F488550

General Info

Members Datasets Scaffolds Average Seq Length
1028 418 1028 242

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10049712|Ga0075364_100497125
Length 278
Sequence VPNTGKPRKDGFKTAVAAITLDLMVESLFSGFADISLPELILIGAMALVASVVGGVAGYGTGALMPLVLVPIVGAEPVVPILSLSALFTNSSRTAAFLPLVDWRRAAIVLVAAVPTCALGAWGYTMLTGTGAALVIGTMLIASVPLRRLMRRRGLVLSHRGLAAAAFAWGPLAGGTVGAGIILLSLLMAAGLEGAAVVATDAVVSIGIGLTKLLTFGLAGAVTAKVIAVALLIGGIAFPGAFFAKAMINRLPVHVHTVILDAVVAGGGAMMIVNAFAR

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
85 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
89 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
141 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
142 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
145 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
216 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
217 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
218 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
219 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
220 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
221 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
222 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
223 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
224 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
225 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
226 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
227 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
228 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
229 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
230 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
231 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
232 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
233 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
234 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
235 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
236 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
237 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
238 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
240 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
241 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
242 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
243 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
244 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
245 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
246 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
247 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
248 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
249 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
250 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
251 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
252 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
253 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
255 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
256 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
257 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
258 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
259 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
261 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
262 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
263 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
264 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
265 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
266 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
267 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
268 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
269 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
270 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
271 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
272 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
273 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
274 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
275 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
276 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
277 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
278 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
281 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
282 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
283 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
284 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
285 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
286 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
287 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
288 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
289 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
290 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
291 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
292 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
293 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
294 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
295 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
296 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
297 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
298 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
299 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
300 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
301 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
302 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
303 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
304 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
305 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
306 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
307 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
308 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
309 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
310 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
311 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
312 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
313 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
314 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
315 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
316 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
317 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
318 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
319 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
320 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
321 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
322 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
323 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
324 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
325 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
326 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
327 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
328 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
329 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
330 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
331 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
332 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
333 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
334 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
335 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
336 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
337 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
338 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
339 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
340 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
341 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
342 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
343 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
344 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
345 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
346 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
347 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
348 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
349 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
350 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
351 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
352 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
353 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
354 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
355 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
356 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
357 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
358 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
372 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
373 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
374 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
375 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
376 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
377 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
378 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
379 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
380 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
381 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
382 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
383 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
385 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
386 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
387 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
388 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
389 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
390 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
391 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
392 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
393 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
394 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
395 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
396 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
397 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
398 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
399 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
400 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
401 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
402 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
403 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
404 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
405 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
406 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
407 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
408 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
409 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
410 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
411 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
412 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
413 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
414 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
415 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
416 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
417 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
418 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.57
Nodule 0
Rhizoplane 9.05
Rhizosphere 85.6
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1009665 3300001976 Bacteria 1258
2 JGI24746J21847_1000660 3300001977 Bacteria 5285
3 JGI24739J22299_10005070 3300001989 Bacteria 5015
4 JGI24737J22298_10001725 3300001990 Bacteria 7790
5 JGI24738J21930_10014991 3300002075 Bacteria 1654
6 JGI24035J26624_1000749 3300002126 Bacteria 3043
7 JGI24742J22300_10000548 3300002244 Bacteria 5621
8 JGI24742J22300_10020073 3300002244 Bacteria 1137
9 JGI25406J46586_10006738 3300003203 Bacteria 5279
10 JGI25153J46596_10011635 3300003215 Bacteria 3870
11 JGI25404J52841_10005908 3300003659 Bacteria 2540
12 JGI25405J52794_10002353 3300003911 Bacteria 3245
13 Ga0065165_1001015 3300005262 Bacteria 34129
14 Ga0070658_10073615 3300005327 Bacteria 2801
15 Ga0070658_10181552 3300005327 Bacteria 1771
16 Ga0070658_10442188 3300005327 Bacteria 1120
17 Ga0070676_10004291 3300005328 Bacteria 7488
18 Ga0070683_100004677 3300005329 Bacteria 11310
19 Ga0070683_100149328 3300005329 Bacteria 2215
20 Ga0070683_100164431 3300005329 Bacteria 2105
21 Ga0070690_100008757 3300005330 Bacteria 5842
22 Ga0070690_100092134 3300005330 Bacteria 1998
23 Ga0070690_100103615 3300005330 Bacteria 1889
24 Ga0070670_100004378 3300005331 Bacteria 11820
25 Ga0070670_100016298 3300005331 Bacteria 6382
26 Ga0070670_100048139 3300005331 Bacteria 3668
27 Ga0068869_100000546 3300005334 Bacteria 21018
28 Ga0068869_100063996 3300005334 Bacteria 2704
29 Ga0070680_100035104 3300005336 Bacteria 4047
30 Ga0070680_100043638 3300005336 Bacteria 3642
31 Ga0070680_100070863 3300005336 Bacteria 2864
32 Ga0070680_100099086 3300005336 Bacteria 2418
33 Ga0070680_100442230 3300005336 Bacteria 1110
34 Ga0070680_100541981 3300005336 Bacteria 997
35 Ga0070682_100003445 3300005337 Bacteria 8766
36 Ga0070682_100110716 3300005337 Bacteria 1829
37 Ga0068868_100012769 3300005338 Bacteria 6144
38 Ga0068868_100209747 3300005338 Bacteria 1627
39 Ga0070660_100006773 3300005339 Bacteria 7953
40 Ga0070660_100036099 3300005339 Bacteria 3743
41 Ga0070660_100039013 3300005339 Bacteria 3609
42 Ga0070660_100217924 3300005339 Bacteria 1551
43 Ga0070689_100002392 3300005340 Bacteria 12238
44 Ga0070689_100023289 3300005340 Bacteria 4634
45 Ga0070689_100054606 3300005340 Bacteria 3093
46 Ga0070691_10003723 3300005341 Bacteria 6886
47 Ga0070691_10094042 3300005341 Bacteria 1481
48 Ga0070687_100001017 3300005343 Bacteria 9561
49 Ga0070661_100004096 3300005344 Bacteria 10046
50 Ga0070661_100191351 3300005344 Bacteria 1560
51 Ga0070692_10004423 3300005345 Bacteria 5871
52 Ga0070668_100008178 3300005347 Bacteria 7768
53 Ga0070668_100047207 3300005347 Bacteria 3310
54 Ga0070668_100497346 3300005347 Bacteria 1055
55 Ga0070669_100009976 3300005353 Bacteria 6754
56 Ga0070675_100010473 3300005354 Bacteria 7243
57 Ga0070671_100033814 3300005355 Bacteria 4230
58 Ga0070671_100076769 3300005355 Bacteria 2791
59 Ga0070674_100027012 3300005356 Bacteria 3757
60 Ga0070674_100088015 3300005356 Bacteria 2234
61 Ga0070673_100000050 3300005364 Bacteria 49499
62 Ga0070673_100057192 3300005364 Bacteria 3081
63 Ga0070688_100000781 3300005365 Bacteria 15764
64 Ga0070688_100005154 3300005365 Bacteria 6855
65 Ga0070659_100036287 3300005366 Bacteria 3842
66 Ga0070659_100336097 3300005366 Bacteria 1265
67 Ga0070667_100007711 3300005367 Bacteria 8923
68 Ga0070667_100114407 3300005367 Bacteria 2342
69 Ga0070667_100266149 3300005367 Bacteria 1536
70 Ga0070703_10029323 3300005406 Unclassified 1651
71 Ga0070709_10002579 3300005434 Bacteria 9800
72 Ga0070709_10015376 3300005434 Bacteria 4353
73 Ga0070709_10117887 3300005434 Bacteria 1795
74 Ga0070714_100006031 3300005435 Bacteria 9304
75 Ga0070714_100058980 3300005435 Bacteria 3290
76 Ga0070714_100263447 3300005435 Bacteria 1597
77 Ga0070713_100017576 3300005436 Bacteria 5412
78 Ga0070713_100055547 3300005436 Bacteria 3291
79 Ga0070713_100056884 3300005436 Bacteria 3254
80 Ga0070713_100243471 3300005436 Bacteria 1638
81 Ga0070710_10003313 3300005437 Bacteria 7639
82 Ga0070710_10021794 3300005437 Bacteria 3344
83 Ga0070710_10092281 3300005437 Bacteria 1788
84 Ga0070710_10153247 3300005437 Bacteria 1423
85 Ga0070701_10002148 3300005438 Bacteria 7507
86 Ga0070701_10437087 3300005438 Bacteria 837
87 Ga0070711_100022517 3300005439 Bacteria 4085
88 Ga0070711_100024455 3300005439 Bacteria 3939
89 Ga0070711_100027086 3300005439 Bacteria 3761
90 Ga0070705_100003118 3300005440 Bacteria 8153
91 Ga0070700_100002692 3300005441 Bacteria 9079
92 Ga0070694_100005972 3300005444 Bacteria 7383
93 Ga0070708_100269960 3300005445 Bacteria 1600
94 Ga0070663_100019695 3300005455 Bacteria 4455
95 Ga0070663_100044767 3300005455 Bacteria 3123
96 Ga0070663_100087995 3300005455 Bacteria 2296
97 Ga0070663_100272077 3300005455 Unclassified 1347
98 Ga0070663_100486178 3300005455 Unclassified 1023
99 Ga0070678_100000518 3300005456 Bacteria 18676
100 Ga0070678_100022233 3300005456 Bacteria 4197
101 Ga0070678_100055812 3300005456 Bacteria 2886
102 Ga0070678_100261512 3300005456 Bacteria 1456
103 Ga0070678_100429698 3300005456 Bacteria 1153
104 Ga0070662_100207506 3300005457 Bacteria 1557
105 Ga0070681_10011624 3300005458 Bacteria 8716
106 Ga0070681_10027987 3300005458 Bacteria 5666
107 Ga0070681_10196314 3300005458 Bacteria 1937
108 Ga0070681_10552107 3300005458 Bacteria 1066
109 Ga0068867_100084087 3300005459 Bacteria 2403
110 Ga0070685_10003674 3300005466 Bacteria 7777
111 Ga0070685_10014330 3300005466 Bacteria 4198
112 Ga0070707_100135839 3300005468 Bacteria 2392
113 Ga0070699_100010972 3300005518 Bacteria 7834
114 Ga0070679_100004048 3300005530 Bacteria 13502
115 Ga0070679_100007667 3300005530 Bacteria 10102
116 Ga0070679_100038301 3300005530 Bacteria 4766
117 Ga0070679_100103442 3300005530 Bacteria 2834
118 Ga0070679_100157769 3300005530 Bacteria 2243
119 Ga0070684_100004205 3300005535 Bacteria 10907
120 Ga0070697_100245505 3300005536 Bacteria 1530
121 Ga0070697_100652942 3300005536 Bacteria 926
122 Ga0068853_100042900 3300005539 Bacteria 3869
123 Ga0068853_100718527 3300005539 Bacteria 954
124 Ga0070672_100000643 3300005543 Bacteria 20456
125 Ga0070686_100081135 3300005544 Bacteria 2147
126 Ga0070695_100127165 3300005545 Bacteria 1751
127 Ga0070696_100147295 3300005546 Bacteria 1725
128 Ga0070693_100010080 3300005547 Bacteria 4718
129 Ga0070693_100015464 3300005547 Bacteria 3930
130 Ga0070665_100004366 3300005548 Bacteria 14875
131 Ga0070665_100098694 3300005548 Bacteria 2925
132 Ga0070665_100107354 3300005548 Bacteria 2794
133 Ga0070665_100205970 3300005548 Bacteria 1968
134 Ga0070704_100007534 3300005549 Bacteria 6481
135 Ga0068855_100035984 3300005563 Bacteria 5895
136 Ga0068855_100263615 3300005563 Bacteria 1919
137 Ga0070664_100045869 3300005564 Bacteria 3691
138 Ga0070664_100061029 3300005564 Bacteria 3212
139 Ga0070664_100273849 3300005564 Bacteria 1521
140 Ga0068857_100001038 3300005577 Bacteria 21487
141 Ga0068857_100193234 3300005577 Bacteria 1854
142 Ga0068854_100154785 3300005578 Bacteria 1770
143 Ga0068856_100009104 3300005614 Bacteria 9654
144 Ga0068856_100216401 3300005614 Bacteria 1931
145 Ga0068856_100705853 3300005614 Bacteria 1029
146 Ga0070702_100003907 3300005615 Bacteria 6754
147 Ga0070702_100045550 3300005615 Bacteria 2482
148 Ga0070702_100280699 3300005615 Bacteria 1143
149 Ga0068852_100024049 3300005616 Bacteria 4916
150 Ga0068852_100342276 3300005616 Bacteria 1458
151 Ga0068859_100125159 3300005617 Bacteria 2639
152 Ga0068859_100337060 3300005617 Bacteria 1602
153 Ga0068859_100582430 3300005617 Bacteria 1212
154 Ga0068859_101001040 3300005617 Bacteria 918
155 Ga0068864_100001882 3300005618 Bacteria 17235
156 Ga0068864_100227008 3300005618 Bacteria 1725
157 Ga0068864_100237471 3300005618 Bacteria 1688
158 Ga0068866_10000791 3300005718 Bacteria 14174
159 Ga0068866_10028400 3300005718 Bacteria 2665
160 Ga0068861_100002491 3300005719 Bacteria 12008
161 Ga0068870_10001431 3300005840 Bacteria 9645
162 Ga0068870_10026649 3300005840 Bacteria 2883
163 Ga0068863_100031598 3300005841 Bacteria 5051
164 Ga0068863_100097902 3300005841 Bacteria 2786
165 Ga0068863_100155588 3300005841 Bacteria 2189
166 Ga0068858_100028785 3300005842 Bacteria 5159
167 Ga0068858_100050653 3300005842 Bacteria 3843
168 Ga0068858_100131690 3300005842 Bacteria 2345
169 Ga0068860_100002530 3300005843 Bacteria 19153
170 Ga0068860_100213517 3300005843 Bacteria 1872
171 Ga0068860_100380951 3300005843 Bacteria 1392
172 Ga0068862_100011700 3300005844 Bacteria 7241
173 Ga0081455_10000081 3300005937 Bacteria 103752
174 Ga0081455_10016554 3300005937 Bacteria 7113
175 Ga0081455_10034433 3300005937 Bacteria 4537
176 Ga0081455_10049916 3300005937 Bacteria 3603
177 Ga0081455_10082000 3300005937 Bacteria 2639
178 Ga0081455_10138580 3300005937 Bacteria 1892
179 Ga0081538_10108327 3300005981 Bacteria 1372
180 Ga0081540_1000027 3300005983 Bacteria 151880
181 Ga0081540_1003265 3300005983 Bacteria 12889
182 Ga0081540_1025762 3300005983 Bacteria 3375
183 Ga0081539_10001260 3300005985 Bacteria 44845
184 Ga0081539_10029936 3300005985 Bacteria 3390
185 Ga0070717_10000485 3300006028 Bacteria 25249
186 Ga0070717_10000980 3300006028 Bacteria 19102
187 Ga0070717_10494912 3300006028 Bacteria 1104
188 Ga0075365_10001829 3300006038 Bacteria 9956
189 Ga0075365_10001918 3300006038 Bacteria 9807
190 Ga0075365_10018393 3300006038 Bacteria 4295
191 Ga0075365_10238853 3300006038 Bacteria 1276
192 Ga0075368_10023549 3300006042 Bacteria 2353
193 Ga0075363_100067153 3300006048 Bacteria 1942
194 Ga0075364_10010606 3300006051 Bacteria 5573
195 Ga0075364_10049712 3300006051 Bacteria 2735
196 Ga0070715_10000289 3300006163 Bacteria 12366
197 Ga0070715_10001137 3300006163 Bacteria 7597
198 Ga0070716_100004371 3300006173 Bacteria 6749
199 Ga0070716_100085838 3300006173 Bacteria 1892
200 Ga0070712_100000210 3300006175 Bacteria 32927
201 Ga0070712_100000381 3300006175 Bacteria 25274
202 Ga0070712_100003511 3300006175 Bacteria 9649
203 Ga0075362_10004834 3300006177 Bacteria 4866
204 Ga0075367_10049089 3300006178 Bacteria 2487
205 Ga0075367_10087502 3300006178 Bacteria 1892
206 Ga0075366_10075432 3300006195 Bacteria 2012
207 Ga0075366_10316823 3300006195 Unclassified 955
208 Ga0097621_100001425 3300006237 Bacteria 16408
209 Ga0097621_100002618 3300006237 Bacteria 12322
210 Ga0097621_100070217 3300006237 Bacteria 2892
211 Ga0075370_10076893 3300006353 Bacteria 1915
212 Ga0068871_100006790 3300006358 Bacteria 8135
213 Ga0068871_100016863 3300006358 Bacteria 5513
214 Ga0068871_100124129 3300006358 Bacteria 2184
215 Ga0068871_100731276 3300006358 Bacteria 908
216 Ga0075428_100015591 3300006844 Bacteria 8426
217 Ga0075428_100500760 3300006844 Bacteria 1300
218 Ga0075428_100557035 3300006844 Bacteria 1225
219 Ga0075428_100863425 3300006844 Bacteria 961
220 Ga0075430_100099742 3300006846 Bacteria 2425
221 Ga0075430_100196520 3300006846 Bacteria 1676
222 Ga0075431_100067535 3300006847 Bacteria 3691
223 Ga0075431_100079885 3300006847 Bacteria 3376
224 Ga0075431_100441514 3300006847 Bacteria 1298
225 Ga0075433_10109293 3300006852 Bacteria 2453
226 Ga0075433_10199409 3300006852 Bacteria 1780
227 Ga0075434_100004560 3300006871 Bacteria 12511
228 Ga0075434_100031153 3300006871 Bacteria 5256
229 Ga0075434_100035379 3300006871 Bacteria 4938
230 Ga0075434_100043586 3300006871 Bacteria 4450
231 Ga0075434_100052243 3300006871 Bacteria 4060
232 Ga0075434_100053877 3300006871 Bacteria 3996
233 Ga0075434_100083203 3300006871 Bacteria 3198
234 Ga0075434_100132457 3300006871 Bacteria 2512
235 Ga0075434_100188580 3300006871 Bacteria 2082
236 Ga0075434_100383708 3300006871 Bacteria 1426
237 Ga0075429_100058070 3300006880 Bacteria 3370
238 Ga0068865_100001097 3300006881 Bacteria 15622
239 Ga0068865_100078168 3300006881 Bacteria 2366
240 Ga0068865_100411765 3300006881 Bacteria 1109
241 Ga0075436_100008403 3300006914 Bacteria 7059
242 Ga0075436_100334795 3300006914 Bacteria 1089
243 Ga0097620_100125151 3300006931 Bacteria 2639
244 Ga0097620_100337073 3300006931 Bacteria 1602
245 Ga0097620_100582456 3300006931 Bacteria 1212
246 Ga0097620_101000998 3300006931 Bacteria 918
247 Ga0075435_100014832 3300007076 Bacteria 5841
248 Ga0075435_100054758 3300007076 Bacteria 3220
249 Ga0075435_100134421 3300007076 Bacteria 2071
250 Ga0075435_100251387 3300007076 Bacteria 1505
251 Ga0075435_100518526 3300007076 Bacteria 1031
252 Ga0099795_10021163 3300007788 Bacteria 2129
253 Ga0105240_10067050 3300009093 Bacteria 4450
254 Ga0105240_10135711 3300009093 Bacteria 2947
255 Ga0111539_10011548 3300009094 Bacteria 11084
256 Ga0111539_10026539 3300009094 Bacteria 7080
257 Ga0111539_10050713 3300009094 Bacteria 4944
258 Ga0111539_10196327 3300009094 Bacteria 2354
259 Ga0111539_10203357 3300009094 Bacteria 2309
260 Ga0105245_10004787 3300009098 Bacteria 11946
261 Ga0105245_10197564 3300009098 Bacteria 1930
262 Ga0105245_10319031 3300009098 Bacteria 1530
263 Ga0105247_10003270 3300009101 Bacteria 10626
264 Ga0105247_10018149 3300009101 Bacteria 4219
265 Ga0105247_10024753 3300009101 Bacteria 3619
266 Ga0105247_10141527 3300009101 Unclassified 1577
267 Ga0105247_10378015 3300009101 Bacteria 1003
268 Ga0114129_10001669 3300009147 Bacteria 30222
269 Ga0114129_10006740 3300009147 Bacteria 16309
270 Ga0114129_10024067 3300009147 Bacteria 8629
271 Ga0114129_10035205 3300009147 Bacteria 7074
272 Ga0114129_10166040 3300009147 Bacteria 3012
273 Ga0114129_10309068 3300009147 Bacteria 2105
274 Ga0114129_10510661 3300009147 Bacteria 1568
275 Ga0114129_10542927 3300009147 Bacteria 1513
276 Ga0105243_10002400 3300009148 Bacteria 15707
277 Ga0105243_10004402 3300009148 Bacteria 11139
278 Ga0105243_10088625 3300009148 Bacteria 2542
279 Ga0105241_10008636 3300009174 Bacteria 7488
280 Ga0105241_10012784 3300009174 Bacteria 6160
281 Ga0105241_10470102 3300009174 Bacteria 1116
282 Ga0105242_10007578 3300009176 Bacteria 8356
283 Ga0105242_10023432 3300009176 Bacteria 4864
284 Ga0105242_10156399 3300009176 Bacteria 1992
285 Ga0105248_10010839 3300009177 Bacteria 10064
286 Ga0105248_10014218 3300009177 Bacteria 8762
287 Ga0105248_10049787 3300009177 Bacteria 4698
288 Ga0105248_10237669 3300009177 Bacteria 2051
289 Ga0105237_10158136 3300009545 Bacteria 2263
290 Ga0105238_10015699 3300009551 Bacteria 7667
291 Ga0105238_10063358 3300009551 Bacteria 3697
292 Ga0105238_10083461 3300009551 Bacteria 3184
293 Ga0105249_10336778 3300009553 Bacteria 1524
294 Ga0099796_10002132 3300010159 Bacteria 4257
295 Ga0105246_10025827 3300011119 Bacteria 3830
296 Ga0105246_10041134 3300011119 Bacteria 3122
297 Ga0157342_1003062 3300012507 Bacteria 1409
298 Ga0157373_10099718 3300013100 Bacteria 2044
299 Ga0157371_10158753 3300013102 Bacteria 1615
300 Ga0157369_10307822 3300013105 Bacteria 1648
301 Ga0157374_10001167 3300013296 Bacteria 22404
302 Ga0157374_10095661 3300013296 Bacteria 2840
303 Ga0157374_10344591 3300013296 Bacteria 1480
304 Ga0157378_10008023 3300013297 Bacteria 9217
305 Ga0157378_10020136 3300013297 Bacteria 5867
306 Ga0157378_10034938 3300013297 Bacteria 4444
307 Ga0157378_10088994 3300013297 Bacteria 2803
308 Ga0163162_10010853 3300013306 Bacteria 8866
309 Ga0163162_10194670 3300013306 Bacteria 2156
310 Ga0157372_10070864 3300013307 Bacteria 3923
311 Ga0157372_10216912 3300013307 Bacteria 2218
312 Ga0157375_10031874 3300013308 Bacteria 4992
313 Ga0163163_10007288 3300014325 Bacteria 9756
314 Ga0163163_10011174 3300014325 Bacteria 8131
315 Ga0163163_10041756 3300014325 Bacteria 4487
316 Ga0163163_10450329 3300014325 Bacteria 1347
317 Ga0157380_10001551 3300014326 Bacteria 15111
318 Ga0157380_10059935 3300014326 Bacteria 3039
319 Ga0157377_10070737 3300014745 Bacteria 2016
320 Ga0157379_10008646 3300014968 Bacteria 8866
321 Ga0157379_10202713 3300014968 Unclassified 1794
322 Ga0157379_10591223 3300014968 Bacteria 1035
323 Ga0157376_10062718 3300014969 Bacteria 3128
324 Ga0157376_11108952 3300014969 Bacteria 817
325 Ga0157376_11109594 3300014969 Bacteria 817
326 Ga0213876_10104415 3300021384 Bacteria 1503
327 Ga0228598_1031928 3300024227 Bacteria 1037
328 Ga0207666_1000153 3300025271 Bacteria 10663
329 Ga0209758_1000125 3300025297 Bacteria 189869
330 Ga0209758_1019110 3300025297 Bacteria 3324
331 Ga0207426_1000573 3300025302 Bacteria 49440
332 Ga0207697_10001059 3300025315 Bacteria 15198
333 Ga0207682_10002885 3300025893 Bacteria 7586
334 Ga0207692_10000282 3300025898 Bacteria 17493
335 Ga0207692_10020210 3300025898 Bacteria 3024
336 Ga0207692_10076128 3300025898 Bacteria 1782
337 Ga0207642_10000385 3300025899 Bacteria 13210
338 Ga0207642_10024406 3300025899 Bacteria 2430
339 Ga0207710_10000382 3300025900 Bacteria 30360
340 Ga0207710_10065532 3300025900 Bacteria 1656
341 Ga0207688_10001072 3300025901 Bacteria 13993
342 Ga0207688_10004597 3300025901 Bacteria 7515
343 Ga0207680_10046034 3300025903 Bacteria 2577
344 Ga0207647_10033262 3300025904 Bacteria 3302
345 Ga0207647_10048650 3300025904 Bacteria 2632
346 Ga0207685_10002544 3300025905 Bacteria 4206
347 Ga0207685_10006711 3300025905 Bacteria 3157
348 Ga0207699_10012918 3300025906 Bacteria 4257
349 Ga0207699_10032604 3300025906 Bacteria 2936
350 Ga0207699_10053630 3300025906 Bacteria 2391
351 Ga0207699_10185222 3300025906 Bacteria 1402
352 Ga0207645_10002745 3300025907 Bacteria 13711
353 Ga0207645_10110760 3300025907 Bacteria 1777
354 Ga0207643_10000004 3300025908 Bacteria 187006
355 Ga0207643_10000532 3300025908 Bacteria 24445
356 Ga0207705_10252777 3300025909 Bacteria 1344
357 Ga0207705_10260064 3300025909 Bacteria 1325
358 Ga0207684_10009569 3300025910 Bacteria 8549
359 Ga0207654_10008032 3300025911 Bacteria 5318
360 Ga0207707_10014644 3300025912 Bacteria 6833
361 Ga0207707_10095432 3300025912 Bacteria 2599
362 Ga0207707_10149498 3300025912 Bacteria 2042
363 Ga0207707_10257582 3300025912 Bacteria 1514
364 Ga0207695_10535643 3300025913 Bacteria 1052
365 Ga0207671_10382544 3300025914 Bacteria 1118
366 Ga0207693_10001038 3300025915 Bacteria 24865
367 Ga0207693_10002870 3300025915 Bacteria 14928
368 Ga0207693_10021249 3300025915 Bacteria 5158
369 Ga0207693_10051413 3300025915 Bacteria 3233
370 Ga0207693_10111293 3300025915 Bacteria 2148
371 Ga0207693_10113805 3300025915 Bacteria 2123
372 Ga0207663_10001206 3300025916 Bacteria 11940
373 Ga0207663_10020826 3300025916 Bacteria 3722
374 Ga0207663_10182611 3300025916 Bacteria 1499
375 Ga0207660_10084417 3300025917 Bacteria 2341
376 Ga0207660_10108359 3300025917 Bacteria 2086
377 Ga0207660_10171963 3300025917 Bacteria 1677
378 Ga0207660_10504782 3300025917 Bacteria 981
379 Ga0207662_10000392 3300025918 Bacteria 19588
380 Ga0207662_10009678 3300025918 Bacteria 5313
381 Ga0207657_10002007 3300025919 Bacteria 22003
382 Ga0207657_10007818 3300025919 Bacteria 10913
383 Ga0207657_10019229 3300025919 Bacteria 6492
384 Ga0207657_10124539 3300025919 Bacteria 2118
385 Ga0207649_10005404 3300025920 Bacteria 6918
386 Ga0207649_10176514 3300025920 Bacteria 1492
387 Ga0207649_10237596 3300025920 Bacteria 1306
388 Ga0207652_10040807 3300025921 Bacteria 3942
389 Ga0207652_10057538 3300025921 Bacteria 3349
390 Ga0207681_10203774 3300025923 Bacteria 1520
391 Ga0207694_10036064 3300025924 Bacteria 3794
392 Ga0207694_10052161 3300025924 Bacteria 3171
393 Ga0207650_10017240 3300025925 Bacteria 5055
394 Ga0207650_10180047 3300025925 Bacteria 1684
395 Ga0207650_10226842 3300025925 Bacteria 1505
396 Ga0207659_10000374 3300025926 Bacteria 26976
397 Ga0207687_10001956 3300025927 Bacteria 14176
398 Ga0207687_10003333 3300025927 Bacteria 10848
399 Ga0207687_10416250 3300025927 Bacteria 1108
400 Ga0207700_10029040 3300025928 Bacteria 3898
401 Ga0207700_10054514 3300025928 Bacteria 3002
402 Ga0207700_10063040 3300025928 Bacteria 2818
403 Ga0207700_10132844 3300025928 Bacteria 2035
404 Ga0207664_10012974 3300025929 Bacteria 5970
405 Ga0207664_10294781 3300025929 Bacteria 1426
406 Ga0207644_10004888 3300025931 Bacteria 8732
407 Ga0207690_10022501 3300025932 Bacteria 3923
408 Ga0207706_10017396 3300025933 Bacteria 6476
409 Ga0207706_10093282 3300025933 Bacteria 2648
410 Ga0207686_10028626 3300025934 Bacteria 3277
411 Ga0207686_10108717 3300025934 Bacteria 1866
412 Ga0207709_10008652 3300025935 Bacteria 5620
413 Ga0207670_10121973 3300025936 Unclassified 1896
414 Ga0207670_10303769 3300025936 Bacteria 1250
415 Ga0207670_10478287 3300025936 Bacteria 1008
416 Ga0207669_10000275 3300025937 Bacteria 23591
417 Ga0207669_10011700 3300025937 Bacteria 4283
418 Ga0207704_10016005 3300025938 Bacteria 3842
419 Ga0207704_10022163 3300025938 Bacteria 3397
420 Ga0207704_10087365 3300025938 Bacteria 2036
421 Ga0207665_10000541 3300025939 Bacteria 25458
422 Ga0207665_10011153 3300025939 Bacteria 5896
423 Ga0207665_10013741 3300025939 Bacteria 5325
424 Ga0207665_10403257 3300025939 Bacteria 1042
425 Ga0207691_10004396 3300025940 Bacteria 13666
426 Ga0207691_10030766 3300025940 Bacteria 5014
427 Ga0207711_10007738 3300025941 Bacteria 8978
428 Ga0207711_10021126 3300025941 Bacteria 5438
429 Ga0207711_10047684 3300025941 Bacteria 3664
430 Ga0207689_10002724 3300025942 Bacteria 16345
431 Ga0207689_10009477 3300025942 Bacteria 8407
432 Ga0207689_10576332 3300025942 Bacteria 946
433 Ga0207661_10055077 3300025944 Bacteria 3188
434 Ga0207661_10148872 3300025944 Bacteria 2022
435 Ga0207679_10001617 3300025945 Bacteria 14034
436 Ga0207679_10039424 3300025945 Bacteria 3373
437 Ga0207679_10156602 3300025945 Bacteria 1861
438 Ga0207679_10211104 3300025945 Bacteria 1628
439 Ga0207679_10235872 3300025945 Bacteria 1547
440 Ga0207679_10333306 3300025945 Bacteria 1317
441 Ga0207667_10234750 3300025949 Bacteria 1877
442 Ga0207651_10127427 3300025960 Bacteria 1942
443 Ga0207651_10292182 3300025960 Bacteria 1352
444 Ga0207712_10045788 3300025961 Bacteria 3031
445 Ga0207668_10118862 3300025972 Bacteria 1997
446 Ga0207668_10144878 3300025972 Unclassified 1831
447 Ga0207640_10005141 3300025981 Bacteria 7114
448 Ga0207658_10038686 3300025986 Bacteria 3438
449 Ga0207658_10076749 3300025986 Bacteria 2547
450 Ga0207658_10163522 3300025986 Bacteria 1826
451 Ga0207677_10044426 3300026023 Bacteria 2960
452 Ga0207677_10172528 3300026023 Bacteria 1693
453 Ga0207703_10001822 3300026035 Bacteria 19007
454 Ga0207703_10019332 3300026035 Bacteria 5322
455 Ga0207703_10511580 3300026035 Bacteria 1128
456 Ga0207639_10491558 3300026041 Bacteria 1120
457 Ga0207678_10002471 3300026067 Bacteria 16791
458 Ga0207678_10020636 3300026067 Bacteria 5775
459 Ga0207678_10020641 3300026067 Bacteria 5775
460 Ga0207678_10258142 3300026067 Unclassified 1493
461 Ga0207678_10267055 3300026067 Bacteria 1467
462 Ga0207678_10338961 3300026067 Bacteria 1295
463 Ga0207708_10001992 3300026075 Bacteria 15035
464 Ga0207702_10134688 3300026078 Bacteria 2227
465 Ga0207702_10266006 3300026078 Bacteria 1616
466 Ga0207702_10310503 3300026078 Bacteria 1499
467 Ga0207641_10013221 3300026088 Bacteria 6768
468 Ga0207641_10113659 3300026088 Bacteria 2405
469 Ga0207641_10132858 3300026088 Bacteria 2237
470 Ga0207641_10222589 3300026088 Bacteria 1750
471 Ga0207648_10004767 3300026089 Bacteria 13850
472 Ga0207648_10169900 3300026089 Bacteria 1927
473 Ga0207676_10002246 3300026095 Bacteria 13878
474 Ga0207676_10014005 3300026095 Bacteria 5758
475 Ga0207676_10541017 3300026095 Bacteria 1111
476 Ga0207674_10007733 3300026116 Bacteria 12510
477 Ga0207674_10077985 3300026116 Bacteria 3318
478 Ga0207675_100007986 3300026118 Bacteria 9973
479 Ga0207675_100131771 3300026118 Bacteria 2371
480 Ga0207683_10002044 3300026121 Bacteria 17862
481 Ga0207683_10063915 3300026121 Bacteria 3242
482 Ga0207698_10150582 3300026142 Unclassified 2018
483 Ga0207698_10483027 3300026142 Bacteria 1202
484 Ga0207698_10671905 3300026142 Bacteria 1028
485 Ga0207428_10000501 3300027907 Bacteria 46798
486 Ga0265357_1000379 3300028023 Bacteria 2483
487 Ga0268266_10003041 3300028379 Bacteria 17192
488 Ga0268266_10217814 3300028379 Bacteria 1753
489 Ga0268265_10016446 3300028380 Bacteria 5082
490 Ga0268265_10027065 3300028380 Bacteria 4088
491 Ga0268264_10339522 3300028381 Bacteria 1426
492 Ga0268264_10849295 3300028381 Bacteria 914
493 Ga0265318_10024190 3300028577 Bacteria 2412
494 Ga0265338_10028004 3300028800 Bacteria 5634
495 Ga0265338_10140153 3300028800 Bacteria 1895
496 Ga0265330_10004272 3300031235 Bacteria 7274
497 Ga0265330_10076126 3300031235 Bacteria 1448
498 Ga0265332_10000839 3300031238 Bacteria 18678
499 Ga0265332_10011394 3300031238 Bacteria 3953
500 Ga0265320_10006465 3300031240 Bacteria 7386
501 Ga0265325_10000073 3300031241 Bacteria 70109
502 Ga0265325_10001135 3300031241 Bacteria 19104
503 Ga0265325_10014684 3300031241 Bacteria 4419
504 Ga0265325_10044216 3300031241 Bacteria 2320
505 Ga0265325_10045055 3300031241 Bacteria 2294
506 Ga0265329_10012107 3300031242 Bacteria 3113
507 Ga0265329_10025533 3300031242 Bacteria 1954
508 Ga0265340_10000382 3300031247 Bacteria 23632
509 Ga0265340_10009552 3300031247 Bacteria 5201
510 Ga0265339_10001051 3300031249 Bacteria 20994
511 Ga0265339_10002691 3300031249 Bacteria 12639
512 Ga0265339_10062900 3300031249 Bacteria 1994
513 Ga0265339_10101044 3300031249 Bacteria 1501
514 Ga0265331_10019051 3300031250 Bacteria 3548
515 Ga0265331_10065609 3300031250 Bacteria 1706
516 Ga0265316_10110271 3300031344 Bacteria 2084
517 Ga0265313_10000024 3300031595 Bacteria 138587
518 Ga0265313_10000716 3300031595 Bacteria 34149
519 Ga0265313_10016138 3300031595 Bacteria 4310
520 Ga0265313_10022124 3300031595 Bacteria 3457
521 Ga0265313_10054389 3300031595 Bacteria 1901
522 Ga0265313_10085404 3300031595 Bacteria 1426
523 Ga0265314_10002492 3300031711 Bacteria 18802
524 Ga0265314_10038121 3300031711 Bacteria 3476
525 Ga0265342_10000179 3300031712 Bacteria 70615
526 Ga0265342_10000308 3300031712 Bacteria 55378
527 Ga0265342_10069743 3300031712 Bacteria 2052
528 Ga0265342_10088723 3300031712 Bacteria 1775
529 Ga0265342_10094730 3300031712 Bacteria 1708
530 Ga0265342_10104608 3300031712 Bacteria 1608
531 Ga0307409_100728911 3300031995 Bacteria 993
532 Ga0373930_0001440 3300034816 Bacteria 3539
533 Ga0373950_0002146 3300034818 Bacteria 2683
534 Ga0373950_0013499 3300034818 Bacteria 1364
535 Ga0373938_0018629 3300034957 Bacteria 1380
536 Ga0373926_0027127 3300035083 Bacteria 2005
537 Ga0373928_0005721 3300035084 Bacteria 2377
538 Ga0373928_0025134 3300035084 Bacteria 1282
539 Ga0373928_0034523 3300035084 Bacteria 1136
540 Ga0373934_0079192 3300035086 Bacteria 1319
541 Ga0373944_0021028 3300035089 Bacteria 1885
542 Ga0373949_0001783 3300035090 Bacteria 5906
543 Ga0373923_0009905 3300035111 Bacteria 3452
544 Ga0373923_0160727 3300035111 Bacteria 1025
545 Ga0373932_0088132 3300035112 Bacteria 991
546 Ga0373936_0153426 3300035113 Bacteria 999
547 Ga0373941_0003872 3300035115 Bacteria 3427
548 Ga0373941_0007122 3300035115 Bacteria 2724
549 Ga0373945_0018268 3300035116 Bacteria 2384
550 Ga0373945_0061574 3300035116 Bacteria 1402
551 Ga0373953_0002856 3300035117 Bacteria 5267
552 Ga0373954_0009066 3300035118 Bacteria 4375
553 Ga0373954_0010543 3300035118 Bacteria 4080
554 Ga0373956_0001142 3300035119 Bacteria 10971
555 Ga0373956_0050075 3300035119 Bacteria 1874
556 Ga0373956_0072650 3300035119 Bacteria 1571
557 Ga0373957_0003057 3300035120 Bacteria 4875
558 Ga0373957_0014833 3300035120 Bacteria 2670
559 Ga0373957_0028081 3300035120 Bacteria 2048
560 Ga0373960_0067388 3300035121 Bacteria 1099
561 Ga0373960_0095298 3300035121 Unclassified 957
562 Ga0373943_0007879 3300035170 Bacteria 4781
563 Ga0373943_0040473 3300035170 Bacteria 2250
564 Ga0373946_0001413 3300035171 Bacteria 8330
565 Ga0373946_0003685 3300035171 Bacteria 5427
566 Ga0373946_0133376 3300035171 Unclassified 1145
567 Ga0373955_0000504 3300035172 Bacteria 16576
568 Ga0373955_0004843 3300035172 Bacteria 6000
569 Ga0373955_0006423 3300035172 Bacteria 5356
570 Ga0373955_0118923 3300035172 Bacteria 1534
571 Ga0373961_0019628 3300035241 Bacteria 1778
572 Ga0373962_0010443 3300035242 Bacteria 2315
573 Ga0373924_0000932 3300035410 Bacteria 9223
574 Ga0373931_0045780 3300035691 Bacteria 2311
575 Ga0373931_0093004 3300035691 Bacteria 1683
576 Ga0373935_0000038 3300035692 Bacteria 51446
577 Ga0373935_0036156 3300035692 Bacteria 3086
578 Ga0373935_0117686 3300035692 Bacteria 1771
579 Ga0373935_0201173 3300035692 Bacteria 1376
580 Ga0373927_0008438 3300035695 Bacteria 6928
581 Ga0373927_0129562 3300035695 Bacteria 1647
582 Ga0373927_0307177 3300035695 Bacteria 1044
583 Ga0373927_0434125 3300035695 Bacteria 867
584 Ga0373933_0007752 3300035724 Bacteria 5864
585 Ga0373933_0011420 3300035724 Bacteria 4894
586 Ga0373933_0020352 3300035724 Bacteria 3761
587 Ga0373947_0000229 3300035725 Bacteria 31423
588 Ga0373947_0009320 3300035725 Bacteria 5640
589 Ga0373947_0027554 3300035725 Bacteria 3326
590 Ga0373947_0097450 3300035725 Bacteria 1843
591 Ga0373947_0140882 3300035725 Bacteria 1546
592 Ga0373937_0000004 3300036401 Bacteria 212269
593 Ga0373937_0000655 3300036401 Bacteria 30381
594 Ga0373937_0009675 3300036401 Bacteria 8398
595 Ga0373937_0053957 3300036401 Bacteria 3687
596 Ga0373937_0074055 3300036401 Bacteria 3142
597 Ga0373937_0261283 3300036401 Bacteria 1633
598 Ga0373937_0497149 3300036401 Bacteria 1159
599 Ga0373937_0672259 3300036401 Bacteria 981
600 Ga0373925_0000424 3300037068 Bacteria 42803
601 Ga0373925_0017194 3300037068 Bacteria 5238
602 Ga0373925_0030232 3300037068 Bacteria 3976
603 Ga0373925_0032039 3300037068 Bacteria 3867
604 Ga0373925_0155975 3300037068 Bacteria 1795
605 Ga0373925_0254939 3300037068 Bacteria 1408
606 Ga0395898_0326517 3300037466 Bacteria 1463
607 Ga0436365_0076921 3300039437 Bacteria 40502
608 Ga0436365_0432047 3300039437 Bacteria 2497
609 Ga0436365_0960142 3300039437 Bacteria 882
610 Ga0436360_0780623 3300039438 Bacteria 1035
611 Ga0436361_0685960 3300039447 Bacteria 1426
612 Ga0439453_0000181 3300041408 Bacteria 5943
613 Ga0451798_0958274 3300041458 Bacteria 826
614 Ga0451853_4041355 3300041512 Bacteria 2370
615 Ga0439443_000550 3300042003 Bacteria 3424
616 Ga0439446_0063269 3300042156 Bacteria 1121
617 Ga0439435_0000899 3300042436 Bacteria 5123
618 Ga0466966_0088104 3300044684 Bacteria 1929
619 Ga0466963_0005670 3300044694 Bacteria 7334
620 Ga0466963_0137821 3300044694 Bacteria 1689
621 Ga0466963_0418771 3300044694 Bacteria 945
622 Ga0466964_0158830 3300044706 Bacteria 1055
623 Ga0466957_0015548 3300044842 Bacteria 4445
624 Ga0466957_0420031 3300044842 Bacteria 917
625 Ga0466958_0015838 3300045836 Bacteria 4331
626 Ga0466967_0031688 3300045976 Bacteria 4454
627 Ga0466967_0033052 3300045976 Bacteria 4376
628 Ga0495627_039797 3300046453 Bacteria 1449
629 Ga0495592_0000032 3300046454 Bacteria 128274
630 Ga0495629_0001232 3300046459 Bacteria 20103
631 Ga0495629_0001465 3300046459 Bacteria 18592
632 Ga0495629_0107794 3300046459 Bacteria 1943
633 Ga0495638_0058828 3300046460 Bacteria 2381
634 Ga0495641_0010900 3300046461 Bacteria 5225
635 Ga0495651_0000799 3300046462 Bacteria 24378
636 Ga0495653_0000012 3300046463 Bacteria 266880
637 Ga0495653_0448518 3300046463 Bacteria 812
638 Ga0495580_0377740 3300046472 Bacteria 957
639 Ga0495582_0000570 3300046473 Bacteria 20403
640 Ga0495582_0031519 3300046473 Bacteria 2914
641 Ga0495605_0055488 3300046474 Bacteria 1914
642 Ga0495639_0027847 3300046475 Bacteria 2502
643 Ga0495639_0084793 3300046475 Bacteria 1480
644 Ga0495662_0032039 3300046476 Bacteria 2539
645 Ga0495662_0191079 3300046476 Bacteria 1010
646 Ga0495662_0191517 3300046476 Bacteria 1008
647 Ga0495664_0000004 3300046477 Bacteria 489411
648 Ga0495584_0040744 3300046491 Bacteria 2345
649 Ga0495584_0041179 3300046491 Bacteria 2332
650 Ga0495584_0124009 3300046491 Bacteria 1309
651 Ga0495594_0083376 3300046499 Bacteria 1787
652 Ga0495596_0108968 3300046500 Bacteria 1075
653 Ga0495608_0000017 3300046511 Bacteria 192929
654 Ga0495608_0009665 3300046511 Bacteria 6728
655 Ga0495618_0000006 3300046514 Bacteria 229906
656 Ga0495618_0019785 3300046514 Bacteria 4143
657 Ga0495628_0000001 3300046516 Bacteria 917742
658 Ga0495628_0004103 3300046516 Bacteria 12959
659 Ga0495630_0005871 3300046517 Bacteria 8684
660 Ga0495630_0017154 3300046517 Bacteria 5301
661 Ga0495630_0093365 3300046517 Bacteria 2274
662 Ga0495630_0131230 3300046517 Bacteria 1903
663 Ga0495637_0053136 3300046520 Bacteria 1688
664 Ga0495644_0041322 3300046523 Bacteria 1737
665 Ga0495666_0040048 3300046526 Bacteria 2273
666 Ga0495666_0159086 3300046526 Bacteria 1048
667 Ga0495652_0000002 3300046529 Bacteria 946606
668 Ga0495652_0027665 3300046529 Bacteria 4994
669 Ga0495652_0297466 3300046529 Bacteria 1175
670 Ga0495665_0032202 3300046531 Bacteria 2804
671 Ga0495640_0000001 3300046533 Bacteria 853827
672 Ga0495640_0008218 3300046533 Bacteria 8189
673 Ga0495640_0017302 3300046533 Bacteria 5375
674 Ga0495586_0082644 3300046535 Bacteria 1766
675 Ga0495586_0199705 3300046535 Bacteria 1133
676 Ga0495587_0000008 3300046536 Bacteria 271097
677 Ga0495587_0009997 3300046536 Bacteria 6057
678 Ga0495598_0001843 3300046537 Bacteria 4269
679 Ga0495645_0000002 3300046543 Bacteria 651644
680 Ga0495645_0044935 3300046543 Bacteria 3221
681 Ga0495633_0053006 3300046558 Bacteria 1910
682 Ga0495667_0000124 3300046559 Bacteria 55660
683 Ga0495667_0003621 3300046559 Bacteria 10387
684 Ga0495667_0020065 3300046559 Bacteria 4509
685 Ga0495656_0004314 3300046615 Bacteria 4861
686 Ga0495656_0007363 3300046615 Bacteria 3886
687 Ga0495634_0000003 3300046642 Bacteria 206222
688 Ga0495634_0057544 3300046642 Bacteria 2594
689 Ga0495634_0214514 3300046642 Bacteria 1190
690 Ga0495635_0000002 3300046663 Bacteria 490490
691 Ga0495635_0011233 3300046663 Bacteria 6278
692 Ga0495588_0055920 3300046674 Bacteria 2037
693 Ga0495657_0000054 3300046675 Bacteria 99620
694 Ga0495657_0005238 3300046675 Bacteria 10267
695 Ga0495657_0148490 3300046675 Bacteria 1457
696 Ga0495599_0000005 3300046678 Bacteria 300169
697 Ga0495599_0010640 3300046678 Bacteria 5630
698 Ga0495623_0000148 3300046679 Bacteria 43192
699 Ga0495623_0010769 3300046679 Bacteria 5921
700 Ga0495646_0000002 3300046680 Bacteria 310568
701 Ga0495647_0004214 3300046681 Bacteria 4657
702 Ga0495658_0000237 3300046683 Bacteria 31696
703 Ga0495658_0002178 3300046683 Bacteria 9911
704 Ga0495658_0006226 3300046683 Bacteria 5863
705 Ga0495658_0070105 3300046683 Bacteria 2033
706 Ga0495658_0218450 3300046683 Bacteria 1193
707 Ga0495669_0033891 3300046684 Bacteria 2250
708 Ga0495669_0109873 3300046684 Bacteria 1287
709 Ga0495613_0103162 3300046689 Bacteria 2059
710 Ga0495624_0026442 3300046690 Bacteria 3803
711 Ga0495624_0063231 3300046690 Bacteria 2313
712 Ga0495624_0066333 3300046690 Bacteria 2253
713 Ga0495624_0336260 3300046690 Bacteria 909
714 Ga0495670_0011251 3300046691 Bacteria 4398
715 Ga0495671_0025087 3300046692 Bacteria 3101
716 Ga0495589_0046648 3300046794 Bacteria 2150
717 Ga0495589_0069097 3300046794 Bacteria 1728
718 Ga0495600_0000012 3300046809 Bacteria 119798
719 Ga0495600_0057999 3300046809 Bacteria 2529
720 Ga0495600_0060644 3300046809 Bacteria 2470
721 Ga0495660_0170585 3300046810 Bacteria 1060
722 Ga0495581_0019117 3300047315 Bacteria 3977
723 Ga0495581_0300835 3300047315 Bacteria 937
724 Ga0495604_0000009 3300047317 Bacteria 326341
725 Ga0495604_0174391 3300047317 Bacteria 1509
726 Ga0495604_0211351 3300047317 Bacteria 1340
727 Ga0495674_0000002 3300047319 Bacteria 642785
728 Ga0495674_0047745 3300047319 Bacteria 3793
729 Ga0495674_0086497 3300047319 Bacteria 2684
730 Ga0495672_0175556 3300047320 Bacteria 1089
731 Ga0495676_0119787 3300047321 Bacteria 1916
732 Ga0495676_0158133 3300047321 Bacteria 1606
733 Ga0495680_0001385 3300047322 Bacteria 26203
734 Ga0495680_0012328 3300047322 Bacteria 7529
735 Ga0495680_0018500 3300047322 Bacteria 5910
736 Ga0495680_0097090 3300047322 Bacteria 2200
737 Ga0495675_0000028 3300047444 Bacteria 105848
738 Ga0495684_0000006 3300047471 Bacteria 247568
739 Ga0495684_0047360 3300047471 Bacteria 3288
740 Ga0495684_0196638 3300047471 Bacteria 1488
741 Ga0495684_0339281 3300047471 Unclassified 1070
742 Ga0495684_0343927 3300047471 Bacteria 1061
743 Ga0495593_0000140 3300047673 Bacteria 35205
744 Ga0495593_0057150 3300047673 Bacteria 2049
745 Ga0495593_0179692 3300047673 Bacteria 1066
746 Ga0495602_0000005 3300048088 Bacteria 325957
747 Ga0495602_0013847 3300048088 Bacteria 8223
748 Ga0495614_0051122 3300048089 Bacteria 1771
749 Ga0495626_0130530 3300048091 Bacteria 1073
750 Ga0496100_0003363 3300048903 Bacteria 8326
751 Ga0496100_0015869 3300048903 Bacteria 4409
752 Ga0496100_0041015 3300048903 Bacteria 2948
753 Ga0496100_0098257 3300048903 Bacteria 2012
754 Ga0496100_0169228 3300048903 Bacteria 1572
755 Ga0496100_0445511 3300048903 Unclassified 992
756 Ga0496101_0001983 3300048904 Bacteria 12419
757 Ga0496101_0023889 3300048904 Bacteria 4226
758 Ga0496101_0095327 3300048904 Bacteria 2219
759 Ga0496101_0362825 3300048904 Bacteria 1139
760 Ga0496102_0002793 3300048905 Bacteria 14888
761 Ga0496102_0016941 3300048905 Bacteria 6377
762 Ga0496102_0028300 3300048905 Bacteria 5005
763 Ga0496102_0039250 3300048905 Bacteria 4277
764 Ga0496102_0090073 3300048905 Bacteria 2838
765 Ga0496102_0573841 3300048905 Bacteria 1051
766 Ga0496103_0002369 3300048906 Bacteria 11883
767 Ga0496103_0020793 3300048906 Bacteria 3945
768 Ga0496103_0021619 3300048906 Bacteria 3871
769 Ga0496103_0120987 3300048906 Bacteria 1667
770 Ga0496104_0000092 3300048907 Bacteria 87232
771 Ga0496104_0018299 3300048907 Bacteria 6392
772 Ga0496104_0053307 3300048907 Bacteria 3820
773 Ga0496104_0099636 3300048907 Bacteria 2781
774 Ga0496104_0122512 3300048907 Bacteria 2496
775 Ga0496104_0225839 3300048907 Bacteria 1784
776 Ga0496104_0563007 3300048907 Bacteria 1050
777 Ga0496105_0002505 3300048908 Bacteria 13315
778 Ga0496105_0004200 3300048908 Bacteria 10816
779 Ga0496105_0007082 3300048908 Bacteria 8644
780 Ga0496105_0501735 3300048908 Bacteria 952
781 Ga0496105_0501954 3300048908 Unclassified 952
782 Ga0496105_0547419 3300048908 Bacteria 903
783 Ga0496106_0007123 3300048909 Bacteria 8258
784 Ga0496106_0010646 3300048909 Bacteria 6795
785 Ga0496106_0020424 3300048909 Bacteria 4915
786 Ga0496106_0086476 3300048909 Bacteria 2414
787 Ga0496106_0113396 3300048909 Bacteria 2113
788 Ga0496107_0005855 3300048910 Bacteria 8416
789 Ga0496107_0019014 3300048910 Bacteria 4844
790 Ga0496107_0057547 3300048910 Bacteria 2810
791 Ga0496107_0084405 3300048910 Bacteria 2317
792 Ga0496107_0113311 3300048910 Bacteria 1994
793 Ga0496107_0175623 3300048910 Unclassified 1590
794 Ga0496107_0295982 3300048910 Bacteria 1204
795 Ga0496108_0000951 3300048911 Bacteria 22499
796 Ga0496108_0009284 3300048911 Bacteria 7960
797 Ga0496108_0017326 3300048911 Bacteria 5892
798 Ga0496109_0004879 3300048912 Bacteria 11202
799 Ga0496109_0010573 3300048912 Bacteria 7892
800 Ga0496109_0017589 3300048912 Bacteria 6269
801 Ga0496109_0109183 3300048912 Bacteria 2571
802 Ga0496109_0120779 3300048912 Bacteria 2441
803 Ga0496109_0132660 3300048912 Bacteria 2326
804 Ga0496109_0255984 3300048912 Bacteria 1649
805 Ga0496110_0010330 3300048913 Bacteria 7588
806 Ga0496110_0025021 3300048913 Bacteria 5096
807 Ga0496110_0047745 3300048913 Bacteria 3750
808 Ga0496110_0064482 3300048913 Bacteria 3238
809 Ga0496110_0106657 3300048913 Bacteria 2514
810 Ga0496110_0178571 3300048913 Bacteria 1927
811 Ga0496111_0002467 3300048914 Bacteria 11163
812 Ga0496111_0015671 3300048914 Bacteria 5209
813 Ga0496111_0037699 3300048914 Bacteria 3460
814 Ga0496111_0077159 3300048914 Bacteria 2429
815 Ga0496111_0093737 3300048914 Bacteria 2202
816 Ga0496111_0206953 3300048914 Bacteria 1458
817 Ga0496112_0007378 3300048915 Bacteria 9759
818 Ga0496112_0023680 3300048915 Bacteria 5872
819 Ga0496112_0027458 3300048915 Bacteria 5487
820 Ga0496112_0060168 3300048915 Bacteria 3742
821 Ga0496112_0179824 3300048915 Bacteria 2079
822 Ga0496112_0297778 3300048915 Bacteria 1559
823 Ga0496112_0517234 3300048915 Bacteria 1128
824 Ga0496113_0000043 3300048916 Bacteria 52544
825 Ga0496113_0004559 3300048916 Bacteria 8532
826 Ga0496113_0022484 3300048916 Bacteria 4461
827 Ga0496113_0048900 3300048916 Bacteria 3147
828 Ga0496113_0113175 3300048916 Bacteria 2115
829 Ga0496113_0390828 3300048916 Bacteria 1116
830 Ga0496114_0036470 3300048917 Bacteria 4065
831 Ga0496114_0064599 3300048917 Bacteria 3065
832 Ga0496114_0087094 3300048917 Bacteria 2647
833 Ga0496114_0144870 3300048917 Bacteria 2059
834 Ga0496114_0765122 3300048917 Bacteria 843
835 Ga0496115_0002647 3300048918 Bacteria 12855
836 Ga0496115_0003701 3300048918 Bacteria 11002
837 Ga0496115_0008385 3300048918 Bacteria 7647
838 Ga0496115_0037995 3300048918 Bacteria 3819
839 Ga0496115_0076178 3300048918 Bacteria 2726
840 Ga0496115_0211523 3300048918 Bacteria 1601
841 Ga0496115_0342819 3300048918 Unclassified 1219
842 Ga0496118_0020061 3300048921 Bacteria 5944
843 Ga0496125_0071564 3300048928 Bacteria 2708
844 Ga0496126_0158448 3300048929 Bacteria 1936
845 Ga0501031_0045785 3300049568 Bacteria 2854
846 Ga0501032_0142322 3300049569 Bacteria 1579
847 Ga0501032_0153501 3300049569 Bacteria 1513
848 Ga0501032_0197791 3300049569 Bacteria 1312
849 Ga0501033_0059998 3300049570 Bacteria 2807
850 Ga0501033_0100363 3300049570 Bacteria 2112
851 Ga0501034_0022311 3300049571 Bacteria 6453
852 Ga0501034_0025437 3300049571 Bacteria 6026
853 Ga0501034_0057724 3300049571 Bacteria 3901
854 Ga0501034_0081484 3300049571 Bacteria 3238
855 Ga0501034_0479055 3300049571 Bacteria 1160
856 Ga0501036_0000177 3300049572 Bacteria 41942
857 Ga0501036_0004805 3300049572 Bacteria 10920
858 Ga0501036_0035608 3300049572 Bacteria 4211
859 Ga0501036_0037074 3300049572 Bacteria 4124
860 Ga0501036_0049253 3300049572 Bacteria 3567
861 Ga0501036_0191676 3300049572 Bacteria 1720
862 Ga0501037_0001926 3300049573 Bacteria 15044
863 Ga0501037_0007004 3300049573 Bacteria 8232
864 Ga0501038_0013458 3300049574 Bacteria 7457
865 Ga0501038_0176621 3300049574 Bacteria 1725
866 Ga0501038_0221024 3300049574 Bacteria 1511
867 Ga0501039_0073837 3300049575 Bacteria 2650
868 Ga0501039_0117190 3300049575 Bacteria 2085
869 Ga0501039_0183775 3300049575 Bacteria 1644
870 Ga0501041_0026039 3300049577 Bacteria 3516
871 Ga0501041_0552573 3300049577 Bacteria 734
872 Ga0501043_0008320 3300049579 Bacteria 8168
873 Ga0501043_0022538 3300049579 Bacteria 4938
874 Ga0501043_0024067 3300049579 Bacteria 4778
875 Ga0501046_0008241 3300049580 Bacteria 9099
876 Ga0501046_0013329 3300049580 Bacteria 6965
877 Ga0501046_0037763 3300049580 Bacteria 3880
878 Ga0501047_0000756 3300049581 Bacteria 33738
879 Ga0501047_0056933 3300049581 Bacteria 3781
880 Ga0501047_0086785 3300049581 Bacteria 3007
881 Ga0501047_0090581 3300049581 Bacteria 2935
882 Ga0501048_0000357 3300049582 Bacteria 31694
883 Ga0501048_0009539 3300049582 Bacteria 7285
884 Ga0501048_0277758 3300049582 Bacteria 1191
885 Ga0501067_0065035 3300049583 Bacteria 2019
886 Ga0501068_0002385 3300049584 Bacteria 9988
887 Ga0501068_0022450 3300049584 Bacteria 3690
888 Ga0501068_0067385 3300049584 Bacteria 2181
889 Ga0501068_0167547 3300049584 Bacteria 1386
890 Ga0501069_0000659 3300049585 Bacteria 16060
891 Ga0501069_0030171 3300049585 Bacteria 2977
892 Ga0501069_0140591 3300049585 Bacteria 1385
893 Ga0501070_0000711 3300049586 Bacteria 30493
894 Ga0501070_0021174 3300049586 Bacteria 5457
895 Ga0501070_0059888 3300049586 Bacteria 3156
896 Ga0501070_0123837 3300049586 Bacteria 2136
897 Ga0501070_0168615 3300049586 Bacteria 1804
898 Ga0501070_0228060 3300049586 Bacteria 1526
899 Ga0501071_0037406 3300049587 Bacteria 3466
900 Ga0501071_0049661 3300049587 Bacteria 3020
901 Ga0501071_0100595 3300049587 Bacteria 2131
902 Ga0501071_0125061 3300049587 Bacteria 1908
903 Ga0501071_0287214 3300049587 Bacteria 1245
904 Ga0501073_0022644 3300049589 Bacteria 4521
905 Ga0501073_0027377 3300049589 Bacteria 4076
906 Ga0501073_0043280 3300049589 Bacteria 3175
907 Ga0501073_0053332 3300049589 Bacteria 2831
908 Ga0501073_0213810 3300049589 Bacteria 1332
909 Ga0501074_0003367 3300049590 Bacteria 11324
910 Ga0501074_0025506 3300049590 Bacteria 4292
911 Ga0501074_0091376 3300049590 Bacteria 2180
912 Ga0501074_0179723 3300049590 Bacteria 1509
913 Ga0501074_0285235 3300049590 Bacteria 1173
914 Ga0501076_0004238 3300049592 Bacteria 10148
915 Ga0501076_0146074 3300049592 Unclassified 1923
916 Ga0501077_0046016 3300049593 Bacteria 2772
917 Ga0501079_0066503 3300049741 Bacteria 2781
918 Ga0501079_0184899 3300049741 Bacteria 1627
919 Ga0501079_0513541 3300049741 Bacteria 942
920 Ga0501079_0563086 3300049741 Bacteria 896
921 Ga0501080_0003552 3300049742 Bacteria 13734
922 Ga0501080_0012302 3300049742 Bacteria 7840
923 Ga0501080_0335063 3300049742 Bacteria 1368
924 Ga0501083_0007330 3300049744 Bacteria 7822
925 Ga0501083_0009300 3300049744 Bacteria 6937
926 Ga0501083_0045559 3300049744 Bacteria 2967
927 Ga0501083_0049616 3300049744 Bacteria 2828
928 Ga0501083_0089402 3300049744 Bacteria 2035
929 Ga0501083_0238909 3300049744 Bacteria 1183
930 Ga0501083_0246018 3300049744 Bacteria 1164
931 Ga0501035_0000703 3300049822 Bacteria 36519
932 Ga0501035_0014587 3300049822 Bacteria 7252
933 Ga0501035_0383105 3300049822 Bacteria 1172
934 Ga0501044_0009505 3300049823 Bacteria 10587
935 Ga0501044_0012398 3300049823 Bacteria 9228
936 Ga0501044_0028947 3300049823 Bacteria 5843
937 Ga0501044_0063013 3300049823 Bacteria 3789
938 Ga0501044_0246637 3300049823 Bacteria 1728
939 nmdc:mga03683_12606_c1 3300050489 Bacteria 3093
940 nmdc:mga03n38_134547_c1 3300050490 Bacteria 1229
941 nmdc:mga00v17_123895_c1 3300050491 Bacteria 1648
942 nmdc:mga00v17_43279_c1 3300050491 Bacteria 2711
943 nmdc:mga0yw44_10242_c2 3300050492 Bacteria 4376
944 nmdc:mga0yw44_1073_c2 3300050492 Bacteria 3816
945 nmdc:mga0yw44_28448_c1 3300050492 Bacteria 3215
946 nmdc:mga0yw44_339340_c1 3300050492 Bacteria 1010
947 nmdc:mga0yw44_813_c1 3300050492 Bacteria 11629
948 nmdc:mga0k408_102437_c1 3300050493 Bacteria 1688
949 nmdc:mga0k408_60181_c1 3300050493 Bacteria 2207
950 nmdc:mga07m45_133038_c1 3300050496 Bacteria 1439
951 nmdc:mga05p37_23570_c1 3300050507 Bacteria 7469
952 nmdc:mga05p37_6119_c1 3300050507 Bacteria 14175
953 nmdc:mga05p37_656200_c1 3300050507 Bacteria 1174
954 nmdc:mga05p37_66476_c1 3300050507 Bacteria 4435
955 nmdc:mga06r32_142613_c1 3300050510 Bacteria 2373
956 nmdc:mga06r32_215584_c1 3300050510 Bacteria 1333
957 nmdc:mga06r32_457892_c1 3300050510 Bacteria 1255
958 nmdc:mga06r32_473174_c1 3300050510 Bacteria 1231
959 nmdc:mga06r32_673857_c1 3300050510 Bacteria 1001
960 nmdc:mga08y16_100861_c1 3300050511 Bacteria 3005
961 nmdc:mga08y16_218924_c1 3300050511 Bacteria 1971
962 nmdc:mga08y16_281693_c1 3300050511 Bacteria 1715
963 nmdc:mga08y16_53580_c1 3300050511 Bacteria 4218
964 nmdc:mga08y16_68582_c1 3300050511 Bacteria 3697
965 nmdc:mga08y16_7940_c1 3300050511 Bacteria 11107
966 nmdc:mga0n895_128932_c1 3300050512 Bacteria 2554
967 nmdc:mga0n895_138128_c1 3300050512 Bacteria 2464
968 nmdc:mga0n895_212807_c1 3300050512 Bacteria 1963
969 nmdc:mga0n895_346872_c1 3300050512 Unclassified 1504
970 nmdc:mga0n895_70607_c1 3300050512 Bacteria 3461
971 nmdc:mga0n895_80372_c1 3300050512 Bacteria 3248
972 nmdc:mga0rr50_114313_c1 3300050513 Bacteria 2140
973 nmdc:mga0rr50_183946_c1 3300050513 Bacteria 1709
974 nmdc:mga0rr50_244589_c1 3300050513 Bacteria 1488
975 nmdc:mga0rr50_36677_c1 3300050513 Bacteria 3533
976 nmdc:mga0rr50_443475_c1 3300050513 Bacteria 1100
977 nmdc:mga0rr50_73707_c1 3300050513 Bacteria 2611
978 nmdc:mga08x19_140409_c1 3300050514 Bacteria 1631
979 nmdc:mga08x19_272733_c1 3300050514 Bacteria 1171
980 nmdc:mga08x19_4943_c1 3300050514 Bacteria 7874
981 nmdc:mga0a205_19073_c1 3300050515 Bacteria 6463
982 nmdc:mga0a205_30953_c1 3300050515 Bacteria 5126
983 nmdc:mga0a205_329112_c1 3300050515 Bacteria 1398
984 nmdc:mga0a205_439085_c1 3300050515 Bacteria 1166
985 Ga0495601_0000002 3300053077 Bacteria 528704
986 Ga0495601_0001735 3300053077 Bacteria 12053
987 Ga0495601_0013626 3300053077 Bacteria 4891
988 Ga0495601_0031821 3300053077 Bacteria 3280
989 Ga0495612_0000010 3300053078 Bacteria 227618
990 Ga0495612_0024655 3300053078 Bacteria 2414
991 Ga0495612_0043876 3300053078 Bacteria 1828
992 Ga0495612_0274639 3300053078 Bacteria 752
993 Ga0495595_0000026 3300053084 Bacteria 99949
994 Ga0495595_0007500 3300053084 Bacteria 4468
995 Ga0495595_0050761 3300053084 Bacteria 1922
996 Ga0495595_0071510 3300053084 Bacteria 1640
997 Ga0495595_0161542 3300053084 Bacteria 1105
998 Ga0495619_0000019 3300053085 Bacteria 209518
999 Ga0495619_0000484 3300053085 Bacteria 26647
1000 Ga0495619_0072501 3300053085 Bacteria 2306
1001 Ga0495619_0091849 3300053085 Bacteria 2055
1002 Ga0495619_0222827 3300053085 Bacteria 1306
1003 Ga0500643_000042 3300053087 Bacteria 158933
1004 Ga0500643_001251 3300053087 Bacteria 15060
1005 Ga0500644_0000533 3300053088 Bacteria 15780
1006 Ga0500646_0036379 3300053090 Bacteria 1371
1007 Ga0500647_0013260 3300053091 Bacteria 3725
1008 Ga0500651_0001643 3300053093 Bacteria 11381
1009 Ga0500557_000006 3300053105 Bacteria 141252
1010 Ga0500595_000002 3300053119 Bacteria 1074388
1011 Ga0500595_007280 3300053119 Bacteria 4596
1012 Ga0500642_0000040 3300053130 Bacteria 96160
1013 Ga0500652_000005 3300053131 Bacteria 171538
1014 Ga0500604_0017874 3300053151 Bacteria 1969
1015 Ga0500616_0000002 3300053153 Bacteria 1611257
1016 Ga0500636_0060032 3300053177 Bacteria 2221
1017 Ga0500636_0268572 3300053177 Bacteria 859
1018 Ga0500645_000156 3300053730 Bacteria 53110
1019 Ga0501084_0013592 3300054114 Bacteria 6737
1020 Ga0501084_0067860 3300054114 Bacteria 2985
1021 Ga0501084_0129722 3300054114 Bacteria 2122
1022 Ga0501084_0211552 3300054114 Bacteria 1636
1023 Ga0501082_0000285 3300060353 Bacteria 44550
1024 Ga0501082_0038227 3300060353 Bacteria 4141
1025 Ga0501082_0509380 3300060353 Bacteria 1052
1026 Ga0501082_0747162 3300060353 Bacteria 856
1027 Ga0466962_0083171 3300061719 Bacteria 1531
1028 Ga0530510_0392921 3300061734 Bacteria 1045

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050510 nmdc:mga06r32_473174_c1 nmdc:mga06r32_473174_c1_556_1200 161
2 3300050513 nmdc:mga0rr50_114313_c1 nmdc:mga0rr50_114313_c1_22_666 161
3 3300049572 Ga0501036_0037074 Ga0501036_0037074_693_1460 180
4 3300049823 Ga0501044_0246637 Ga0501044_0246637_206_973 180
5 3300049577 Ga0501041_0552573 Ga0501041_0552573_78_722 185
6 3300005455 Ga0070663_100486178 Ga0070663_1004861781 192
7 3300005615 Ga0070702_100045550 Ga0070702_1000455503 192
8 3300006358 Ga0068871_100124129 Ga0068871_1001241292 192
9 3300026067 Ga0207678_10258142 Ga0207678_102581423 192
10 3300035121 Ga0373960_0095298 Ga0373960_0095298_120_887 192
11 3300035691 Ga0373931_0045780 Ga0373931_0045780_1082_1849 192
12 3300048903 Ga0496100_0445511 Ga0496100_0445511_46_813 192
13 3300048908 Ga0496105_0501954 Ga0496105_0501954_113_880 192
14 3300048909 Ga0496106_0113396 Ga0496106_0113396_39_806 192
15 3300048910 Ga0496107_0175623 Ga0496107_0175623_74_841 192
16 3300048918 Ga0496115_0342819 Ga0496115_0342819_155_922 192
17 3300035695 Ga0373927_0008438 Ga0373927_0008438_4868_5635 193
18 3300005330 Ga0070690_100092134 Ga0070690_1000921341 194
19 3300005937 Ga0081455_10000081 Ga0081455_1000008155 194
20 3300009098 Ga0105245_10004787 Ga0105245_100047873 194
21 3300009177 Ga0105248_10237669 Ga0105248_102376692 194
22 3300025915 Ga0207693_10113805 Ga0207693_101138052 194
23 3300035116 Ga0373945_0061574 Ga0373945_0061574_245_1012 194
24 3300035695 Ga0373927_0434125 Ga0373927_0434125_59_823 194
25 3300035725 Ga0373947_0027554 Ga0373947_0027554_1405_2172 194
26 3300037068 Ga0373925_0030232 Ga0373925_0030232_1250_2017 194
27 3300037068 Ga0373925_0032039 Ga0373925_0032039_2658_3422 194
28 3300046476 Ga0495662_0191517 Ga0495662_0191517_212_976 194
29 3300046517 Ga0495630_0131230 Ga0495630_0131230_640_1407 194
30 3300046531 Ga0495665_0032202 Ga0495665_0032202_910_1677 194
31 3300046533 Ga0495640_0017302 Ga0495640_0017302_3838_4602 194
32 3300046535 Ga0495586_0082644 Ga0495586_0082644_823_1590 194
33 3300046615 Ga0495656_0007363 Ga0495656_0007363_2548_3315 194
34 3300046642 Ga0495634_0214514 Ga0495634_0214514_265_1029 194
35 3300046683 Ga0495658_0002178 Ga0495658_0002178_7573_8340 194
36 3300047319 Ga0495674_0086497 Ga0495674_0086497_158_919 194
37 3300005435 Ga0070714_100263447 Ga0070714_1002634472 195
38 3300054114 Ga0501084_0067860 Ga0501084_0067860_404_1159 196
39 3300005616 Ga0068852_100024049 Ga0068852_1000240492 197
40 3300006844 Ga0075428_100863425 Ga0075428_1008634251 197
41 3300041408 Ga0439453_0000181 Ga0439453_0000181_4970_5725 197
42 3300042003 Ga0439443_000550 Ga0439443_000550_1218_1973 197
43 3300042436 Ga0439435_0000899 Ga0439435_0000899_4129_4884 197
44 3300060353 Ga0501082_0000285 Ga0501082_0000285_41007_41762 197
45 3300003203 JGI25406J46586_10006738 JGI25406J46586_100067386 198
46 3300005985 Ga0081539_10001260 Ga0081539_1000126024 198
47 3300006048 Ga0075363_100067153 Ga0075363_1000671533 198
48 3300006051 Ga0075364_10010606 Ga0075364_100106066 198
49 3300006177 Ga0075362_10004834 Ga0075362_100048346 198
50 3300031711 Ga0265314_10002492 Ga0265314_1000249213 198
51 3300046558 Ga0495633_0053006 Ga0495633_0053006_1043_1810 198
52 3300049569 Ga0501032_0197791 Ga0501032_0197791_237_920 198
53 3300049570 Ga0501033_0059998 Ga0501033_0059998_1885_2568 198
54 3300049571 Ga0501034_0025437 Ga0501034_0025437_5282_5965 198
55 3300049572 Ga0501036_0004805 Ga0501036_0004805_183_866 198
56 3300049573 Ga0501037_0001926 Ga0501037_0001926_5590_6273 198
57 3300049575 Ga0501039_0073837 Ga0501039_0073837_257_940 198
58 3300049580 Ga0501046_0008241 Ga0501046_0008241_7754_8437 198
59 3300049581 Ga0501047_0090581 Ga0501047_0090581_1885_2568 198
60 3300049582 Ga0501048_0009539 Ga0501048_0009539_1321_2004 198
61 3300049584 Ga0501068_0002385 Ga0501068_0002385_8447_9130 198
62 3300049585 Ga0501069_0000659 Ga0501069_0000659_14667_15350 198
63 3300049587 Ga0501071_0049661 Ga0501071_0049661_1260_1943 198
64 3300049589 Ga0501073_0027377 Ga0501073_0027377_199_882 198
65 3300049590 Ga0501074_0003367 Ga0501074_0003367_5695_6378 198
66 3300049741 Ga0501079_0066503 Ga0501079_0066503_2038_2721 198
67 3300049744 Ga0501083_0049616 Ga0501083_0049616_86_841 198
68 3300049822 Ga0501035_0014587 Ga0501035_0014587_1885_2568 198
69 3300049823 Ga0501044_0012398 Ga0501044_0012398_791_1474 198
70 3300049823 Ga0501044_0063013 Ga0501044_0063013_1538_2221 198
71 3300050489 nmdc:mga03683_12606_c1 nmdc:mga03683_12606_c1_1754_2509 198
72 3300050490 nmdc:mga03n38_134547_c1 nmdc:mga03n38_134547_c1_429_1184 198
73 3300050493 nmdc:mga0k408_60181_c1 nmdc:mga0k408_60181_c1_420_1175 198
74 3300053084 Ga0495595_0071510 Ga0495595_0071510_210_968 198
75 3300054114 Ga0501084_0013592 Ga0501084_0013592_1630_2313 198
76 3300005327 Ga0070658_10073615 Ga0070658_100736153 199
77 3300005336 Ga0070680_100035104 Ga0070680_1000351044 199
78 3300005339 Ga0070660_100036099 Ga0070660_1000360993 199
79 3300005530 Ga0070679_100103442 Ga0070679_1001034423 199
80 3300005563 Ga0068855_100263615 Ga0068855_1002636152 199
81 3300007788 Ga0099795_10021163 Ga0099795_100211632 199
82 3300010159 Ga0099796_10002132 Ga0099796_100021324 199
83 3300025909 Ga0207705_10252777 Ga0207705_102527772 199
84 3300025917 Ga0207660_10108359 Ga0207660_101083592 199
85 3300025919 Ga0207657_10007818 Ga0207657_1000781810 199
86 3300025921 Ga0207652_10040807 Ga0207652_100408074 199
87 3300025949 Ga0207667_10234750 Ga0207667_102347502 199
88 3300026078 Ga0207702_10266006 Ga0207702_102660063 199
89 3300031249 Ga0265339_10101044 Ga0265339_101010441 199
90 3300031595 Ga0265313_10016138 Ga0265313_100161385 199
91 3300031712 Ga0265342_10000308 Ga0265342_1000030817 199
92 3300037466 Ga0395898_0326517 Ga0395898_0326517_15_716 199
93 3300049571 Ga0501034_0479055 Ga0501034_0479055_82_843 199
94 3300049581 Ga0501047_0056933 Ga0501047_0056933_683_1444 199
95 3300049823 Ga0501044_0028947 Ga0501044_0028947_472_1233 199
96 3300005436 Ga0070713_100017576 Ga0070713_1000175767 200
97 3300005983 Ga0081540_1025762 Ga0081540_10257622 200
98 3300006847 Ga0075431_100441514 Ga0075431_1004415142 200
99 3300006852 Ga0075433_10109293 Ga0075433_101092933 200
100 3300006871 Ga0075434_100043586 Ga0075434_1000435865 200
101 3300009094 Ga0111539_10011548 Ga0111539_1001154811 200
102 3300031595 Ga0265313_10054389 Ga0265313_100543893 200
103 3300031712 Ga0265342_10088723 Ga0265342_100887232 200
104 3300046684 Ga0495669_0109873 Ga0495669_0109873_308_1075 200
105 3300050511 nmdc:mga08y16_7940_c1 nmdc:mga08y16_7940_c1_9858_10625 200
106 3300050512 nmdc:mga0n895_346872_c1 nmdc:mga0n895_346872_c1_652_1419 200
107 3300050515 nmdc:mga0a205_30953_c1 nmdc:mga0a205_30953_c1_1242_2009 200
108 3300005518 Ga0070699_100010972 Ga0070699_1000109726 201
109 3300006028 Ga0070717_10494912 Ga0070717_104949122 201
110 3300006175 Ga0070712_100000210 Ga0070712_10000021014 201
111 3300006846 Ga0075430_100099742 Ga0075430_1000997422 201
112 3300025915 Ga0207693_10002870 Ga0207693_1000287013 201
113 3300049589 Ga0501073_0022644 Ga0501073_0022644_1151_1906 201
114 3300049590 Ga0501074_0091376 Ga0501074_0091376_68_823 201
115 3300049741 Ga0501079_0563086 Ga0501079_0563086_52_807 201
116 3300053151 Ga0500604_0017874 Ga0500604_0017874_1135_1890 201
117 3300054114 Ga0501084_0211552 Ga0501084_0211552_467_1222 201
118 3300005327 Ga0070658_10442188 Ga0070658_104421881 202
119 3300005339 Ga0070660_100039013 Ga0070660_1000390131 202
120 3300006042 Ga0075368_10023549 Ga0075368_100235492 202
121 3300006353 Ga0075370_10076893 Ga0075370_100768932 202
122 3300006914 Ga0075436_100008403 Ga0075436_1000084038 202
123 3300009551 Ga0105238_10015699 Ga0105238_100156993 202
124 3300013307 Ga0157372_10216912 Ga0157372_102169123 202
125 3300025909 Ga0207705_10260064 Ga0207705_102600642 202
126 3300025919 Ga0207657_10124539 Ga0207657_101245392 202
127 3300025924 Ga0207694_10036064 Ga0207694_100360644 202
128 3300026116 Ga0207674_10077985 Ga0207674_100779854 202
129 3300026142 Ga0207698_10483027 Ga0207698_104830272 202
130 3300026142 Ga0207698_10671905 Ga0207698_106719052 202
131 3300028577 Ga0265318_10024190 Ga0265318_100241902 202
132 3300031240 Ga0265320_10006465 Ga0265320_100064656 202
133 3300031249 Ga0265339_10062900 Ga0265339_100629002 202
134 3300031712 Ga0265342_10104608 Ga0265342_101046082 202
135 3300050492 nmdc:mga0yw44_1073_c2 nmdc:mga0yw44_1073_c2_2613_3395 202
136 3300050513 nmdc:mga0rr50_443475_c1 nmdc:mga0rr50_443475_c1_117_890 202
137 3300050514 nmdc:mga08x19_4943_c1 nmdc:mga08x19_4943_c1_5986_6756 202
138 3300053078 Ga0495612_0274639 Ga0495612_0274639_24_716 202
139 3300053177 Ga0500636_0268572 Ga0500636_0268572_19_789 202
140 3300005336 Ga0070680_100541981 Ga0070680_1005419811 203
141 3300005983 Ga0081540_1003265 Ga0081540_100326510 203
142 3300006038 Ga0075365_10001918 Ga0075365_100019184 203
143 3300025917 Ga0207660_10504782 Ga0207660_105047821 203
144 3300031235 Ga0265330_10004272 Ga0265330_100042723 203
145 3300031250 Ga0265331_10065609 Ga0265331_100656092 203
146 3300050513 nmdc:mga0rr50_244589_c1 nmdc:mga0rr50_244589_c1_81_851 203
147 3300050514 nmdc:mga08x19_140409_c1 nmdc:mga08x19_140409_c1_424_1194 203
148 3300005985 Ga0081539_10029936 Ga0081539_100299362 204
149 3300026067 Ga0207678_10338961 Ga0207678_103389611 204
150 3300035171 Ga0373946_0133376 Ga0373946_0133376_425_1126 204
151 3300046463 Ga0495653_0448518 Ga0495653_0448518_11_712 204
152 3300049587 Ga0501071_0125061 Ga0501071_0125061_180_938 204
153 3300049592 Ga0501076_0004238 Ga0501076_0004238_7605_8363 204
154 3300049593 Ga0501077_0046016 Ga0501077_0046016_443_1201 204
155 3300060353 Ga0501082_0038227 Ga0501082_0038227_406_1164 204
156 3300003215 JGI25153J46596_10011635 JGI25153J46596_100116352 205
157 3300025297 Ga0209758_1000125 Ga0209758_1000125122 205
158 3300031238 Ga0265332_10011394 Ga0265332_100113942 205
159 3300031242 Ga0265329_10012107 Ga0265329_100121074 205
160 3300031247 Ga0265340_10009552 Ga0265340_100095522 205
161 3300050491 nmdc:mga00v17_123895_c1 nmdc:mga00v17_123895_c1_520_1275 205
162 3300053090 Ga0500646_0036379 Ga0500646_0036379_370_1125 205
163 3300053119 Ga0500595_007280 Ga0500595_007280_186_947 205
164 3300003659 JGI25404J52841_10005908 JGI25404J52841_100059083 206
165 3300005983 Ga0081540_1000027 Ga0081540_100002736 206
166 3300025297 Ga0209758_1019110 Ga0209758_10191103 206
167 3300025939 Ga0207665_10403257 Ga0207665_104032572 206
168 3300028800 Ga0265338_10140153 Ga0265338_101401532 206
169 3300031235 Ga0265330_10076126 Ga0265330_100761262 206
170 3300031241 Ga0265325_10014684 Ga0265325_100146843 206
171 3300005327 Ga0070658_10181552 Ga0070658_101815522 207
172 3300005458 Ga0070681_10011624 Ga0070681_100116246 207
173 3300005530 Ga0070679_100004048 Ga0070679_1000040483 207
174 3300025912 Ga0207707_10257582 Ga0207707_102575822 207
175 3300031241 Ga0265325_10000073 Ga0265325_1000007334 207
176 3300031242 Ga0265329_10025533 Ga0265329_100255332 207
177 3300031595 Ga0265313_10022124 Ga0265313_100221242 207
178 3300035118 Ga0373954_0009066 Ga0373954_0009066_1939_2709 207
179 3300035119 Ga0373956_0050075 Ga0373956_0050075_1076_1846 207
180 3300035120 Ga0373957_0003057 Ga0373957_0003057_2798_3568 207
181 3300035170 Ga0373943_0007879 Ga0373943_0007879_921_1691 207
182 3300035171 Ga0373946_0001413 Ga0373946_0001413_3699_4469 207
183 3300035172 Ga0373955_0000504 Ga0373955_0000504_1340_2110 207
184 3300035410 Ga0373924_0000932 Ga0373924_0000932_3870_4640 207
185 3300035692 Ga0373935_0000038 Ga0373935_0000038_46128_46898 207
186 3300035724 Ga0373933_0020352 Ga0373933_0020352_2544_3314 207
187 3300035725 Ga0373947_0000229 Ga0373947_0000229_4183_4953 207
188 3300036401 Ga0373937_0000004 Ga0373937_0000004_61961_62731 207
189 3300037068 Ga0373925_0000424 Ga0373925_0000424_2242_3012 207
190 3300046454 Ga0495592_0000032 Ga0495592_0000032_125101_125871 207
191 3300046459 Ga0495629_0001232 Ga0495629_0001232_12326_13096 207
192 3300046462 Ga0495651_0000799 Ga0495651_0000799_17475_18245 207
193 3300046463 Ga0495653_0000012 Ga0495653_0000012_199745_200515 207
194 3300046477 Ga0495664_0000004 Ga0495664_0000004_181802_182572 207
195 3300046511 Ga0495608_0000017 Ga0495608_0000017_181789_182559 207
196 3300046514 Ga0495618_0000006 Ga0495618_0000006_140895_141665 207
197 3300046516 Ga0495628_0000001 Ga0495628_0000001_181791_182561 207
198 3300046517 Ga0495630_0005871 Ga0495630_0005871_6258_7028 207
199 3300046529 Ga0495652_0000002 Ga0495652_0000002_396325_397095 207
200 3300046533 Ga0495640_0000001 Ga0495640_0000001_490329_491099 207
201 3300046536 Ga0495587_0000008 Ga0495587_0000008_182009_182779 207
202 3300046543 Ga0495645_0000002 Ga0495645_0000002_181804_182574 207
203 3300046559 Ga0495667_0000124 Ga0495667_0000124_30225_30995 207
204 3300046642 Ga0495634_0000003 Ga0495634_0000003_175204_175974 207
205 3300046663 Ga0495635_0000002 Ga0495635_0000002_304363_305133 207
206 3300046675 Ga0495657_0000054 Ga0495657_0000054_28223_28993 207
207 3300046678 Ga0495599_0000005 Ga0495599_0000005_10026_10796 207
208 3300046679 Ga0495623_0000148 Ga0495623_0000148_16176_16946 207
209 3300046680 Ga0495646_0000002 Ga0495646_0000002_289315_290085 207
210 3300046690 Ga0495624_0066333 Ga0495624_0066333_1454_2224 207
211 3300046809 Ga0495600_0000012 Ga0495600_0000012_32934_33704 207
212 3300047317 Ga0495604_0000009 Ga0495604_0000009_143731_144501 207
213 3300047319 Ga0495674_0000002 Ga0495674_0000002_181792_182562 207
214 3300047322 Ga0495680_0001385 Ga0495680_0001385_9185_9955 207
215 3300047444 Ga0495675_0000028 Ga0495675_0000028_55380_56150 207
216 3300047471 Ga0495684_0000006 Ga0495684_0000006_181751_182521 207
217 3300047673 Ga0495593_0000140 Ga0495593_0000140_29873_30643 207
218 3300048088 Ga0495602_0000005 Ga0495602_0000005_163112_163882 207
219 3300049586 Ga0501070_0000711 Ga0501070_0000711_8386_9156 207
220 3300053077 Ga0495601_0000002 Ga0495601_0000002_128900_129670 207
221 3300053078 Ga0495612_0000010 Ga0495612_0000010_64788_65558 207
222 3300053084 Ga0495595_0000026 Ga0495595_0000026_7899_8669 207
223 3300053085 Ga0495619_0000019 Ga0495619_0000019_88236_89006 207
224 3300053177 Ga0500636_0060032 Ga0500636_0060032_509_1270 207
225 3300005336 Ga0070680_100442230 Ga0070680_1004422302 208
226 3300005456 Ga0070678_100429698 Ga0070678_1004296981 208
227 3300005617 Ga0068859_100337060 Ga0068859_1003370602 208
228 3300006931 Ga0097620_100337073 Ga0097620_1003370733 208
229 3300025927 Ga0207687_10416250 Ga0207687_104162502 208
230 3300026095 Ga0207676_10541017 Ga0207676_105410171 208
231 3300031344 Ga0265316_10110271 Ga0265316_101102712 208
232 3300031712 Ga0265342_10094730 Ga0265342_100947302 208
233 3300005334 Ga0068869_100063996 Ga0068869_1000639961 209
234 3300005548 Ga0070665_100205970 Ga0070665_1002059702 209
235 3300005564 Ga0070664_100273849 Ga0070664_1002738492 209
236 3300021384 Ga0213876_10104415 Ga0213876_101044153 209
237 3300025942 Ga0207689_10576332 Ga0207689_105763321 209
238 3300025945 Ga0207679_10333306 Ga0207679_103333062 209
239 3300028379 Ga0268266_10217814 Ga0268266_102178142 209
240 3300039437 Ga0436365_0432047 Ga0436365_0432047_396_1151 209
241 3300046474 Ga0495605_0055488 Ga0495605_0055488_883_1635 209
242 3300048921 Ga0496118_0020061 Ga0496118_0020061_352_1122 209
243 3300053087 Ga0500643_000042 Ga0500643_000042_80277_81044 209
244 3300013297 Ga0157378_10020136 Ga0157378_100201363 210
245 3300035241 Ga0373961_0019628 Ga0373961_0019628_1045_1761 210
246 3300005434 Ga0070709_10117887 Ga0070709_101178872 211
247 3300005436 Ga0070713_100055547 Ga0070713_1000555472 211
248 3300005439 Ga0070711_100024455 Ga0070711_1000244553 211
249 3300006173 Ga0070716_100085838 Ga0070716_1000858382 211
250 3300025906 Ga0207699_10012918 Ga0207699_100129182 211
251 3300025915 Ga0207693_10051413 Ga0207693_100514133 211
252 3300025916 Ga0207663_10182611 Ga0207663_101826112 211
253 3300025928 Ga0207700_10054514 Ga0207700_100545143 211
254 3300025939 Ga0207665_10011153 Ga0207665_100111532 211
255 3300048910 Ga0496107_0295982 Ga0496107_0295982_260_1027 211
256 3300048912 Ga0496109_0255984 Ga0496109_0255984_220_987 211
257 3300048914 Ga0496111_0206953 Ga0496111_0206953_388_1155 211
258 3300048917 Ga0496114_0144870 Ga0496114_0144870_710_1477 211
259 3300006844 Ga0075428_100500760 Ga0075428_1005007602 212
260 3300006871 Ga0075434_100083203 Ga0075434_1000832033 212
261 3300006914 Ga0075436_100334795 Ga0075436_1003347952 212
262 3300048916 Ga0496113_0113175 Ga0496113_0113175_1161_1928 212
263 3300050512 nmdc:mga0n895_138128_c1 nmdc:mga0n895_138128_c1_1480_2238 212
264 3300050514 nmdc:mga08x19_272733_c1 nmdc:mga08x19_272733_c1_281_1039 212
265 3300007076 Ga0075435_100251387 Ga0075435_1002513872 213
266 3300036401 Ga0373937_0261283 Ga0373937_0261283_281_1048 213
267 3300050510 nmdc:mga06r32_215584_c1 nmdc:mga06r32_215584_c1_324_1091 213
268 3300050513 nmdc:mga0rr50_183946_c1 nmdc:mga0rr50_183946_c1_662_1429 213
269 3300025928 Ga0207700_10132844 Ga0207700_101328442 215
270 3300053131 Ga0500652_000005 Ga0500652_000005_95133_95894 215
271 3300049589 Ga0501073_0213810 Ga0501073_0213810_177_935 216
272 3300049590 Ga0501074_0179723 Ga0501074_0179723_200_958 216
273 3300005366 Ga0070659_100336097 Ga0070659_1003360971 217
274 3300006175 Ga0070712_100000381 Ga0070712_10000038113 217
275 3300026088 Ga0207641_10132858 Ga0207641_101328583 217
276 3300034818 Ga0373950_0002146 Ga0373950_0002146_1746_2504 217
277 3300049569 Ga0501032_0142322 Ga0501032_0142322_803_1561 217
278 3300049586 Ga0501070_0021174 Ga0501070_0021174_932_1690 217
279 3300049822 Ga0501035_0000703 Ga0501035_0000703_18054_18812 217
280 3300053077 Ga0495601_0001735 Ga0495601_0001735_3215_3970 217
281 3300053091 Ga0500647_0013260 Ga0500647_0013260_753_1523 217
282 3300053105 Ga0500557_000006 Ga0500557_000006_74531_75301 217
283 3300053130 Ga0500642_0000040 Ga0500642_0000040_55914_56684 217
284 3300006847 Ga0075431_100067535 Ga0075431_1000675355 218
285 3300009147 Ga0114129_10166040 Ga0114129_101660402 218
286 3300009147 Ga0114129_10542927 Ga0114129_105429272 218
287 3300031595 Ga0265313_10000716 Ga0265313_1000071635 218
288 3300039437 Ga0436365_0076921 Ga0436365_0076921_9782_10540 218
289 3300048903 Ga0496100_0041015 Ga0496100_0041015_1598_2365 218
290 3300048905 Ga0496102_0573841 Ga0496102_0573841_69_836 218
291 3300050510 nmdc:mga06r32_673857_c1 nmdc:mga06r32_673857_c1_188_958 218
292 3300003911 JGI25405J52794_10002353 JGI25405J52794_100023533 219
293 3300005614 Ga0068856_100705853 Ga0068856_1007058532 219
294 3300005937 Ga0081455_10034433 Ga0081455_100344332 219
295 3300009147 Ga0114129_10510661 Ga0114129_105106611 219
296 3300006846 Ga0075430_100196520 Ga0075430_1001965202 220
297 3300025986 Ga0207658_10076749 Ga0207658_100767493 220
298 3300005437 Ga0070710_10092281 Ga0070710_100922812 221
299 3300024227 Ga0228598_1031928 Ga0228598_10319282 221
300 3300028023 Ga0265357_1000379 Ga0265357_10003792 221
301 3300028800 Ga0265338_10028004 Ga0265338_100280047 221
302 3300031241 Ga0265325_10044216 Ga0265325_100442162 221
303 3300031249 Ga0265339_10002691 Ga0265339_100026917 221
304 3300031595 Ga0265313_10000024 Ga0265313_10000024133 221
305 3300035111 Ga0373923_0160727 Ga0373923_0160727_116_874 221
306 3300035120 Ga0373957_0028081 Ga0373957_0028081_1023_1781 221
307 3300035172 Ga0373955_0004843 Ga0373955_0004843_1176_1934 221
308 3300035724 Ga0373933_0011420 Ga0373933_0011420_2722_3480 221
309 3300036401 Ga0373937_0053957 Ga0373937_0053957_373_1131 221
310 3300039438 Ga0436360_0780623 Ga0436360_0780623_205_957 221
311 3300046529 Ga0495652_0297466 Ga0495652_0297466_127_885 221
312 3300046559 Ga0495667_0020065 Ga0495667_0020065_1012_1770 221
313 3300046675 Ga0495657_0148490 Ga0495657_0148490_273_1031 221
314 3300046809 Ga0495600_0057999 Ga0495600_0057999_527_1285 221
315 3300047317 Ga0495604_0174391 Ga0495604_0174391_251_1009 221
316 3300047322 Ga0495680_0097090 Ga0495680_0097090_854_1612 221
317 3300049571 Ga0501034_0081484 Ga0501034_0081484_2459_3217 221
318 3300049572 Ga0501036_0000177 Ga0501036_0000177_38348_39106 221
319 3300049574 Ga0501038_0221024 Ga0501038_0221024_53_811 221
320 3300049579 Ga0501043_0024067 Ga0501043_0024067_596_1354 221
321 3300049580 Ga0501046_0037763 Ga0501046_0037763_1898_2656 221
322 3300049581 Ga0501047_0000756 Ga0501047_0000756_3440_4198 221
323 3300049582 Ga0501048_0000357 Ga0501048_0000357_3412_4170 221
324 3300049585 Ga0501069_0140591 Ga0501069_0140591_315_1073 221
325 3300049586 Ga0501070_0123837 Ga0501070_0123837_1023_1781 221
326 3300049589 Ga0501073_0043280 Ga0501073_0043280_999_1757 221
327 3300049590 Ga0501074_0285235 Ga0501074_0285235_306_1064 221
328 3300049742 Ga0501080_0003552 Ga0501080_0003552_5260_6018 221
329 3300049744 Ga0501083_0007330 Ga0501083_0007330_4657_5415 221
330 3300053077 Ga0495601_0031821 Ga0495601_0031821_1052_1810 221
331 3300053078 Ga0495612_0043876 Ga0495612_0043876_872_1630 221
332 3300053084 Ga0495595_0161542 Ga0495595_0161542_103_861 221
333 3300053085 Ga0495619_0091849 Ga0495619_0091849_116_874 221
334 3300005438 Ga0070701_10437087 Ga0070701_104370871 222
335 3300006038 Ga0075365_10238853 Ga0075365_102388532 222
336 3300006871 Ga0075434_100031153 Ga0075434_1000311532 222
337 3300009093 Ga0105240_10135711 Ga0105240_101357114 222
338 3300009101 Ga0105247_10378015 Ga0105247_103780151 222
339 3300009147 Ga0114129_10001669 Ga0114129_100016698 222
340 3300009147 Ga0114129_10309068 Ga0114129_103090682 222
341 3300009551 Ga0105238_10063358 Ga0105238_100633584 222
342 3300025913 Ga0207695_10535643 Ga0207695_105356432 222
343 3300025924 Ga0207694_10052161 Ga0207694_100521614 222
344 3300031238 Ga0265332_10000839 Ga0265332_1000083914 222
345 3300031241 Ga0265325_10045055 Ga0265325_100450552 222
346 3300031247 Ga0265340_10000382 Ga0265340_1000038216 222
347 3300031249 Ga0265339_10001051 Ga0265339_1000105115 222
348 3300031250 Ga0265331_10019051 Ga0265331_100190515 222
349 3300031595 Ga0265313_10085404 Ga0265313_100854042 222
350 3300031711 Ga0265314_10038121 Ga0265314_100381212 222
351 3300031712 Ga0265342_10000179 Ga0265342_1000017933 222
352 3300031712 Ga0265342_10069743 Ga0265342_100697432 222
353 3300039437 Ga0436365_0960142 Ga0436365_0960142_116_871 222
354 3300042156 Ga0439446_0063269 Ga0439446_0063269_279_1034 222
355 3300044694 Ga0466963_0005670 Ga0466963_0005670_3454_4212 222
356 3300044706 Ga0466964_0158830 Ga0466964_0158830_38_796 222
357 3300044842 Ga0466957_0015548 Ga0466957_0015548_3013_3771 222
358 3300045976 Ga0466967_0031688 Ga0466967_0031688_1886_2644 222
359 3300048903 Ga0496100_0098257 Ga0496100_0098257_442_1194 222
360 3300049569 Ga0501032_0153501 Ga0501032_0153501_659_1420 222
361 3300049571 Ga0501034_0057724 Ga0501034_0057724_1226_1987 222
362 3300049572 Ga0501036_0035608 Ga0501036_0035608_1750_2511 222
363 3300049573 Ga0501037_0007004 Ga0501037_0007004_2237_2998 222
364 3300049574 Ga0501038_0013458 Ga0501038_0013458_6188_6949 222
365 3300049579 Ga0501043_0008320 Ga0501043_0008320_6303_7064 222
366 3300049580 Ga0501046_0013329 Ga0501046_0013329_704_1465 222
367 3300049584 Ga0501068_0067385 Ga0501068_0067385_904_1665 222
368 3300049586 Ga0501070_0059888 Ga0501070_0059888_1734_2495 222
369 3300049587 Ga0501071_0287214 Ga0501071_0287214_393_1154 222
370 3300049589 Ga0501073_0053332 Ga0501073_0053332_831_1592 222
371 3300049592 Ga0501076_0146074 Ga0501076_0146074_438_1193 222
372 3300049742 Ga0501080_0012302 Ga0501080_0012302_2237_2998 222
373 3300049744 Ga0501083_0009300 Ga0501083_0009300_1741_2496 222
374 3300049744 Ga0501083_0045559 Ga0501083_0045559_562_1323 222
375 3300049823 Ga0501044_0009505 Ga0501044_0009505_7345_8106 222
376 3300050492 nmdc:mga0yw44_339340_c1 nmdc:mga0yw44_339340_c1_42_809 222
377 3300050507 nmdc:mga05p37_6119_c1 nmdc:mga05p37_6119_c1_1951_2706 222
378 3300050507 nmdc:mga05p37_656200_c1 nmdc:mga05p37_656200_c1_49_804 222
379 3300050512 nmdc:mga0n895_80372_c1 nmdc:mga0n895_80372_c1_1105_1872 222
380 3300054114 Ga0501084_0129722 Ga0501084_0129722_487_1242 222
381 3300061734 Ga0530510_0392921 Ga0530510_0392921_279_1034 222
382 3300005341 Ga0070691_10094042 Ga0070691_100940422 223
383 3300035086 Ga0373934_0079192 Ga0373934_0079192_225_983 223
384 3300035117 Ga0373953_0002856 Ga0373953_0002856_1361_2119 223
385 3300035119 Ga0373956_0072650 Ga0373956_0072650_38_796 223
386 3300035172 Ga0373955_0118923 Ga0373955_0118923_454_1212 223
387 3300036401 Ga0373937_0009675 Ga0373937_0009675_4427_5185 223
388 3300047471 Ga0495684_0343927 Ga0495684_0343927_194_952 223
389 3300001976 JGI24752J21851_1009665 JGI24752J21851_10096652 224
390 3300001977 JGI24746J21847_1000660 JGI24746J21847_10006602 224
391 3300001989 JGI24739J22299_10005070 JGI24739J22299_100050701 224
392 3300001990 JGI24737J22298_10001725 JGI24737J22298_100017253 224
393 3300002075 JGI24738J21930_10014991 JGI24738J21930_100149912 224
394 3300002126 JGI24035J26624_1000749 JGI24035J26624_10007492 224
395 3300002244 JGI24742J22300_10000548 JGI24742J22300_100005481 224
396 3300002244 JGI24742J22300_10020073 JGI24742J22300_100200731 224
397 3300005262 Ga0065165_1001015 Ga0065165_10010159 224
398 3300005328 Ga0070676_10004291 Ga0070676_100042917 224
399 3300005329 Ga0070683_100004677 Ga0070683_1000046779 224
400 3300005329 Ga0070683_100149328 Ga0070683_1001493283 224
401 3300005329 Ga0070683_100164431 Ga0070683_1001644312 224
402 3300005330 Ga0070690_100008757 Ga0070690_1000087577 224
403 3300005330 Ga0070690_100103615 Ga0070690_1001036151 224
404 3300005331 Ga0070670_100004378 Ga0070670_1000043783 224
405 3300005331 Ga0070670_100016298 Ga0070670_1000162983 224
406 3300005331 Ga0070670_100048139 Ga0070670_1000481395 224
407 3300005334 Ga0068869_100000546 Ga0068869_10000054614 224
408 3300005336 Ga0070680_100043638 Ga0070680_1000436382 224
409 3300005336 Ga0070680_100070863 Ga0070680_1000708631 224
410 3300005336 Ga0070680_100099086 Ga0070680_1000990863 224
411 3300005337 Ga0070682_100003445 Ga0070682_1000034458 224
412 3300005337 Ga0070682_100110716 Ga0070682_1001107162 224
413 3300005338 Ga0068868_100012769 Ga0068868_1000127692 224
414 3300005338 Ga0068868_100209747 Ga0068868_1002097471 224
415 3300005339 Ga0070660_100006773 Ga0070660_1000067736 224
416 3300005339 Ga0070660_100217924 Ga0070660_1002179242 224
417 3300005340 Ga0070689_100002392 Ga0070689_1000023929 224
418 3300005340 Ga0070689_100023289 Ga0070689_1000232895 224
419 3300005340 Ga0070689_100054606 Ga0070689_1000546063 224
420 3300005341 Ga0070691_10003723 Ga0070691_100037239 224
421 3300005343 Ga0070687_100001017 Ga0070687_1000010174 224
422 3300005344 Ga0070661_100004096 Ga0070661_1000040962 224
423 3300005344 Ga0070661_100191351 Ga0070661_1001913512 224
424 3300005345 Ga0070692_10004423 Ga0070692_100044234 224
425 3300005347 Ga0070668_100008178 Ga0070668_1000081782 224
426 3300005347 Ga0070668_100047207 Ga0070668_1000472072 224
427 3300005347 Ga0070668_100497346 Ga0070668_1004973462 224
428 3300005353 Ga0070669_100009976 Ga0070669_1000099763 224
429 3300005354 Ga0070675_100010473 Ga0070675_1000104732 224
430 3300005355 Ga0070671_100033814 Ga0070671_1000338144 224
431 3300005355 Ga0070671_100076769 Ga0070671_1000767692 224
432 3300005356 Ga0070674_100027012 Ga0070674_1000270123 224
433 3300005356 Ga0070674_100088015 Ga0070674_1000880152 224
434 3300005364 Ga0070673_100000050 Ga0070673_10000005011 224
435 3300005364 Ga0070673_100057192 Ga0070673_1000571922 224
436 3300005365 Ga0070688_100000781 Ga0070688_10000078114 224
437 3300005365 Ga0070688_100005154 Ga0070688_1000051547 224
438 3300005366 Ga0070659_100036287 Ga0070659_1000362873 224
439 3300005367 Ga0070667_100007711 Ga0070667_1000077114 224
440 3300005367 Ga0070667_100114407 Ga0070667_1001144072 224
441 3300005367 Ga0070667_100266149 Ga0070667_1002661492 224
442 3300005406 Ga0070703_10029323 Ga0070703_100293231 224
443 3300005434 Ga0070709_10002579 Ga0070709_100025797 224
444 3300005434 Ga0070709_10015376 Ga0070709_100153762 224
445 3300005435 Ga0070714_100006031 Ga0070714_1000060319 224
446 3300005435 Ga0070714_100058980 Ga0070714_1000589804 224
447 3300005436 Ga0070713_100056884 Ga0070713_1000568842 224
448 3300005436 Ga0070713_100243471 Ga0070713_1002434712 224
449 3300005437 Ga0070710_10003313 Ga0070710_100033134 224
450 3300005437 Ga0070710_10021794 Ga0070710_100217944 224
451 3300005437 Ga0070710_10153247 Ga0070710_101532471 224
452 3300005438 Ga0070701_10002148 Ga0070701_100021485 224
453 3300005439 Ga0070711_100022517 Ga0070711_1000225172 224
454 3300005439 Ga0070711_100027086 Ga0070711_1000270862 224
455 3300005440 Ga0070705_100003118 Ga0070705_1000031189 224
456 3300005441 Ga0070700_100002692 Ga0070700_1000026929 224
457 3300005444 Ga0070694_100005972 Ga0070694_1000059725 224
458 3300005445 Ga0070708_100269960 Ga0070708_1002699601 224
459 3300005455 Ga0070663_100019695 Ga0070663_1000196954 224
460 3300005455 Ga0070663_100044767 Ga0070663_1000447672 224
461 3300005455 Ga0070663_100087995 Ga0070663_1000879952 224
462 3300005455 Ga0070663_100272077 Ga0070663_1002720772 224
463 3300005456 Ga0070678_100000518 Ga0070678_10000051812 224
464 3300005456 Ga0070678_100022233 Ga0070678_1000222334 224
465 3300005456 Ga0070678_100055812 Ga0070678_1000558124 224
466 3300005456 Ga0070678_100261512 Ga0070678_1002615122 224
467 3300005457 Ga0070662_100207506 Ga0070662_1002075061 224
468 3300005458 Ga0070681_10027987 Ga0070681_100279878 224
469 3300005458 Ga0070681_10196314 Ga0070681_101963142 224
470 3300005458 Ga0070681_10552107 Ga0070681_105521071 224
471 3300005459 Ga0068867_100084087 Ga0068867_1000840872 224
472 3300005466 Ga0070685_10003674 Ga0070685_100036742 224
473 3300005466 Ga0070685_10014330 Ga0070685_100143303 224
474 3300005468 Ga0070707_100135839 Ga0070707_1001358392 224
475 3300005530 Ga0070679_100007667 Ga0070679_1000076678 224
476 3300005530 Ga0070679_100038301 Ga0070679_1000383016 224
477 3300005530 Ga0070679_100157769 Ga0070679_1001577692 224
478 3300005535 Ga0070684_100004205 Ga0070684_1000042056 224
479 3300005536 Ga0070697_100245505 Ga0070697_1002455052 224
480 3300005536 Ga0070697_100652942 Ga0070697_1006529421 224
481 3300005539 Ga0068853_100042900 Ga0068853_1000429002 224
482 3300005539 Ga0068853_100718527 Ga0068853_1007185272 224
483 3300005543 Ga0070672_100000643 Ga0070672_1000006437 224
484 3300005544 Ga0070686_100081135 Ga0070686_1000811353 224
485 3300005545 Ga0070695_100127165 Ga0070695_1001271651 224
486 3300005546 Ga0070696_100147295 Ga0070696_1001472952 224
487 3300005547 Ga0070693_100010080 Ga0070693_1000100802 224
488 3300005547 Ga0070693_100015464 Ga0070693_1000154644 224
489 3300005548 Ga0070665_100004366 Ga0070665_10000436616 224
490 3300005548 Ga0070665_100098694 Ga0070665_1000986943 224
491 3300005548 Ga0070665_100107354 Ga0070665_1001073542 224
492 3300005549 Ga0070704_100007534 Ga0070704_1000075344 224
493 3300005563 Ga0068855_100035984 Ga0068855_1000359844 224
494 3300005564 Ga0070664_100045869 Ga0070664_1000458694 224
495 3300005564 Ga0070664_100061029 Ga0070664_1000610294 224
496 3300005577 Ga0068857_100001038 Ga0068857_1000010388 224
497 3300005577 Ga0068857_100193234 Ga0068857_1001932342 224
498 3300005578 Ga0068854_100154785 Ga0068854_1001547852 224
499 3300005614 Ga0068856_100009104 Ga0068856_1000091047 224
500 3300005614 Ga0068856_100216401 Ga0068856_1002164011 224
501 3300005615 Ga0070702_100003907 Ga0070702_1000039072 224
502 3300005615 Ga0070702_100280699 Ga0070702_1002806991 224
503 3300005616 Ga0068852_100342276 Ga0068852_1003422762 224
504 3300005617 Ga0068859_100125159 Ga0068859_1001251592 224
505 3300005617 Ga0068859_100582430 Ga0068859_1005824302 224
506 3300005617 Ga0068859_101001040 Ga0068859_1010010402 224
507 3300005618 Ga0068864_100001882 Ga0068864_10000188217 224
508 3300005618 Ga0068864_100227008 Ga0068864_1002270082 224
509 3300005618 Ga0068864_100237471 Ga0068864_1002374712 224
510 3300005718 Ga0068866_10000791 Ga0068866_100007917 224
511 3300005718 Ga0068866_10028400 Ga0068866_100284003 224
512 3300005719 Ga0068861_100002491 Ga0068861_1000024918 224
513 3300005840 Ga0068870_10001431 Ga0068870_100014312 224
514 3300005840 Ga0068870_10026649 Ga0068870_100266491 224
515 3300005841 Ga0068863_100031598 Ga0068863_1000315984 224
516 3300005841 Ga0068863_100097902 Ga0068863_1000979023 224
517 3300005841 Ga0068863_100155588 Ga0068863_1001555882 224
518 3300005842 Ga0068858_100028785 Ga0068858_1000287854 224
519 3300005842 Ga0068858_100050653 Ga0068858_1000506533 224
520 3300005842 Ga0068858_100131690 Ga0068858_1001316904 224
521 3300005843 Ga0068860_100002530 Ga0068860_10000253014 224
522 3300005843 Ga0068860_100213517 Ga0068860_1002135171 224
523 3300005843 Ga0068860_100380951 Ga0068860_1003809512 224
524 3300005844 Ga0068862_100011700 Ga0068862_1000117002 224
525 3300005937 Ga0081455_10016554 Ga0081455_100165548 224
526 3300005937 Ga0081455_10049916 Ga0081455_100499164 224
527 3300005937 Ga0081455_10082000 Ga0081455_100820003 224
528 3300005937 Ga0081455_10138580 Ga0081455_101385802 224
529 3300005981 Ga0081538_10108327 Ga0081538_101083272 224
530 3300006028 Ga0070717_10000485 Ga0070717_1000048515 224
531 3300006028 Ga0070717_10000980 Ga0070717_1000098017 224
532 3300006038 Ga0075365_10001829 Ga0075365_100018294 224
533 3300006038 Ga0075365_10018393 Ga0075365_100183935 224
534 3300006051 Ga0075364_10049712 Ga0075364_100497125 224
535 3300006163 Ga0070715_10000289 Ga0070715_100002895 224
536 3300006163 Ga0070715_10001137 Ga0070715_100011375 224
537 3300006173 Ga0070716_100004371 Ga0070716_1000043714 224
538 3300006175 Ga0070712_100003511 Ga0070712_1000035114 224
539 3300006178 Ga0075367_10049089 Ga0075367_100490893 224
540 3300006178 Ga0075367_10087502 Ga0075367_100875023 224
541 3300006195 Ga0075366_10075432 Ga0075366_100754322 224
542 3300006195 Ga0075366_10316823 Ga0075366_103168232 224
543 3300006237 Ga0097621_100001425 Ga0097621_10000142512 224
544 3300006237 Ga0097621_100002618 Ga0097621_10000261814 224
545 3300006237 Ga0097621_100070217 Ga0097621_1000702172 224
546 3300006358 Ga0068871_100006790 Ga0068871_1000067904 224
547 3300006358 Ga0068871_100016863 Ga0068871_1000168635 224
548 3300006358 Ga0068871_100731276 Ga0068871_1007312762 224
549 3300006844 Ga0075428_100015591 Ga0075428_1000155914 224
550 3300006844 Ga0075428_100557035 Ga0075428_1005570352 224
551 3300006847 Ga0075431_100079885 Ga0075431_1000798853 224
552 3300006852 Ga0075433_10199409 Ga0075433_101994091 224
553 3300006871 Ga0075434_100004560 Ga0075434_10000456011 224
554 3300006871 Ga0075434_100035379 Ga0075434_1000353794 224
555 3300006871 Ga0075434_100052243 Ga0075434_1000522432 224
556 3300006871 Ga0075434_100053877 Ga0075434_1000538771 224
557 3300006871 Ga0075434_100132457 Ga0075434_1001324572 224
558 3300006871 Ga0075434_100188580 Ga0075434_1001885802 224
559 3300006871 Ga0075434_100383708 Ga0075434_1003837081 224
560 3300006880 Ga0075429_100058070 Ga0075429_1000580702 224
561 3300006881 Ga0068865_100001097 Ga0068865_1000010974 224
562 3300006881 Ga0068865_100078168 Ga0068865_1000781683 224
563 3300006881 Ga0068865_100411765 Ga0068865_1004117651 224
564 3300006931 Ga0097620_100125151 Ga0097620_1001251512 224
565 3300006931 Ga0097620_100582456 Ga0097620_1005824562 224
566 3300006931 Ga0097620_101000998 Ga0097620_1010009981 224
567 3300007076 Ga0075435_100014832 Ga0075435_1000148326 224
568 3300007076 Ga0075435_100054758 Ga0075435_1000547582 224
569 3300007076 Ga0075435_100134421 Ga0075435_1001344212 224
570 3300007076 Ga0075435_100518526 Ga0075435_1005185261 224
571 3300009093 Ga0105240_10067050 Ga0105240_100670506 224
572 3300009094 Ga0111539_10026539 Ga0111539_100265393 224
573 3300009094 Ga0111539_10050713 Ga0111539_100507131 224
574 3300009094 Ga0111539_10196327 Ga0111539_101963272 224
575 3300009094 Ga0111539_10203357 Ga0111539_102033572 224
576 3300009098 Ga0105245_10197564 Ga0105245_101975643 224
577 3300009098 Ga0105245_10319031 Ga0105245_103190312 224
578 3300009101 Ga0105247_10003270 Ga0105247_100032708 224
579 3300009101 Ga0105247_10018149 Ga0105247_100181494 224
580 3300009101 Ga0105247_10024753 Ga0105247_100247532 224
581 3300009101 Ga0105247_10141527 Ga0105247_101415272 224
582 3300009147 Ga0114129_10006740 Ga0114129_100067403 224
583 3300009147 Ga0114129_10024067 Ga0114129_100240678 224
584 3300009147 Ga0114129_10035205 Ga0114129_100352055 224
585 3300009148 Ga0105243_10002400 Ga0105243_1000240011 224
586 3300009148 Ga0105243_10004402 Ga0105243_100044025 224
587 3300009148 Ga0105243_10088625 Ga0105243_100886253 224
588 3300009174 Ga0105241_10008636 Ga0105241_100086368 224
589 3300009174 Ga0105241_10012784 Ga0105241_100127847 224
590 3300009174 Ga0105241_10470102 Ga0105241_104701021 224
591 3300009176 Ga0105242_10007578 Ga0105242_100075788 224
592 3300009176 Ga0105242_10023432 Ga0105242_100234325 224
593 3300009176 Ga0105242_10156399 Ga0105242_101563992 224
594 3300009177 Ga0105248_10010839 Ga0105248_100108393 224
595 3300009177 Ga0105248_10014218 Ga0105248_100142188 224
596 3300009177 Ga0105248_10049787 Ga0105248_100497874 224
597 3300009545 Ga0105237_10158136 Ga0105237_101581362 224
598 3300009551 Ga0105238_10083461 Ga0105238_100834612 224
599 3300009553 Ga0105249_10336778 Ga0105249_103367782 224
600 3300011119 Ga0105246_10025827 Ga0105246_100258275 224
601 3300011119 Ga0105246_10041134 Ga0105246_100411344 224
602 3300012507 Ga0157342_1003062 Ga0157342_10030622 224
603 3300013100 Ga0157373_10099718 Ga0157373_100997182 224
604 3300013102 Ga0157371_10158753 Ga0157371_101587532 224
605 3300013105 Ga0157369_10307822 Ga0157369_103078221 224
606 3300013296 Ga0157374_10001167 Ga0157374_100011672 224
607 3300013296 Ga0157374_10095661 Ga0157374_100956614 224
608 3300013296 Ga0157374_10344591 Ga0157374_103445912 224
609 3300013297 Ga0157378_10008023 Ga0157378_100080232 224
610 3300013297 Ga0157378_10034938 Ga0157378_100349384 224
611 3300013297 Ga0157378_10088994 Ga0157378_100889944 224
612 3300013306 Ga0163162_10010853 Ga0163162_100108532 224
613 3300013306 Ga0163162_10194670 Ga0163162_101946702 224
614 3300013307 Ga0157372_10070864 Ga0157372_100708645 224
615 3300013308 Ga0157375_10031874 Ga0157375_100318743 224
616 3300014325 Ga0163163_10007288 Ga0163163_100072885 224
617 3300014325 Ga0163163_10011174 Ga0163163_100111745 224
618 3300014325 Ga0163163_10041756 Ga0163163_100417562 224
619 3300014325 Ga0163163_10450329 Ga0163163_104503291 224
620 3300014326 Ga0157380_10001551 Ga0157380_100015516 224
621 3300014326 Ga0157380_10059935 Ga0157380_100599353 224
622 3300014745 Ga0157377_10070737 Ga0157377_100707373 224
623 3300014968 Ga0157379_10008646 Ga0157379_100086465 224
624 3300014968 Ga0157379_10202713 Ga0157379_102027133 224
625 3300014968 Ga0157379_10591223 Ga0157379_105912232 224
626 3300014969 Ga0157376_10062718 Ga0157376_100627183 224
627 3300014969 Ga0157376_11108952 Ga0157376_111089521 224
628 3300014969 Ga0157376_11109594 Ga0157376_111095941 224
629 3300025271 Ga0207666_1000153 Ga0207666_10001538 224
630 3300025302 Ga0207426_1000573 Ga0207426_100057332 224
631 3300025315 Ga0207697_10001059 Ga0207697_100010596 224
632 3300025893 Ga0207682_10002885 Ga0207682_100028855 224
633 3300025898 Ga0207692_10000282 Ga0207692_100002829 224
634 3300025898 Ga0207692_10020210 Ga0207692_100202104 224
635 3300025898 Ga0207692_10076128 Ga0207692_100761283 224
636 3300025899 Ga0207642_10000385 Ga0207642_1000038513 224
637 3300025899 Ga0207642_10024406 Ga0207642_100244063 224
638 3300025900 Ga0207710_10000382 Ga0207710_1000038217 224
639 3300025900 Ga0207710_10065532 Ga0207710_100655322 224
640 3300025901 Ga0207688_10001072 Ga0207688_100010729 224
641 3300025901 Ga0207688_10004597 Ga0207688_100045976 224
642 3300025903 Ga0207680_10046034 Ga0207680_100460342 224
643 3300025904 Ga0207647_10033262 Ga0207647_100332621 224
644 3300025904 Ga0207647_10048650 Ga0207647_100486503 224
645 3300025905 Ga0207685_10002544 Ga0207685_100025442 224
646 3300025905 Ga0207685_10006711 Ga0207685_100067112 224
647 3300025906 Ga0207699_10032604 Ga0207699_100326042 224
648 3300025906 Ga0207699_10053630 Ga0207699_100536302 224
649 3300025906 Ga0207699_10185222 Ga0207699_101852222 224
650 3300025907 Ga0207645_10002745 Ga0207645_100027454 224
651 3300025907 Ga0207645_10110760 Ga0207645_101107602 224
652 3300025908 Ga0207643_10000004 Ga0207643_1000000477 224
653 3300025908 Ga0207643_10000532 Ga0207643_100005328 224
654 3300025910 Ga0207684_10009569 Ga0207684_100095692 224
655 3300025911 Ga0207654_10008032 Ga0207654_100080327 224
656 3300025912 Ga0207707_10014644 Ga0207707_100146442 224
657 3300025912 Ga0207707_10095432 Ga0207707_100954322 224
658 3300025912 Ga0207707_10149498 Ga0207707_101494981 224
659 3300025914 Ga0207671_10382544 Ga0207671_103825442 224
660 3300025915 Ga0207693_10001038 Ga0207693_1000103812 224
661 3300025915 Ga0207693_10021249 Ga0207693_100212494 224
662 3300025915 Ga0207693_10111293 Ga0207693_101112932 224
663 3300025916 Ga0207663_10001206 Ga0207663_100012068 224
664 3300025916 Ga0207663_10020826 Ga0207663_100208263 224
665 3300025917 Ga0207660_10084417 Ga0207660_100844172 224
666 3300025917 Ga0207660_10171963 Ga0207660_101719632 224
667 3300025918 Ga0207662_10000392 Ga0207662_100003925 224
668 3300025918 Ga0207662_10009678 Ga0207662_100096781 224
669 3300025919 Ga0207657_10002007 Ga0207657_1000200717 224
670 3300025919 Ga0207657_10019229 Ga0207657_100192299 224
671 3300025920 Ga0207649_10005404 Ga0207649_100054041 224
672 3300025920 Ga0207649_10176514 Ga0207649_101765142 224
673 3300025920 Ga0207649_10237596 Ga0207649_102375962 224
674 3300025921 Ga0207652_10057538 Ga0207652_100575382 224
675 3300025923 Ga0207681_10203774 Ga0207681_102037742 224
676 3300025925 Ga0207650_10017240 Ga0207650_100172402 224
677 3300025925 Ga0207650_10180047 Ga0207650_101800472 224
678 3300025925 Ga0207650_10226842 Ga0207650_102268422 224
679 3300025926 Ga0207659_10000374 Ga0207659_1000037416 224
680 3300025927 Ga0207687_10001956 Ga0207687_1000195614 224
681 3300025927 Ga0207687_10003333 Ga0207687_100033332 224
682 3300025928 Ga0207700_10029040 Ga0207700_100290403 224
683 3300025928 Ga0207700_10063040 Ga0207700_100630402 224
684 3300025929 Ga0207664_10012974 Ga0207664_100129746 224
685 3300025929 Ga0207664_10294781 Ga0207664_102947812 224
686 3300025931 Ga0207644_10004888 Ga0207644_100048882 224
687 3300025932 Ga0207690_10022501 Ga0207690_100225012 224
688 3300025933 Ga0207706_10017396 Ga0207706_100173967 224
689 3300025933 Ga0207706_10093282 Ga0207706_100932822 224
690 3300025934 Ga0207686_10028626 Ga0207686_100286261 224
691 3300025934 Ga0207686_10108717 Ga0207686_101087172 224
692 3300025935 Ga0207709_10008652 Ga0207709_100086524 224
693 3300025936 Ga0207670_10121973 Ga0207670_101219733 224
694 3300025936 Ga0207670_10303769 Ga0207670_103037692 224
695 3300025936 Ga0207670_10478287 Ga0207670_104782872 224
696 3300025937 Ga0207669_10000275 Ga0207669_1000027521 224
697 3300025937 Ga0207669_10011700 Ga0207669_100117005 224
698 3300025938 Ga0207704_10016005 Ga0207704_100160052 224
699 3300025938 Ga0207704_10022163 Ga0207704_100221633 224
700 3300025938 Ga0207704_10087365 Ga0207704_100873653 224
701 3300025939 Ga0207665_10000541 Ga0207665_100005415 224
702 3300025939 Ga0207665_10013741 Ga0207665_100137413 224
703 3300025940 Ga0207691_10004396 Ga0207691_100043965 224
704 3300025940 Ga0207691_10030766 Ga0207691_100307666 224
705 3300025941 Ga0207711_10007738 Ga0207711_1000773810 224
706 3300025941 Ga0207711_10021126 Ga0207711_100211264 224
707 3300025941 Ga0207711_10047684 Ga0207711_100476842 224
708 3300025942 Ga0207689_10002724 Ga0207689_100027247 224
709 3300025942 Ga0207689_10009477 Ga0207689_100094777 224
710 3300025944 Ga0207661_10055077 Ga0207661_100550772 224
711 3300025944 Ga0207661_10148872 Ga0207661_101488723 224
712 3300025945 Ga0207679_10001617 Ga0207679_100016179 224
713 3300025945 Ga0207679_10039424 Ga0207679_100394241 224
714 3300025945 Ga0207679_10156602 Ga0207679_101566022 224
715 3300025945 Ga0207679_10211104 Ga0207679_102111042 224
716 3300025945 Ga0207679_10235872 Ga0207679_102358722 224
717 3300025960 Ga0207651_10127427 Ga0207651_101274271 224
718 3300025960 Ga0207651_10292182 Ga0207651_102921822 224
719 3300025961 Ga0207712_10045788 Ga0207712_100457883 224
720 3300025972 Ga0207668_10118862 Ga0207668_101188621 224
721 3300025972 Ga0207668_10144878 Ga0207668_101448782 224
722 3300025981 Ga0207640_10005141 Ga0207640_100051411 224
723 3300025986 Ga0207658_10038686 Ga0207658_100386862 224
724 3300025986 Ga0207658_10163522 Ga0207658_101635222 224
725 3300026023 Ga0207677_10044426 Ga0207677_100444264 224
726 3300026023 Ga0207677_10172528 Ga0207677_101725283 224
727 3300026035 Ga0207703_10001822 Ga0207703_1000182215 224
728 3300026035 Ga0207703_10019332 Ga0207703_100193323 224
729 3300026035 Ga0207703_10511580 Ga0207703_105115802 224
730 3300026041 Ga0207639_10491558 Ga0207639_104915582 224
731 3300026067 Ga0207678_10002471 Ga0207678_1000247113 224
732 3300026067 Ga0207678_10020636 Ga0207678_100206367 224
733 3300026067 Ga0207678_10020641 Ga0207678_100206417 224
734 3300026067 Ga0207678_10267055 Ga0207678_102670551 224
735 3300026075 Ga0207708_10001992 Ga0207708_100019925 224
736 3300026078 Ga0207702_10134688 Ga0207702_101346883 224
737 3300026078 Ga0207702_10310503 Ga0207702_103105031 224
738 3300026088 Ga0207641_10013221 Ga0207641_100132217 224
739 3300026088 Ga0207641_10113659 Ga0207641_101136592 224
740 3300026088 Ga0207641_10222589 Ga0207641_102225892 224
741 3300026089 Ga0207648_10004767 Ga0207648_100047673 224
742 3300026089 Ga0207648_10169900 Ga0207648_101699002 224
743 3300026095 Ga0207676_10002246 Ga0207676_100022465 224
744 3300026095 Ga0207676_10014005 Ga0207676_100140056 224
745 3300026116 Ga0207674_10007733 Ga0207674_100077339 224
746 3300026118 Ga0207675_100007986 Ga0207675_1000079868 224
747 3300026118 Ga0207675_100131771 Ga0207675_1001317712 224
748 3300026121 Ga0207683_10002044 Ga0207683_1000204411 224
749 3300026121 Ga0207683_10063915 Ga0207683_100639152 224
750 3300026142 Ga0207698_10150582 Ga0207698_101505822 224
751 3300027907 Ga0207428_10000501 Ga0207428_1000050148 224
752 3300028379 Ga0268266_10003041 Ga0268266_1000304116 224
753 3300028380 Ga0268265_10016446 Ga0268265_100164463 224
754 3300028380 Ga0268265_10027065 Ga0268265_100270657 224
755 3300028381 Ga0268264_10339522 Ga0268264_103395222 224
756 3300028381 Ga0268264_10849295 Ga0268264_108492951 224
757 3300031241 Ga0265325_10001135 Ga0265325_100011355 224
758 3300031995 Ga0307409_100728911 Ga0307409_1007289112 224
759 3300034816 Ga0373930_0001440 Ga0373930_0001440_185_943 224
760 3300034818 Ga0373950_0013499 Ga0373950_0013499_134_892 224
761 3300034957 Ga0373938_0018629 Ga0373938_0018629_373_1131 224
762 3300035083 Ga0373926_0027127 Ga0373926_0027127_275_1042 224
763 3300035084 Ga0373928_0005721 Ga0373928_0005721_1366_2124 224
764 3300035084 Ga0373928_0025134 Ga0373928_0025134_313_1071 224
765 3300035084 Ga0373928_0034523 Ga0373928_0034523_82_840 224
766 3300035089 Ga0373944_0021028 Ga0373944_0021028_810_1577 224
767 3300035090 Ga0373949_0001783 Ga0373949_0001783_480_1238 224
768 3300035111 Ga0373923_0009905 Ga0373923_0009905_2502_3260 224
769 3300035112 Ga0373932_0088132 Ga0373932_0088132_215_973 224
770 3300035113 Ga0373936_0153426 Ga0373936_0153426_200_958 224
771 3300035115 Ga0373941_0003872 Ga0373941_0003872_1446_2228 224
772 3300035115 Ga0373941_0007122 Ga0373941_0007122_1857_2615 224
773 3300035116 Ga0373945_0018268 Ga0373945_0018268_416_1183 224
774 3300035118 Ga0373954_0010543 Ga0373954_0010543_2087_2845 224
775 3300035119 Ga0373956_0001142 Ga0373956_0001142_5362_6120 224
776 3300035120 Ga0373957_0014833 Ga0373957_0014833_192_950 224
777 3300035121 Ga0373960_0067388 Ga0373960_0067388_149_907 224
778 3300035170 Ga0373943_0040473 Ga0373943_0040473_763_1530 224
779 3300035171 Ga0373946_0003685 Ga0373946_0003685_3696_4463 224
780 3300035172 Ga0373955_0006423 Ga0373955_0006423_968_1726 224
781 3300035242 Ga0373962_0010443 Ga0373962_0010443_717_1475 224
782 3300035691 Ga0373931_0093004 Ga0373931_0093004_785_1543 224
783 3300035692 Ga0373935_0036156 Ga0373935_0036156_222_980 224
784 3300035692 Ga0373935_0117686 Ga0373935_0117686_144_902 224
785 3300035692 Ga0373935_0201173 Ga0373935_0201173_502_1269 224
786 3300035695 Ga0373927_0129562 Ga0373927_0129562_377_1144 224
787 3300035695 Ga0373927_0307177 Ga0373927_0307177_182_940 224
788 3300035724 Ga0373933_0007752 Ga0373933_0007752_2703_3461 224
789 3300035725 Ga0373947_0009320 Ga0373947_0009320_3162_3920 224
790 3300035725 Ga0373947_0097450 Ga0373947_0097450_725_1483 224
791 3300035725 Ga0373947_0140882 Ga0373947_0140882_111_878 224
792 3300036401 Ga0373937_0000655 Ga0373937_0000655_28993_29751 224
793 3300036401 Ga0373937_0074055 Ga0373937_0074055_1660_2418 224
794 3300036401 Ga0373937_0497149 Ga0373937_0497149_133_891 224
795 3300036401 Ga0373937_0672259 Ga0373937_0672259_77_835 224
796 3300037068 Ga0373925_0017194 Ga0373925_0017194_2494_3252 224
797 3300037068 Ga0373925_0155975 Ga0373925_0155975_652_1419 224
798 3300037068 Ga0373925_0254939 Ga0373925_0254939_31_789 224
799 3300039447 Ga0436361_0685960 Ga0436361_0685960_643_1410 224
800 3300041458 Ga0451798_0958274 Ga0451798_0958274_25_792 224
801 3300041512 Ga0451853_4041355 Ga0451853_4041355_1200_1967 224
802 3300044684 Ga0466966_0088104 Ga0466966_0088104_1044_1802 224
803 3300044694 Ga0466963_0137821 Ga0466963_0137821_588_1346 224
804 3300044694 Ga0466963_0418771 Ga0466963_0418771_126_884 224
805 3300044842 Ga0466957_0420031 Ga0466957_0420031_11_769 224
806 3300045836 Ga0466958_0015838 Ga0466958_0015838_1763_2521 224
807 3300045976 Ga0466967_0033052 Ga0466967_0033052_112_882 224
808 3300046453 Ga0495627_039797 Ga0495627_039797_112_879 224
809 3300046459 Ga0495629_0001465 Ga0495629_0001465_12050_12808 224
810 3300046459 Ga0495629_0107794 Ga0495629_0107794_165_923 224
811 3300046460 Ga0495638_0058828 Ga0495638_0058828_137_904 224
812 3300046461 Ga0495641_0010900 Ga0495641_0010900_4232_4999 224
813 3300046472 Ga0495580_0377740 Ga0495580_0377740_45_812 224
814 3300046473 Ga0495582_0000570 Ga0495582_0000570_11120_11878 224
815 3300046473 Ga0495582_0031519 Ga0495582_0031519_643_1410 224
816 3300046475 Ga0495639_0027847 Ga0495639_0027847_134_901 224
817 3300046475 Ga0495639_0084793 Ga0495639_0084793_326_1084 224
818 3300046476 Ga0495662_0032039 Ga0495662_0032039_1644_2411 224
819 3300046476 Ga0495662_0191079 Ga0495662_0191079_221_988 224
820 3300046491 Ga0495584_0040744 Ga0495584_0040744_617_1384 224
821 3300046491 Ga0495584_0041179 Ga0495584_0041179_356_1123 224
822 3300046491 Ga0495584_0124009 Ga0495584_0124009_410_1168 224
823 3300046499 Ga0495594_0083376 Ga0495594_0083376_504_1271 224
824 3300046500 Ga0495596_0108968 Ga0495596_0108968_252_1019 224
825 3300046511 Ga0495608_0009665 Ga0495608_0009665_2934_3692 224
826 3300046514 Ga0495618_0019785 Ga0495618_0019785_1987_2745 224
827 3300046516 Ga0495628_0004103 Ga0495628_0004103_2934_3692 224
828 3300046517 Ga0495630_0017154 Ga0495630_0017154_144_911 224
829 3300046517 Ga0495630_0093365 Ga0495630_0093365_79_837 224
830 3300046520 Ga0495637_0053136 Ga0495637_0053136_893_1660 224
831 3300046523 Ga0495644_0041322 Ga0495644_0041322_471_1238 224
832 3300046526 Ga0495666_0040048 Ga0495666_0040048_751_1518 224
833 3300046526 Ga0495666_0159086 Ga0495666_0159086_16_774 224
834 3300046529 Ga0495652_0027665 Ga0495652_0027665_1833_2591 224
835 3300046533 Ga0495640_0008218 Ga0495640_0008218_2984_3742 224
836 3300046535 Ga0495586_0199705 Ga0495586_0199705_73_831 224
837 3300046536 Ga0495587_0009997 Ga0495587_0009997_2208_2966 224
838 3300046537 Ga0495598_0001843 Ga0495598_0001843_1245_2012 224
839 3300046543 Ga0495645_0044935 Ga0495645_0044935_631_1389 224
840 3300046559 Ga0495667_0003621 Ga0495667_0003621_6602_7360 224
841 3300046615 Ga0495656_0004314 Ga0495656_0004314_1840_2607 224
842 3300046642 Ga0495634_0057544 Ga0495634_0057544_1671_2429 224
843 3300046663 Ga0495635_0011233 Ga0495635_0011233_2749_3507 224
844 3300046674 Ga0495588_0055920 Ga0495588_0055920_533_1300 224
845 3300046675 Ga0495657_0005238 Ga0495657_0005238_2795_3553 224
846 3300046678 Ga0495599_0010640 Ga0495599_0010640_3168_3926 224
847 3300046679 Ga0495623_0010769 Ga0495623_0010769_2268_3026 224
848 3300046681 Ga0495647_0004214 Ga0495647_0004214_3177_3944 224
849 3300046683 Ga0495658_0000237 Ga0495658_0000237_29750_30508 224
850 3300046683 Ga0495658_0006226 Ga0495658_0006226_3189_3956 224
851 3300046683 Ga0495658_0070105 Ga0495658_0070105_823_1581 224
852 3300046683 Ga0495658_0218450 Ga0495658_0218450_293_1060 224
853 3300046684 Ga0495669_0033891 Ga0495669_0033891_14_781 224
854 3300046689 Ga0495613_0103162 Ga0495613_0103162_1195_1953 224
855 3300046690 Ga0495624_0026442 Ga0495624_0026442_839_1597 224
856 3300046690 Ga0495624_0063231 Ga0495624_0063231_811_1578 224
857 3300046690 Ga0495624_0336260 Ga0495624_0336260_20_787 224
858 3300046691 Ga0495670_0011251 Ga0495670_0011251_3279_4046 224
859 3300046692 Ga0495671_0025087 Ga0495671_0025087_736_1503 224
860 3300046794 Ga0495589_0046648 Ga0495589_0046648_964_1731 224
861 3300046794 Ga0495589_0069097 Ga0495589_0069097_80_847 224
862 3300046809 Ga0495600_0060644 Ga0495600_0060644_1634_2392 224
863 3300046810 Ga0495660_0170585 Ga0495660_0170585_52_819 224
864 3300047315 Ga0495581_0019117 Ga0495581_0019117_2500_3258 224
865 3300047315 Ga0495581_0300835 Ga0495581_0300835_158_925 224
866 3300047317 Ga0495604_0211351 Ga0495604_0211351_80_838 224
867 3300047319 Ga0495674_0047745 Ga0495674_0047745_1527_2285 224
868 3300047320 Ga0495672_0175556 Ga0495672_0175556_231_992 224
869 3300047321 Ga0495676_0119787 Ga0495676_0119787_811_1578 224
870 3300047321 Ga0495676_0158133 Ga0495676_0158133_656_1423 224
871 3300047322 Ga0495680_0012328 Ga0495680_0012328_1620_2378 224
872 3300047322 Ga0495680_0018500 Ga0495680_0018500_1127_1885 224
873 3300047471 Ga0495684_0047360 Ga0495684_0047360_1000_1758 224
874 3300047471 Ga0495684_0196638 Ga0495684_0196638_252_1010 224
875 3300047471 Ga0495684_0339281 Ga0495684_0339281_65_832 224
876 3300047673 Ga0495593_0057150 Ga0495593_0057150_492_1250 224
877 3300047673 Ga0495593_0179692 Ga0495593_0179692_41_808 224
878 3300048088 Ga0495602_0013847 Ga0495602_0013847_2680_3438 224
879 3300048089 Ga0495614_0051122 Ga0495614_0051122_361_1119 224
880 3300048091 Ga0495626_0130530 Ga0495626_0130530_226_993 224
881 3300048903 Ga0496100_0003363 Ga0496100_0003363_1884_2642 224
882 3300048903 Ga0496100_0015869 Ga0496100_0015869_2074_2841 224
883 3300048903 Ga0496100_0169228 Ga0496100_0169228_352_1119 224
884 3300048904 Ga0496101_0001983 Ga0496101_0001983_1388_2155 224
885 3300048904 Ga0496101_0023889 Ga0496101_0023889_843_1601 224
886 3300048904 Ga0496101_0095327 Ga0496101_0095327_1023_1781 224
887 3300048904 Ga0496101_0362825 Ga0496101_0362825_176_934 224
888 3300048905 Ga0496102_0002793 Ga0496102_0002793_3450_4208 224
889 3300048905 Ga0496102_0016941 Ga0496102_0016941_5358_6125 224
890 3300048905 Ga0496102_0028300 Ga0496102_0028300_3942_4709 224
891 3300048905 Ga0496102_0039250 Ga0496102_0039250_1247_2005 224
892 3300048905 Ga0496102_0090073 Ga0496102_0090073_1296_2054 224
893 3300048906 Ga0496103_0002369 Ga0496103_0002369_5950_6708 224
894 3300048906 Ga0496103_0020793 Ga0496103_0020793_1911_2669 224
895 3300048906 Ga0496103_0021619 Ga0496103_0021619_373_1140 224
896 3300048906 Ga0496103_0120987 Ga0496103_0120987_213_971 224
897 3300048907 Ga0496104_0000092 Ga0496104_0000092_7572_8345 224
898 3300048907 Ga0496104_0018299 Ga0496104_0018299_466_1233 224
899 3300048907 Ga0496104_0053307 Ga0496104_0053307_124_882 224
900 3300048907 Ga0496104_0099636 Ga0496104_0099636_881_1648 224
901 3300048907 Ga0496104_0122512 Ga0496104_0122512_1325_2083 224
902 3300048907 Ga0496104_0225839 Ga0496104_0225839_916_1683 224
903 3300048907 Ga0496104_0563007 Ga0496104_0563007_76_843 224
904 3300048908 Ga0496105_0002505 Ga0496105_0002505_6800_7573 224
905 3300048908 Ga0496105_0004200 Ga0496105_0004200_9783_10541 224
906 3300048908 Ga0496105_0007082 Ga0496105_0007082_3055_3822 224
907 3300048908 Ga0496105_0501735 Ga0496105_0501735_10_777 224
908 3300048908 Ga0496105_0547419 Ga0496105_0547419_35_802 224
909 3300048909 Ga0496106_0007123 Ga0496106_0007123_2319_3077 224
910 3300048909 Ga0496106_0010646 Ga0496106_0010646_4134_4892 224
911 3300048909 Ga0496106_0020424 Ga0496106_0020424_1334_2092 224
912 3300048909 Ga0496106_0086476 Ga0496106_0086476_1536_2303 224
913 3300048910 Ga0496107_0005855 Ga0496107_0005855_3986_4744 224
914 3300048910 Ga0496107_0019014 Ga0496107_0019014_2610_3377 224
915 3300048910 Ga0496107_0057547 Ga0496107_0057547_757_1515 224
916 3300048910 Ga0496107_0084405 Ga0496107_0084405_370_1137 224
917 3300048910 Ga0496107_0113311 Ga0496107_0113311_479_1237 224
918 3300048911 Ga0496108_0000951 Ga0496108_0000951_2763_3530 224
919 3300048911 Ga0496108_0009284 Ga0496108_0009284_4722_5489 224
920 3300048911 Ga0496108_0017326 Ga0496108_0017326_2760_3518 224
921 3300048912 Ga0496109_0004879 Ga0496109_0004879_6680_7438 224
922 3300048912 Ga0496109_0010573 Ga0496109_0010573_159_926 224
923 3300048912 Ga0496109_0017589 Ga0496109_0017589_1873_2631 224
924 3300048912 Ga0496109_0109183 Ga0496109_0109183_1472_2239 224
925 3300048912 Ga0496109_0120779 Ga0496109_0120779_1358_2125 224
926 3300048912 Ga0496109_0132660 Ga0496109_0132660_1307_2065 224
927 3300048913 Ga0496110_0010330 Ga0496110_0010330_446_1213 224
928 3300048913 Ga0496110_0025021 Ga0496110_0025021_2549_3316 224
929 3300048913 Ga0496110_0047745 Ga0496110_0047745_467_1225 224
930 3300048913 Ga0496110_0064482 Ga0496110_0064482_1832_2590 224
931 3300048913 Ga0496110_0106657 Ga0496110_0106657_703_1470 224
932 3300048913 Ga0496110_0178571 Ga0496110_0178571_307_1065 224
933 3300048914 Ga0496111_0002467 Ga0496111_0002467_9295_10062 224
934 3300048914 Ga0496111_0015671 Ga0496111_0015671_4344_5111 224
935 3300048914 Ga0496111_0037699 Ga0496111_0037699_942_1700 224
936 3300048914 Ga0496111_0077159 Ga0496111_0077159_481_1239 224
937 3300048914 Ga0496111_0093737 Ga0496111_0093737_433_1200 224
938 3300048915 Ga0496112_0007378 Ga0496112_0007378_3013_3780 224
939 3300048915 Ga0496112_0023680 Ga0496112_0023680_1781_2548 224
940 3300048915 Ga0496112_0027458 Ga0496112_0027458_825_1583 224
941 3300048915 Ga0496112_0060168 Ga0496112_0060168_1930_2688 224
942 3300048915 Ga0496112_0179824 Ga0496112_0179824_1252_2019 224
943 3300048915 Ga0496112_0297778 Ga0496112_0297778_40_807 224
944 3300048915 Ga0496112_0517234 Ga0496112_0517234_22_789 224
945 3300048916 Ga0496113_0000043 Ga0496113_0000043_3422_4189 224
946 3300048916 Ga0496113_0004559 Ga0496113_0004559_6253_7011 224
947 3300048916 Ga0496113_0022484 Ga0496113_0022484_927_1685 224
948 3300048916 Ga0496113_0048900 Ga0496113_0048900_927_1685 224
949 3300048916 Ga0496113_0390828 Ga0496113_0390828_161_928 224
950 3300048917 Ga0496114_0036470 Ga0496114_0036470_469_1236 224
951 3300048917 Ga0496114_0064599 Ga0496114_0064599_1175_1933 224
952 3300048917 Ga0496114_0087094 Ga0496114_0087094_1569_2336 224
953 3300048917 Ga0496114_0765122 Ga0496114_0765122_43_801 224
954 3300048918 Ga0496115_0002647 Ga0496115_0002647_6390_7148 224
955 3300048918 Ga0496115_0003701 Ga0496115_0003701_1553_2311 224
956 3300048918 Ga0496115_0008385 Ga0496115_0008385_5296_6063 224
957 3300048918 Ga0496115_0037995 Ga0496115_0037995_1197_1955 224
958 3300048918 Ga0496115_0076178 Ga0496115_0076178_304_1071 224
959 3300048918 Ga0496115_0211523 Ga0496115_0211523_800_1558 224
960 3300048928 Ga0496125_0071564 Ga0496125_0071564_1542_2300 224
961 3300048929 Ga0496126_0158448 Ga0496126_0158448_702_1460 224
962 3300049568 Ga0501031_0045785 Ga0501031_0045785_959_1720 224
963 3300049570 Ga0501033_0100363 Ga0501033_0100363_1082_1864 224
964 3300049571 Ga0501034_0022311 Ga0501034_0022311_2315_3073 224
965 3300049572 Ga0501036_0049253 Ga0501036_0049253_476_1258 224
966 3300049572 Ga0501036_0191676 Ga0501036_0191676_384_1151 224
967 3300049574 Ga0501038_0176621 Ga0501038_0176621_706_1488 224
968 3300049575 Ga0501039_0117190 Ga0501039_0117190_524_1306 224
969 3300049575 Ga0501039_0183775 Ga0501039_0183775_685_1452 224
970 3300049577 Ga0501041_0026039 Ga0501041_0026039_249_1010 224
971 3300049579 Ga0501043_0022538 Ga0501043_0022538_2290_3072 224
972 3300049581 Ga0501047_0086785 Ga0501047_0086785_821_1603 224
973 3300049582 Ga0501048_0277758 Ga0501048_0277758_403_1164 224
974 3300049583 Ga0501067_0065035 Ga0501067_0065035_267_1049 224
975 3300049584 Ga0501068_0022450 Ga0501068_0022450_617_1399 224
976 3300049584 Ga0501068_0167547 Ga0501068_0167547_428_1186 224
977 3300049585 Ga0501069_0030171 Ga0501069_0030171_677_1459 224
978 3300049586 Ga0501070_0168615 Ga0501070_0168615_613_1371 224
979 3300049586 Ga0501070_0228060 Ga0501070_0228060_237_1019 224
980 3300049587 Ga0501071_0037406 Ga0501071_0037406_2373_3134 224
981 3300049587 Ga0501071_0100595 Ga0501071_0100595_66_848 224
982 3300049590 Ga0501074_0025506 Ga0501074_0025506_1201_1983 224
983 3300049741 Ga0501079_0184899 Ga0501079_0184899_750_1517 224
984 3300049741 Ga0501079_0513541 Ga0501079_0513541_109_870 224
985 3300049742 Ga0501080_0335063 Ga0501080_0335063_131_889 224
986 3300049744 Ga0501083_0089402 Ga0501083_0089402_254_1012 224
987 3300049744 Ga0501083_0238909 Ga0501083_0238909_157_918 224
988 3300049744 Ga0501083_0246018 Ga0501083_0246018_232_1014 224
989 3300049822 Ga0501035_0383105 Ga0501035_0383105_124_906 224
990 3300050491 nmdc:mga00v17_43279_c1 nmdc:mga00v17_43279_c1_64_900 224
991 3300050492 nmdc:mga0yw44_10242_c2 nmdc:mga0yw44_10242_c2_932_1699 224
992 3300050492 nmdc:mga0yw44_28448_c1 nmdc:mga0yw44_28448_c1_2119_2955 224
993 3300050492 nmdc:mga0yw44_813_c1 nmdc:mga0yw44_813_c1_9274_10041 224
994 3300050493 nmdc:mga0k408_102437_c1 nmdc:mga0k408_102437_c1_637_1398 224
995 3300050496 nmdc:mga07m45_133038_c1 nmdc:mga07m45_133038_c1_151_912 224
996 3300050507 nmdc:mga05p37_23570_c1 nmdc:mga05p37_23570_c1_960_1727 224
997 3300050507 nmdc:mga05p37_66476_c1 nmdc:mga05p37_66476_c1_2405_3172 224
998 3300050510 nmdc:mga06r32_142613_c1 nmdc:mga06r32_142613_c1_342_1109 224
999 3300050510 nmdc:mga06r32_457892_c1 nmdc:mga06r32_457892_c1_333_1169 224
1000 3300050511 nmdc:mga08y16_100861_c1 nmdc:mga08y16_100861_c1_466_1224 224
1001 3300050511 nmdc:mga08y16_218924_c1 nmdc:mga08y16_218924_c1_867_1625 224
1002 3300050511 nmdc:mga08y16_281693_c1 nmdc:mga08y16_281693_c1_736_1494 224
1003 3300050511 nmdc:mga08y16_53580_c1 nmdc:mga08y16_53580_c1_95_853 224
1004 3300050511 nmdc:mga08y16_68582_c1 nmdc:mga08y16_68582_c1_677_1444 224
1005 3300050512 nmdc:mga0n895_128932_c1 nmdc:mga0n895_128932_c1_286_1044 224
1006 3300050512 nmdc:mga0n895_212807_c1 nmdc:mga0n895_212807_c1_526_1284 224
1007 3300050512 nmdc:mga0n895_70607_c1 nmdc:mga0n895_70607_c1_260_1027 224
1008 3300050513 nmdc:mga0rr50_36677_c1 nmdc:mga0rr50_36677_c1_915_1673 224
1009 3300050513 nmdc:mga0rr50_73707_c1 nmdc:mga0rr50_73707_c1_1037_1795 224
1010 3300050515 nmdc:mga0a205_19073_c1 nmdc:mga0a205_19073_c1_1484_2242 224
1011 3300050515 nmdc:mga0a205_329112_c1 nmdc:mga0a205_329112_c1_319_1077 224
1012 3300050515 nmdc:mga0a205_439085_c1 nmdc:mga0a205_439085_c1_313_1071 224
1013 3300053077 Ga0495601_0013626 Ga0495601_0013626_3631_4389 224
1014 3300053078 Ga0495612_0024655 Ga0495612_0024655_166_924 224
1015 3300053084 Ga0495595_0007500 Ga0495595_0007500_850_1608 224
1016 3300053084 Ga0495595_0050761 Ga0495595_0050761_842_1609 224
1017 3300053085 Ga0495619_0000484 Ga0495619_0000484_1920_2678 224
1018 3300053085 Ga0495619_0072501 Ga0495619_0072501_1460_2218 224
1019 3300053085 Ga0495619_0222827 Ga0495619_0222827_459_1226 224
1020 3300053087 Ga0500643_001251 Ga0500643_001251_2460_3218 224
1021 3300053088 Ga0500644_0000533 Ga0500644_0000533_1632_2390 224
1022 3300053093 Ga0500651_0001643 Ga0500651_0001643_4611_5369 224
1023 3300053119 Ga0500595_000002 Ga0500595_000002_982367_983125 224
1024 3300053153 Ga0500616_0000002 Ga0500616_0000002_1093016_1093774 224
1025 3300053730 Ga0500645_000156 Ga0500645_000156_22688_23446 224
1026 3300060353 Ga0501082_0509380 Ga0501082_0509380_102_884 224
1027 3300060353 Ga0501082_0747162 Ga0501082_0747162_46_813 224
1028 3300061719 Ga0466962_0083171 Ga0466962_0083171_271_1029 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

43

271

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wik-assembly1.cif.gz_A cryo-em structure of slc40/ferroportin with fab in the presence of hepcidin 0.4733 44 222
6rw3-assembly4.cif.gz_D the molecular basis for sugar import in malaria parasites. 0.4679 2 223
6rw3-assembly1.cif.gz_A the molecular basis for sugar import in malaria parasites. 0.463 1 223
6rw3-assembly2.cif.gz_B the molecular basis for sugar import in malaria parasites. 0.4626 1 223
4qiq-assembly1.cif.gz_A crystal structure of d-xylose-proton symporter 0.4456 44 217
ID Description Score Start End Superfamily
af_Q2FW85_14_250_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5173 55 217 1.20.1250.20
af_Q54E82_206_395_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.504 48 216 1.20.1250.20
af_Q2G0K4_242_431_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.503 50 217 1.20.1250.20
af_Q9Y267_168_571_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5021 55 217 1.20.1250.20
af_Q23063_235_438_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4972 56 218 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7Z9K8V3-F1-model_v4 Probable membrane transporter protein 0.8532 3 222 GO:0005886
AF-C6WYA3-F1-model_v4 Probable membrane transporter protein 0.8434 14 222 GO:0005886
AF-A0A2A4NFJ0-F1-model_v4 Probable membrane transporter protein 0.8428 11 223 GO:0005886
AF-A0A537RZN4-F1-model_v4 Probable membrane transporter protein 0.841 3 222 GO:0005886
AF-A0A7Z9K8V3-F1-model_v4 Probable membrane transporter protein 0.8392 3 222 GO:0005886

Feature Viewer

pLDDT pTM Quality
79.36 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map