |
| 383 | 3300035120 | Ga0373957_0144152 | Ga0373957_0144152_389_769 | 121 |
| 384 | 3300035171 | Ga0373946_0243773 | Ga0373946_0243773_368_748 | 121 |
| 385 | 3300035172 | Ga0373955_0133041 | Ga0373955_0133041_978_1358 | 121 |
| 386 | 3300035172 | Ga0373955_0189045 | Ga0373955_0189045_176_556 | 121 |
| 387 | 3300035207 | Ga0373942_0084394 | Ga0373942_0084394_170_556 | 121 |
| 388 | 3300035692 | Ga0373935_0899219 | Ga0373935_0899219_178_558 | 121 |
| 389 | 3300035695 | Ga0373927_0391430 | Ga0373927_0391430_492_872 | 121 |
| 390 | 3300035724 | Ga0373933_0207445 | Ga0373933_0207445_574_954 | 121 |
| 391 | 3300037068 | Ga0373925_0304817 | Ga0373925_0304817_349_729 | 121 |
| 392 | 3300037068 | Ga0373925_1281841 | Ga0373925_1281841_57_437 | 121 |
| 393 | 3300042876 | Ga0451577_0043520 | Ga0451577_0043520_590_982 | 121 |
| 394 | 3300044712 | Ga0453684_0356274 | Ga0453684_0356274_432_824 | 121 |
| 395 | 3300045051 | Ga0451576_0012591 | Ga0451576_0012591_635_1039 | 121 |
| 396 | 3300045051 | Ga0451576_0221949 | Ga0451576_0221949_1329_1715 | 121 |
| 397 | 3300046460 | Ga0495638_0030093 | Ga0495638_0030093_1359_1736 | 121 |
| 398 | 3300046476 | Ga0495662_0459287 | Ga0495662_0459287_33_413 | 121 |
| 399 | 3300046511 | Ga0495608_0007294 | Ga0495608_0007294_929_1342 | 121 |
| 400 | 3300046522 | Ga0495643_0129231 | Ga0495643_0129231_156_527 | 121 |
| 401 | 3300046559 | Ga0495667_0061625 | Ga0495667_0061625_1232_1645 | 121 |
| 402 | 3300046681 | Ga0495647_0146596 | Ga0495647_0146596_542_922 | 121 |
| 403 | 3300046683 | Ga0495658_1041918 | Ga0495658_1041918_126_506 | 121 |
| 404 | 3300047317 | Ga0495604_0124825 | Ga0495604_0124825_413_826 | 121 |
| 405 | 3300048903 | Ga0496100_0018741 | Ga0496100_0018741_3190_3570 | 121 |
| 406 | 3300048905 | Ga0496102_0845352 | Ga0496102_0845352_372_752 | 121 |
| 407 | 3300048905 | Ga0496102_0903228 | Ga0496102_0903228_379_780 | 121 |
| 408 | 3300048906 | Ga0496103_0372961 | Ga0496103_0372961_410_790 | 121 |
| 409 | 3300048907 | Ga0496104_0030376 | Ga0496104_0030376_1452_1832 | 121 |
| 410 | 3300048907 | Ga0496104_0560735 | Ga0496104_0560735_47_421 | 121 |
| 411 | 3300048908 | Ga0496105_0607282 | Ga0496105_0607282_165_545 | 121 |
| 412 | 3300048910 | Ga0496107_0107652 | Ga0496107_0107652_765_1145 | 121 |
| 413 | 3300048915 | Ga0496112_0152291 | Ga0496112_0152291_1690_2166 | 121 |
| 414 | 3300048917 | Ga0496114_0000226 | Ga0496114_0000226_845_1225 | 121 |
| 415 | 3300048918 | Ga0496115_0288584 | Ga0496115_0288584_324_698 | 121 |
| 416 | 3300050509 | nmdc:mga0qj67_357818_c1 | nmdc:mga0qj67_357818_c1_480_854 | 121 |
| 417 | 3300050509 | nmdc:mga0qj67_976194_c1 | nmdc:mga0qj67_976194_c1_216_605 | 121 |
| 418 | 3300050511 | nmdc:mga08y16_194128_c1 | nmdc:mga08y16_194128_c1_1702_2091 | 121 |
| 419 | 3300050511 | nmdc:mga08y16_536_c1 | nmdc:mga08y16_536_c1_3163_3567 | 121 |
| 420 | 3300053077 | Ga0495601_0001625 | Ga0495601_0001625_7798_8211 | 121 |
| 421 | 3300053078 | Ga0495612_0360478 | Ga0495612_0360478_134_547 | 121 |
| 422 | 3300053079 | Ga0500610_0235387 | Ga0500610_0235387_162_560 | 121 |
| 423 | 3300053085 | Ga0495619_0003403 | Ga0495619_0003403_4002_4415 | 121 |
| 424 | 3300053085 | Ga0495619_0382337 | Ga0495619_0382337_208_588 | 121 |
| 425 | 3300005295 | Ga0065707_10506285 | Ga0065707_105062852 | 122 |
| 426 | 3300005330 | Ga0070690_100536427 | Ga0070690_1005364272 | 122 |
| 427 | 3300005334 | Ga0068869_100426904 | Ga0068869_1004269042 | 122 |
| 428 | 3300005340 | Ga0070689_101436049 | Ga0070689_1014360492 | 122 |
| 429 | 3300005345 | Ga0070692_10007969 | Ga0070692_100079697 | 122 |
| 430 | 3300005353 | Ga0070669_100068286 | Ga0070669_1000682862 | 122 |
| 431 | 3300005354 | Ga0070675_100000751 | Ga0070675_1000007517 | 122 |
| 432 | 3300005354 | Ga0070675_100029068 | Ga0070675_1000290682 | 122 |
| 433 | 3300005356 | Ga0070674_100061123 | Ga0070674_1000611234 | 122 |
| 434 | 3300005364 | Ga0070673_100413409 | Ga0070673_1004134092 | 122 |
| 435 | 3300005438 | Ga0070701_10175578 | Ga0070701_101755782 | 122 |
| 436 | 3300005440 | Ga0070705_100143667 | Ga0070705_1001436672 | 122 |
| 437 | 3300005440 | Ga0070705_100146809 | Ga0070705_1001468093 | 122 |
| 438 | 3300005441 | Ga0070700_100206662 | Ga0070700_1002066622 | 122 |
| 439 | 3300005444 | Ga0070694_100001846 | Ga0070694_1000018467 | 122 |
| 440 | 3300005444 | Ga0070694_100004226 | Ga0070694_1000042262 | 122 |
| 441 | 3300005444 | Ga0070694_100414031 | Ga0070694_1004140312 | 122 |
| 442 | 3300005445 | Ga0070708_100260540 | Ga0070708_1002605402 | 122 |
| 443 | 3300005456 | Ga0070678_100885776 | Ga0070678_1008857762 | 122 |
| 444 | 3300005457 | Ga0070662_101999921 | Ga0070662_1019999211 | 122 |
| 445 | 3300005467 | Ga0070706_100453045 | Ga0070706_1004530451 | 122 |
| 446 | 3300005468 | Ga0070707_100443789 | Ga0070707_1004437892 | 122 |
| 447 | 3300005471 | Ga0070698_100003898 | Ga0070698_10000389815 | 122 |
| 448 | 3300005471 | Ga0070698_100015144 | Ga0070698_1000151447 | 122 |
| 449 | 3300005471 | Ga0070698_100263705 | Ga0070698_1002637052 | 122 |
| 450 | 3300005471 | Ga0070698_100698258 | Ga0070698_1006982582 | 122 |
| 451 | 3300005471 | Ga0070698_100855633 | Ga0070698_1008556332 | 122 |
| 452 | 3300005518 | Ga0070699_100000172 | Ga0070699_10000017262 | 122 |
| 453 | 3300005518 | Ga0070699_100029044 | Ga0070699_1000290447 | 122 |
| 454 | 3300005536 | Ga0070697_100434398 | Ga0070697_1004343982 | 122 |
| 455 | 3300005536 | Ga0070697_101242850 | Ga0070697_1012428502 | 122 |
| 456 | 3300005545 | Ga0070695_100000734 | Ga0070695_1000007349 | 122 |
| 457 | 3300005545 | Ga0070695_100405574 | Ga0070695_1004055741 | 122 |
| 458 | 3300005546 | Ga0070696_100008142 | Ga0070696_1000081424 | 122 |
| 459 | 3300005546 | Ga0070696_100028771 | Ga0070696_1000287712 | 122 |
| 460 | 3300005546 | Ga0070696_100465175 | Ga0070696_1004651751 | 122 |
| 461 | 3300005549 | Ga0070704_100001693 | Ga0070704_1000016936 | 122 |
| 462 | 3300005549 | Ga0070704_100004420 | Ga0070704_1000044207 | 122 |
| 463 | 3300005549 | Ga0070704_100048652 | Ga0070704_1000486524 | 122 |
| 464 | 3300005577 | Ga0068857_101560764 | Ga0068857_1015607642 | 122 |
| 465 | 3300005615 | Ga0070702_100225134 | Ga0070702_1002251342 | 122 |
| 466 | 3300005617 | Ga0068859_100466709 | Ga0068859_1004667092 | 122 |
| 467 | 3300005719 | Ga0068861_100028621 | Ga0068861_1000286214 | 122 |
| 468 | 3300005719 | Ga0068861_100647014 | Ga0068861_1006470141 | 122 |
| 469 | 3300005840 | Ga0068870_10154125 | Ga0068870_101541252 | 122 |
| 470 | 3300005843 | Ga0068860_100059006 | Ga0068860_1000590063 | 122 |
| 471 | 3300006175 | Ga0070712_100547834 | Ga0070712_1005478342 | 122 |
| 472 | 3300006237 | Ga0097621_100154032 | Ga0097621_1001540322 | 122 |
| 473 | 3300006237 | Ga0097621_101034887 | Ga0097621_1010348872 | 122 |
| 474 | 3300006358 | Ga0068871_100251826 | Ga0068871_1002518262 | 122 |
| 475 | 3300006844 | Ga0075428_100000034 | Ga0075428_10000003441 | 122 |
| 476 | 3300006852 | Ga0075433_10104324 | Ga0075433_101043242 | 122 |
| 477 | 3300006852 | Ga0075433_10164534 | Ga0075433_101645343 | 122 |
| 478 | 3300006852 | Ga0075433_10569701 | Ga0075433_105697012 | 122 |
| 479 | 3300006871 | Ga0075434_100197349 | Ga0075434_1001973493 | 122 |
| 480 | 3300006880 | Ga0075429_100129403 | Ga0075429_1001294033 | 122 |
| 481 | 3300006881 | Ga0068865_100708334 | Ga0068865_1007083342 | 122 |
| 482 | 3300006914 | Ga0075436_100002680 | Ga0075436_1000026808 | 122 |
| 483 | 3300006931 | Ga0097620_100466733 | Ga0097620_1004667332 | 122 |
| 484 | 3300007076 | Ga0075435_100000698 | Ga0075435_10000069814 | 122 |
| 485 | 3300007076 | Ga0075435_100056808 | Ga0075435_1000568085 | 122 |
| 486 | 3300007076 | Ga0075435_100900372 | Ga0075435_1009003722 | 122 |
| 487 | 3300007076 | Ga0075435_101963055 | Ga0075435_1019630551 | 122 |
| 488 | 3300009093 | Ga0105240_10006149 | Ga0105240_100061495 | 122 |
| 489 | 3300009094 | Ga0111539_10000014 | Ga0111539_10000014196 | 122 |
| 490 | 3300009098 | Ga0105245_11346693 | Ga0105245_113466931 | 122 |
| 491 | 3300009147 | Ga0114129_10003695 | Ga0114129_100036952 | 122 |
| 492 | 3300009147 | Ga0114129_10028396 | Ga0114129_100283968 | 122 |
| 493 | 3300009147 | Ga0114129_10063645 | Ga0114129_100636452 | 122 |
| 494 | 3300009147 | Ga0114129_10240663 | Ga0114129_102406634 | 122 |
| 495 | 3300009147 | Ga0114129_11317187 | Ga0114129_113171872 | 122 |
| 496 | 3300009147 | Ga0114129_12059081 | Ga0114129_120590812 | 122 |
| 497 | 3300009147 | Ga0114129_12835565 | Ga0114129_128355652 | 122 |
| 498 | 3300009148 | Ga0105243_10620224 | Ga0105243_106202243 | 122 |
| 499 | 3300009148 | Ga0105243_10632052 | Ga0105243_106320522 | 122 |
| 500 | 3300009176 | Ga0105242_10292282 | Ga0105242_102922822 | 122 |
| 501 | 3300009553 | Ga0105249_10446545 | Ga0105249_104465452 | 122 |
| 502 | 3300009553 | Ga0105249_11504478 | Ga0105249_115044782 | 122 |
| 503 | 3300010375 | Ga0105239_12294227 | Ga0105239_122942272 | 122 |
| 504 | 3300011119 | Ga0105246_10339378 | Ga0105246_103393782 | 122 |
| 505 | 3300013307 | Ga0157372_10653397 | Ga0157372_106533971 | 122 |
| 506 | 3300014326 | Ga0157380_10067340 | Ga0157380_100673404 | 122 |
| 507 | 3300014326 | Ga0157380_10153171 | Ga0157380_101531713 | 122 |
| 508 | 3300014968 | Ga0157379_12090542 | Ga0157379_120905421 | 122 |
| 509 | 3300017792 | Ga0163161_10318839 | Ga0163161_103188393 | 122 |
| 510 | 3300025321 | Ga0207656_10297123 | Ga0207656_102971232 | 122 |
| 511 | 3300025901 | Ga0207688_10478104 | Ga0207688_104781042 | 122 |
| 512 | 3300025913 | Ga0207695_10133316 | Ga0207695_101333162 | 122 |
| 513 | 3300025915 | Ga0207693_10510436 | Ga0207693_105104361 | 122 |
| 514 | 3300025916 | Ga0207663_10822571 | Ga0207663_108225712 | 122 |
| 515 | 3300025923 | Ga0207681_10046170 | Ga0207681_100461703 | 122 |
| 516 | 3300025926 | Ga0207659_10001326 | Ga0207659_100013265 | 122 |
| 517 | 3300025933 | Ga0207706_10006351 | Ga0207706_100063512 | 122 |
| 518 | 3300025936 | Ga0207670_10934535 | Ga0207670_109345352 | 122 |
| 519 | 3300025937 | Ga0207669_10084560 | Ga0207669_100845603 | 122 |
| 520 | 3300025937 | Ga0207669_10310856 | Ga0207669_103108562 | 122 |
| 521 | 3300025938 | Ga0207704_10594861 | Ga0207704_105948612 | 122 |
| 522 | 3300025938 | Ga0207704_11092153 | Ga0207704_110921532 | 122 |
| 523 | 3300025942 | Ga0207689_10126295 | Ga0207689_101262952 | 122 |
| 524 | 3300025942 | Ga0207689_10270130 | Ga0207689_102701302 | 122 |
| 525 | 3300026075 | Ga0207708_11210787 | Ga0207708_112107872 | 122 |
| 526 | 3300026088 | Ga0207641_10217180 | Ga0207641_102171804 | 122 |
| 527 | 3300026116 | Ga0207674_11524729 | Ga0207674_115247292 | 122 |
| 528 | 3300027462 | Ga0210000_1069327 | Ga0210000_10693271 | 122 |
| 529 | 3300027907 | Ga0207428_10000005 | Ga0207428_1000000550 | 122 |
| 530 | 3300028380 | Ga0268265_10820668 | Ga0268265_108206682 | 122 |
| 531 | 3300028381 | Ga0268264_10056317 | Ga0268264_100563173 | 122 |
| 532 | 3300035086 | Ga0373934_0342087 | Ga0373934_0342087_34_414 | 122 |
| 533 | 3300035111 | Ga0373923_0017689 | Ga0373923_0017689_534_914 | 122 |
| 534 | 3300035116 | Ga0373945_0029110 | Ga0373945_0029110_347_727 | 122 |
| 535 | 3300035117 | Ga0373953_0088554 | Ga0373953_0088554_465_845 | 122 |
| 536 | 3300035118 | Ga0373954_0279309 | Ga0373954_0279309_357_737 | 122 |
| 537 | 3300035119 | Ga0373956_0021764 | Ga0373956_0021764_913_1293 | 122 |
| 538 | 3300035119 | Ga0373956_0124247 | Ga0373956_0124247_718_1098 | 122 |
| 539 | 3300035170 | Ga0373943_0023781 | Ga0373943_0023781_1851_2231 | 122 |
| 540 | 3300035171 | Ga0373946_0301340 | Ga0373946_0301340_363_743 | 122 |
| 541 | 3300035172 | Ga0373955_0229437 | Ga0373955_0229437_385_765 | 122 |
| 542 | 3300035172 | Ga0373955_0411331 | Ga0373955_0411331_347_727 | 122 |
| 543 | 3300035172 | Ga0373955_0589039 | Ga0373955_0589039_289_660 | 122 |
| 544 | 3300035410 | Ga0373924_0013649 | Ga0373924_0013649_1198_1578 | 122 |
| 545 | 3300035692 | Ga0373935_0058303 | Ga0373935_0058303_1087_1467 | 122 |
| 546 | 3300035695 | Ga0373927_0199571 | Ga0373927_0199571_912_1292 | 122 |
| 547 | 3300035724 | Ga0373933_0139824 | Ga0373933_0139824_967_1347 | 122 |
| 548 | 3300035725 | Ga0373947_0034582 | Ga0373947_0034582_2235_2615 | 122 |
| 549 | 3300036401 | Ga0373937_0758928 | Ga0373937_0758928_62_442 | 122 |
| 550 | 3300037068 | Ga0373925_0035857 | Ga0373925_0035857_840_1220 | 122 |
| 551 | 3300041997 | Ga0439431_0245609 | Ga0439431_0245609_124_507 | 122 |
| 552 | 3300042437 | Ga0439444_0123752 | Ga0439444_0123752_43_426 | 122 |
| 553 | 3300044694 | Ga0466963_0053920 | Ga0466963_0053920_772_1152 | 122 |
| 554 | 3300045051 | Ga0451576_2450582 | Ga0451576_2450582_93_473 | 122 |
| 555 | 3300046454 | Ga0495592_0045926 | Ga0495592_0045926_2712_3092 | 122 |
| 556 | 3300046455 | Ga0495603_0047369 | Ga0495603_0047369_1709_2080 | 122 |
| 557 | 3300046462 | Ga0495651_0104066 | Ga0495651_0104066_742_1122 | 122 |
| 558 | 3300046472 | Ga0495580_0037523 | Ga0495580_0037523_1785_2165 | 122 |
| 559 | 3300046472 | Ga0495580_0684233 | Ga0495580_0684233_250_630 | 122 |
| 560 | 3300046473 | Ga0495582_0127085 | Ga0495582_0127085_688_1068 | 122 |
| 561 | 3300046476 | Ga0495662_0123636 | Ga0495662_0123636_122_502 | 122 |
| 562 | 3300046477 | Ga0495664_0168536 | Ga0495664_0168536_738_1118 | 122 |
| 563 | 3300046499 | Ga0495594_0298887 | Ga0495594_0298887_134_505 | 122 |
| 564 | 3300046511 | Ga0495608_0009303 | Ga0495608_0009303_280_660 | 122 |
| 565 | 3300046514 | Ga0495618_0411394 | Ga0495618_0411394_11_391 | 122 |
| 566 | 3300046516 | Ga0495628_0153628 | Ga0495628_0153628_27_407 | 122 |
| 567 | 3300046517 | Ga0495630_0020785 | Ga0495630_0020785_415_795 | 122 |
| 568 | 3300046523 | Ga0495644_0115927 | Ga0495644_0115927_203_577 | 122 |
| 569 | 3300046529 | Ga0495652_0043389 | Ga0495652_0043389_493_873 | 122 |
| 570 | 3300046533 | Ga0495640_0429030 | Ga0495640_0429030_223_603 | 122 |
| 571 | 3300046535 | Ga0495586_0852160 | Ga0495586_0852160_51_422 | 122 |
| 572 | 3300046536 | Ga0495587_0398052 | Ga0495587_0398052_56_436 | 122 |
| 573 | 3300046559 | Ga0495667_0017615 | Ga0495667_0017615_1578_1958 | 122 |
| 574 | 3300046642 | Ga0495634_0132800 | Ga0495634_0132800_503_883 | 122 |
| 575 | 3300046664 | Ga0495659_0196109 | Ga0495659_0196109_121_492 | 122 |
| 576 | 3300046674 | Ga0495588_0016972 | Ga0495588_0016972_1835_2206 | 122 |
| 577 | 3300046675 | Ga0495657_0112692 | Ga0495657_0112692_688_1068 | 122 |
| 578 | 3300046679 | Ga0495623_0333677 | Ga0495623_0333677_433_813 | 122 |
| 579 | 3300046683 | Ga0495658_0188754 | Ga0495658_0188754_877_1248 | 122 |
| 580 | 3300046684 | Ga0495669_0170400 | Ga0495669_0170400_163_597 | 122 |
| 581 | 3300046689 | Ga0495613_0026797 | Ga0495613_0026797_3266_3646 | 122 |
| 582 | 3300046809 | Ga0495600_0181287 | Ga0495600_0181287_318_698 | 122 |
| 583 | 3300047317 | Ga0495604_0015903 | Ga0495604_0015903_4349_4738 | 122 |
| 584 | 3300047319 | Ga0495674_0030010 | Ga0495674_0030010_3587_3967 | 122 |
| 585 | 3300047320 | Ga0495672_0136882 | Ga0495672_0136882_897_1268 | 122 |
| 586 | 3300047322 | Ga0495680_0788567 | Ga0495680_0788567_221_601 | 122 |
| 587 | 3300047444 | Ga0495675_0320265 | Ga0495675_0320265_479_859 | 122 |
| 588 | 3300047445 | Ga0495677_0344431 | Ga0495677_0344431_44_418 | 122 |
| 589 | 3300047471 | Ga0495684_0000462 | Ga0495684_0000462_1789_2169 | 122 |
| 590 | 3300048088 | Ga0495602_0160499 | Ga0495602_0160499_1343_1723 | 122 |
| 591 | 3300049572 | Ga0501036_0301954 | Ga0501036_0301954_625_1017 | 122 |
| 592 | 3300049574 | Ga0501038_0454229 | Ga0501038_0454229_570_962 | 122 |
| 593 | 3300049575 | Ga0501039_0027416 | Ga0501039_0027416_496_888 | 122 |
| 594 | 3300049576 | Ga0501040_0013356 | Ga0501040_0013356_316_708 | 122 |
| 595 | 3300049577 | Ga0501041_0011828 | Ga0501041_0011828_1710_2102 | 122 |
| 596 | 3300049578 | Ga0501042_0027346 | Ga0501042_0027346_777_1169 | 122 |
| 597 | 3300049580 | Ga0501046_0048808 | Ga0501046_0048808_588_980 | 122 |
| 598 | 3300049582 | Ga0501048_0161423 | Ga0501048_0161423_1026_1418 | 122 |
| 599 | 3300049587 | Ga0501071_0213607 | Ga0501071_0213607_90_482 | 122 |
| 600 | 3300049588 | Ga0501072_0036855 | Ga0501072_0036855_2413_2805 | 122 |
| 601 | 3300049591 | Ga0501075_0095218 | Ga0501075_0095218_68_460 | 122 |
| 602 | 3300049593 | Ga0501077_0082486 | Ga0501077_0082486_1372_1764 | 122 |
| 603 | 3300049741 | Ga0501079_0182407 | Ga0501079_0182407_1175_1567 | 122 |
| 604 | 3300049744 | Ga0501083_1011684 | Ga0501083_1011684_128_520 | 122 |
| 605 | 3300049824 | Ga0501045_0006013 | Ga0501045_0006013_3040_3432 | 122 |
| 606 | 3300050491 | nmdc:mga00v17_886298_c1 | nmdc:mga00v17_886298_c1_104_484 | 122 |
| 607 | 3300050507 | nmdc:mga05p37_12236_c1 | nmdc:mga05p37_12236_c1_1381_1761 | 122 |
| 608 | 3300050507 | nmdc:mga05p37_21375_c1 | nmdc:mga05p37_21375_c1_5715_6092 | 122 |
| 609 | 3300050507 | nmdc:mga05p37_743957_c1 | nmdc:mga05p37_743957_c1_135_509 | 122 |
| 610 | 3300050507 | nmdc:mga05p37_763643_c1 | nmdc:mga05p37_763643_c1_540_917 | 122 |
| 611 | 3300050508 | nmdc:mga09592_32662_c1 | nmdc:mga09592_32662_c1_1142_1525 | 122 |
| 612 | 3300050511 | nmdc:mga08y16_9_c1 | nmdc:mga08y16_9_c1_499253_499636 | 122 |
| 613 | 3300050512 | nmdc:mga0n895_124596_c1 | nmdc:mga0n895_124596_c1_479_853 | 122 |
| 614 | 3300050512 | nmdc:mga0n895_35_c1 | nmdc:mga0n895_35_c1_70777_71148 | 122 |
| 615 | 3300050512 | nmdc:mga0n895_507715_c1 | nmdc:mga0n895_507715_c1_16_414 | 122 |
| 616 | 3300050513 | nmdc:mga0rr50_1_c1 | nmdc:mga0rr50_1_c1_70777_71148 | 122 |
| 617 | 3300050513 | nmdc:mga0rr50_272586_c1 | nmdc:mga0rr50_272586_c1_457_831 | 122 |
| 618 | 3300050513 | nmdc:mga0rr50_843060_c1 | nmdc:mga0rr50_843060_c1_77_451 | 122 |
| 619 | 3300050514 | nmdc:mga08x19_118_c1 | nmdc:mga08x19_118_c1_24324_24695 | 122 |
| 620 | 3300050515 | nmdc:mga0a205_188382_c1 | nmdc:mga0a205_188382_c1_926_1300 | 122 |
| 621 | 3300050515 | nmdc:mga0a205_30084_c1 | nmdc:mga0a205_30084_c1_786_1163 | 122 |
| 622 | 3300050515 | nmdc:mga0a205_340181_c1 | nmdc:mga0a205_340181_c1_458_835 | 122 |
| 623 | 3300050515 | nmdc:mga0a205_659071_c1 | nmdc:mga0a205_659071_c1_305_688 | 122 |
| 624 | 3300053077 | Ga0495601_0018399 | Ga0495601_0018399_666_1046 | 122 |
| 625 | 3300053084 | Ga0495595_0059057 | Ga0495595_0059057_645_1025 | 122 |
| 626 | 3300053085 | Ga0495619_0020908 | Ga0495619_0020908_1783_2163 | 122 |
| 627 | 3300054114 | Ga0501084_0289560 | Ga0501084_0289560_762_1154 | 122 |
| 628 | 3300059423 | Ga0590074_005514 | Ga0590074_005514_994_1383 | 122 |
| 629 | 3300059424 | Ga0590075_000399 | Ga0590075_000399_921_1310 | 122 |
| 630 | 3300059426 | Ga0590077_000076 | Ga0590077_000076_7664_8053 | 122 |
| 631 | 3300061734 | Ga0530510_0034897 | Ga0530510_0034897_1270_1662 | 122 |
| 632 | 3300005327 | Ga0070658_10848456 | Ga0070658_108484562 | 123 |
| 633 | 3300005335 | Ga0070666_10816782 | Ga0070666_108167821 | 123 |
| 634 | 3300005336 | Ga0070680_100394798 | Ga0070680_1003947981 | 123 |
| 635 | 3300005336 | Ga0070680_100609710 | Ga0070680_1006097101 | 123 |
| 636 | 3300005338 | Ga0068868_100236938 | Ga0068868_1002369382 | 123 |
| 637 | 3300005339 | Ga0070660_100222973 | Ga0070660_1002229732 | 123 |
| 638 | 3300005343 | Ga0070687_100773152 | Ga0070687_1007731521 | 123 |
| 639 | 3300005354 | Ga0070675_100475068 | Ga0070675_1004750682 | 123 |
| 640 | 3300005355 | Ga0070671_100782237 | Ga0070671_1007822372 | 123 |
| 641 | 3300005366 | Ga0070659_100884994 | Ga0070659_1008849942 | 123 |
| 642 | 3300005458 | Ga0070681_10163198 | Ga0070681_101631983 | 123 |
| 643 | 3300005530 | Ga0070679_100295033 | Ga0070679_1002950332 | 123 |
| 644 | 3300005530 | Ga0070679_100639277 | Ga0070679_1006392772 | 123 |
| 645 | 3300005543 | Ga0070672_100221817 | Ga0070672_1002218172 | 123 |
| 646 | 3300005548 | Ga0070665_100574112 | Ga0070665_1005741122 | 123 |
| 647 | 3300005563 | Ga0068855_100029227 | Ga0068855_1000292275 | 123 |
| 648 | 3300005578 | Ga0068854_100497605 | Ga0068854_1004976051 | 123 |
| 649 | 3300005616 | Ga0068852_100223378 | Ga0068852_1002233784 | 123 |
| 650 | 3300005617 | Ga0068859_100948359 | Ga0068859_1009483592 | 123 |
| 651 | 3300005618 | Ga0068864_102206686 | Ga0068864_1022066861 | 123 |
| 652 | 3300005834 | Ga0068851_10429922 | Ga0068851_104299222 | 123 |
| 653 | 3300005842 | Ga0068858_100241085 | Ga0068858_1002410852 | 123 |
| 654 | 3300005843 | Ga0068860_100119367 | Ga0068860_1001193672 | 123 |
| 655 | 3300005844 | Ga0068862_101534607 | Ga0068862_1015346072 | 123 |
| 656 | 3300006237 | Ga0097621_100040163 | Ga0097621_1000401632 | 123 |
| 657 | 3300006237 | Ga0097621_101176887 | Ga0097621_1011768872 | 123 |
| 658 | 3300006931 | Ga0097620_100948153 | Ga0097620_1009481531 | 123 |
| 659 | 3300009101 | Ga0105247_10039681 | Ga0105247_100396812 | 123 |
| 660 | 3300009176 | Ga0105242_11026511 | Ga0105242_110265111 | 123 |
| 661 | 3300009177 | Ga0105248_10797074 | Ga0105248_107970742 | 123 |
| 662 | 3300009551 | Ga0105238_12618648 | Ga0105238_126186481 | 123 |
| 663 | 3300013296 | Ga0157374_10592825 | Ga0157374_105928251 | 123 |
| 664 | 3300013297 | Ga0157378_10311311 | Ga0157378_103113111 | 123 |
| 665 | 3300013297 | Ga0157378_10841609 | Ga0157378_108416092 | 123 |
| 666 | 3300013306 | Ga0163162_11728544 | Ga0163162_117285442 | 123 |
| 667 | 3300013308 | Ga0157375_10308011 | Ga0157375_103080113 | 123 |
| 668 | 3300013308 | Ga0157375_10966561 | Ga0157375_109665612 | 123 |
| 669 | 3300014325 | Ga0163163_10013902 | Ga0163163_100139023 | 123 |
| 670 | 3300014968 | Ga0157379_10051258 | Ga0157379_100512583 | 123 |
| 671 | 3300014968 | Ga0157379_10289830 | Ga0157379_102898302 | 123 |
| 672 | 3300014969 | Ga0157376_10169760 | Ga0157376_101697603 | 123 |
| 673 | 3300014969 | Ga0157376_10353454 | Ga0157376_103534542 | 123 |
| 674 | 3300025900 | Ga0207710_10027842 | Ga0207710_100278421 | 123 |
| 675 | 3300025903 | Ga0207680_10094918 | Ga0207680_100949182 | 123 |
| 676 | 3300025909 | Ga0207705_10118300 | Ga0207705_101183002 | 123 |
| 677 | 3300025912 | Ga0207707_10036682 | Ga0207707_100366824 | 123 |
| 678 | 3300025912 | Ga0207707_10927489 | Ga0207707_109274892 | 123 |
| 679 | 3300025917 | Ga0207660_10276408 | Ga0207660_102764082 | 123 |
| 680 | 3300025917 | Ga0207660_10825420 | Ga0207660_108254202 | 123 |
| 681 | 3300025917 | Ga0207660_10955996 | Ga0207660_109559963 | 123 |
| 682 | 3300025918 | Ga0207662_10510275 | Ga0207662_105102752 | 123 |
| 683 | 3300025919 | Ga0207657_10140279 | Ga0207657_101402792 | 123 |
| 684 | 3300025919 | Ga0207657_10342007 | Ga0207657_103420072 | 123 |
| 685 | 3300025921 | Ga0207652_10099452 | Ga0207652_100994522 | 123 |
| 686 | 3300025921 | Ga0207652_10592423 | Ga0207652_105924232 | 123 |
| 687 | 3300025921 | Ga0207652_11111077 | Ga0207652_111110772 | 123 |
| 688 | 3300025924 | Ga0207694_10921567 | Ga0207694_109215672 | 123 |
| 689 | 3300025926 | Ga0207659_10001674 | Ga0207659_1000167413 | 123 |
| 690 | 3300025926 | Ga0207659_10247927 | Ga0207659_102479272 | 123 |
| 691 | 3300025932 | Ga0207690_11396297 | Ga0207690_113962971 | 123 |
| 692 | 3300025940 | Ga0207691_10385754 | Ga0207691_103857542 | 123 |
| 693 | 3300025941 | Ga0207711_10570936 | Ga0207711_105709362 | 123 |
| 694 | 3300025941 | Ga0207711_10603451 | Ga0207711_106034512 | 123 |
| 695 | 3300025942 | Ga0207689_10599422 | Ga0207689_105994222 | 123 |
| 696 | 3300025949 | Ga0207667_10273595 | Ga0207667_102735953 | 123 |
| 697 | 3300026023 | Ga0207677_10362046 | Ga0207677_103620462 | 123 |
| 698 | 3300026035 | Ga0207703_11768276 | Ga0207703_117682761 | 123 |
| 699 | 3300026075 | Ga0207708_10400095 | Ga0207708_104000952 | 123 |
| 700 | 3300026088 | Ga0207641_11344892 | Ga0207641_113448921 | 123 |
| 701 | 3300026142 | Ga0207698_10196373 | Ga0207698_101963731 | 123 |
| 702 | 3300028381 | Ga0268264_10827074 | Ga0268264_108270741 | 123 |
| 703 | 3300031824 | Ga0307413_10435117 | Ga0307413_104351172 | 123 |
| 704 | 3300031852 | Ga0307410_10259844 | Ga0307410_102598442 | 123 |
| 705 | 3300032005 | Ga0307411_10145071 | Ga0307411_101450712 | 123 |
| 706 | 3300035117 | Ga0373953_0476259 | Ga0373953_0476259_162_533 | 123 |
| 707 | 3300035119 | Ga0373956_0283840 | Ga0373956_0283840_39_425 | 123 |
| 708 | 3300035120 | Ga0373957_0252072 | Ga0373957_0252072_118_513 | 123 |
| 709 | 3300035172 | Ga0373955_0140934 | Ga0373955_0140934_574_966 | 123 |
| 710 | 3300035172 | Ga0373955_0261993 | Ga0373955_0261993_430_804 | 123 |
| 711 | 3300035172 | Ga0373955_0778766 | Ga0373955_0778766_49_420 | 123 |
| 712 | 3300035410 | Ga0373924_0399003 | Ga0373924_0399003_11_397 | 123 |
| 713 | 3300035692 | Ga0373935_0587622 | Ga0373935_0587622_264_653 | 123 |
| 714 | 3300035725 | Ga0373947_0917258 | Ga0373947_0917258_204_575 | 123 |
| 715 | 3300036401 | Ga0373937_0303068 | Ga0373937_0303068_159_530 | 123 |
| 716 | 3300036401 | Ga0373937_1203240 | Ga0373937_1203240_88_480 | 123 |
| 717 | 3300036401 | Ga0373937_1511974 | Ga0373937_1511974_60_458 | 123 |
| 718 | 3300046516 | Ga0495628_0361711 | Ga0495628_0361711_475_867 | 123 |
| 719 | 3300046691 | Ga0495670_0312830 | Ga0495670_0312830_409_786 | 123 |
| 720 | 3300048904 | Ga0496101_0555387 | Ga0496101_0555387_143_517 | 123 |
| 721 | 3300048907 | Ga0496104_0905721 | Ga0496104_0905721_360_734 | 123 |
| 722 | 3300048917 | Ga0496114_0667892 | Ga0496114_0667892_245_619 | 123 |
| 723 | 3300049521 | Ga0501298_169502 | Ga0501298_169502_86_463 | 123 |
| 724 | 3300049576 | Ga0501040_0412101 | Ga0501040_0412101_331_717 | 123 |
| 725 | 3300049590 | Ga0501074_0160452 | Ga0501074_0160452_396_782 | 123 |
| 726 | 3300049591 | Ga0501075_0013330 | Ga0501075_0013330_2618_3004 | 123 |
| 727 | 3300049679 | Ga0501249_025503 | Ga0501249_025503_536_910 | 123 |
| 728 | 3300049706 | Ga0501229_011645 | Ga0501229_011645_95_469 | 123 |
| 729 | 3300049743 | Ga0501081_0035672 | Ga0501081_0035672_363_749 | 123 |
| 730 | 3300049744 | Ga0501083_0203036 | Ga0501083_0203036_102_476 | 123 |
| 731 | 3300049824 | Ga0501045_0069253 | Ga0501045_0069253_795_1181 | 123 |
| 732 | 3300053077 | Ga0495601_0230088 | Ga0495601_0230088_380_751 | 123 |
| 733 | 3300053084 | Ga0495595_0201711 | Ga0495595_0201711_167_538 | 123 |
| 734 | 3300053085 | Ga0495619_0982521 | Ga0495619_0982521_162_533 | 123 |
| 735 | 3300054114 | Ga0501084_0119412 | Ga0501084_0119412_79_465 | 123 |
| 736 | 3300002459 | JGI24751J29686_10006594 | JGI24751J29686_100065943 | 124 |
| 737 | 3300002459 | JGI24751J29686_10052539 | JGI24751J29686_100525391 | 124 |
| 738 | 3300003203 | JGI25406J46586_10000248 | JGI25406J46586_1000024817 | 124 |
| 739 | 3300005288 | Ga0065714_10127719 | Ga0065714_101277192 | 124 |
| 740 | 3300005290 | Ga0065712_10001548 | Ga0065712_1000154812 | 124 |
| 741 | 3300005290 | Ga0065712_10077635 | Ga0065712_100776352 | 124 |
| 742 | 3300005290 | Ga0065712_10079198 | Ga0065712_100791982 | 124 |
| 743 | 3300005293 | Ga0065715_10018291 | Ga0065715_100182911 | 124 |
| 744 | 3300005293 | Ga0065715_10172584 | Ga0065715_101725842 | 124 |
| 745 | 3300005293 | Ga0065715_10179017 | Ga0065715_101790171 | 124 |
| 746 | 3300005328 | Ga0070676_10209847 | Ga0070676_102098472 | 124 |
| 747 | 3300005330 | Ga0070690_100080496 | Ga0070690_1000804961 | 124 |
| 748 | 3300005330 | Ga0070690_100674151 | Ga0070690_1006741512 | 124 |
| 749 | 3300005331 | Ga0070670_100014409 | Ga0070670_1000144097 | 124 |
| 750 | 3300005331 | Ga0070670_102191482 | Ga0070670_1021914821 | 124 |
| 751 | 3300005333 | Ga0070677_10156520 | Ga0070677_101565202 | 124 |
| 752 | 3300005334 | Ga0068869_100358559 | Ga0068869_1003585591 | 124 |
| 753 | 3300005334 | Ga0068869_101839424 | Ga0068869_1018394242 | 124 |
| 754 | 3300005335 | Ga0070666_10785532 | Ga0070666_107855321 | 124 |
| 755 | 3300005336 | Ga0070680_100446842 | Ga0070680_1004468422 | 124 |
| 756 | 3300005337 | Ga0070682_100273060 | Ga0070682_1002730602 | 124 |
| 757 | 3300005337 | Ga0070682_100787575 | Ga0070682_1007875752 | 124 |
| 758 | 3300005337 | Ga0070682_101998506 | Ga0070682_1019985062 | 124 |
| 759 | 3300005339 | Ga0070660_100056197 | Ga0070660_1000561972 | 124 |
| 760 | 3300005340 | Ga0070689_100074592 | Ga0070689_1000745922 | 124 |
| 761 | 3300005341 | Ga0070691_10025543 | Ga0070691_100255432 | 124 |
| 762 | 3300005343 | Ga0070687_100213093 | Ga0070687_1002130931 | 124 |
| 763 | 3300005345 | Ga0070692_10229849 | Ga0070692_102298491 | 124 |
| 764 | 3300005345 | Ga0070692_11009642 | Ga0070692_110096421 | 124 |
| 765 | 3300005347 | Ga0070668_101208751 | Ga0070668_1012087511 | 124 |
| 766 | 3300005353 | Ga0070669_100003388 | Ga0070669_10000338812 | 124 |
| 767 | 3300005353 | Ga0070669_100132753 | Ga0070669_1001327532 | 124 |
| 768 | 3300005354 | Ga0070675_100058207 | Ga0070675_1000582072 | 124 |
| 769 | 3300005354 | Ga0070675_100061685 | Ga0070675_1000616852 | 124 |
| 770 | 3300005354 | Ga0070675_100065156 | Ga0070675_1000651564 | 124 |
| 771 | 3300005356 | Ga0070674_100000091 | Ga0070674_10000009119 | 124 |
| 772 | 3300005356 | Ga0070674_100976164 | Ga0070674_1009761642 | 124 |
| 773 | 3300005364 | Ga0070673_100064090 | Ga0070673_1000640902 | 124 |
| 774 | 3300005364 | Ga0070673_100115693 | Ga0070673_1001156932 | 124 |
| 775 | 3300005364 | Ga0070673_100256640 | Ga0070673_1002566401 | 124 |
| 776 | 3300005365 | Ga0070688_100035670 | Ga0070688_1000356702 | 124 |
| 777 | 3300005365 | Ga0070688_100764252 | Ga0070688_1007642522 | 124 |
| 778 | 3300005366 | Ga0070659_100064104 | Ga0070659_1000641044 | 124 |
| 779 | 3300005366 | Ga0070659_101226091 | Ga0070659_1012260911 | 124 |
| 780 | 3300005367 | Ga0070667_102366990 | Ga0070667_1023669901 | 124 |
| 781 | 3300005434 | Ga0070709_10052217 | Ga0070709_100522173 | 124 |
| 782 | 3300005436 | Ga0070713_100920896 | Ga0070713_1009208963 | 124 |
| 783 | 3300005438 | Ga0070701_10278317 | Ga0070701_102783171 | 124 |
| 784 | 3300005438 | Ga0070701_10848691 | Ga0070701_108486911 | 124 |
| 785 | 3300005439 | Ga0070711_100471901 | Ga0070711_1004719012 | 124 |
| 786 | 3300005439 | Ga0070711_100526269 | Ga0070711_1005262692 | 124 |
| 787 | 3300005440 | Ga0070705_100005883 | Ga0070705_1000058835 | 124 |
| 788 | 3300005440 | Ga0070705_101888596 | Ga0070705_1018885961 | 124 |
| 789 | 3300005441 | Ga0070700_100008279 | Ga0070700_1000082792 | 124 |
| 790 | 3300005441 | Ga0070700_100246215 | Ga0070700_1002462152 | 124 |
| 791 | 3300005441 | Ga0070700_100280663 | Ga0070700_1002806632 | 124 |
| 792 | 3300005441 | Ga0070700_101291097 | Ga0070700_1012910971 | 124 |
| 793 | 3300005444 | Ga0070694_100907374 | Ga0070694_1009073741 | 124 |
| 794 | 3300005457 | Ga0070662_100299493 | Ga0070662_1002994931 | 124 |
| 795 | 3300005457 | Ga0070662_100515026 | Ga0070662_1005150263 | 124 |
| 796 | 3300005457 | Ga0070662_100868438 | Ga0070662_1008684382 | 124 |
| 797 | 3300005458 | Ga0070681_10046585 | Ga0070681_100465857 | 124 |
| 798 | 3300005459 | Ga0068867_100066459 | Ga0068867_1000664592 | 124 |
| 799 | 3300005459 | Ga0068867_100438783 | Ga0068867_1004387832 | 124 |
| 800 | 3300005466 | Ga0070685_10066483 | Ga0070685_100664833 | 124 |
| 801 | 3300005468 | Ga0070707_101321307 | Ga0070707_1013213071 | 124 |
| 802 | 3300005471 | Ga0070698_102045601 | Ga0070698_1020456011 | 124 |
| 803 | 3300005530 | Ga0070679_100269725 | Ga0070679_1002697252 | 124 |
| 804 | 3300005539 | Ga0068853_102099929 | Ga0068853_1020999292 | 124 |
| 805 | 3300005543 | Ga0070672_100111434 | Ga0070672_1001114342 | 124 |
| 806 | 3300005544 | Ga0070686_100048973 | Ga0070686_1000489733 | 124 |
| 807 | 3300005544 | Ga0070686_100167695 | Ga0070686_1001676952 | 124 |
| 808 | 3300005545 | Ga0070695_100036742 | Ga0070695_1000367422 | 124 |
| 809 | 3300005546 | Ga0070696_100028838 | Ga0070696_1000288382 | 124 |
| 810 | 3300005549 | Ga0070704_100010100 | Ga0070704_1000101003 | 124 |
| 811 | 3300005549 | Ga0070704_101294147 | Ga0070704_1012941472 | 124 |
| 812 | 3300005549 | Ga0070704_101359871 | Ga0070704_1013598712 | 124 |
| 813 | 3300005563 | Ga0068855_101854580 | Ga0068855_1018545802 | 124 |
| 814 | 3300005563 | Ga0068855_102177151 | Ga0068855_1021771512 | 124 |
| 815 | 3300005564 | Ga0070664_100020626 | Ga0070664_1000206264 | 124 |
| 816 | 3300005564 | Ga0070664_100319159 | Ga0070664_1003191592 | 124 |
| 817 | 3300005577 | Ga0068857_102498385 | Ga0068857_1024983851 | 124 |
| 818 | 3300005615 | Ga0070702_100000625 | Ga0070702_1000006252 | 124 |
| 819 | 3300005617 | Ga0068859_100006458 | Ga0068859_10000645813 | 124 |
| 820 | 3300005617 | Ga0068859_100093941 | Ga0068859_1000939414 | 124 |
| 821 | 3300005617 | Ga0068859_100109529 | Ga0068859_1001095293 | 124 |
| 822 | 3300005618 | Ga0068864_100010624 | Ga0068864_1000106242 | 124 |
| 823 | 3300005618 | Ga0068864_100404833 | Ga0068864_1004048332 | 124 |
| 824 | 3300005718 | Ga0068866_10538031 | Ga0068866_105380312 | 124 |
| 825 | 3300005718 | Ga0068866_11006828 | Ga0068866_110068282 | 124 |
| 826 | 3300005719 | Ga0068861_100004292 | Ga0068861_10000429211 | 124 |
| 827 | 3300005719 | Ga0068861_101693108 | Ga0068861_1016931081 | 124 |
| 828 | 3300005840 | Ga0068870_10392479 | Ga0068870_103924792 | 124 |
| 829 | 3300005841 | Ga0068863_100237071 | Ga0068863_1002370712 | 124 |
| 830 | 3300005841 | Ga0068863_100521966 | Ga0068863_1005219661 | 124 |
| 831 | 3300005842 | Ga0068858_100010813 | Ga0068858_1000108132 | 124 |
| 832 | 3300005843 | Ga0068860_100403694 | Ga0068860_1004036941 | 124 |
| 833 | 3300005843 | Ga0068860_102254153 | Ga0068860_1022541532 | 124 |
| 834 | 3300005844 | Ga0068862_100026207 | Ga0068862_1000262076 | 124 |
| 835 | 3300005937 | Ga0081455_10056302 | Ga0081455_100563022 | 124 |
| 836 | 3300005985 | Ga0081539_10000090 | Ga0081539_10000090183 | 124 |
| 837 | 3300005985 | Ga0081539_10000649 | Ga0081539_1000064936 | 124 |
| 838 | 3300006028 | Ga0070717_10722868 | Ga0070717_107228682 | 124 |
| 839 | 3300006042 | Ga0075368_10053612 | Ga0075368_100536122 | 124 |
| 840 | 3300006048 | Ga0075363_100330301 | Ga0075363_1003303011 | 124 |
| 841 | 3300006051 | Ga0075364_10063700 | Ga0075364_100637002 | 124 |
| 842 | 3300006178 | Ga0075367_10038545 | Ga0075367_100385453 | 124 |
| 843 | 3300006195 | Ga0075366_10079063 | Ga0075366_100790632 | 124 |
| 844 | 3300006195 | Ga0075366_10647477 | Ga0075366_106474772 | 124 |
| 845 | 3300006237 | Ga0097621_100759185 | Ga0097621_1007591852 | 124 |
| 846 | 3300006844 | Ga0075428_100023619 | Ga0075428_1000236193 | 124 |
| 847 | 3300006846 | Ga0075430_100004097 | Ga0075430_1000040974 | 124 |
| 848 | 3300006847 | Ga0075431_100025373 | Ga0075431_1000253734 | 124 |
| 849 | 3300006847 | Ga0075431_100072066 | Ga0075431_1000720663 | 124 |
| 850 | 3300006847 | Ga0075431_100075412 | Ga0075431_1000754123 | 124 |
| 851 | 3300006847 | Ga0075431_101630017 | Ga0075431_1016300172 | 124 |
| 852 | 3300006852 | Ga0075433_10069622 | Ga0075433_100696222 | 124 |
| 853 | 3300006852 | Ga0075433_10397966 | Ga0075433_103979661 | 124 |
| 854 | 3300006852 | Ga0075433_11086375 | Ga0075433_110863751 | 124 |
| 855 | 3300006871 | Ga0075434_100044278 | Ga0075434_1000442782 | 124 |
| 856 | 3300006871 | Ga0075434_100064759 | Ga0075434_1000647592 | 124 |
| 857 | 3300006880 | Ga0075429_100038481 | Ga0075429_1000384813 | 124 |
| 858 | 3300006880 | Ga0075429_100199037 | Ga0075429_1001990372 | 124 |
| 859 | 3300006880 | Ga0075429_100236033 | Ga0075429_1002360333 | 124 |
| 860 | 3300006880 | Ga0075429_100984728 | Ga0075429_1009847282 | 124 |
| 861 | 3300006880 | Ga0075429_101759165 | Ga0075429_1017591652 | 124 |
| 862 | 3300006881 | Ga0068865_100143856 | Ga0068865_1001438562 | 124 |
| 863 | 3300006914 | Ga0075436_100034208 | Ga0075436_1000342082 | 124 |
| 864 | 3300006931 | Ga0097620_100006458 | Ga0097620_10000645813 | 124 |
| 865 | 3300006931 | Ga0097620_100093938 | Ga0097620_1000939384 | 124 |
| 866 | 3300006931 | Ga0097620_100109528 | Ga0097620_1001095283 | 124 |
| 867 | 3300006931 | Ga0097620_100296245 | Ga0097620_1002962453 | 124 |
| 868 | 3300007076 | Ga0075435_101309132 | Ga0075435_1013091322 | 124 |
| 869 | 3300009094 | Ga0111539_10015286 | Ga0111539_100152863 | 124 |
| 870 | 3300009094 | Ga0111539_10078739 | Ga0111539_100787394 | 124 |
| 871 | 3300009094 | Ga0111539_11479312 | Ga0111539_114793122 | 124 |
| 872 | 3300009101 | Ga0105247_10017021 | Ga0105247_100170211 | 124 |
| 873 | 3300009147 | Ga0114129_10105734 | Ga0114129_101057343 | 124 |
| 874 | 3300009147 | Ga0114129_10303454 | Ga0114129_103034543 | 124 |
| 875 | 3300009147 | Ga0114129_10464335 | Ga0114129_104643352 | 124 |
| 876 | 3300009147 | Ga0114129_10644141 | Ga0114129_106441412 | 124 |
| 877 | 3300009148 | Ga0105243_10155273 | Ga0105243_101552732 | 124 |
| 878 | 3300009174 | Ga0105241_10680023 | Ga0105241_106800232 | 124 |
| 879 | 3300009176 | Ga0105242_11473318 | Ga0105242_114733181 | 124 |
| 880 | 3300009177 | Ga0105248_10254620 | Ga0105248_102546202 | 124 |
| 881 | 3300009177 | Ga0105248_12047897 | Ga0105248_120478971 | 124 |
| 882 | 3300009177 | Ga0105248_12123984 | Ga0105248_121239842 | 124 |
| 883 | 3300009177 | Ga0105248_12177349 | Ga0105248_121773492 | 124 |
| 884 | 3300009545 | Ga0105237_10791424 | Ga0105237_107914242 | 124 |
| 885 | 3300009551 | Ga0105238_10567153 | Ga0105238_105671532 | 124 |
| 886 | 3300009553 | Ga0105249_10099145 | Ga0105249_100991453 | 124 |
| 887 | 3300009553 | Ga0105249_10891252 | Ga0105249_108912522 | 124 |
| 888 | 3300009553 | Ga0105249_10945030 | Ga0105249_109450301 | 124 |
| 889 | 3300011119 | Ga0105246_11095589 | Ga0105246_110955892 | 124 |
| 890 | 3300013100 | Ga0157373_10667413 | Ga0157373_106674131 | 124 |
| 891 | 3300013105 | Ga0157369_11833230 | Ga0157369_118332301 | 124 |
| 892 | 3300013307 | Ga0157372_10465805 | Ga0157372_104658052 | 124 |
| 893 | 3300013308 | Ga0157375_10304377 | Ga0157375_103043772 | 124 |
| 894 | 3300014325 | Ga0163163_10026560 | Ga0163163_100265605 | 124 |
| 895 | 3300014325 | Ga0163163_10145562 | Ga0163163_101455622 | 124 |
| 896 | 3300014326 | Ga0157380_10001120 | Ga0157380_100011202 | 124 |
| 897 | 3300014326 | Ga0157380_10045494 | Ga0157380_100454941 | 124 |
| 898 | 3300014326 | Ga0157380_10051365 | Ga0157380_100513653 | 124 |
| 899 | 3300014968 | Ga0157379_10331196 | Ga0157379_103311963 | 124 |
| 900 | 3300025893 | Ga0207682_10007672 | Ga0207682_100076724 | 124 |
| 901 | 3300025898 | Ga0207692_10436519 | Ga0207692_104365191 | 124 |
| 902 | 3300025899 | Ga0207642_10098183 | Ga0207642_100981832 | 124 |
| 903 | 3300025906 | Ga0207699_10044251 | Ga0207699_100442513 | 124 |
| 904 | 3300025907 | Ga0207645_10004409 | Ga0207645_100044095 | 124 |
| 905 | 3300025907 | Ga0207645_10030979 | Ga0207645_100309794 | 124 |
| 906 | 3300025907 | Ga0207645_10102441 | Ga0207645_101024412 | 124 |
| 907 | 3300025908 | Ga0207643_10213277 | Ga0207643_102132771 | 124 |
| 908 | 3300025908 | Ga0207643_10363404 | Ga0207643_103634043 | 124 |
| 909 | 3300025911 | Ga0207654_10731068 | Ga0207654_107310681 | 124 |
| 910 | 3300025912 | Ga0207707_10026199 | Ga0207707_100261994 | 124 |
| 911 | 3300025913 | Ga0207695_10455243 | Ga0207695_104552432 | 124 |
| 912 | 3300025914 | Ga0207671_10845904 | Ga0207671_108459041 | 124 |
| 913 | 3300025916 | Ga0207663_10897576 | Ga0207663_108975762 | 124 |
| 914 | 3300025917 | Ga0207660_10281074 | Ga0207660_102810743 | 124 |
| 915 | 3300025918 | Ga0207662_10043871 | Ga0207662_100438712 | 124 |
| 916 | 3300025919 | Ga0207657_10524204 | Ga0207657_105242042 | 124 |
| 917 | 3300025920 | Ga0207649_10306477 | Ga0207649_103064772 | 124 |
| 918 | 3300025920 | Ga0207649_11089690 | Ga0207649_110896902 | 124 |
| 919 | 3300025921 | Ga0207652_10049212 | Ga0207652_100492125 | 124 |
| 920 | 3300025923 | Ga0207681_10015905 | Ga0207681_100159052 | 124 |
| 921 | 3300025923 | Ga0207681_10057138 | Ga0207681_100571383 | 124 |
| 922 | 3300025923 | Ga0207681_10089547 | Ga0207681_100895473 | 124 |
| 923 | 3300025925 | Ga0207650_10001357 | Ga0207650_100013572 | 124 |
| 924 | 3300025925 | Ga0207650_10009031 | Ga0207650_100090312 | 124 |
| 925 | 3300025926 | Ga0207659_10078583 | Ga0207659_100785832 | 124 |
| 926 | 3300025926 | Ga0207659_10236618 | Ga0207659_102366182 | 124 |
| 927 | 3300025928 | Ga0207700_10727148 | Ga0207700_107271481 | 124 |
| 928 | 3300025931 | Ga0207644_10198864 | Ga0207644_101988642 | 124 |
| 929 | 3300025932 | Ga0207690_10340718 | Ga0207690_103407182 | 124 |
| 930 | 3300025933 | Ga0207706_10287602 | Ga0207706_102876022 | 124 |
| 931 | 3300025936 | Ga0207670_10512921 | Ga0207670_105129211 | 124 |
| 932 | 3300025937 | Ga0207669_10009114 | Ga0207669_100091146 | 124 |
| 933 | 3300025937 | Ga0207669_10749921 | Ga0207669_107499211 | 124 |
| 934 | 3300025937 | Ga0207669_11148462 | Ga0207669_111484622 | 124 |
| 935 | 3300025938 | Ga0207704_10029133 | Ga0207704_100291332 | 124 |
| 936 | 3300025940 | Ga0207691_10136581 | Ga0207691_101365812 | 124 |
| 937 | 3300025941 | Ga0207711_10042075 | Ga0207711_100420753 | 124 |
| 938 | 3300025942 | Ga0207689_11405692 | Ga0207689_114056922 | 124 |
| 939 | 3300025945 | Ga0207679_10024525 | Ga0207679_100245252 | 124 |
| 940 | 3300025949 | Ga0207667_11668369 | Ga0207667_116683692 | 124 |
| 941 | 3300025960 | Ga0207651_10077267 | Ga0207651_100772672 | 124 |
| 942 | 3300025960 | Ga0207651_10646127 | Ga0207651_106461272 | 124 |
| 943 | 3300025961 | Ga0207712_10068046 | Ga0207712_100680463 | 124 |
| 944 | 3300025961 | Ga0207712_10942657 | Ga0207712_109426572 | 124 |
| 945 | 3300025972 | Ga0207668_10100658 | Ga0207668_101006583 | 124 |
| 946 | 3300026035 | Ga0207703_10081327 | Ga0207703_100813272 | 124 |
| 947 | 3300026035 | Ga0207703_10711778 | Ga0207703_107117782 | 124 |
| 948 | 3300026075 | Ga0207708_10006212 | Ga0207708_100062123 | 124 |
| 949 | 3300026075 | Ga0207708_10228303 | Ga0207708_102283032 | 124 |
| 950 | 3300026075 | Ga0207708_10402365 | Ga0207708_104023651 | 124 |
| 951 | 3300026075 | Ga0207708_10606101 | Ga0207708_106061012 | 124 |
| 952 | 3300026075 | Ga0207708_10731554 | Ga0207708_107315542 | 124 |
| 953 | 3300026078 | Ga0207702_10575086 | Ga0207702_105750861 | 124 |
| 954 | 3300026088 | Ga0207641_10147915 | Ga0207641_101479152 | 124 |
| 955 | 3300026088 | Ga0207641_10521286 | Ga0207641_105212862 | 124 |
| 956 | 3300026089 | Ga0207648_10089858 | Ga0207648_100898582 | 124 |
| 957 | 3300026095 | Ga0207676_10036492 | Ga0207676_100364921 | 124 |
| 958 | 3300026095 | Ga0207676_11915693 | Ga0207676_119156932 | 124 |
| 959 | 3300026116 | Ga0207674_10103741 | Ga0207674_101037413 | 124 |
| 960 | 3300026116 | Ga0207674_10375909 | Ga0207674_103759092 | 124 |
| 961 | 3300026118 | Ga0207675_100001984 | Ga0207675_1000019842 | 124 |
| 962 | 3300026118 | Ga0207675_101361243 | Ga0207675_1013612432 | 124 |
| 963 | 3300027866 | Ga0209813_10217466 | Ga0209813_102174661 | 124 |
| 964 | 3300027907 | Ga0207428_10338042 | Ga0207428_103380422 | 124 |
| 965 | 3300028380 | Ga0268265_10028514 | Ga0268265_100285144 | 124 |
| 966 | 3300028380 | Ga0268265_10458522 | Ga0268265_104585221 | 124 |
| 967 | 3300028380 | Ga0268265_10912867 | Ga0268265_109128672 | 124 |
| 968 | 3300028381 | Ga0268264_10806797 | Ga0268264_108067971 | 124 |
| 969 | 3300028381 | Ga0268264_11384091 | Ga0268264_113840912 | 124 |
| 970 | 3300032005 | Ga0307411_10682661 | Ga0307411_106826612 | 124 |
| 971 | 3300035691 | Ga0373931_0521377 | Ga0373931_0521377_103_477 | 124 |
| 972 | 3300041997 | Ga0439431_0027667 | Ga0439431_0027667_205_609 | 124 |
| 973 | 3300042004 | Ga0439445_0043161 | Ga0439445_0043161_92_496 | 124 |
| 974 | 3300046455 | Ga0495603_0154718 | Ga0495603_0154718_741_1121 | 124 |
| 975 | 3300046459 | Ga0495629_0039644 | Ga0495629_0039644_616_996 | 124 |
| 976 | 3300046535 | Ga0495586_0667073 | Ga0495586_0667073_175_552 | 124 |
| 977 | 3300046539 | Ga0495621_0012653 | Ga0495621_0012653_1015_1395 | 124 |
| 978 | 3300046539 | Ga0495621_0081706 | Ga0495621_0081706_790_1167 | 124 |
| 979 | 3300046539 | Ga0495621_0161290 | Ga0495621_0161290_134_523 | 124 |
| 980 | 3300047320 | Ga0495672_0031959 | Ga0495672_0031959_413_820 | 124 |
| 981 | 3300048907 | Ga0496104_0208307 | Ga0496104_0208307_822_1196 | 124 |
| 982 | 3300048909 | Ga0496106_0129552 | Ga0496106_0129552_1223_1597 | 124 |
| 983 | 3300048911 | Ga0496108_0396358 | Ga0496108_0396358_268_657 | 124 |
| 984 | 3300048912 | Ga0496109_0042376 | Ga0496109_0042376_1922_2305 | 124 |
| 985 | 3300048912 | Ga0496109_0114683 | Ga0496109_0114683_1537_1911 | 124 |
| 986 | 3300048913 | Ga0496110_0306643 | Ga0496110_0306643_850_1224 | 124 |
| 987 | 3300048914 | Ga0496111_0352835 | Ga0496111_0352835_284_658 | 124 |
| 988 | 3300048916 | Ga0496113_0385631 | Ga0496113_0385631_242_616 | 124 |
| 989 | 3300048916 | Ga0496113_0998546 | Ga0496113_0998546_260_643 | 124 |
| 990 | 3300049591 | Ga0501075_0607778 | Ga0501075_0607778_211_591 | 124 |
| 991 | 3300050491 | nmdc:mga00v17_112166_c1 | nmdc:mga00v17_112166_c1_1061_1468 | 124 |
| 992 | 3300050491 | nmdc:mga00v17_68561_c1 | nmdc:mga00v17_68561_c1_452_859 | 124 |
| 993 | 3300050493 | nmdc:mga0k408_136798_c1 | nmdc:mga0k408_136798_c1_780_1187 | 124 |
| 994 | 3300050494 | nmdc:mga06z11_132588_c1 | nmdc:mga06z11_132588_c1_711_1112 | 124 |
| 995 | 3300050494 | nmdc:mga06z11_33068_c1 | nmdc:mga06z11_33068_c1_1426_1833 | 124 |
| 996 | 3300050494 | nmdc:mga06z11_47870_c1 | nmdc:mga06z11_47870_c1_1359_1766 | 124 |
| 997 | 3300050495 | nmdc:mga04h51_94307_c1 | nmdc:mga04h51_94307_c1_629_1036 | 124 |
| 998 | 3300050507 | nmdc:mga05p37_1215570_c1 | nmdc:mga05p37_1215570_c1_178_561 | 124 |
| 999 | 3300050507 | nmdc:mga05p37_137872_c1 | nmdc:mga05p37_137872_c1_398_778 | 124 |
| 1000 | 3300050507 | nmdc:mga05p37_93364_c1 | nmdc:mga05p37_93364_c1_90_467 | 124 |
| 1001 | 3300050508 | nmdc:mga09592_1495004_c1 | nmdc:mga09592_1495004_c1_114_497 | 124 |
| 1002 | 3300050508 | nmdc:mga09592_257964_c1 | nmdc:mga09592_257964_c1_62_454 | 124 |
| 1003 | 3300050508 | nmdc:mga09592_65218_c1 | nmdc:mga09592_65218_c1_2341_2718 | 124 |
| 1004 | 3300050508 | nmdc:mga09592_702093_c1 | nmdc:mga09592_702093_c1_360_740 | 124 |
| 1005 | 3300050509 | nmdc:mga0qj67_303095_c1 | nmdc:mga0qj67_303095_c1_511_903 | 124 |
| 1006 | 3300050509 | nmdc:mga0qj67_43508_c1 | nmdc:mga0qj67_43508_c1_3034_3414 | 124 |
| 1007 | 3300050509 | nmdc:mga0qj67_48387_c1 | nmdc:mga0qj67_48387_c1_2361_2750 | 124 |
| 1008 | 3300050510 | nmdc:mga06r32_24482_c1 | nmdc:mga06r32_24482_c1_2604_2984 | 124 |
| 1009 | 3300050510 | nmdc:mga06r32_59692_c1 | nmdc:mga06r32_59692_c1_1560_1943 | 124 |
| 1010 | 3300050510 | nmdc:mga06r32_671152_c1 | nmdc:mga06r32_671152_c1_544_927 | 124 |
| 1011 | 3300050510 | nmdc:mga06r32_706315_c1 | nmdc:mga06r32_706315_c1_427_804 | 124 |
| 1012 | 3300050511 | nmdc:mga08y16_240822_c1 | nmdc:mga08y16_240822_c1_138_539 | 124 |
| 1013 | 3300050511 | nmdc:mga08y16_57296_c1 | nmdc:mga08y16_57296_c1_387_770 | 124 |
| 1014 | 3300050512 | nmdc:mga0n895_117712_c1 | nmdc:mga0n895_117712_c1_1375_1758 | 124 |
| 1015 | 3300050512 | nmdc:mga0n895_21724_c1 | nmdc:mga0n895_21724_c1_4387_4779 | 124 |
| 1016 | 3300050512 | nmdc:mga0n895_43411_c1 | nmdc:mga0n895_43411_c1_821_1246 | 124 |
| 1017 | 3300050513 | nmdc:mga0rr50_480202_c1 | nmdc:mga0rr50_480202_c1_99_497 | 124 |
| 1018 | 3300050513 | nmdc:mga0rr50_81970_c1 | nmdc:mga0rr50_81970_c1_1837_2262 | 124 |
| 1019 | 3300050513 | nmdc:mga0rr50_949671_c1 | nmdc:mga0rr50_949671_c1_29_421 | 124 |
| 1020 | 3300050514 | nmdc:mga08x19_124725_c1 | nmdc:mga08x19_124725_c1_1287_1712 | 124 |
| 1021 | 3300050515 | nmdc:mga0a205_411460_c1 | nmdc:mga0a205_411460_c1_244_618 | 124 |
| 1022 | 3300050515 | nmdc:mga0a205_41338_c1 | nmdc:mga0a205_41338_c1_453_845 | 124 |
| 1023 | 3300050515 | nmdc:mga0a205_418782_c1 | nmdc:mga0a205_418782_c1_112_489 | 124 |
| 1024 | 3300053103 | Ga0500555_000534 | Ga0500555_000534_8497_8889 | 124 |
| 1025 | 3300053116 | Ga0500592_038539 | Ga0500592_038539_157_549 | 124 |
| 1026 | 3300053139 | Ga0500568_0001551 | Ga0500568_0001551_11882_12289 | 124 |
| 1027 | 3300053153 | Ga0500616_0001234 | Ga0500616_0001234_8056_8475 | 124 |
| 1028 | 3300053730 | Ga0500645_000765 | Ga0500645_000765_14753_15145 | 124 |
| 1029 | 3300053736 | Ga0500599_004568 | Ga0500599_004568_1212_1637 | 124 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1m2d-assembly1.cif.gz_B | crystal structure at 1.05 angstroms resolution of the cys59ser variant of the thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus | 0.867 | 19 | 114 |
| 1m2b-assembly1.cif.gz_B | crystal structure at 1.25 angstroms resolution of the cys55ser variant of the thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus | 0.8611 | 19 | 114 |
| 8oh5-assembly1.cif.gz_B | cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) | 0.8582 | 20 | 115 |
| 5abr-assembly1.cif.gz_B | structure of fesi protein from azotobacter vinelandii | 0.85 | 19 | 114 |
| 1m2d-assembly1.cif.gz_B | crystal structure at 1.05 angstroms resolution of the cys59ser variant of the thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus | 0.8195 | 19 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q55BP2_216_308_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8785 | 19 | 114 | 3.40.30.10 |
| 1m2dB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.867 | 19 | 114 | 3.40.30.10 |
| af_Q55BP2_216_308_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8616 | 19 | 114 | 3.40.30.10 |
| 5abrB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.85 | 19 | 114 | 3.40.30.10 |
| af_I1M6F2_186_285_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8388 | 19 | 112 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8GVT4-F1-model_v4 | Ferredoxin | 0.9918 | 1 | 118 |
|
| AF-A0A3N5ZH83-F1-model_v4 | (2Fe-2S) ferredoxin domain-containing protein | 0.981 | 1 | 118 |
|
| AF-A0A7W0FX34-F1-model_v4 | (2Fe-2S) ferredoxin domain-containing protein | 0.9807 | 5 | 118 |
|
| AF-A0A2E5M0T9-F1-model_v4 | Ferredoxin | 0.9801 | 1 | 118 |
|
| AF-A0A482UP77-F1-model_v4 | Ferredoxin | 0.9791 | 8 | 114 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar