F488499

General Info

Members Datasets Scaffolds Average Seq Length
1025 267 1025 134

Family's Representative Sequence

Representative Sequence 3300049850|Ga0501204_044804|Ga0501204_044804_123_500
Length 125
Sequence MRYQRAEPPLKLDGLAAARKFFAGCLAEEDPRRESLWVAHVDNDARCLHVACYRGDAVAADASHHGSAGIVLAHNHPSGDARPSDSDCRATRRLASAAEALDCTVLDHLVFAGKDCTSLRQLGYL

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
184 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
185 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
186 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
187 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
196 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
197 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
198 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
199 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
200 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
201 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
206 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
207 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
215 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
216 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
217 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
220 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
240 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
241 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
242 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
243 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
244 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
245 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
246 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
247 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
248 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
249 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
250 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
251 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
252 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
253 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
254 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
255 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
256 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
257 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
258 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
259 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
260 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
261 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
262 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 3.41
Rhizosphere 96
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1031289 3300001904 Bacteria 822
2 JGI24740J21852_10008659 3300001979 Bacteria 4039
3 JGI24740J21852_10034115 3300001979 Bacteria 1607
4 JGI24739J22299_10009129 3300001989 Bacteria 3699
5 JGI24739J22299_10021228 3300001989 Bacteria 2313
6 JGI24737J22298_10004177 3300001990 Bacteria 5049
7 JGI24737J22298_10032855 3300001990 Bacteria 1614
8 JGI24737J22298_10051823 3300001990 Bacteria 1245
9 JGI24743J22301_10007370 3300001991 Bacteria 1906
10 JGI24743J22301_10031105 3300001991 Bacteria 1051
11 JGI24743J22301_10035884 3300001991 Bacteria 986
12 JGI24735J21928_10031903 3300002067 Bacteria 1561
13 JGI24735J21928_10132300 3300002067 Unclassified 719
14 JGI24745J21846_1003710 3300002073 Bacteria 1608
15 JGI24744J21845_10000111 3300002077 Bacteria 11081
16 JGI24742J22300_10015013 3300002244 Bacteria 1302
17 Ga0065704_10042887 3300005289 Unclassified 764
18 Ga0065715_10184812 3300005293 Bacteria 1452
19 Ga0070658_10005690 3300005327 Bacteria 10107
20 Ga0070658_10028246 3300005327 Bacteria 4503
21 Ga0070658_10044805 3300005327 Bacteria 3575
22 Ga0070658_10049652 3300005327 Bacteria 3399
23 Ga0070658_10078042 3300005327 Bacteria 2717
24 Ga0070658_10106887 3300005327 Bacteria 2315
25 Ga0070658_10114352 3300005327 Bacteria 2238
26 Ga0070658_10117686 3300005327 Bacteria 2206
27 Ga0070658_10132943 3300005327 Bacteria 2074
28 Ga0070658_10265834 3300005327 Bacteria 1458
29 Ga0070658_10322902 3300005327 Bacteria 1318
30 Ga0070658_10333048 3300005327 Bacteria 1297
31 Ga0070658_10347864 3300005327 Bacteria 1268
32 Ga0070658_10754517 3300005327 Unclassified 845
33 Ga0070658_10825464 3300005327 Bacteria 805
34 Ga0070658_10827438 3300005327 Bacteria 804
35 Ga0070658_10964448 3300005327 Bacteria 741
36 Ga0070658_11004821 3300005327 Unclassified 725
37 Ga0070658_11034082 3300005327 Unclassified 714
38 Ga0070658_11292408 3300005327 Bacteria 634
39 Ga0070676_10030556 3300005328 Bacteria 3073
40 Ga0070676_10057428 3300005328 Bacteria 2303
41 Ga0070676_10089920 3300005328 Bacteria 1879
42 Ga0070676_10113005 3300005328 Bacteria 1694
43 Ga0070676_10117500 3300005328 Bacteria 1664
44 Ga0070676_10124527 3300005328 Bacteria 1622
45 Ga0070676_10761984 3300005328 Bacteria 711
46 Ga0070683_100005914 3300005329 Bacteria 10237
47 Ga0070683_100016035 3300005329 Bacteria 6594
48 Ga0070683_100043657 3300005329 Bacteria 4132
49 Ga0070683_100116324 3300005329 Bacteria 2524
50 Ga0070683_100362861 3300005329 Bacteria 1380
51 Ga0070690_100005454 3300005330 Bacteria 7146
52 Ga0070690_100011910 3300005330 Bacteria 5105
53 Ga0070670_100190759 3300005331 Bacteria 1780
54 Ga0070670_100234802 3300005331 Bacteria 1596
55 Ga0070670_100578950 3300005331 Bacteria 1003
56 Ga0070677_10046990 3300005333 Bacteria 1728
57 Ga0068869_100079144 3300005334 Bacteria 2449
58 Ga0068869_100385084 3300005334 Bacteria 1150
59 Ga0068869_100896723 3300005334 Bacteria 767
60 Ga0070666_10005568 3300005335 Bacteria 7725
61 Ga0070666_10016133 3300005335 Bacteria 4773
62 Ga0070666_10020416 3300005335 Bacteria 4282
63 Ga0070666_10050842 3300005335 Bacteria 2789
64 Ga0070666_10376765 3300005335 Bacteria 1018
65 Ga0070666_10708590 3300005335 Unclassified 738
66 Ga0070680_100022384 3300005336 Bacteria 5034
67 Ga0070680_100161154 3300005336 Bacteria 1885
68 Ga0070680_100241907 3300005336 Bacteria 1525
69 Ga0070680_100480307 3300005336 Bacteria 1062
70 Ga0070680_100749171 3300005336 Bacteria 841
71 Ga0070682_100066675 3300005337 Bacteria 2291
72 Ga0070682_100420028 3300005337 Bacteria 1016
73 Ga0068868_100007444 3300005338 Bacteria 7795
74 Ga0068868_100112598 3300005338 Bacteria 2212
75 Ga0068868_100138552 3300005338 Bacteria 1996
76 Ga0068868_100259612 3300005338 Bacteria 1464
77 Ga0070660_100021004 3300005339 Bacteria 4807
78 Ga0070660_100047439 3300005339 Bacteria 3296
79 Ga0070660_100068007 3300005339 Bacteria 2776
80 Ga0070660_100072096 3300005339 Bacteria 2698
81 Ga0070660_100076394 3300005339 Bacteria 2623
82 Ga0070660_100163169 3300005339 Bacteria 1796
83 Ga0070660_100193964 3300005339 Bacteria 1646
84 Ga0070660_100207160 3300005339 Bacteria 1591
85 Ga0070660_100215612 3300005339 Bacteria 1559
86 Ga0070660_100254180 3300005339 Bacteria 1433
87 Ga0070660_100472128 3300005339 Bacteria 1042
88 Ga0070660_100960689 3300005339 Bacteria 721
89 Ga0070689_100780444 3300005340 Bacteria 839
90 Ga0070691_10002830 3300005341 Bacteria 7756
91 Ga0070687_100030928 3300005343 Bacteria 2621
92 Ga0070661_100017415 3300005344 Bacteria 5097
93 Ga0070661_100020888 3300005344 Bacteria 4673
94 Ga0070661_100024685 3300005344 Bacteria 4312
95 Ga0070661_100030553 3300005344 Bacteria 3892
96 Ga0070661_100034228 3300005344 Bacteria 3684
97 Ga0070661_100052208 3300005344 Bacteria 2992
98 Ga0070661_100072325 3300005344 Bacteria 2537
99 Ga0070661_100074859 3300005344 Bacteria 2494
100 Ga0070661_100215349 3300005344 Bacteria 1471
101 Ga0070661_100217775 3300005344 Bacteria 1463
102 Ga0070661_100586005 3300005344 Bacteria 900
103 Ga0070661_100740743 3300005344 Bacteria 803
104 Ga0070661_100881392 3300005344 Bacteria 738
105 Ga0070661_101409615 3300005344 Unclassified 586
106 Ga0070692_10031022 3300005345 Bacteria 2677
107 Ga0070692_10312758 3300005345 Bacteria 963
108 Ga0070692_10798390 3300005345 Bacteria 644
109 Ga0070668_100151724 3300005347 Bacteria 1874
110 Ga0070668_100239632 3300005347 Bacteria 1502
111 Ga0070668_100317777 3300005347 Bacteria 1310
112 Ga0070668_100493598 3300005347 Bacteria 1059
113 Ga0070669_100025211 3300005353 Bacteria 4270
114 Ga0070669_100179848 3300005353 Bacteria 1654
115 Ga0070675_100045611 3300005354 Bacteria 3587
116 Ga0070675_100224953 3300005354 Bacteria 1635
117 Ga0070675_100276139 3300005354 Bacteria 1476
118 Ga0070671_100007870 3300005355 Bacteria 8521
119 Ga0070671_100037184 3300005355 Bacteria 4037
120 Ga0070671_100160972 3300005355 Bacteria 1897
121 Ga0070674_100018215 3300005356 Bacteria 4435
122 Ga0070674_100146977 3300005356 Bacteria 1775
123 Ga0070674_100195205 3300005356 Bacteria 1559
124 Ga0070674_100248081 3300005356 Bacteria 1397
125 Ga0070674_100380828 3300005356 Bacteria 1148
126 Ga0070673_100029293 3300005364 Bacteria 4105
127 Ga0070673_100074529 3300005364 Bacteria 2735
128 Ga0070673_100680556 3300005364 Bacteria 943
129 Ga0070673_100840476 3300005364 Bacteria 849
130 Ga0070673_100888797 3300005364 Bacteria 826
131 Ga0070688_100233135 3300005365 Bacteria 1303
132 Ga0070659_100008501 3300005366 Bacteria 7503
133 Ga0070659_100008995 3300005366 Bacteria 7323
134 Ga0070659_100016125 3300005366 Bacteria 5607
135 Ga0070659_100023294 3300005366 Bacteria 4738
136 Ga0070659_100029693 3300005366 Bacteria 4226
137 Ga0070659_100037137 3300005366 Bacteria 3797
138 Ga0070659_100043143 3300005366 Bacteria 3527
139 Ga0070659_100053768 3300005366 Bacteria 3170
140 Ga0070659_100146067 3300005366 Bacteria 1927
141 Ga0070659_100269878 3300005366 Bacteria 1413
142 Ga0070659_100403745 3300005366 Bacteria 1154
143 Ga0070667_100010950 3300005367 Bacteria 7500
144 Ga0070667_100024075 3300005367 Bacteria 5056
145 Ga0070667_100046599 3300005367 Bacteria 3647
146 Ga0070667_100052622 3300005367 Bacteria 3436
147 Ga0070667_100080670 3300005367 Bacteria 2783
148 Ga0070667_100103121 3300005367 Bacteria 2466
149 Ga0070667_100171884 3300005367 Bacteria 1913
150 Ga0070714_100393350 3300005435 Bacteria 1309
151 Ga0070663_100009308 3300005455 Bacteria 6079
152 Ga0070663_100024579 3300005455 Bacteria 4057
153 Ga0070663_100032768 3300005455 Bacteria 3585
154 Ga0070663_100034824 3300005455 Bacteria 3489
155 Ga0070663_100075585 3300005455 Bacteria 2462
156 Ga0070663_100100010 3300005455 Bacteria 2163
157 Ga0070663_100295216 3300005455 Bacteria 1295
158 Ga0070663_100413661 3300005455 Bacteria 1105
159 Ga0070663_101215894 3300005455 Bacteria 662
160 Ga0070678_100046313 3300005456 Bacteria 3117
161 Ga0070678_100151667 3300005456 Bacteria 1867
162 Ga0070662_100007577 3300005457 Bacteria 7043
163 Ga0070662_100023737 3300005457 Bacteria 4217
164 Ga0070662_100037755 3300005457 Bacteria 3426
165 Ga0070662_100044214 3300005457 Bacteria 3189
166 Ga0070662_100078127 3300005457 Bacteria 2458
167 Ga0070662_100084784 3300005457 Bacteria 2367
168 Ga0070662_100105019 3300005457 Bacteria 2144
169 Ga0070662_100120489 3300005457 Bacteria 2010
170 Ga0070662_100255886 3300005457 Bacteria 1409
171 Ga0070662_100260542 3300005457 Bacteria 1397
172 Ga0070681_10055658 3300005458 Bacteria 3938
173 Ga0070681_10100209 3300005458 Bacteria 2843
174 Ga0070681_10105476 3300005458 Bacteria 2760
175 Ga0070681_10208271 3300005458 Bacteria 1872
176 Ga0070681_10548228 3300005458 Bacteria 1070
177 Ga0070681_10722111 3300005458 Unclassified 912
178 Ga0068867_100005872 3300005459 Bacteria 8707
179 Ga0068867_100043538 3300005459 Bacteria 3286
180 Ga0068867_100072637 3300005459 Bacteria 2576
181 Ga0068867_100187884 3300005459 Bacteria 1647
182 Ga0068867_100833129 3300005459 Bacteria 825
183 Ga0070679_100053872 3300005530 Bacteria 4005
184 Ga0070679_100065499 3300005530 Bacteria 3622
185 Ga0070679_100399454 3300005530 Bacteria 1320
186 Ga0070679_100714599 3300005530 Bacteria 945
187 Ga0070684_100034034 3300005535 Bacteria 4354
188 Ga0070684_100393442 3300005535 Bacteria 1277
189 Ga0070684_100534066 3300005535 Bacteria 1088
190 Ga0070684_100917896 3300005535 Bacteria 821
191 Ga0068853_100043655 3300005539 Bacteria 3835
192 Ga0068853_100164084 3300005539 Bacteria 2006
193 Ga0068853_100256988 3300005539 Bacteria 1605
194 Ga0068853_100348365 3300005539 Bacteria 1377
195 Ga0068853_100416899 3300005539 Bacteria 1259
196 Ga0068853_100702015 3300005539 Bacteria 965
197 Ga0068853_100764840 3300005539 Bacteria 924
198 Ga0068853_100805732 3300005539 Bacteria 899
199 Ga0070672_100050522 3300005543 Bacteria 3239
200 Ga0070672_101138081 3300005543 Unclassified 694
201 Ga0070672_101163535 3300005543 Unclassified 686
202 Ga0070672_101205527 3300005543 Bacteria 674
203 Ga0070686_100674287 3300005544 Bacteria 822
204 Ga0070695_101637659 3300005545 Unclassified 538
205 Ga0070693_100004419 3300005547 Bacteria 6645
206 Ga0070693_100039930 3300005547 Bacteria 2632
207 Ga0070693_100094485 3300005547 Bacteria 1809
208 Ga0070665_100058313 3300005548 Bacteria 3871
209 Ga0070665_101491274 3300005548 Bacteria 685
210 Ga0070704_100199854 3300005549 Bacteria 1613
211 Ga0068855_100036876 3300005563 Bacteria 5816
212 Ga0068855_100101200 3300005563 Bacteria 3317
213 Ga0068855_100125957 3300005563 Bacteria 2929
214 Ga0068855_100173397 3300005563 Bacteria 2441
215 Ga0068855_100238189 3300005563 Bacteria 2034
216 Ga0068855_100317365 3300005563 Bacteria 1723
217 Ga0068855_100538057 3300005563 Bacteria 1266
218 Ga0068855_100712021 3300005563 Bacteria 1073
219 Ga0068855_101559331 3300005563 Unclassified 677
220 Ga0070664_100013787 3300005564 Bacteria 6589
221 Ga0070664_100015083 3300005564 Bacteria 6308
222 Ga0070664_100021246 3300005564 Bacteria 5348
223 Ga0070664_100064007 3300005564 Bacteria 3136
224 Ga0070664_100098844 3300005564 Bacteria 2536
225 Ga0070664_100103553 3300005564 Bacteria 2477
226 Ga0070664_100129233 3300005564 Bacteria 2218
227 Ga0070664_100201393 3300005564 Bacteria 1777
228 Ga0070664_100763344 3300005564 Bacteria 903
229 Ga0070664_101223974 3300005564 Unclassified 708
230 Ga0068857_100011113 3300005577 Bacteria 7831
231 Ga0068857_100014994 3300005577 Bacteria 6761
232 Ga0068857_100079040 3300005577 Bacteria 2936
233 Ga0068857_100860494 3300005577 Unclassified 868
234 Ga0068854_100003788 3300005578 Bacteria 9456
235 Ga0068854_100009368 3300005578 Bacteria 6321
236 Ga0068854_100029766 3300005578 Bacteria 3783
237 Ga0068854_100048156 3300005578 Bacteria 3040
238 Ga0068854_100050917 3300005578 Bacteria 2965
239 Ga0068854_100083586 3300005578 Bacteria 2361
240 Ga0068854_100120603 3300005578 Bacteria 1990
241 Ga0068854_100241903 3300005578 Bacteria 1437
242 Ga0068854_100352749 3300005578 Bacteria 1205
243 Ga0068854_101002485 3300005578 Bacteria 740
244 Ga0068856_100012390 3300005614 Bacteria 8258
245 Ga0068856_100232308 3300005614 Bacteria 1859
246 Ga0068856_100360265 3300005614 Bacteria 1473
247 Ga0068856_100601718 3300005614 Bacteria 1120
248 Ga0068856_100667879 3300005614 Bacteria 1060
249 Ga0068856_101231389 3300005614 Bacteria 764
250 Ga0070702_100215112 3300005615 Bacteria 1282
251 Ga0068852_100001493 3300005616 Bacteria 15819
252 Ga0068852_100007008 3300005616 Bacteria 8206
253 Ga0068852_100027596 3300005616 Bacteria 4629
254 Ga0068852_100110434 3300005616 Bacteria 2499
255 Ga0068852_100154078 3300005616 Bacteria 2139
256 Ga0068852_100225805 3300005616 Bacteria 1783
257 Ga0068852_100242673 3300005616 Bacteria 1723
258 Ga0068852_100442953 3300005616 Bacteria 1285
259 Ga0068852_100778816 3300005616 Bacteria 970
260 Ga0068852_101019848 3300005616 Bacteria 846
261 Ga0068852_101054305 3300005616 Unclassified 832
262 Ga0068852_101077468 3300005616 Bacteria 823
263 Ga0068852_101362786 3300005616 Unclassified 731
264 Ga0068859_100017745 3300005617 Bacteria 7154
265 Ga0068859_100030289 3300005617 Bacteria 5430
266 Ga0068859_100345879 3300005617 Bacteria 1581
267 Ga0068859_101166829 3300005617 Unclassified 848
268 Ga0068864_100116149 3300005618 Bacteria 2387
269 Ga0068864_100177216 3300005618 Bacteria 1947
270 Ga0068864_100905428 3300005618 Bacteria 871
271 Ga0068864_101213310 3300005618 Bacteria 753
272 Ga0068866_10003017 3300005718 Bacteria 6953
273 Ga0068866_10005962 3300005718 Bacteria 5069
274 Ga0068866_10259246 3300005718 Bacteria 1068
275 Ga0068861_100665356 3300005719 Bacteria 964
276 Ga0068851_10021386 3300005834 Bacteria 3140
277 Ga0068851_10029996 3300005834 Bacteria 2695
278 Ga0068851_10102656 3300005834 Bacteria 1519
279 Ga0068851_10514790 3300005834 Bacteria 719
280 Ga0068870_10305261 3300005840 Bacteria 1006
281 Ga0068863_100006772 3300005841 Bacteria 11235
282 Ga0068863_100013348 3300005841 Bacteria 7920
283 Ga0068863_100042082 3300005841 Bacteria 4342
284 Ga0068863_101646542 3300005841 Bacteria 651
285 Ga0068858_100000698 3300005842 Bacteria 35076
286 Ga0068858_100044077 3300005842 Bacteria 4136
287 Ga0068858_100103287 3300005842 Bacteria 2659
288 Ga0068858_100405553 3300005842 Bacteria 1310
289 Ga0068860_100082725 3300005843 Bacteria 3053
290 Ga0068860_100159480 3300005843 Bacteria 2174
291 Ga0068860_100413419 3300005843 Bacteria 1336
292 Ga0068860_100445147 3300005843 Bacteria 1287
293 Ga0068860_100495860 3300005843 Bacteria 1219
294 Ga0068862_100033453 3300005844 Bacteria 4346
295 Ga0068862_100564824 3300005844 Bacteria 1088
296 Ga0081539_10016302 3300005985 Bacteria 5320
297 Ga0075364_10092912 3300006051 Bacteria 2003
298 Ga0070712_100117743 3300006175 Bacteria 1994
299 Ga0075366_10238263 3300006195 Bacteria 1109
300 Ga0097621_100142634 3300006237 Bacteria 2048
301 Ga0097621_100239035 3300006237 Bacteria 1587
302 Ga0097621_100855543 3300006237 Unclassified 845
303 Ga0068871_100005013 3300006358 Bacteria 9250
304 Ga0068871_100401815 3300006358 Bacteria 1220
305 Ga0068871_102047904 3300006358 Unclassified 545
306 Ga0068871_102259343 3300006358 Unclassified 519
307 Ga0075428_101138361 3300006844 Bacteria 824
308 Ga0075433_11162179 3300006852 Unclassified 670
309 Ga0068865_100388540 3300006881 Bacteria 1140
310 Ga0068865_101535927 3300006881 Unclassified 597
311 Ga0097620_100017745 3300006931 Bacteria 7154
312 Ga0097620_100030289 3300006931 Bacteria 5430
313 Ga0097620_100345878 3300006931 Bacteria 1581
314 Ga0097620_101166952 3300006931 Unclassified 848
315 Ga0105240_10113761 3300009093 Bacteria 3270
316 Ga0105240_10205037 3300009093 Bacteria 2308
317 Ga0105240_10227141 3300009093 Bacteria 2171
318 Ga0105240_10247614 3300009093 Bacteria 2063
319 Ga0105240_10723845 3300009093 Bacteria 1084
320 Ga0111539_10464272 3300009094 Bacteria 1474
321 Ga0105245_10012575 3300009098 Bacteria 7367
322 Ga0105245_10016987 3300009098 Bacteria 6351
323 Ga0105245_10051551 3300009098 Bacteria 3689
324 Ga0105245_10198428 3300009098 Bacteria 1926
325 Ga0105245_11829666 3300009098 Unclassified 660
326 Ga0105247_10108256 3300009101 Bacteria 1785
327 Ga0114129_10195035 3300009147 Bacteria 2747
328 Ga0114129_12440506 3300009147 Bacteria 626
329 Ga0105243_10022275 3300009148 Bacteria 4813
330 Ga0105243_10046162 3300009148 Bacteria 3425
331 Ga0105243_10364435 3300009148 Bacteria 1331
332 Ga0105241_10113927 3300009174 Bacteria 2168
333 Ga0105241_10116659 3300009174 Bacteria 2144
334 Ga0105241_10127466 3300009174 Bacteria 2057
335 Ga0105241_10919052 3300009174 Bacteria 814
336 Ga0105242_10043810 3300009176 Bacteria 3622
337 Ga0105242_10739686 3300009176 Bacteria 967
338 Ga0105248_10016198 3300009177 Bacteria 8205
339 Ga0105248_10031884 3300009177 Bacteria 5889
340 Ga0105248_10080537 3300009177 Bacteria 3660
341 Ga0105248_10315049 3300009177 Bacteria 1762
342 Ga0105248_10646078 3300009177 Bacteria 1194
343 Ga0105237_10042391 3300009545 Bacteria 4589
344 Ga0105237_10046487 3300009545 Bacteria 4365
345 Ga0105238_10055251 3300009551 Bacteria 3987
346 Ga0105238_10084336 3300009551 Bacteria 3167
347 Ga0105238_10131405 3300009551 Bacteria 2482
348 Ga0105238_10134547 3300009551 Bacteria 2450
349 Ga0105238_10179520 3300009551 Bacteria 2094
350 Ga0105249_10336936 3300009553 Bacteria 1524
351 Ga0105032_103594 3300009979 Unclassified 1343
352 Ga0105239_10054774 3300010375 Bacteria 4376
353 Ga0105239_10295056 3300010375 Bacteria 1825
354 Ga0105239_10865947 3300010375 Bacteria 1036
355 Ga0105246_10079172 3300011119 Bacteria 2336
356 Ga0157373_10019821 3300013100 Bacteria 4893
357 Ga0157373_10020418 3300013100 Bacteria 4814
358 Ga0157373_10052932 3300013100 Bacteria 2887
359 Ga0157373_10057676 3300013100 Bacteria 2754
360 Ga0157373_10065847 3300013100 Bacteria 2564
361 Ga0157373_10104521 3300013100 Bacteria 1992
362 Ga0157373_10113482 3300013100 Bacteria 1904
363 Ga0157373_10150646 3300013100 Bacteria 1636
364 Ga0157373_10244882 3300013100 Bacteria 1268
365 Ga0157373_10274722 3300013100 Bacteria 1193
366 Ga0157371_10011587 3300013102 Bacteria 6777
367 Ga0157371_10072281 3300013102 Bacteria 2442
368 Ga0157371_10078626 3300013102 Bacteria 2336
369 Ga0157371_10087969 3300013102 Bacteria 2199
370 Ga0157371_10121977 3300013102 Bacteria 1853
371 Ga0157371_10167267 3300013102 Bacteria 1571
372 Ga0157371_10180348 3300013102 Bacteria 1511
373 Ga0157371_10237789 3300013102 Bacteria 1310
374 Ga0157371_10323479 3300013102 Bacteria 1119
375 Ga0157371_10620646 3300013102 Bacteria 805
376 Ga0157370_10059811 3300013104 Bacteria 3620
377 Ga0157370_10085743 3300013104 Bacteria 2959
378 Ga0157370_10143871 3300013104 Bacteria 2221
379 Ga0157370_10301670 3300013104 Bacteria 1478
380 Ga0157370_10386634 3300013104 Bacteria 1288
381 Ga0157370_10535413 3300013104 Bacteria 1074
382 Ga0157370_10660370 3300013104 Bacteria 955
383 Ga0157370_10726457 3300013104 Bacteria 906
384 Ga0157370_10975848 3300013104 Bacteria 768
385 Ga0157369_10012892 3300013105 Bacteria 9475
386 Ga0157369_10017591 3300013105 Bacteria 8034
387 Ga0157369_10037223 3300013105 Bacteria 5327
388 Ga0157369_10060124 3300013105 Bacteria 4098
389 Ga0157369_10076714 3300013105 Bacteria 3583
390 Ga0157369_10153916 3300013105 Bacteria 2430
391 Ga0157369_10243536 3300013105 Bacteria 1878
392 Ga0157369_10307348 3300013105 Bacteria 1649
393 Ga0157369_10519354 3300013105 Bacteria 1232
394 Ga0157369_10592772 3300013105 Bacteria 1144
395 Ga0157369_10781988 3300013105 Bacteria 981
396 Ga0157369_11361975 3300013105 Bacteria 723
397 Ga0157374_10014255 3300013296 Bacteria 6952
398 Ga0157374_10021424 3300013296 Bacteria 5751
399 Ga0157374_10053773 3300013296 Bacteria 3754
400 Ga0157374_10495150 3300013296 Bacteria 1226
401 Ga0157374_10717215 3300013296 Bacteria 1014
402 Ga0157374_11378608 3300013296 Bacteria 728
403 Ga0157378_10056711 3300013297 Bacteria 3491
404 Ga0157378_10092163 3300013297 Bacteria 2756
405 Ga0157378_10173979 3300013297 Bacteria 2021
406 Ga0157378_10256171 3300013297 Bacteria 1677
407 Ga0157378_12257592 3300013297 Unclassified 596
408 Ga0163162_10127478 3300013306 Bacteria 2652
409 Ga0163162_10521073 3300013306 Bacteria 1318
410 Ga0157372_10091705 3300013307 Bacteria 3455
411 Ga0157372_10257302 3300013307 Bacteria 2027
412 Ga0157372_10596620 3300013307 Bacteria 1287
413 Ga0157372_10624915 3300013307 Bacteria 1255
414 Ga0157372_11442482 3300013307 Unclassified 793
415 Ga0157372_12787255 3300013307 Unclassified 560
416 Ga0157375_10011784 3300013308 Bacteria 7731
417 Ga0157375_10089713 3300013308 Bacteria 3131
418 Ga0157375_10157437 3300013308 Bacteria 2411
419 Ga0157375_10375982 3300013308 Bacteria 1587
420 Ga0157375_10439445 3300013308 Bacteria 1470
421 Ga0163163_10247810 3300014325 Bacteria 1832
422 Ga0157380_10156030 3300014326 Bacteria 1978
423 Ga0157380_10880062 3300014326 Unclassified 920
424 Ga0157377_10099779 3300014745 Bacteria 1728
425 Ga0157379_10275733 3300014968 Bacteria 1530
426 Ga0157379_11310787 3300014968 Bacteria 699
427 Ga0157376_10172397 3300014969 Bacteria 1971
428 Ga0197907_11482614 3300020069 Unclassified 862
429 Ga0206356_10024764 3300020070 Unclassified 851
430 Ga0206354_10983484 3300020081 Bacteria 1621
431 Ga0206353_11028540 3300020082 Unclassified 1285
432 Ga0213875_10017229 3300021388 Bacteria 3495
433 Ga0207697_10003609 3300025315 Bacteria 7585
434 Ga0207697_10143398 3300025315 Bacteria 1037
435 Ga0207697_10197433 3300025315 Bacteria 884
436 Ga0207656_10013827 3300025321 Bacteria 3095
437 Ga0207656_10043096 3300025321 Bacteria 1923
438 Ga0207656_10091669 3300025321 Bacteria 1380
439 Ga0207656_10456047 3300025321 Bacteria 646
440 Ga0207682_10011969 3300025893 Bacteria 3387
441 Ga0207642_10003539 3300025899 Bacteria 4947
442 Ga0207642_10069729 3300025899 Bacteria 1668
443 Ga0207688_10085601 3300025901 Bacteria 1805
444 Ga0207688_10091085 3300025901 Bacteria 1751
445 Ga0207688_10139536 3300025901 Bacteria 1426
446 Ga0207680_10007734 3300025903 Bacteria 5254
447 Ga0207680_10083888 3300025903 Bacteria 2009
448 Ga0207680_10115470 3300025903 Bacteria 1748
449 Ga0207680_10180663 3300025903 Bacteria 1426
450 Ga0207647_10008591 3300025904 Bacteria 7308
451 Ga0207647_10011971 3300025904 Bacteria 6056
452 Ga0207647_10040161 3300025904 Bacteria 2948
453 Ga0207647_10053242 3300025904 Bacteria 2495
454 Ga0207647_10071415 3300025904 Bacteria 2094
455 Ga0207647_10102165 3300025904 Bacteria 1700
456 Ga0207647_10117603 3300025904 Bacteria 1569
457 Ga0207647_10222512 3300025904 Bacteria 1087
458 Ga0207645_10011068 3300025907 Bacteria 6173
459 Ga0207645_10111789 3300025907 Bacteria 1769
460 Ga0207645_10153918 3300025907 Bacteria 1502
461 Ga0207645_10184349 3300025907 Bacteria 1370
462 Ga0207705_10001770 3300025909 Bacteria 17052
463 Ga0207705_10003609 3300025909 Bacteria 11783
464 Ga0207705_10008044 3300025909 Bacteria 7728
465 Ga0207705_10020054 3300025909 Bacteria 4780
466 Ga0207705_10023323 3300025909 Bacteria 4415
467 Ga0207705_10041566 3300025909 Bacteria 3298
468 Ga0207705_10055577 3300025909 Bacteria 2854
469 Ga0207705_10056918 3300025909 Bacteria 2820
470 Ga0207705_10072045 3300025909 Bacteria 2506
471 Ga0207705_10076353 3300025909 Bacteria 2435
472 Ga0207705_10113471 3300025909 Bacteria 2004
473 Ga0207705_10144538 3300025909 Bacteria 1778
474 Ga0207705_10161566 3300025909 Bacteria 1683
475 Ga0207705_10165226 3300025909 Bacteria 1664
476 Ga0207705_10393668 3300025909 Bacteria 1071
477 Ga0207705_10443424 3300025909 Unclassified 1006
478 Ga0207705_10472226 3300025909 Bacteria 973
479 Ga0207705_10521942 3300025909 Unclassified 923
480 Ga0207705_10550261 3300025909 Bacteria 897
481 Ga0207654_10314783 3300025911 Bacteria 1068
482 Ga0207654_10598607 3300025911 Bacteria 786
483 Ga0207707_10026313 3300025912 Bacteria 5085
484 Ga0207707_10357996 3300025912 Bacteria 1257
485 Ga0207707_10542542 3300025912 Bacteria 989
486 Ga0207707_11034967 3300025912 Bacteria 672
487 Ga0207695_10014363 3300025913 Bacteria 9388
488 Ga0207695_10188590 3300025913 Bacteria 1980
489 Ga0207695_10276154 3300025913 Bacteria 1575
490 Ga0207695_10728165 3300025913 Bacteria 872
491 Ga0207671_10141743 3300025914 Bacteria 1852
492 Ga0207693_10018845 3300025915 Bacteria 5493
493 Ga0207660_10014922 3300025917 Bacteria 5121
494 Ga0207660_10044262 3300025917 Bacteria 3132
495 Ga0207660_10436300 3300025917 Bacteria 1058
496 Ga0207660_10481207 3300025917 Bacteria 1006
497 Ga0207660_10654600 3300025917 Bacteria 856
498 Ga0207662_10068687 3300025918 Bacteria 2140
499 Ga0207657_10006637 3300025919 Bacteria 11976
500 Ga0207657_10009671 3300025919 Bacteria 9675
501 Ga0207657_10012629 3300025919 Bacteria 8325
502 Ga0207657_10013869 3300025919 Bacteria 7886
503 Ga0207657_10016054 3300025919 Bacteria 7228
504 Ga0207657_10045967 3300025919 Bacteria 3827
505 Ga0207657_10048589 3300025919 Bacteria 3703
506 Ga0207657_10049254 3300025919 Bacteria 3673
507 Ga0207657_10056193 3300025919 Bacteria 3397
508 Ga0207657_10060282 3300025919 Bacteria 3257
509 Ga0207657_10069683 3300025919 Bacteria 2983
510 Ga0207657_11106834 3300025919 Bacteria 605
511 Ga0207649_10000609 3300025920 Bacteria 24164
512 Ga0207649_10017146 3300025920 Bacteria 4102
513 Ga0207649_10017742 3300025920 Bacteria 4035
514 Ga0207649_10031567 3300025920 Bacteria 3149
515 Ga0207649_10035183 3300025920 Bacteria 3008
516 Ga0207649_10039402 3300025920 Bacteria 2865
517 Ga0207649_10054934 3300025920 Bacteria 2481
518 Ga0207649_10055222 3300025920 Bacteria 2475
519 Ga0207649_10063970 3300025920 Bacteria 2324
520 Ga0207649_10123450 3300025920 Bacteria 1749
521 Ga0207649_10183202 3300025920 Bacteria 1467
522 Ga0207649_10455561 3300025920 Unclassified 966
523 Ga0207649_10940612 3300025920 Unclassified 679
524 Ga0207649_11596097 3300025920 Unclassified 516
525 Ga0207652_10030413 3300025921 Bacteria 4522
526 Ga0207652_10072922 3300025921 Bacteria 2986
527 Ga0207652_10566221 3300025921 Bacteria 1020
528 Ga0207681_10154873 3300025923 Bacteria 1721
529 Ga0207694_10049494 3300025924 Bacteria 3253
530 Ga0207694_10052285 3300025924 Bacteria 3167
531 Ga0207694_10061259 3300025924 Bacteria 2929
532 Ga0207694_10074543 3300025924 Bacteria 2656
533 Ga0207650_10015641 3300025925 Bacteria 5288
534 Ga0207650_10236036 3300025925 Bacteria 1476
535 Ga0207650_10546808 3300025925 Bacteria 971
536 Ga0207659_10064791 3300025926 Bacteria 2646
537 Ga0207687_10130714 3300025927 Bacteria 1892
538 Ga0207687_10196412 3300025927 Bacteria 1574
539 Ga0207687_10491946 3300025927 Bacteria 1023
540 Ga0207687_11508624 3300025927 Unclassified 577
541 Ga0207644_10005901 3300025931 Bacteria 7986
542 Ga0207644_10010410 3300025931 Bacteria 6127
543 Ga0207644_10064872 3300025931 Bacteria 2654
544 Ga0207644_10167803 3300025931 Bacteria 1711
545 Ga0207690_10021720 3300025932 Bacteria 3984
546 Ga0207690_10040828 3300025932 Bacteria 3036
547 Ga0207690_10057730 3300025932 Bacteria 2623
548 Ga0207690_10096114 3300025932 Bacteria 2106
549 Ga0207690_10111500 3300025932 Bacteria 1971
550 Ga0207690_10113203 3300025932 Bacteria 1958
551 Ga0207690_10116250 3300025932 Bacteria 1934
552 Ga0207690_10142031 3300025932 Bacteria 1770
553 Ga0207690_10172357 3300025932 Bacteria 1622
554 Ga0207690_10207385 3300025932 Bacteria 1492
555 Ga0207690_10258974 3300025932 Bacteria 1347
556 Ga0207690_10379367 3300025932 Bacteria 1123
557 Ga0207690_10580637 3300025932 Bacteria 913
558 Ga0207706_10010928 3300025933 Bacteria 8279
559 Ga0207706_10017233 3300025933 Bacteria 6512
560 Ga0207706_10022481 3300025933 Bacteria 5659
561 Ga0207706_10059992 3300025933 Bacteria 3350
562 Ga0207706_10082822 3300025933 Bacteria 2820
563 Ga0207706_10093332 3300025933 Bacteria 2647
564 Ga0207706_10101119 3300025933 Bacteria 2536
565 Ga0207706_10428635 3300025933 Bacteria 1145
566 Ga0207706_10623912 3300025933 Bacteria 925
567 Ga0207686_10119720 3300025934 Bacteria 1790
568 Ga0207686_10196916 3300025934 Bacteria 1440
569 Ga0207709_10020092 3300025935 Bacteria 3764
570 Ga0207709_10174688 3300025935 Bacteria 1511
571 Ga0207709_10336951 3300025935 Bacteria 1134
572 Ga0207670_11006401 3300025936 Unclassified 701
573 Ga0207669_10147668 3300025937 Bacteria 1642
574 Ga0207669_10154177 3300025937 Bacteria 1613
575 Ga0207669_10155239 3300025937 Bacteria 1609
576 Ga0207669_10264649 3300025937 Bacteria 1288
577 Ga0207669_11141135 3300025937 Unclassified 659
578 Ga0207704_10263280 3300025938 Bacteria 1301
579 Ga0207691_10053748 3300025940 Bacteria 3676
580 Ga0207691_10067449 3300025940 Bacteria 3235
581 Ga0207691_10225294 3300025940 Bacteria 1625
582 Ga0207691_10885742 3300025940 Bacteria 748
583 Ga0207711_10001586 3300025941 Bacteria 20994
584 Ga0207711_10012397 3300025941 Bacteria 7086
585 Ga0207711_10086336 3300025941 Bacteria 2751
586 Ga0207711_10865428 3300025941 Bacteria 841
587 Ga0207661_10014880 3300025944 Bacteria 5708
588 Ga0207661_10029303 3300025944 Bacteria 4226
589 Ga0207661_10043986 3300025944 Bacteria 3526
590 Ga0207661_10284814 3300025944 Bacteria 1478
591 Ga0207661_10452581 3300025944 Bacteria 1169
592 Ga0207679_10016312 3300025945 Bacteria 4931
593 Ga0207679_10020313 3300025945 Bacteria 4481
594 Ga0207679_10024962 3300025945 Bacteria 4104
595 Ga0207679_10036166 3300025945 Bacteria 3500
596 Ga0207679_10074803 3300025945 Bacteria 2568
597 Ga0207679_10075951 3300025945 Bacteria 2551
598 Ga0207679_10111043 3300025945 Bacteria 2164
599 Ga0207679_10188069 3300025945 Bacteria 1714
600 Ga0207679_10761223 3300025945 Bacteria 881
601 Ga0207679_11848047 3300025945 Unclassified 551
602 Ga0207667_10012522 3300025949 Bacteria 9764
603 Ga0207667_10040678 3300025949 Bacteria 4949
604 Ga0207667_10058404 3300025949 Bacteria 4046
605 Ga0207667_10098724 3300025949 Bacteria 3013
606 Ga0207667_10150361 3300025949 Bacteria 2397
607 Ga0207667_10158671 3300025949 Bacteria 2327
608 Ga0207667_10188860 3300025949 Bacteria 2114
609 Ga0207667_10245627 3300025949 Bacteria 1831
610 Ga0207667_10342973 3300025949 Bacteria 1524
611 Ga0207667_10737549 3300025949 Bacteria 985
612 Ga0207667_11073060 3300025949 Bacteria 790
613 Ga0207667_11250403 3300025949 Unclassified 720
614 Ga0207667_11508403 3300025949 Bacteria 643
615 Ga0207651_10001064 3300025960 Bacteria 12172
616 Ga0207651_10017121 3300025960 Bacteria 4271
617 Ga0207651_10162444 3300025960 Bacteria 1752
618 Ga0207651_10177361 3300025960 Bacteria 1686
619 Ga0207668_10248460 3300025972 Bacteria 1443
620 Ga0207668_10279728 3300025972 Bacteria 1368
621 Ga0207640_10006995 3300025981 Bacteria 6208
622 Ga0207640_10011184 3300025981 Bacteria 5075
623 Ga0207640_10020967 3300025981 Bacteria 3886
624 Ga0207640_10025728 3300025981 Bacteria 3566
625 Ga0207640_10119774 3300025981 Bacteria 1883
626 Ga0207640_10160695 3300025981 Bacteria 1662
627 Ga0207640_10166894 3300025981 Bacteria 1636
628 Ga0207640_10201817 3300025981 Bacteria 1508
629 Ga0207640_10207011 3300025981 Bacteria 1491
630 Ga0207640_10286430 3300025981 Bacteria 1297
631 Ga0207640_11106035 3300025981 Bacteria 701
632 Ga0207658_10015410 3300025986 Bacteria 5243
633 Ga0207658_10022103 3300025986 Bacteria 4425
634 Ga0207658_10050500 3300025986 Bacteria 3061
635 Ga0207658_10050773 3300025986 Bacteria 3053
636 Ga0207658_10057410 3300025986 Bacteria 2892
637 Ga0207658_10077272 3300025986 Bacteria 2539
638 Ga0207658_10232161 3300025986 Bacteria 1558
639 Ga0207658_11363023 3300025986 Bacteria 649
640 Ga0207677_10007773 3300026023 Bacteria 5952
641 Ga0207677_10018428 3300026023 Bacteria 4189
642 Ga0207677_10162593 3300026023 Bacteria 1736
643 Ga0207677_10243831 3300026023 Bacteria 1455
644 Ga0207677_10666686 3300026023 Bacteria 920
645 Ga0207703_10001131 3300026035 Bacteria 25163
646 Ga0207703_10309149 3300026035 Bacteria 1444
647 Ga0207703_10346513 3300026035 Bacteria 1367
648 Ga0207639_10005372 3300026041 Bacteria 8660
649 Ga0207639_10035157 3300026041 Bacteria 3707
650 Ga0207639_10075162 3300026041 Bacteria 2656
651 Ga0207639_10094009 3300026041 Bacteria 2406
652 Ga0207639_10152837 3300026041 Bacteria 1935
653 Ga0207639_10160442 3300026041 Bacteria 1894
654 Ga0207639_10258373 3300026041 Bacteria 1522
655 Ga0207639_10287397 3300026041 Bacteria 1449
656 Ga0207639_10470431 3300026041 Bacteria 1144
657 Ga0207639_10578421 3300026041 Bacteria 1034
658 Ga0207678_10008034 3300026067 Bacteria 9300
659 Ga0207678_10008741 3300026067 Bacteria 8914
660 Ga0207678_10018256 3300026067 Bacteria 6160
661 Ga0207678_10034890 3300026067 Bacteria 4381
662 Ga0207678_10049425 3300026067 Bacteria 3634
663 Ga0207678_10077827 3300026067 Bacteria 2840
664 Ga0207678_10083764 3300026067 Bacteria 2728
665 Ga0207678_10094505 3300026067 Bacteria 2554
666 Ga0207678_10097948 3300026067 Bacteria 2506
667 Ga0207678_10199844 3300026067 Bacteria 1709
668 Ga0207702_10005398 3300026078 Bacteria 11196
669 Ga0207702_10007420 3300026078 Bacteria 9358
670 Ga0207702_10011401 3300026078 Bacteria 7410
671 Ga0207702_10023661 3300026078 Bacteria 5095
672 Ga0207702_10250408 3300026078 Bacteria 1663
673 Ga0207702_10437580 3300026078 Bacteria 1267
674 Ga0207702_10486849 3300026078 Bacteria 1201
675 Ga0207641_10005432 3300026088 Bacteria 10876
676 Ga0207641_10010661 3300026088 Bacteria 7540
677 Ga0207641_10020616 3300026088 Bacteria 5416
678 Ga0207641_10646569 3300026088 Bacteria 1038
679 Ga0207641_10679120 3300026088 Bacteria 1013
680 Ga0207641_11553909 3300026088 Bacteria 663
681 Ga0207648_10011594 3300026089 Bacteria 8299
682 Ga0207648_10076673 3300026089 Bacteria 2914
683 Ga0207648_10099037 3300026089 Bacteria 2553
684 Ga0207648_10237119 3300026089 Bacteria 1624
685 Ga0207676_10011103 3300026095 Bacteria 6429
686 Ga0207676_10126804 3300026095 Bacteria 2163
687 Ga0207674_10019429 3300026116 Bacteria 7357
688 Ga0207674_10061064 3300026116 Bacteria 3809
689 Ga0207674_10173578 3300026116 Bacteria 2108
690 Ga0207674_10316547 3300026116 Bacteria 1510
691 Ga0207675_100107740 3300026118 Bacteria 2627
692 Ga0207683_10034084 3300026121 Bacteria 4424
693 Ga0207683_10035825 3300026121 Bacteria 4316
694 Ga0207698_10001495 3300026142 Bacteria 13610
695 Ga0207698_10003511 3300026142 Bacteria 9453
696 Ga0207698_10009252 3300026142 Bacteria 6270
697 Ga0207698_10026189 3300026142 Bacteria 4122
698 Ga0207698_10174290 3300026142 Bacteria 1897
699 Ga0207698_10228234 3300026142 Bacteria 1688
700 Ga0207698_10274743 3300026142 Bacteria 1555
701 Ga0207698_10515931 3300026142 Bacteria 1165
702 Ga0207698_10780335 3300026142 Bacteria 956
703 Ga0207698_11549281 3300026142 Unclassified 678
704 Ga0268266_10108661 3300028379 Bacteria 2455
705 Ga0268266_10913210 3300028379 Bacteria 849
706 Ga0268265_11216891 3300028380 Unclassified 751
707 Ga0268264_10136746 3300028381 Bacteria 2180
708 Ga0268264_10167220 3300028381 Bacteria 1986
709 Ga0268264_10339339 3300028381 Bacteria 1427
710 Ga0268264_10353434 3300028381 Bacteria 1399
711 Ga0316182_1268691 3300030745 Bacteria 1001
712 Ga0307408_100072989 3300031548 Bacteria 2542
713 Ga0307408_100258169 3300031548 Bacteria 1441
714 Ga0307405_10094732 3300031731 Bacteria 1986
715 Ga0307405_10200833 3300031731 Bacteria 1448
716 Ga0307405_10340018 3300031731 Bacteria 1154
717 Ga0307413_10011592 3300031824 Bacteria 4346
718 Ga0307413_11928748 3300031824 Bacteria 531
719 Ga0307410_10004325 3300031852 Bacteria 7325
720 Ga0307410_10017783 3300031852 Bacteria 4278
721 Ga0307410_10019949 3300031852 Bacteria 4090
722 Ga0307410_10058833 3300031852 Bacteria 2621
723 Ga0307410_10135811 3300031852 Bacteria 1813
724 Ga0307410_10189220 3300031852 Bacteria 1564
725 Ga0307410_10356904 3300031852 Bacteria 1170
726 Ga0307410_10720171 3300031852 Bacteria 842
727 Ga0307406_10061210 3300031901 Bacteria 2430
728 Ga0307406_10246739 3300031901 Bacteria 1343
729 Ga0307406_10288701 3300031901 Bacteria 1255
730 Ga0307406_10520247 3300031901 Bacteria 968
731 Ga0307407_10015741 3300031903 Bacteria 3749
732 Ga0307407_10131552 3300031903 Bacteria 1601
733 Ga0307407_10164887 3300031903 Bacteria 1453
734 Ga0307407_10289208 3300031903 Bacteria 1138
735 Ga0307407_10422927 3300031903 Bacteria 961
736 Ga0307412_10171977 3300031911 Bacteria 1621
737 Ga0307412_10539212 3300031911 Bacteria 978
738 Ga0307409_100037602 3300031995 Bacteria 3570
739 Ga0307409_100037694 3300031995 Bacteria 3566
740 Ga0307409_100046604 3300031995 Bacteria 3283
741 Ga0307409_100192794 3300031995 Bacteria 1815
742 Ga0307409_100302593 3300031995 Bacteria 1488
743 Ga0307409_100329347 3300031995 Bacteria 1432
744 Ga0307409_101372419 3300031995 Bacteria 733
745 Ga0307416_100072310 3300032002 Bacteria 2870
746 Ga0307416_100081435 3300032002 Bacteria 2737
747 Ga0307416_100219199 3300032002 Bacteria 1823
748 Ga0307416_100273737 3300032002 Bacteria 1660
749 Ga0307416_100339982 3300032002 Bacteria 1513
750 Ga0307416_100782864 3300032002 Bacteria 1048
751 Ga0307416_100831637 3300032002 Bacteria 1021
752 Ga0307416_101130720 3300032002 Bacteria 888
753 Ga0307414_10024662 3300032004 Bacteria 3839
754 Ga0307414_10792233 3300032004 Bacteria 864
755 Ga0307414_11395623 3300032004 Bacteria 651
756 Ga0307414_11861155 3300032004 Unclassified 562
757 Ga0307411_10001080 3300032005 Bacteria 10587
758 Ga0307411_10015528 3300032005 Bacteria 4281
759 Ga0307411_10218319 3300032005 Bacteria 1477
760 Ga0307411_10723867 3300032005 Bacteria 869
761 Ga0307411_10789598 3300032005 Unclassified 835
762 Ga0307411_10970574 3300032005 Bacteria 759
763 Ga0307415_100102394 3300032126 Bacteria 2104
764 Ga0307415_100263268 3300032126 Bacteria 1408
765 Ga0307415_100363294 3300032126 Bacteria 1223
766 Ga0307415_100628858 3300032126 Bacteria 959
767 Ga0307415_100704632 3300032126 Bacteria 911
768 Ga0307415_100913150 3300032126 Bacteria 810
769 Ga0307415_101324001 3300032126 Bacteria 683
770 Ga0373940_0181648 3300035088 Bacteria 684
771 Ga0373960_0352143 3300035121 Bacteria 559
772 Ga0373942_0262631 3300035207 Unclassified 590
773 Ga0373961_0209969 3300035241 Bacteria 690
774 Ga0373962_0045100 3300035242 Bacteria 1255
775 Ga0373962_0174182 3300035242 Bacteria 716
776 Ga0373931_0637155 3300035691 Bacteria 699
777 Ga0395899_0003159 3300037312 Bacteria 13082
778 Ga0395899_0010009 3300037312 Bacteria 7270
779 Ga0395899_0012795 3300037312 Bacteria 6428
780 Ga0395899_0018141 3300037312 Bacteria 5354
781 Ga0395899_0031153 3300037312 Bacteria 4008
782 Ga0395899_0081035 3300037312 Bacteria 2362
783 Ga0395899_0099940 3300037312 Bacteria 2095
784 Ga0395899_0122223 3300037312 Bacteria 1863
785 Ga0395899_0127942 3300037312 Bacteria 1816
786 Ga0395899_0129289 3300037312 Bacteria 1804
787 Ga0395899_0212738 3300037312 Bacteria 1343
788 Ga0395899_0220931 3300037312 Bacteria 1312
789 Ga0395899_0308682 3300037312 Bacteria 1068
790 Ga0395899_0558200 3300037312 Bacteria 735
791 Ga0395899_0604840 3300037312 Bacteria 698
792 Ga0395900_0003502 3300037418 Bacteria 16945
793 Ga0395900_0008180 3300037418 Bacteria 10762
794 Ga0395900_0011717 3300037418 Bacteria 8965
795 Ga0395900_0015629 3300037418 Bacteria 7737
796 Ga0395900_0041426 3300037418 Bacteria 4748
797 Ga0395900_0055890 3300037418 Bacteria 4064
798 Ga0395900_0069977 3300037418 Bacteria 3607
799 Ga0395900_0086435 3300037418 Bacteria 3223
800 Ga0395900_0104018 3300037418 Bacteria 2917
801 Ga0395900_0120169 3300037418 Bacteria 2696
802 Ga0395900_0160689 3300037418 Bacteria 2292
803 Ga0395900_0236271 3300037418 Bacteria 1835
804 Ga0395900_0272569 3300037418 Bacteria 1686
805 Ga0395900_0302066 3300037418 Bacteria 1586
806 Ga0395900_0310088 3300037418 Bacteria 1561
807 Ga0395900_0321875 3300037418 Bacteria 1526
808 Ga0395900_0436009 3300037418 Bacteria 1269
809 Ga0395900_0460665 3300037418 Unclassified 1226
810 Ga0395900_0616174 3300037418 Bacteria 1024
811 Ga0395900_0631538 3300037418 Unclassified 1009
812 Ga0395900_0994201 3300037418 Unclassified 759
813 Ga0395900_1063387 3300037418 Bacteria 727
814 Ga0395900_1216571 3300037418 Unclassified 668
815 Ga0395900_1218423 3300037418 Unclassified 668
816 Ga0395900_1289512 3300037418 Bacteria 644
817 Ga0395900_1489580 3300037418 Unclassified 589
818 Ga0395900_1656821 3300037418 Bacteria 551
819 Ga0395898_0006138 3300037466 Bacteria 12878
820 Ga0395898_0022087 3300037466 Bacteria 6446
821 Ga0395898_0030146 3300037466 Bacteria 5430
822 Ga0395898_0049474 3300037466 Bacteria 4118
823 Ga0395898_0062485 3300037466 Bacteria 3616
824 Ga0395898_0065673 3300037466 Bacteria 3517
825 Ga0395898_0094720 3300037466 Bacteria 2869
826 Ga0395898_0125150 3300037466 Bacteria 2462
827 Ga0395898_0230467 3300037466 Bacteria 1766
828 Ga0395898_0307288 3300037466 Bacteria 1513
829 Ga0395898_0312866 3300037466 Bacteria 1498
830 Ga0395898_0362865 3300037466 Bacteria 1381
831 Ga0395898_0518375 3300037466 Bacteria 1133
832 Ga0395898_0579674 3300037466 Bacteria 1064
833 Ga0395898_0631625 3300037466 Bacteria 1013
834 Ga0395898_0934765 3300037466 Bacteria 804
835 Ga0395898_1077509 3300037466 Bacteria 737
836 Ga0395898_1269811 3300037466 Unclassified 666
837 Ga0395898_1515586 3300037466 Bacteria 596
838 Ga0395905_0001949 3300037471 Bacteria 23650
839 Ga0395905_0003598 3300037471 Bacteria 16480
840 Ga0395905_0013181 3300037471 Bacteria 7935
841 Ga0395905_0014848 3300037471 Bacteria 7428
842 Ga0395905_0028235 3300037471 Bacteria 5289
843 Ga0395905_0042071 3300037471 Bacteria 4286
844 Ga0395905_0094434 3300037471 Bacteria 2806
845 Ga0395905_0117294 3300037471 Bacteria 2501
846 Ga0395905_0163218 3300037471 Bacteria 2093
847 Ga0395905_0170316 3300037471 Bacteria 2045
848 Ga0395905_0173389 3300037471 Bacteria 2025
849 Ga0395905_0241034 3300037471 Bacteria 1689
850 Ga0395905_0252156 3300037471 Bacteria 1648
851 Ga0395905_0366621 3300037471 Bacteria 1333
852 Ga0395905_0366633 3300037471 Bacteria 1333
853 Ga0395905_0408188 3300037471 Bacteria 1253
854 Ga0395905_0424247 3300037471 Unclassified 1226
855 Ga0395905_0448151 3300037471 Bacteria 1188
856 Ga0395905_0507929 3300037471 Bacteria 1106
857 Ga0395905_0698655 3300037471 Bacteria 916
858 Ga0395905_0698733 3300037471 Bacteria 916
859 Ga0395905_0862450 3300037471 Unclassified 808
860 Ga0395905_0879671 3300037471 Bacteria 799
861 Ga0395905_1395881 3300037471 Unclassified 604
862 Ga0395905_1420272 3300037471 Bacteria 598
863 Ga0436364_0792406 3300037853 Bacteria 3558
864 Ga0395901_0005705 3300038443 Bacteria 12599
865 Ga0395901_0014347 3300038443 Bacteria 8067
866 Ga0395901_0014751 3300038443 Bacteria 7942
867 Ga0395901_0044472 3300038443 Bacteria 4606
868 Ga0395901_0047933 3300038443 Bacteria 4436
869 Ga0395901_0062335 3300038443 Bacteria 3880
870 Ga0395901_0079373 3300038443 Bacteria 3427
871 Ga0395901_0102079 3300038443 Bacteria 3009
872 Ga0395901_0105231 3300038443 Bacteria 2961
873 Ga0395901_0120668 3300038443 Bacteria 2755
874 Ga0395901_0305248 3300038443 Bacteria 1649
875 Ga0395901_0315471 3300038443 Bacteria 1618
876 Ga0395901_0346053 3300038443 Bacteria 1535
877 Ga0395901_0356771 3300038443 Bacteria 1508
878 Ga0395901_0382442 3300038443 Bacteria 1448
879 Ga0395901_0561026 3300038443 Bacteria 1156
880 Ga0395901_0742206 3300038443 Bacteria 975
881 Ga0395901_0849206 3300038443 Bacteria 898
882 Ga0395901_0972360 3300038443 Bacteria 826
883 Ga0395901_1027651 3300038443 Unclassified 798
884 Ga0395901_1308113 3300038443 Bacteria 686
885 Ga0395901_1405396 3300038443 Unclassified 656
886 Ga0395901_1736571 3300038443 Unclassified 574
887 Ga0395901_2157864 3300038443 Bacteria 501
888 Ga0439438_122239 3300041405 Unclassified 626
889 Ga0439432_004519 3300042006 Bacteria 5077
890 Ga0450898_049869 3300042134 Unclassified 807
891 Ga0450899_025489 3300042135 Unclassified 705
892 Ga0439458_0011922 3300042157 Bacteria 1947
893 Ga0439458_0175610 3300042157 Bacteria 580
894 Ga0466972_0012993 3300044658 Bacteria 4183
895 Ga0466972_0165979 3300044658 Unclassified 1037
896 Ga0466972_0251012 3300044658 Bacteria 827
897 Ga0466965_0360342 3300044683 Bacteria 798
898 Ga0466966_0000003 3300044684 Bacteria 233677
899 Ga0466966_0004449 3300044684 Bacteria 9243
900 Ga0466966_0077444 3300044684 Bacteria 2075
901 Ga0466966_0291809 3300044684 Bacteria 980
902 Ga0466966_0302969 3300044684 Bacteria 960
903 Ga0466961_0342246 3300044693 Bacteria 911
904 Ga0466963_0006348 3300044694 Bacteria 6992
905 Ga0466963_0027629 3300044694 Bacteria 3635
906 Ga0466963_0032139 3300044694 Bacteria 3397
907 Ga0466963_0105277 3300044694 Bacteria 1933
908 Ga0466963_0158794 3300044694 Bacteria 1573
909 Ga0466963_0196401 3300044694 Bacteria 1410
910 Ga0466963_0254063 3300044694 Bacteria 1233
911 Ga0466963_0266319 3300044694 Bacteria 1204
912 Ga0466963_0320979 3300044694 Bacteria 1090
913 Ga0466963_0626957 3300044694 Bacteria 759
914 Ga0466963_0646646 3300044694 Bacteria 746
915 Ga0466964_0075537 3300044706 Bacteria 1435
916 Ga0466971_0074134 3300044719 Bacteria 1547
917 Ga0466970_0185014 3300044765 Bacteria 1156
918 Ga0466957_0029232 3300044842 Bacteria 3285
919 Ga0466957_0110500 3300044842 Bacteria 1743
920 Ga0466957_0128913 3300044842 Bacteria 1619
921 Ga0466957_0145538 3300044842 Bacteria 1529
922 Ga0466957_0255018 3300044842 Bacteria 1167
923 Ga0466957_0463131 3300044842 Bacteria 875
924 Ga0466960_0150832 3300044901 Bacteria 1242
925 Ga0466960_0783862 3300044901 Unclassified 576
926 Ga0466959_0299596 3300045049 Bacteria 1101
927 Ga0466959_0836032 3300045049 Bacteria 615
928 Ga0466958_0264914 3300045836 Bacteria 1100
929 Ga0466958_0372521 3300045836 Bacteria 920
930 Ga0466958_0439889 3300045836 Bacteria 844
931 Ga0466967_0043676 3300045976 Bacteria 3882
932 Ga0466967_0083855 3300045976 Bacteria 2883
933 Ga0466967_0085523 3300045976 Bacteria 2855
934 Ga0466967_0162182 3300045976 Bacteria 2099
935 Ga0466967_0216012 3300045976 Bacteria 1820
936 Ga0466967_0360607 3300045976 Bacteria 1408
937 Ga0466967_0599350 3300045976 Bacteria 1087
938 Ga0466967_0625443 3300045976 Bacteria 1063
939 Ga0466967_1344992 3300045976 Unclassified 711
940 Ga0466967_1625837 3300045976 Bacteria 643
941 Ga0495629_0484109 3300046459 Bacteria 836
942 Ga0495584_0469123 3300046491 Unclassified 641
943 Ga0495642_0037967 3300046528 Bacteria 1950
944 Ga0495598_0000969 3300046537 Bacteria 5539
945 Ga0495621_0000609 3300046539 Bacteria 8968
946 Ga0495621_0111745 3300046539 Bacteria 1048
947 Ga0495668_0261016 3300046616 Bacteria 948
948 Ga0495669_0063502 3300046684 Bacteria 1675
949 Ga0495669_0128390 3300046684 Bacteria 1192
950 Ga0495669_0206949 3300046684 Bacteria 939
951 Ga0495669_0250238 3300046684 Bacteria 851
952 Ga0495670_0002361 3300046691 Bacteria 9293
953 Ga0496100_0009195 3300048903 Bacteria 5544
954 Ga0496100_0417061 3300048903 Bacteria 1025
955 Ga0496101_0005978 3300048904 Bacteria 7802
956 Ga0496101_0322017 3300048904 Bacteria 1213
957 Ga0496101_1569938 3300048904 Unclassified 512
958 Ga0496102_0461494 3300048905 Bacteria 1191
959 Ga0496102_0819194 3300048905 Unclassified 853
960 Ga0496103_0011091 3300048906 Bacteria 5337
961 Ga0496104_0205663 3300048907 Bacteria 1880
962 Ga0496104_1052041 3300048907 Unclassified 718
963 Ga0496105_0010892 3300048908 Bacteria 7162
964 Ga0496105_0120864 3300048908 Bacteria 2160
965 Ga0496107_0009344 3300048910 Bacteria 6795
966 Ga0496107_0217249 3300048910 Bacteria 1422
967 Ga0496107_0235021 3300048910 Bacteria 1364
968 Ga0496107_0286131 3300048910 Bacteria 1227
969 Ga0496108_0006649 3300048911 Bacteria 9363
970 Ga0496108_0022816 3300048911 Bacteria 5149
971 Ga0496108_1295035 3300048911 Unclassified 613
972 Ga0496109_0010191 3300048912 Bacteria 8023
973 Ga0496109_0488070 3300048912 Bacteria 1163
974 Ga0496109_0733676 3300048912 Bacteria 926
975 Ga0496109_0756955 3300048912 Unclassified 909
976 Ga0496109_1436497 3300048912 Unclassified 625
977 Ga0496110_0019059 3300048913 Bacteria 5767
978 Ga0496111_0020047 3300048914 Bacteria 4650
979 Ga0496112_0010385 3300048915 Bacteria 8443
980 Ga0496112_0078448 3300048915 Bacteria 3266
981 Ga0496112_0125247 3300048915 Bacteria 2540
982 Ga0496112_0240243 3300048915 Bacteria 1764
983 Ga0496112_0812790 3300048915 Unclassified 859
984 Ga0496113_0325552 3300048916 Bacteria 1232
985 Ga0496113_0683054 3300048916 Bacteria 820
986 Ga0496114_0000069 3300048917 Bacteria 73894
987 Ga0496114_0837090 3300048917 Bacteria 800
988 Ga0501298_003475 3300049521 Bacteria 2440
989 Ga0501040_0677854 3300049576 Unclassified 745
990 Ga0501067_0050652 3300049583 Bacteria 2301
991 Ga0501067_0190404 3300049583 Unclassified 1143
992 Ga0501071_0318593 3300049587 Bacteria 1181
993 Ga0501198_004657 3300049649 Bacteria 1911
994 Ga0501199_003215 3300049650 Bacteria 1559
995 Ga0501209_137532 3300049656 Unclassified 731
996 Ga0501216_010060 3300049660 Bacteria 1516
997 Ga0501217_027089 3300049661 Bacteria 1389
998 Ga0501223_002822 3300049663 Bacteria 3808
999 Ga0501223_044756 3300049663 Bacteria 859
1000 Ga0501224_007313 3300049664 Bacteria 1609
1001 Ga0501233_033334 3300049668 Bacteria 1176
1002 Ga0501235_002872 3300049669 Bacteria 3713
1003 Ga0501235_027377 3300049669 Bacteria 1279
1004 Ga0501247_063426 3300049677 Unclassified 571
1005 Ga0501221_002960 3300049704 Bacteria 2798
1006 Ga0501225_0021079 3300049705 Bacteria 1801
1007 Ga0501234_019691 3300049707 Bacteria 1072
1008 Ga0501245_034329 3300049708 Bacteria 850
1009 Ga0501262_014071 3300049759 Bacteria 1038
1010 Ga0501263_035112 3300049760 Bacteria 721
1011 Ga0501267_003992 3300049764 Bacteria 1359
1012 Ga0501268_004296 3300049765 Bacteria 2000
1013 Ga0501270_002531 3300049767 Bacteria 1883
1014 Ga0501273_004249 3300049770 Bacteria 1566
1015 Ga0501279_014247 3300049775 Bacteria 1093
1016 Ga0501204_044804 3300049850 Bacteria 660
1017 nmdc:mga00v17_46877_c1 3300050491 Bacteria 2616
1018 nmdc:mga0k408_304599_c1 3300050493 Bacteria 951
1019 nmdc:mga05p37_1587520_c1 3300050507 Bacteria 645
1020 nmdc:mga08y16_933203_c1 3300050511 Bacteria 852
1021 nmdc:mga0n895_605609_c1 3300050512 Bacteria 1097
1022 nmdc:mga0a205_1473562_c1 3300050515 Unclassified 529
1023 Ga0466962_0000327 3300061719 Bacteria 20387
1024 Ga0466962_0018553 3300061719 Bacteria 3347
1025 Ga0466962_0115810 3300061719 Bacteria 1291

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044842 Ga0466957_0029232 Ga0466957_0029232_18_395 125
2 3300049850 Ga0501204_044804 Ga0501204_044804_123_500 125
3 3300032126 Ga0307415_101324001 Ga0307415_1013240012 126
4 3300005327 Ga0070658_10117686 Ga0070658_101176862 127
5 3300005435 Ga0070714_100393350 Ga0070714_1003933501 127
6 3300005616 Ga0068852_101019848 Ga0068852_1010198481 127
7 3300038443 Ga0395901_0356771 Ga0395901_0356771_15_398 127
8 3300001904 JGI24736J21556_1031289 JGI24736J21556_10312892 134
9 3300001979 JGI24740J21852_10008659 JGI24740J21852_100086592 134
10 3300001979 JGI24740J21852_10034115 JGI24740J21852_100341152 134
11 3300001989 JGI24739J22299_10009129 JGI24739J22299_100091292 134
12 3300001989 JGI24739J22299_10021228 JGI24739J22299_100212284 134
13 3300001990 JGI24737J22298_10004177 JGI24737J22298_100041774 134
14 3300001990 JGI24737J22298_10032855 JGI24737J22298_100328552 134
15 3300001990 JGI24737J22298_10051823 JGI24737J22298_100518232 134
16 3300001991 JGI24743J22301_10007370 JGI24743J22301_100073702 134
17 3300001991 JGI24743J22301_10031105 JGI24743J22301_100311051 134
18 3300001991 JGI24743J22301_10035884 JGI24743J22301_100358842 134
19 3300002067 JGI24735J21928_10031903 JGI24735J21928_100319032 134
20 3300002067 JGI24735J21928_10132300 JGI24735J21928_101323001 134
21 3300002073 JGI24745J21846_1003710 JGI24745J21846_10037102 134
22 3300002077 JGI24744J21845_10000111 JGI24744J21845_100001117 134
23 3300002244 JGI24742J22300_10015013 JGI24742J22300_100150132 134
24 3300005289 Ga0065704_10042887 Ga0065704_100428872 134
25 3300005293 Ga0065715_10184812 Ga0065715_101848122 134
26 3300005327 Ga0070658_10005690 Ga0070658_100056905 134
27 3300005327 Ga0070658_10028246 Ga0070658_100282462 134
28 3300005327 Ga0070658_10044805 Ga0070658_100448052 134
29 3300005327 Ga0070658_10049652 Ga0070658_100496522 134
30 3300005327 Ga0070658_10078042 Ga0070658_100780425 134
31 3300005327 Ga0070658_10106887 Ga0070658_101068872 134
32 3300005327 Ga0070658_10114352 Ga0070658_101143525 134
33 3300005327 Ga0070658_10132943 Ga0070658_101329432 134
34 3300005327 Ga0070658_10265834 Ga0070658_102658341 134
35 3300005327 Ga0070658_10322902 Ga0070658_103229022 134
36 3300005327 Ga0070658_10333048 Ga0070658_103330482 134
37 3300005327 Ga0070658_10347864 Ga0070658_103478642 134
38 3300005327 Ga0070658_10754517 Ga0070658_107545171 134
39 3300005327 Ga0070658_10825464 Ga0070658_108254642 134
40 3300005327 Ga0070658_10827438 Ga0070658_108274382 134
41 3300005327 Ga0070658_10964448 Ga0070658_109644482 134
42 3300005327 Ga0070658_11004821 Ga0070658_110048211 134
43 3300005327 Ga0070658_11034082 Ga0070658_110340821 134
44 3300005327 Ga0070658_11292408 Ga0070658_112924082 134
45 3300005328 Ga0070676_10030556 Ga0070676_100305565 134
46 3300005328 Ga0070676_10057428 Ga0070676_100574282 134
47 3300005328 Ga0070676_10089920 Ga0070676_100899203 134
48 3300005328 Ga0070676_10113005 Ga0070676_101130052 134
49 3300005328 Ga0070676_10117500 Ga0070676_101175002 134
50 3300005328 Ga0070676_10124527 Ga0070676_101245272 134
51 3300005328 Ga0070676_10761984 Ga0070676_107619841 134
52 3300005329 Ga0070683_100005914 Ga0070683_1000059142 134
53 3300005329 Ga0070683_100016035 Ga0070683_1000160355 134
54 3300005329 Ga0070683_100043657 Ga0070683_1000436572 134
55 3300005329 Ga0070683_100116324 Ga0070683_1001163242 134
56 3300005329 Ga0070683_100362861 Ga0070683_1003628612 134
57 3300005330 Ga0070690_100005454 Ga0070690_1000054545 134
58 3300005330 Ga0070690_100011910 Ga0070690_1000119105 134
59 3300005331 Ga0070670_100190759 Ga0070670_1001907593 134
60 3300005331 Ga0070670_100234802 Ga0070670_1002348022 134
61 3300005331 Ga0070670_100578950 Ga0070670_1005789502 134
62 3300005333 Ga0070677_10046990 Ga0070677_100469902 134
63 3300005334 Ga0068869_100079144 Ga0068869_1000791442 134
64 3300005334 Ga0068869_100385084 Ga0068869_1003850842 134
65 3300005334 Ga0068869_100896723 Ga0068869_1008967232 134
66 3300005335 Ga0070666_10005568 Ga0070666_100055685 134
67 3300005335 Ga0070666_10016133 Ga0070666_100161335 134
68 3300005335 Ga0070666_10020416 Ga0070666_100204162 134
69 3300005335 Ga0070666_10050842 Ga0070666_100508423 134
70 3300005335 Ga0070666_10376765 Ga0070666_103767652 134
71 3300005335 Ga0070666_10708590 Ga0070666_107085902 134
72 3300005336 Ga0070680_100022384 Ga0070680_1000223845 134
73 3300005336 Ga0070680_100161154 Ga0070680_1001611543 134
74 3300005336 Ga0070680_100241907 Ga0070680_1002419072 134
75 3300005336 Ga0070680_100480307 Ga0070680_1004803071 134
76 3300005336 Ga0070680_100749171 Ga0070680_1007491712 134
77 3300005337 Ga0070682_100066675 Ga0070682_1000666753 134
78 3300005337 Ga0070682_100420028 Ga0070682_1004200282 134
79 3300005338 Ga0068868_100007444 Ga0068868_1000074446 134
80 3300005338 Ga0068868_100112598 Ga0068868_1001125983 134
81 3300005338 Ga0068868_100138552 Ga0068868_1001385521 134
82 3300005338 Ga0068868_100259612 Ga0068868_1002596122 134
83 3300005339 Ga0070660_100021004 Ga0070660_1000210044 134
84 3300005339 Ga0070660_100047439 Ga0070660_1000474393 134
85 3300005339 Ga0070660_100068007 Ga0070660_1000680075 134
86 3300005339 Ga0070660_100072096 Ga0070660_1000720965 134
87 3300005339 Ga0070660_100076394 Ga0070660_1000763942 134
88 3300005339 Ga0070660_100163169 Ga0070660_1001631692 134
89 3300005339 Ga0070660_100193964 Ga0070660_1001939642 134
90 3300005339 Ga0070660_100207160 Ga0070660_1002071602 134
91 3300005339 Ga0070660_100215612 Ga0070660_1002156123 134
92 3300005339 Ga0070660_100254180 Ga0070660_1002541802 134
93 3300005339 Ga0070660_100472128 Ga0070660_1004721281 134
94 3300005339 Ga0070660_100960689 Ga0070660_1009606891 134
95 3300005340 Ga0070689_100780444 Ga0070689_1007804442 134
96 3300005341 Ga0070691_10002830 Ga0070691_100028303 134
97 3300005343 Ga0070687_100030928 Ga0070687_1000309284 134
98 3300005344 Ga0070661_100017415 Ga0070661_1000174153 134
99 3300005344 Ga0070661_100020888 Ga0070661_1000208884 134
100 3300005344 Ga0070661_100024685 Ga0070661_1000246854 134
101 3300005344 Ga0070661_100030553 Ga0070661_1000305532 134
102 3300005344 Ga0070661_100034228 Ga0070661_1000342283 134
103 3300005344 Ga0070661_100052208 Ga0070661_1000522085 134
104 3300005344 Ga0070661_100072325 Ga0070661_1000723252 134
105 3300005344 Ga0070661_100074859 Ga0070661_1000748595 134
106 3300005344 Ga0070661_100215349 Ga0070661_1002153492 134
107 3300005344 Ga0070661_100217775 Ga0070661_1002177752 134
108 3300005344 Ga0070661_100586005 Ga0070661_1005860051 134
109 3300005344 Ga0070661_100740743 Ga0070661_1007407432 134
110 3300005344 Ga0070661_100881392 Ga0070661_1008813921 134
111 3300005344 Ga0070661_101409615 Ga0070661_1014096151 134
112 3300005345 Ga0070692_10031022 Ga0070692_100310223 134
113 3300005345 Ga0070692_10312758 Ga0070692_103127582 134
114 3300005345 Ga0070692_10798390 Ga0070692_107983902 134
115 3300005347 Ga0070668_100151724 Ga0070668_1001517243 134
116 3300005347 Ga0070668_100239632 Ga0070668_1002396322 134
117 3300005347 Ga0070668_100317777 Ga0070668_1003177772 134
118 3300005347 Ga0070668_100493598 Ga0070668_1004935982 134
119 3300005353 Ga0070669_100025211 Ga0070669_1000252114 134
120 3300005353 Ga0070669_100179848 Ga0070669_1001798482 134
121 3300005354 Ga0070675_100045611 Ga0070675_1000456115 134
122 3300005354 Ga0070675_100224953 Ga0070675_1002249532 134
123 3300005354 Ga0070675_100276139 Ga0070675_1002761392 134
124 3300005355 Ga0070671_100007870 Ga0070671_1000078704 134
125 3300005355 Ga0070671_100037184 Ga0070671_1000371843 134
126 3300005355 Ga0070671_100160972 Ga0070671_1001609724 134
127 3300005356 Ga0070674_100018215 Ga0070674_1000182152 134
128 3300005356 Ga0070674_100146977 Ga0070674_1001469773 134
129 3300005356 Ga0070674_100195205 Ga0070674_1001952052 134
130 3300005356 Ga0070674_100248081 Ga0070674_1002480812 134
131 3300005356 Ga0070674_100380828 Ga0070674_1003808282 134
132 3300005364 Ga0070673_100029293 Ga0070673_1000292935 134
133 3300005364 Ga0070673_100074529 Ga0070673_1000745295 134
134 3300005364 Ga0070673_100680556 Ga0070673_1006805562 134
135 3300005364 Ga0070673_100840476 Ga0070673_1008404762 134
136 3300005364 Ga0070673_100888797 Ga0070673_1008887972 134
137 3300005365 Ga0070688_100233135 Ga0070688_1002331352 134
138 3300005366 Ga0070659_100008501 Ga0070659_1000085014 134
139 3300005366 Ga0070659_100008995 Ga0070659_1000089956 134
140 3300005366 Ga0070659_100016125 Ga0070659_1000161255 134
141 3300005366 Ga0070659_100023294 Ga0070659_1000232945 134
142 3300005366 Ga0070659_100029693 Ga0070659_1000296934 134
143 3300005366 Ga0070659_100037137 Ga0070659_1000371375 134
144 3300005366 Ga0070659_100043143 Ga0070659_1000431434 134
145 3300005366 Ga0070659_100053768 Ga0070659_1000537683 134
146 3300005366 Ga0070659_100146067 Ga0070659_1001460672 134
147 3300005366 Ga0070659_100269878 Ga0070659_1002698782 134
148 3300005366 Ga0070659_100403745 Ga0070659_1004037451 134
149 3300005367 Ga0070667_100010950 Ga0070667_1000109505 134
150 3300005367 Ga0070667_100024075 Ga0070667_1000240755 134
151 3300005367 Ga0070667_100046599 Ga0070667_1000465994 134
152 3300005367 Ga0070667_100052622 Ga0070667_1000526223 134
153 3300005367 Ga0070667_100080670 Ga0070667_1000806702 134
154 3300005367 Ga0070667_100103121 Ga0070667_1001031214 134
155 3300005367 Ga0070667_100171884 Ga0070667_1001718842 134
156 3300005455 Ga0070663_100009308 Ga0070663_1000093085 134
157 3300005455 Ga0070663_100024579 Ga0070663_1000245792 134
158 3300005455 Ga0070663_100032768 Ga0070663_1000327685 134
159 3300005455 Ga0070663_100034824 Ga0070663_1000348245 134
160 3300005455 Ga0070663_100075585 Ga0070663_1000755852 134
161 3300005455 Ga0070663_100100010 Ga0070663_1001000103 134
162 3300005455 Ga0070663_100295216 Ga0070663_1002952162 134
163 3300005455 Ga0070663_100413661 Ga0070663_1004136611 134
164 3300005455 Ga0070663_101215894 Ga0070663_1012158942 134
165 3300005456 Ga0070678_100046313 Ga0070678_1000463135 134
166 3300005456 Ga0070678_100151667 Ga0070678_1001516674 134
167 3300005457 Ga0070662_100007577 Ga0070662_1000075775 134
168 3300005457 Ga0070662_100023737 Ga0070662_1000237374 134
169 3300005457 Ga0070662_100037755 Ga0070662_1000377554 134
170 3300005457 Ga0070662_100044214 Ga0070662_1000442143 134
171 3300005457 Ga0070662_100078127 Ga0070662_1000781272 134
172 3300005457 Ga0070662_100084784 Ga0070662_1000847843 134
173 3300005457 Ga0070662_100105019 Ga0070662_1001050193 134
174 3300005457 Ga0070662_100120489 Ga0070662_1001204892 134
175 3300005457 Ga0070662_100255886 Ga0070662_1002558862 134
176 3300005457 Ga0070662_100260542 Ga0070662_1002605422 134
177 3300005458 Ga0070681_10055658 Ga0070681_100556584 134
178 3300005458 Ga0070681_10100209 Ga0070681_101002092 134
179 3300005458 Ga0070681_10105476 Ga0070681_101054762 134
180 3300005458 Ga0070681_10208271 Ga0070681_102082712 134
181 3300005458 Ga0070681_10548228 Ga0070681_105482282 134
182 3300005458 Ga0070681_10722111 Ga0070681_107221111 134
183 3300005459 Ga0068867_100005872 Ga0068867_1000058724 134
184 3300005459 Ga0068867_100043538 Ga0068867_1000435383 134
185 3300005459 Ga0068867_100072637 Ga0068867_1000726372 134
186 3300005459 Ga0068867_100187884 Ga0068867_1001878842 134
187 3300005459 Ga0068867_100833129 Ga0068867_1008331292 134
188 3300005530 Ga0070679_100053872 Ga0070679_1000538723 134
189 3300005530 Ga0070679_100065499 Ga0070679_1000654993 134
190 3300005530 Ga0070679_100399454 Ga0070679_1003994542 134
191 3300005530 Ga0070679_100714599 Ga0070679_1007145991 134
192 3300005535 Ga0070684_100034034 Ga0070684_1000340342 134
193 3300005535 Ga0070684_100393442 Ga0070684_1003934422 134
194 3300005535 Ga0070684_100534066 Ga0070684_1005340662 134
195 3300005535 Ga0070684_100917896 Ga0070684_1009178961 134
196 3300005539 Ga0068853_100043655 Ga0068853_1000436554 134
197 3300005539 Ga0068853_100164084 Ga0068853_1001640842 134
198 3300005539 Ga0068853_100256988 Ga0068853_1002569881 134
199 3300005539 Ga0068853_100348365 Ga0068853_1003483652 134
200 3300005539 Ga0068853_100416899 Ga0068853_1004168992 134
201 3300005539 Ga0068853_100702015 Ga0068853_1007020152 134
202 3300005539 Ga0068853_100764840 Ga0068853_1007648402 134
203 3300005539 Ga0068853_100805732 Ga0068853_1008057322 134
204 3300005543 Ga0070672_100050522 Ga0070672_1000505225 134
205 3300005543 Ga0070672_101138081 Ga0070672_1011380812 134
206 3300005543 Ga0070672_101163535 Ga0070672_1011635352 134
207 3300005543 Ga0070672_101205527 Ga0070672_1012055271 134
208 3300005544 Ga0070686_100674287 Ga0070686_1006742871 134
209 3300005545 Ga0070695_101637659 Ga0070695_1016376591 134
210 3300005547 Ga0070693_100004419 Ga0070693_1000044195 134
211 3300005547 Ga0070693_100039930 Ga0070693_1000399303 134
212 3300005547 Ga0070693_100094485 Ga0070693_1000944853 134
213 3300005548 Ga0070665_100058313 Ga0070665_1000583134 134
214 3300005548 Ga0070665_101491274 Ga0070665_1014912742 134
215 3300005549 Ga0070704_100199854 Ga0070704_1001998543 134
216 3300005563 Ga0068855_100036876 Ga0068855_1000368764 134
217 3300005563 Ga0068855_100101200 Ga0068855_1001012002 134
218 3300005563 Ga0068855_100125957 Ga0068855_1001259573 134
219 3300005563 Ga0068855_100173397 Ga0068855_1001733976 134
220 3300005563 Ga0068855_100238189 Ga0068855_1002381892 134
221 3300005563 Ga0068855_100317365 Ga0068855_1003173652 134
222 3300005563 Ga0068855_100538057 Ga0068855_1005380572 134
223 3300005563 Ga0068855_100712021 Ga0068855_1007120212 134
224 3300005563 Ga0068855_101559331 Ga0068855_1015593312 134
225 3300005564 Ga0070664_100013787 Ga0070664_1000137876 134
226 3300005564 Ga0070664_100015083 Ga0070664_1000150835 134
227 3300005564 Ga0070664_100021246 Ga0070664_1000212465 134
228 3300005564 Ga0070664_100064007 Ga0070664_1000640072 134
229 3300005564 Ga0070664_100098844 Ga0070664_1000988443 134
230 3300005564 Ga0070664_100103553 Ga0070664_1001035532 134
231 3300005564 Ga0070664_100129233 Ga0070664_1001292332 134
232 3300005564 Ga0070664_100201393 Ga0070664_1002013932 134
233 3300005564 Ga0070664_100763344 Ga0070664_1007633442 134
234 3300005564 Ga0070664_101223974 Ga0070664_1012239741 134
235 3300005577 Ga0068857_100011113 Ga0068857_1000111135 134
236 3300005577 Ga0068857_100014994 Ga0068857_1000149942 134
237 3300005577 Ga0068857_100079040 Ga0068857_1000790405 134
238 3300005577 Ga0068857_100860494 Ga0068857_1008604941 134
239 3300005578 Ga0068854_100003788 Ga0068854_1000037882 134
240 3300005578 Ga0068854_100009368 Ga0068854_1000093684 134
241 3300005578 Ga0068854_100029766 Ga0068854_1000297663 134
242 3300005578 Ga0068854_100048156 Ga0068854_1000481563 134
243 3300005578 Ga0068854_100050917 Ga0068854_1000509174 134
244 3300005578 Ga0068854_100083586 Ga0068854_1000835863 134
245 3300005578 Ga0068854_100120603 Ga0068854_1001206035 134
246 3300005578 Ga0068854_100241903 Ga0068854_1002419032 134
247 3300005578 Ga0068854_100352749 Ga0068854_1003527492 134
248 3300005578 Ga0068854_101002485 Ga0068854_1010024851 134
249 3300005614 Ga0068856_100012390 Ga0068856_1000123907 134
250 3300005614 Ga0068856_100232308 Ga0068856_1002323082 134
251 3300005614 Ga0068856_100360265 Ga0068856_1003602652 134
252 3300005614 Ga0068856_100601718 Ga0068856_1006017181 134
253 3300005614 Ga0068856_100667879 Ga0068856_1006678792 134
254 3300005614 Ga0068856_101231389 Ga0068856_1012313892 134
255 3300005615 Ga0070702_100215112 Ga0070702_1002151122 134
256 3300005616 Ga0068852_100001493 Ga0068852_1000014932 134
257 3300005616 Ga0068852_100007008 Ga0068852_1000070085 134
258 3300005616 Ga0068852_100027596 Ga0068852_1000275964 134
259 3300005616 Ga0068852_100110434 Ga0068852_1001104343 134
260 3300005616 Ga0068852_100154078 Ga0068852_1001540784 134
261 3300005616 Ga0068852_100225805 Ga0068852_1002258053 134
262 3300005616 Ga0068852_100242673 Ga0068852_1002426732 134
263 3300005616 Ga0068852_100442953 Ga0068852_1004429532 134
264 3300005616 Ga0068852_100778816 Ga0068852_1007788162 134
265 3300005616 Ga0068852_101054305 Ga0068852_1010543052 134
266 3300005616 Ga0068852_101077468 Ga0068852_1010774681 134
267 3300005616 Ga0068852_101362786 Ga0068852_1013627861 134
268 3300005617 Ga0068859_100017745 Ga0068859_1000177455 134
269 3300005617 Ga0068859_100030289 Ga0068859_1000302895 134
270 3300005617 Ga0068859_100345879 Ga0068859_1003458792 134
271 3300005617 Ga0068859_101166829 Ga0068859_1011668292 134
272 3300005618 Ga0068864_100116149 Ga0068864_1001161493 134
273 3300005618 Ga0068864_100177216 Ga0068864_1001772163 134
274 3300005618 Ga0068864_100905428 Ga0068864_1009054281 134
275 3300005618 Ga0068864_101213310 Ga0068864_1012133101 134
276 3300005718 Ga0068866_10003017 Ga0068866_100030175 134
277 3300005718 Ga0068866_10005962 Ga0068866_100059624 134
278 3300005718 Ga0068866_10259246 Ga0068866_102592461 134
279 3300005719 Ga0068861_100665356 Ga0068861_1006653562 134
280 3300005834 Ga0068851_10021386 Ga0068851_100213862 134
281 3300005834 Ga0068851_10029996 Ga0068851_100299963 134
282 3300005834 Ga0068851_10102656 Ga0068851_101026561 134
283 3300005834 Ga0068851_10514790 Ga0068851_105147902 134
284 3300005840 Ga0068870_10305261 Ga0068870_103052612 134
285 3300005841 Ga0068863_100006772 Ga0068863_1000067726 134
286 3300005841 Ga0068863_100013348 Ga0068863_1000133485 134
287 3300005841 Ga0068863_100042082 Ga0068863_1000420826 134
288 3300005841 Ga0068863_101646542 Ga0068863_1016465421 134
289 3300005842 Ga0068858_100000698 Ga0068858_1000006986 134
290 3300005842 Ga0068858_100044077 Ga0068858_1000440773 134
291 3300005842 Ga0068858_100103287 Ga0068858_1001032873 134
292 3300005842 Ga0068858_100405553 Ga0068858_1004055532 134
293 3300005843 Ga0068860_100082725 Ga0068860_1000827253 134
294 3300005843 Ga0068860_100159480 Ga0068860_1001594803 134
295 3300005843 Ga0068860_100413419 Ga0068860_1004134192 134
296 3300005843 Ga0068860_100445147 Ga0068860_1004451473 134
297 3300005843 Ga0068860_100495860 Ga0068860_1004958602 134
298 3300005844 Ga0068862_100033453 Ga0068862_1000334534 134
299 3300005844 Ga0068862_100564824 Ga0068862_1005648242 134
300 3300005985 Ga0081539_10016302 Ga0081539_100163025 134
301 3300006051 Ga0075364_10092912 Ga0075364_100929122 134
302 3300006175 Ga0070712_100117743 Ga0070712_1001177433 134
303 3300006195 Ga0075366_10238263 Ga0075366_102382632 134
304 3300006237 Ga0097621_100142634 Ga0097621_1001426342 134
305 3300006237 Ga0097621_100239035 Ga0097621_1002390352 134
306 3300006237 Ga0097621_100855543 Ga0097621_1008555431 134
307 3300006358 Ga0068871_100005013 Ga0068871_1000050135 134
308 3300006358 Ga0068871_100401815 Ga0068871_1004018152 134
309 3300006358 Ga0068871_102047904 Ga0068871_1020479041 134
310 3300006358 Ga0068871_102259343 Ga0068871_1022593432 134
311 3300006844 Ga0075428_101138361 Ga0075428_1011383612 134
312 3300006852 Ga0075433_11162179 Ga0075433_111621792 134
313 3300006881 Ga0068865_100388540 Ga0068865_1003885402 134
314 3300006881 Ga0068865_101535927 Ga0068865_1015359272 134
315 3300006931 Ga0097620_100017745 Ga0097620_1000177455 134
316 3300006931 Ga0097620_100030289 Ga0097620_1000302894 134
317 3300006931 Ga0097620_100345878 Ga0097620_1003458782 134
318 3300006931 Ga0097620_101166952 Ga0097620_1011669522 134
319 3300009093 Ga0105240_10113761 Ga0105240_101137612 134
320 3300009093 Ga0105240_10205037 Ga0105240_102050373 134
321 3300009093 Ga0105240_10227141 Ga0105240_102271412 134
322 3300009093 Ga0105240_10247614 Ga0105240_102476142 134
323 3300009093 Ga0105240_10723845 Ga0105240_107238451 134
324 3300009094 Ga0111539_10464272 Ga0111539_104642723 134
325 3300009098 Ga0105245_10012575 Ga0105245_100125752 134
326 3300009098 Ga0105245_10016987 Ga0105245_100169875 134
327 3300009098 Ga0105245_10051551 Ga0105245_100515513 134
328 3300009098 Ga0105245_10198428 Ga0105245_101984284 134
329 3300009098 Ga0105245_11829666 Ga0105245_118296662 134
330 3300009101 Ga0105247_10108256 Ga0105247_101082562 134
331 3300009147 Ga0114129_10195035 Ga0114129_101950352 134
332 3300009147 Ga0114129_12440506 Ga0114129_124405061 134
333 3300009148 Ga0105243_10022275 Ga0105243_100222754 134
334 3300009148 Ga0105243_10046162 Ga0105243_100461622 134
335 3300009148 Ga0105243_10364435 Ga0105243_103644352 134
336 3300009174 Ga0105241_10113927 Ga0105241_101139273 134
337 3300009174 Ga0105241_10116659 Ga0105241_101166593 134
338 3300009174 Ga0105241_10127466 Ga0105241_101274664 134
339 3300009174 Ga0105241_10919052 Ga0105241_109190521 134
340 3300009176 Ga0105242_10043810 Ga0105242_100438105 134
341 3300009176 Ga0105242_10739686 Ga0105242_107396862 134
342 3300009177 Ga0105248_10016198 Ga0105248_100161984 134
343 3300009177 Ga0105248_10031884 Ga0105248_100318846 134
344 3300009177 Ga0105248_10080537 Ga0105248_100805375 134
345 3300009177 Ga0105248_10315049 Ga0105248_103150492 134
346 3300009177 Ga0105248_10646078 Ga0105248_106460781 134
347 3300009545 Ga0105237_10042391 Ga0105237_100423913 134
348 3300009545 Ga0105237_10046487 Ga0105237_100464874 134
349 3300009551 Ga0105238_10055251 Ga0105238_100552514 134
350 3300009551 Ga0105238_10084336 Ga0105238_100843364 134
351 3300009551 Ga0105238_10131405 Ga0105238_101314053 134
352 3300009551 Ga0105238_10134547 Ga0105238_101345473 134
353 3300009551 Ga0105238_10179520 Ga0105238_101795202 134
354 3300009553 Ga0105249_10336936 Ga0105249_103369362 134
355 3300009979 Ga0105032_103594 Ga0105032_1035941 134
356 3300010375 Ga0105239_10054774 Ga0105239_100547744 134
357 3300010375 Ga0105239_10295056 Ga0105239_102950562 134
358 3300010375 Ga0105239_10865947 Ga0105239_108659472 134
359 3300011119 Ga0105246_10079172 Ga0105246_100791724 134
360 3300013100 Ga0157373_10019821 Ga0157373_100198214 134
361 3300013100 Ga0157373_10020418 Ga0157373_100204182 134
362 3300013100 Ga0157373_10052932 Ga0157373_100529322 134
363 3300013100 Ga0157373_10057676 Ga0157373_100576762 134
364 3300013100 Ga0157373_10065847 Ga0157373_100658472 134
365 3300013100 Ga0157373_10104521 Ga0157373_101045212 134
366 3300013100 Ga0157373_10113482 Ga0157373_101134822 134
367 3300013100 Ga0157373_10150646 Ga0157373_101506462 134
368 3300013100 Ga0157373_10244882 Ga0157373_102448822 134
369 3300013100 Ga0157373_10274722 Ga0157373_102747222 134
370 3300013102 Ga0157371_10011587 Ga0157371_100115875 134
371 3300013102 Ga0157371_10072281 Ga0157371_100722815 134
372 3300013102 Ga0157371_10078626 Ga0157371_100786263 134
373 3300013102 Ga0157371_10087969 Ga0157371_100879693 134
374 3300013102 Ga0157371_10121977 Ga0157371_101219773 134
375 3300013102 Ga0157371_10167267 Ga0157371_101672672 134
376 3300013102 Ga0157371_10180348 Ga0157371_101803482 134
377 3300013102 Ga0157371_10237789 Ga0157371_102377892 134
378 3300013102 Ga0157371_10323479 Ga0157371_103234792 134
379 3300013102 Ga0157371_10620646 Ga0157371_106206461 134
380 3300013104 Ga0157370_10059811 Ga0157370_100598113 134
381 3300013104 Ga0157370_10085743 Ga0157370_100857433 134
382 3300013104 Ga0157370_10143871 Ga0157370_101438712 134
383 3300013104 Ga0157370_10301670 Ga0157370_103016703 134
384 3300013104 Ga0157370_10386634 Ga0157370_103866342 134
385 3300013104 Ga0157370_10535413 Ga0157370_105354132 134
386 3300013104 Ga0157370_10660370 Ga0157370_106603702 134
387 3300013104 Ga0157370_10726457 Ga0157370_107264572 134
388 3300013104 Ga0157370_10975848 Ga0157370_109758482 134
389 3300013105 Ga0157369_10012892 Ga0157369_100128925 134
390 3300013105 Ga0157369_10017591 Ga0157369_100175918 134
391 3300013105 Ga0157369_10037223 Ga0157369_100372235 134
392 3300013105 Ga0157369_10060124 Ga0157369_100601244 134
393 3300013105 Ga0157369_10076714 Ga0157369_100767144 134
394 3300013105 Ga0157369_10153916 Ga0157369_101539163 134
395 3300013105 Ga0157369_10243536 Ga0157369_102435362 134
396 3300013105 Ga0157369_10307348 Ga0157369_103073483 134
397 3300013105 Ga0157369_10519354 Ga0157369_105193542 134
398 3300013105 Ga0157369_10592772 Ga0157369_105927722 134
399 3300013105 Ga0157369_10781988 Ga0157369_107819881 134
400 3300013105 Ga0157369_11361975 Ga0157369_113619751 134
401 3300013296 Ga0157374_10014255 Ga0157374_100142555 134
402 3300013296 Ga0157374_10021424 Ga0157374_100214243 134
403 3300013296 Ga0157374_10053773 Ga0157374_100537733 134
404 3300013296 Ga0157374_10495150 Ga0157374_104951503 134
405 3300013296 Ga0157374_10717215 Ga0157374_107172152 134
406 3300013296 Ga0157374_11378608 Ga0157374_113786082 134
407 3300013297 Ga0157378_10056711 Ga0157378_100567115 134
408 3300013297 Ga0157378_10092163 Ga0157378_100921631 134
409 3300013297 Ga0157378_10173979 Ga0157378_101739795 134
410 3300013297 Ga0157378_10256171 Ga0157378_102561712 134
411 3300013297 Ga0157378_12257592 Ga0157378_122575922 134
412 3300013306 Ga0163162_10127478 Ga0163162_101274783 134
413 3300013306 Ga0163162_10521073 Ga0163162_105210732 134
414 3300013307 Ga0157372_10091705 Ga0157372_100917054 134
415 3300013307 Ga0157372_10257302 Ga0157372_102573022 134
416 3300013307 Ga0157372_10596620 Ga0157372_105966202 134
417 3300013307 Ga0157372_10624915 Ga0157372_106249152 134
418 3300013307 Ga0157372_11442482 Ga0157372_114424822 134
419 3300013307 Ga0157372_12787255 Ga0157372_127872552 134
420 3300013308 Ga0157375_10011784 Ga0157375_100117845 134
421 3300013308 Ga0157375_10089713 Ga0157375_100897133 134
422 3300013308 Ga0157375_10157437 Ga0157375_101574373 134
423 3300013308 Ga0157375_10375982 Ga0157375_103759822 134
424 3300013308 Ga0157375_10439445 Ga0157375_104394452 134
425 3300014325 Ga0163163_10247810 Ga0163163_102478102 134
426 3300014326 Ga0157380_10156030 Ga0157380_101560301 134
427 3300014326 Ga0157380_10880062 Ga0157380_108800622 134
428 3300014745 Ga0157377_10099779 Ga0157377_100997792 134
429 3300014968 Ga0157379_10275733 Ga0157379_102757333 134
430 3300014968 Ga0157379_11310787 Ga0157379_113107872 134
431 3300014969 Ga0157376_10172397 Ga0157376_101723973 134
432 3300020069 Ga0197907_11482614 Ga0197907_114826141 134
433 3300020070 Ga0206356_10024764 Ga0206356_100247642 134
434 3300020081 Ga0206354_10983484 Ga0206354_109834842 134
435 3300020082 Ga0206353_11028540 Ga0206353_110285401 134
436 3300021388 Ga0213875_10017229 Ga0213875_100172296 134
437 3300025315 Ga0207697_10003609 Ga0207697_100036095 134
438 3300025315 Ga0207697_10143398 Ga0207697_101433982 134
439 3300025315 Ga0207697_10197433 Ga0207697_101974332 134
440 3300025321 Ga0207656_10013827 Ga0207656_100138273 134
441 3300025321 Ga0207656_10043096 Ga0207656_100430963 134
442 3300025321 Ga0207656_10091669 Ga0207656_100916692 134
443 3300025321 Ga0207656_10456047 Ga0207656_104560472 134
444 3300025893 Ga0207682_10011969 Ga0207682_100119692 134
445 3300025899 Ga0207642_10003539 Ga0207642_100035392 134
446 3300025899 Ga0207642_10069729 Ga0207642_100697292 134
447 3300025901 Ga0207688_10085601 Ga0207688_100856012 134
448 3300025901 Ga0207688_10091085 Ga0207688_100910853 134
449 3300025901 Ga0207688_10139536 Ga0207688_101395362 134
450 3300025903 Ga0207680_10007734 Ga0207680_100077342 134
451 3300025903 Ga0207680_10083888 Ga0207680_100838881 134
452 3300025903 Ga0207680_10115470 Ga0207680_101154702 134
453 3300025903 Ga0207680_10180663 Ga0207680_101806631 134
454 3300025904 Ga0207647_10008591 Ga0207647_100085915 134
455 3300025904 Ga0207647_10011971 Ga0207647_100119714 134
456 3300025904 Ga0207647_10040161 Ga0207647_100401613 134
457 3300025904 Ga0207647_10053242 Ga0207647_100532422 134
458 3300025904 Ga0207647_10071415 Ga0207647_100714153 134
459 3300025904 Ga0207647_10102165 Ga0207647_101021652 134
460 3300025904 Ga0207647_10117603 Ga0207647_101176032 134
461 3300025904 Ga0207647_10222512 Ga0207647_102225122 134
462 3300025907 Ga0207645_10011068 Ga0207645_100110685 134
463 3300025907 Ga0207645_10111789 Ga0207645_101117892 134
464 3300025907 Ga0207645_10153918 Ga0207645_101539182 134
465 3300025907 Ga0207645_10184349 Ga0207645_101843491 134
466 3300025909 Ga0207705_10001770 Ga0207705_100017703 134
467 3300025909 Ga0207705_10003609 Ga0207705_100036095 134
468 3300025909 Ga0207705_10008044 Ga0207705_100080442 134
469 3300025909 Ga0207705_10020054 Ga0207705_100200545 134
470 3300025909 Ga0207705_10023323 Ga0207705_100233233 134
471 3300025909 Ga0207705_10041566 Ga0207705_100415665 134
472 3300025909 Ga0207705_10055577 Ga0207705_100555773 134
473 3300025909 Ga0207705_10056918 Ga0207705_100569182 134
474 3300025909 Ga0207705_10072045 Ga0207705_100720452 134
475 3300025909 Ga0207705_10076353 Ga0207705_100763531 134
476 3300025909 Ga0207705_10113471 Ga0207705_101134713 134
477 3300025909 Ga0207705_10144538 Ga0207705_101445383 134
478 3300025909 Ga0207705_10161566 Ga0207705_101615662 134
479 3300025909 Ga0207705_10165226 Ga0207705_101652263 134
480 3300025909 Ga0207705_10393668 Ga0207705_103936682 134
481 3300025909 Ga0207705_10443424 Ga0207705_104434241 134
482 3300025909 Ga0207705_10472226 Ga0207705_104722261 134
483 3300025909 Ga0207705_10521942 Ga0207705_105219422 134
484 3300025909 Ga0207705_10550261 Ga0207705_105502612 134
485 3300025911 Ga0207654_10314783 Ga0207654_103147832 134
486 3300025911 Ga0207654_10598607 Ga0207654_105986072 134
487 3300025912 Ga0207707_10026313 Ga0207707_100263132 134
488 3300025912 Ga0207707_10357996 Ga0207707_103579962 134
489 3300025912 Ga0207707_10542542 Ga0207707_105425422 134
490 3300025912 Ga0207707_11034967 Ga0207707_110349671 134
491 3300025913 Ga0207695_10014363 Ga0207695_100143637 134
492 3300025913 Ga0207695_10188590 Ga0207695_101885902 134
493 3300025913 Ga0207695_10276154 Ga0207695_102761542 134
494 3300025913 Ga0207695_10728165 Ga0207695_107281652 134
495 3300025914 Ga0207671_10141743 Ga0207671_101417432 134
496 3300025915 Ga0207693_10018845 Ga0207693_100188453 134
497 3300025917 Ga0207660_10014922 Ga0207660_100149222 134
498 3300025917 Ga0207660_10044262 Ga0207660_100442623 134
499 3300025917 Ga0207660_10436300 Ga0207660_104363002 134
500 3300025917 Ga0207660_10481207 Ga0207660_104812072 134
501 3300025917 Ga0207660_10654600 Ga0207660_106546002 134
502 3300025918 Ga0207662_10068687 Ga0207662_100686873 134
503 3300025919 Ga0207657_10006637 Ga0207657_1000663713 134
504 3300025919 Ga0207657_10009671 Ga0207657_100096715 134
505 3300025919 Ga0207657_10012629 Ga0207657_100126295 134
506 3300025919 Ga0207657_10013869 Ga0207657_100138694 134
507 3300025919 Ga0207657_10016054 Ga0207657_100160546 134
508 3300025919 Ga0207657_10045967 Ga0207657_100459674 134
509 3300025919 Ga0207657_10048589 Ga0207657_100485892 134
510 3300025919 Ga0207657_10049254 Ga0207657_100492542 134
511 3300025919 Ga0207657_10056193 Ga0207657_100561935 134
512 3300025919 Ga0207657_10060282 Ga0207657_100602823 134
513 3300025919 Ga0207657_10069683 Ga0207657_100696833 134
514 3300025919 Ga0207657_11106834 Ga0207657_111068341 134
515 3300025920 Ga0207649_10000609 Ga0207649_1000060913 134
516 3300025920 Ga0207649_10017146 Ga0207649_100171465 134
517 3300025920 Ga0207649_10017742 Ga0207649_100177425 134
518 3300025920 Ga0207649_10031567 Ga0207649_100315672 134
519 3300025920 Ga0207649_10035183 Ga0207649_100351832 134
520 3300025920 Ga0207649_10039402 Ga0207649_100394023 134
521 3300025920 Ga0207649_10054934 Ga0207649_100549342 134
522 3300025920 Ga0207649_10055222 Ga0207649_100552223 134
523 3300025920 Ga0207649_10063970 Ga0207649_100639703 134
524 3300025920 Ga0207649_10123450 Ga0207649_101234502 134
525 3300025920 Ga0207649_10183202 Ga0207649_101832022 134
526 3300025920 Ga0207649_10455561 Ga0207649_104555612 134
527 3300025920 Ga0207649_10940612 Ga0207649_109406122 134
528 3300025920 Ga0207649_11596097 Ga0207649_115960972 134
529 3300025921 Ga0207652_10030413 Ga0207652_100304132 134
530 3300025921 Ga0207652_10072922 Ga0207652_100729224 134
531 3300025921 Ga0207652_10566221 Ga0207652_105662212 134
532 3300025923 Ga0207681_10154873 Ga0207681_101548732 134
533 3300025924 Ga0207694_10049494 Ga0207694_100494944 134
534 3300025924 Ga0207694_10052285 Ga0207694_100522851 134
535 3300025924 Ga0207694_10061259 Ga0207694_100612592 134
536 3300025924 Ga0207694_10074543 Ga0207694_100745432 134
537 3300025925 Ga0207650_10015641 Ga0207650_100156413 134
538 3300025925 Ga0207650_10236036 Ga0207650_102360363 134
539 3300025925 Ga0207650_10546808 Ga0207650_105468082 134
540 3300025926 Ga0207659_10064791 Ga0207659_100647912 134
541 3300025927 Ga0207687_10130714 Ga0207687_101307144 134
542 3300025927 Ga0207687_10196412 Ga0207687_101964123 134
543 3300025927 Ga0207687_10491946 Ga0207687_104919462 134
544 3300025927 Ga0207687_11508624 Ga0207687_115086241 134
545 3300025931 Ga0207644_10005901 Ga0207644_100059012 134
546 3300025931 Ga0207644_10010410 Ga0207644_100104103 134
547 3300025931 Ga0207644_10064872 Ga0207644_100648725 134
548 3300025931 Ga0207644_10167803 Ga0207644_101678033 134
549 3300025932 Ga0207690_10021720 Ga0207690_100217205 134
550 3300025932 Ga0207690_10040828 Ga0207690_100408286 134
551 3300025932 Ga0207690_10057730 Ga0207690_100577304 134
552 3300025932 Ga0207690_10096114 Ga0207690_100961143 134
553 3300025932 Ga0207690_10111500 Ga0207690_101115002 134
554 3300025932 Ga0207690_10113203 Ga0207690_101132033 134
555 3300025932 Ga0207690_10116250 Ga0207690_101162502 134
556 3300025932 Ga0207690_10142031 Ga0207690_101420312 134
557 3300025932 Ga0207690_10172357 Ga0207690_101723572 134
558 3300025932 Ga0207690_10207385 Ga0207690_102073851 134
559 3300025932 Ga0207690_10258974 Ga0207690_102589742 134
560 3300025932 Ga0207690_10379367 Ga0207690_103793672 134
561 3300025932 Ga0207690_10580637 Ga0207690_105806372 134
562 3300025933 Ga0207706_10010928 Ga0207706_100109285 134
563 3300025933 Ga0207706_10017233 Ga0207706_100172332 134
564 3300025933 Ga0207706_10022481 Ga0207706_100224815 134
565 3300025933 Ga0207706_10059992 Ga0207706_100599923 134
566 3300025933 Ga0207706_10082822 Ga0207706_100828221 134
567 3300025933 Ga0207706_10093332 Ga0207706_100933324 134
568 3300025933 Ga0207706_10101119 Ga0207706_101011195 134
569 3300025933 Ga0207706_10428635 Ga0207706_104286352 134
570 3300025933 Ga0207706_10623912 Ga0207706_106239122 134
571 3300025934 Ga0207686_10119720 Ga0207686_101197202 134
572 3300025934 Ga0207686_10196916 Ga0207686_101969162 134
573 3300025935 Ga0207709_10020092 Ga0207709_100200924 134
574 3300025935 Ga0207709_10174688 Ga0207709_101746882 134
575 3300025935 Ga0207709_10336951 Ga0207709_103369512 134
576 3300025936 Ga0207670_11006401 Ga0207670_110064011 134
577 3300025937 Ga0207669_10147668 Ga0207669_101476683 134
578 3300025937 Ga0207669_10154177 Ga0207669_101541772 134
579 3300025937 Ga0207669_10155239 Ga0207669_101552392 134
580 3300025937 Ga0207669_10264649 Ga0207669_102646491 134
581 3300025937 Ga0207669_11141135 Ga0207669_111411352 134
582 3300025938 Ga0207704_10263280 Ga0207704_102632801 134
583 3300025940 Ga0207691_10053748 Ga0207691_100537483 134
584 3300025940 Ga0207691_10067449 Ga0207691_100674493 134
585 3300025940 Ga0207691_10225294 Ga0207691_102252942 134
586 3300025940 Ga0207691_10885742 Ga0207691_108857422 134
587 3300025941 Ga0207711_10001586 Ga0207711_100015867 134
588 3300025941 Ga0207711_10012397 Ga0207711_100123975 134
589 3300025941 Ga0207711_10086336 Ga0207711_100863364 134
590 3300025941 Ga0207711_10865428 Ga0207711_108654282 134
591 3300025944 Ga0207661_10014880 Ga0207661_100148804 134
592 3300025944 Ga0207661_10029303 Ga0207661_100293032 134
593 3300025944 Ga0207661_10043986 Ga0207661_100439862 134
594 3300025944 Ga0207661_10284814 Ga0207661_102848142 134
595 3300025944 Ga0207661_10452581 Ga0207661_104525812 134
596 3300025945 Ga0207679_10016312 Ga0207679_100163122 134
597 3300025945 Ga0207679_10020313 Ga0207679_100203134 134
598 3300025945 Ga0207679_10024962 Ga0207679_100249623 134
599 3300025945 Ga0207679_10036166 Ga0207679_100361662 134
600 3300025945 Ga0207679_10074803 Ga0207679_100748035 134
601 3300025945 Ga0207679_10075951 Ga0207679_100759514 134
602 3300025945 Ga0207679_10111043 Ga0207679_101110432 134
603 3300025945 Ga0207679_10188069 Ga0207679_101880693 134
604 3300025945 Ga0207679_10761223 Ga0207679_107612232 134
605 3300025945 Ga0207679_11848047 Ga0207679_118480471 134
606 3300025949 Ga0207667_10012522 Ga0207667_100125226 134
607 3300025949 Ga0207667_10040678 Ga0207667_100406783 134
608 3300025949 Ga0207667_10058404 Ga0207667_100584045 134
609 3300025949 Ga0207667_10098724 Ga0207667_100987242 134
610 3300025949 Ga0207667_10150361 Ga0207667_101503612 134
611 3300025949 Ga0207667_10158671 Ga0207667_101586713 134
612 3300025949 Ga0207667_10188860 Ga0207667_101888602 134
613 3300025949 Ga0207667_10245627 Ga0207667_102456271 134
614 3300025949 Ga0207667_10342973 Ga0207667_103429731 134
615 3300025949 Ga0207667_10737549 Ga0207667_107375492 134
616 3300025949 Ga0207667_11073060 Ga0207667_110730602 134
617 3300025949 Ga0207667_11250403 Ga0207667_112504032 134
618 3300025949 Ga0207667_11508403 Ga0207667_115084032 134
619 3300025960 Ga0207651_10001064 Ga0207651_100010646 134
620 3300025960 Ga0207651_10017121 Ga0207651_100171215 134
621 3300025960 Ga0207651_10162444 Ga0207651_101624442 134
622 3300025960 Ga0207651_10177361 Ga0207651_101773612 134
623 3300025972 Ga0207668_10248460 Ga0207668_102484601 134
624 3300025972 Ga0207668_10279728 Ga0207668_102797282 134
625 3300025981 Ga0207640_10006995 Ga0207640_100069955 134
626 3300025981 Ga0207640_10011184 Ga0207640_100111845 134
627 3300025981 Ga0207640_10020967 Ga0207640_100209673 134
628 3300025981 Ga0207640_10025728 Ga0207640_100257283 134
629 3300025981 Ga0207640_10119774 Ga0207640_101197743 134
630 3300025981 Ga0207640_10160695 Ga0207640_101606952 134
631 3300025981 Ga0207640_10166894 Ga0207640_101668942 134
632 3300025981 Ga0207640_10201817 Ga0207640_102018172 134
633 3300025981 Ga0207640_10207011 Ga0207640_102070112 134
634 3300025981 Ga0207640_10286430 Ga0207640_102864302 134
635 3300025981 Ga0207640_11106035 Ga0207640_111060351 134
636 3300025986 Ga0207658_10015410 Ga0207658_100154105 134
637 3300025986 Ga0207658_10022103 Ga0207658_100221034 134
638 3300025986 Ga0207658_10050500 Ga0207658_100505003 134
639 3300025986 Ga0207658_10050773 Ga0207658_100507733 134
640 3300025986 Ga0207658_10057410 Ga0207658_100574103 134
641 3300025986 Ga0207658_10077272 Ga0207658_100772723 134
642 3300025986 Ga0207658_10232161 Ga0207658_102321613 134
643 3300025986 Ga0207658_11363023 Ga0207658_113630232 134
644 3300026023 Ga0207677_10007773 Ga0207677_100077732 134
645 3300026023 Ga0207677_10018428 Ga0207677_100184284 134
646 3300026023 Ga0207677_10162593 Ga0207677_101625933 134
647 3300026023 Ga0207677_10243831 Ga0207677_102438312 134
648 3300026023 Ga0207677_10666686 Ga0207677_106666862 134
649 3300026035 Ga0207703_10001131 Ga0207703_100011318 134
650 3300026035 Ga0207703_10309149 Ga0207703_103091493 134
651 3300026035 Ga0207703_10346513 Ga0207703_103465132 134
652 3300026041 Ga0207639_10005372 Ga0207639_100053726 134
653 3300026041 Ga0207639_10035157 Ga0207639_100351574 134
654 3300026041 Ga0207639_10075162 Ga0207639_100751622 134
655 3300026041 Ga0207639_10094009 Ga0207639_100940093 134
656 3300026041 Ga0207639_10152837 Ga0207639_101528373 134
657 3300026041 Ga0207639_10160442 Ga0207639_101604423 134
658 3300026041 Ga0207639_10258373 Ga0207639_102583733 134
659 3300026041 Ga0207639_10287397 Ga0207639_102873973 134
660 3300026041 Ga0207639_10470431 Ga0207639_104704312 134
661 3300026041 Ga0207639_10578421 Ga0207639_105784211 134
662 3300026067 Ga0207678_10008034 Ga0207678_100080349 134
663 3300026067 Ga0207678_10008741 Ga0207678_100087414 134
664 3300026067 Ga0207678_10018256 Ga0207678_100182565 134
665 3300026067 Ga0207678_10034890 Ga0207678_100348906 134
666 3300026067 Ga0207678_10049425 Ga0207678_100494252 134
667 3300026067 Ga0207678_10077827 Ga0207678_100778272 134
668 3300026067 Ga0207678_10083764 Ga0207678_100837642 134
669 3300026067 Ga0207678_10094505 Ga0207678_100945052 134
670 3300026067 Ga0207678_10097948 Ga0207678_100979481 134
671 3300026067 Ga0207678_10199844 Ga0207678_101998442 134
672 3300026078 Ga0207702_10005398 Ga0207702_100053985 134
673 3300026078 Ga0207702_10007420 Ga0207702_100074206 134
674 3300026078 Ga0207702_10011401 Ga0207702_100114015 134
675 3300026078 Ga0207702_10023661 Ga0207702_100236614 134
676 3300026078 Ga0207702_10250408 Ga0207702_102504082 134
677 3300026078 Ga0207702_10437580 Ga0207702_104375802 134
678 3300026078 Ga0207702_10486849 Ga0207702_104868492 134
679 3300026088 Ga0207641_10005432 Ga0207641_100054326 134
680 3300026088 Ga0207641_10010661 Ga0207641_100106615 134
681 3300026088 Ga0207641_10020616 Ga0207641_100206164 134
682 3300026088 Ga0207641_10646569 Ga0207641_106465692 134
683 3300026088 Ga0207641_10679120 Ga0207641_106791202 134
684 3300026088 Ga0207641_11553909 Ga0207641_115539092 134
685 3300026089 Ga0207648_10011594 Ga0207648_100115945 134
686 3300026089 Ga0207648_10076673 Ga0207648_100766732 134
687 3300026089 Ga0207648_10099037 Ga0207648_100990373 134
688 3300026089 Ga0207648_10237119 Ga0207648_102371192 134
689 3300026095 Ga0207676_10011103 Ga0207676_100111034 134
690 3300026095 Ga0207676_10126804 Ga0207676_101268043 134
691 3300026116 Ga0207674_10019429 Ga0207674_100194292 134
692 3300026116 Ga0207674_10061064 Ga0207674_100610645 134
693 3300026116 Ga0207674_10173578 Ga0207674_101735783 134
694 3300026116 Ga0207674_10316547 Ga0207674_103165473 134
695 3300026118 Ga0207675_100107740 Ga0207675_1001077402 134
696 3300026121 Ga0207683_10034084 Ga0207683_100340845 134
697 3300026121 Ga0207683_10035825 Ga0207683_100358255 134
698 3300026142 Ga0207698_10001495 Ga0207698_1000149512 134
699 3300026142 Ga0207698_10003511 Ga0207698_100035116 134
700 3300026142 Ga0207698_10009252 Ga0207698_100092524 134
701 3300026142 Ga0207698_10026189 Ga0207698_100261893 134
702 3300026142 Ga0207698_10174290 Ga0207698_101742902 134
703 3300026142 Ga0207698_10228234 Ga0207698_102282342 134
704 3300026142 Ga0207698_10274743 Ga0207698_102747432 134
705 3300026142 Ga0207698_10515931 Ga0207698_105159312 134
706 3300026142 Ga0207698_10780335 Ga0207698_107803352 134
707 3300026142 Ga0207698_11549281 Ga0207698_115492811 134
708 3300028379 Ga0268266_10108661 Ga0268266_101086613 134
709 3300028379 Ga0268266_10913210 Ga0268266_109132102 134
710 3300028380 Ga0268265_11216891 Ga0268265_112168911 134
711 3300028381 Ga0268264_10136746 Ga0268264_101367463 134
712 3300028381 Ga0268264_10167220 Ga0268264_101672201 134
713 3300028381 Ga0268264_10339339 Ga0268264_103393392 134
714 3300028381 Ga0268264_10353434 Ga0268264_103534342 134
715 3300030745 Ga0316182_1268691 Ga0316182_12686912 134
716 3300031548 Ga0307408_100072989 Ga0307408_1000729892 134
717 3300031548 Ga0307408_100258169 Ga0307408_1002581692 134
718 3300031731 Ga0307405_10094732 Ga0307405_100947322 134
719 3300031731 Ga0307405_10200833 Ga0307405_102008332 134
720 3300031731 Ga0307405_10340018 Ga0307405_103400181 134
721 3300031824 Ga0307413_10011592 Ga0307413_100115925 134
722 3300031824 Ga0307413_11928748 Ga0307413_119287481 134
723 3300031852 Ga0307410_10004325 Ga0307410_100043253 134
724 3300031852 Ga0307410_10017783 Ga0307410_100177834 134
725 3300031852 Ga0307410_10019949 Ga0307410_100199493 134
726 3300031852 Ga0307410_10058833 Ga0307410_100588333 134
727 3300031852 Ga0307410_10135811 Ga0307410_101358112 134
728 3300031852 Ga0307410_10189220 Ga0307410_101892202 134
729 3300031852 Ga0307410_10356904 Ga0307410_103569042 134
730 3300031852 Ga0307410_10720171 Ga0307410_107201712 134
731 3300031901 Ga0307406_10061210 Ga0307406_100612102 134
732 3300031901 Ga0307406_10246739 Ga0307406_102467392 134
733 3300031901 Ga0307406_10288701 Ga0307406_102887012 134
734 3300031901 Ga0307406_10520247 Ga0307406_105202471 134
735 3300031903 Ga0307407_10015741 Ga0307407_100157413 134
736 3300031903 Ga0307407_10131552 Ga0307407_101315522 134
737 3300031903 Ga0307407_10164887 Ga0307407_101648872 134
738 3300031903 Ga0307407_10289208 Ga0307407_102892082 134
739 3300031903 Ga0307407_10422927 Ga0307407_104229272 134
740 3300031911 Ga0307412_10171977 Ga0307412_101719772 134
741 3300031911 Ga0307412_10539212 Ga0307412_105392122 134
742 3300031995 Ga0307409_100037602 Ga0307409_1000376024 134
743 3300031995 Ga0307409_100037694 Ga0307409_1000376943 134
744 3300031995 Ga0307409_100046604 Ga0307409_1000466044 134
745 3300031995 Ga0307409_100192794 Ga0307409_1001927942 134
746 3300031995 Ga0307409_100302593 Ga0307409_1003025932 134
747 3300031995 Ga0307409_100329347 Ga0307409_1003293472 134
748 3300031995 Ga0307409_101372419 Ga0307409_1013724191 134
749 3300032002 Ga0307416_100072310 Ga0307416_1000723107 134
750 3300032002 Ga0307416_100081435 Ga0307416_1000814353 134
751 3300032002 Ga0307416_100219199 Ga0307416_1002191992 134
752 3300032002 Ga0307416_100273737 Ga0307416_1002737373 134
753 3300032002 Ga0307416_100339982 Ga0307416_1003399823 134
754 3300032002 Ga0307416_100782864 Ga0307416_1007828642 134
755 3300032002 Ga0307416_100831637 Ga0307416_1008316372 134
756 3300032002 Ga0307416_101130720 Ga0307416_1011307202 134
757 3300032004 Ga0307414_10024662 Ga0307414_100246622 134
758 3300032004 Ga0307414_10792233 Ga0307414_107922331 134
759 3300032004 Ga0307414_11395623 Ga0307414_113956232 134
760 3300032004 Ga0307414_11861155 Ga0307414_118611551 134
761 3300032005 Ga0307411_10001080 Ga0307411_100010807 134
762 3300032005 Ga0307411_10015528 Ga0307411_100155283 134
763 3300032005 Ga0307411_10218319 Ga0307411_102183192 134
764 3300032005 Ga0307411_10723867 Ga0307411_107238671 134
765 3300032005 Ga0307411_10789598 Ga0307411_107895981 134
766 3300032005 Ga0307411_10970574 Ga0307411_109705742 134
767 3300032126 Ga0307415_100102394 Ga0307415_1001023942 134
768 3300032126 Ga0307415_100263268 Ga0307415_1002632682 134
769 3300032126 Ga0307415_100363294 Ga0307415_1003632941 134
770 3300032126 Ga0307415_100628858 Ga0307415_1006288581 134
771 3300032126 Ga0307415_100704632 Ga0307415_1007046322 134
772 3300032126 Ga0307415_100913150 Ga0307415_1009131502 134
773 3300035088 Ga0373940_0181648 Ga0373940_0181648_64_468 134
774 3300035121 Ga0373960_0352143 Ga0373960_0352143_70_474 134
775 3300035207 Ga0373942_0262631 Ga0373942_0262631_164_568 134
776 3300035241 Ga0373961_0209969 Ga0373961_0209969_16_420 134
777 3300035242 Ga0373962_0045100 Ga0373962_0045100_302_706 134
778 3300035242 Ga0373962_0174182 Ga0373962_0174182_189_593 134
779 3300035691 Ga0373931_0637155 Ga0373931_0637155_159_563 134
780 3300037312 Ga0395899_0003159 Ga0395899_0003159_1840_2244 134
781 3300037312 Ga0395899_0010009 Ga0395899_0010009_6361_6765 134
782 3300037312 Ga0395899_0012795 Ga0395899_0012795_5902_6306 134
783 3300037312 Ga0395899_0018141 Ga0395899_0018141_2952_3356 134
784 3300037312 Ga0395899_0031153 Ga0395899_0031153_3542_3946 134
785 3300037312 Ga0395899_0081035 Ga0395899_0081035_1237_1641 134
786 3300037312 Ga0395899_0099940 Ga0395899_0099940_1359_1763 134
787 3300037312 Ga0395899_0122223 Ga0395899_0122223_842_1246 134
788 3300037312 Ga0395899_0127942 Ga0395899_0127942_187_591 134
789 3300037312 Ga0395899_0129289 Ga0395899_0129289_973_1377 134
790 3300037312 Ga0395899_0212738 Ga0395899_0212738_357_761 134
791 3300037312 Ga0395899_0220931 Ga0395899_0220931_789_1193 134
792 3300037312 Ga0395899_0308682 Ga0395899_0308682_378_782 134
793 3300037312 Ga0395899_0558200 Ga0395899_0558200_296_700 134
794 3300037312 Ga0395899_0604840 Ga0395899_0604840_114_518 134
795 3300037418 Ga0395900_0003502 Ga0395900_0003502_1808_2212 134
796 3300037418 Ga0395900_0008180 Ga0395900_0008180_9332_9736 134
797 3300037418 Ga0395900_0011717 Ga0395900_0011717_4729_5133 134
798 3300037418 Ga0395900_0015629 Ga0395900_0015629_2210_2614 134
799 3300037418 Ga0395900_0041426 Ga0395900_0041426_194_598 134
800 3300037418 Ga0395900_0055890 Ga0395900_0055890_699_1103 134
801 3300037418 Ga0395900_0069977 Ga0395900_0069977_977_1381 134
802 3300037418 Ga0395900_0086435 Ga0395900_0086435_2507_2911 134
803 3300037418 Ga0395900_0104018 Ga0395900_0104018_1873_2277 134
804 3300037418 Ga0395900_0120169 Ga0395900_0120169_1733_2137 134
805 3300037418 Ga0395900_0160689 Ga0395900_0160689_1620_2024 134
806 3300037418 Ga0395900_0236271 Ga0395900_0236271_1199_1603 134
807 3300037418 Ga0395900_0272569 Ga0395900_0272569_588_992 134
808 3300037418 Ga0395900_0302066 Ga0395900_0302066_855_1259 134
809 3300037418 Ga0395900_0310088 Ga0395900_0310088_830_1234 134
810 3300037418 Ga0395900_0321875 Ga0395900_0321875_595_999 134
811 3300037418 Ga0395900_0436009 Ga0395900_0436009_583_987 134
812 3300037418 Ga0395900_0460665 Ga0395900_0460665_626_1030 134
813 3300037418 Ga0395900_0616174 Ga0395900_0616174_360_764 134
814 3300037418 Ga0395900_0631538 Ga0395900_0631538_557_961 134
815 3300037418 Ga0395900_0994201 Ga0395900_0994201_101_505 134
816 3300037418 Ga0395900_1063387 Ga0395900_1063387_178_582 134
817 3300037418 Ga0395900_1216571 Ga0395900_1216571_104_550 134
818 3300037418 Ga0395900_1218423 Ga0395900_1218423_218_622 134
819 3300037418 Ga0395900_1289512 Ga0395900_1289512_207_611 134
820 3300037418 Ga0395900_1489580 Ga0395900_1489580_49_453 134
821 3300037418 Ga0395900_1656821 Ga0395900_1656821_16_420 134
822 3300037466 Ga0395898_0006138 Ga0395898_0006138_7310_7714 134
823 3300037466 Ga0395898_0022087 Ga0395898_0022087_1555_1959 134
824 3300037466 Ga0395898_0030146 Ga0395898_0030146_2657_3061 134
825 3300037466 Ga0395898_0049474 Ga0395898_0049474_2993_3397 134
826 3300037466 Ga0395898_0062485 Ga0395898_0062485_1157_1561 134
827 3300037466 Ga0395898_0065673 Ga0395898_0065673_1960_2364 134
828 3300037466 Ga0395898_0094720 Ga0395898_0094720_2038_2442 134
829 3300037466 Ga0395898_0125150 Ga0395898_0125150_1978_2382 134
830 3300037466 Ga0395898_0230467 Ga0395898_0230467_98_502 134
831 3300037466 Ga0395898_0307288 Ga0395898_0307288_263_667 134
832 3300037466 Ga0395898_0312866 Ga0395898_0312866_665_1069 134
833 3300037466 Ga0395898_0362865 Ga0395898_0362865_208_612 134
834 3300037466 Ga0395898_0518375 Ga0395898_0518375_243_647 134
835 3300037466 Ga0395898_0579674 Ga0395898_0579674_579_983 134
836 3300037466 Ga0395898_0631625 Ga0395898_0631625_106_510 134
837 3300037466 Ga0395898_0934765 Ga0395898_0934765_280_684 134
838 3300037466 Ga0395898_1077509 Ga0395898_1077509_271_675 134
839 3300037466 Ga0395898_1269811 Ga0395898_1269811_57_461 134
840 3300037466 Ga0395898_1515586 Ga0395898_1515586_93_497 134
841 3300037471 Ga0395905_0001949 Ga0395905_0001949_442_846 134
842 3300037471 Ga0395905_0003598 Ga0395905_0003598_12832_13236 134
843 3300037471 Ga0395905_0013181 Ga0395905_0013181_5465_5869 134
844 3300037471 Ga0395905_0014848 Ga0395905_0014848_1720_2124 134
845 3300037471 Ga0395905_0028235 Ga0395905_0028235_1672_2076 134
846 3300037471 Ga0395905_0042071 Ga0395905_0042071_960_1364 134
847 3300037471 Ga0395905_0094434 Ga0395905_0094434_718_1122 134
848 3300037471 Ga0395905_0117294 Ga0395905_0117294_687_1091 134
849 3300037471 Ga0395905_0163218 Ga0395905_0163218_254_700 134
850 3300037471 Ga0395905_0170316 Ga0395905_0170316_1277_1681 134
851 3300037471 Ga0395905_0173389 Ga0395905_0173389_1502_1906 134
852 3300037471 Ga0395905_0241034 Ga0395905_0241034_903_1307 134
853 3300037471 Ga0395905_0252156 Ga0395905_0252156_308_712 134
854 3300037471 Ga0395905_0366621 Ga0395905_0366621_440_844 134
855 3300037471 Ga0395905_0366633 Ga0395905_0366633_308_712 134
856 3300037471 Ga0395905_0408188 Ga0395905_0408188_120_524 134
857 3300037471 Ga0395905_0424247 Ga0395905_0424247_780_1184 134
858 3300037471 Ga0395905_0448151 Ga0395905_0448151_156_560 134
859 3300037471 Ga0395905_0507929 Ga0395905_0507929_495_899 134
860 3300037471 Ga0395905_0698655 Ga0395905_0698655_116_520 134
861 3300037471 Ga0395905_0698733 Ga0395905_0698733_282_686 134
862 3300037471 Ga0395905_0862450 Ga0395905_0862450_211_615 134
863 3300037471 Ga0395905_0879671 Ga0395905_0879671_57_461 134
864 3300037471 Ga0395905_1395881 Ga0395905_1395881_16_462 134
865 3300037471 Ga0395905_1420272 Ga0395905_1420272_141_545 134
866 3300037853 Ga0436364_0792406 Ga0436364_0792406_2973_3377 134
867 3300038443 Ga0395901_0005705 Ga0395901_0005705_10745_11149 134
868 3300038443 Ga0395901_0014347 Ga0395901_0014347_3328_3732 134
869 3300038443 Ga0395901_0014751 Ga0395901_0014751_702_1106 134
870 3300038443 Ga0395901_0044472 Ga0395901_0044472_2089_2493 134
871 3300038443 Ga0395901_0047933 Ga0395901_0047933_1569_1973 134
872 3300038443 Ga0395901_0062335 Ga0395901_0062335_672_1076 134
873 3300038443 Ga0395901_0079373 Ga0395901_0079373_20_424 134
874 3300038443 Ga0395901_0102079 Ga0395901_0102079_960_1364 134
875 3300038443 Ga0395901_0105231 Ga0395901_0105231_1643_2047 134
876 3300038443 Ga0395901_0120668 Ga0395901_0120668_1403_1807 134
877 3300038443 Ga0395901_0305248 Ga0395901_0305248_915_1319 134
878 3300038443 Ga0395901_0315471 Ga0395901_0315471_387_791 134
879 3300038443 Ga0395901_0346053 Ga0395901_0346053_22_426 134
880 3300038443 Ga0395901_0382442 Ga0395901_0382442_368_772 134
881 3300038443 Ga0395901_0561026 Ga0395901_0561026_156_560 134
882 3300038443 Ga0395901_0742206 Ga0395901_0742206_365_769 134
883 3300038443 Ga0395901_0849206 Ga0395901_0849206_411_815 134
884 3300038443 Ga0395901_0972360 Ga0395901_0972360_127_531 134
885 3300038443 Ga0395901_1027651 Ga0395901_1027651_105_551 134
886 3300038443 Ga0395901_1308113 Ga0395901_1308113_266_670 134
887 3300038443 Ga0395901_1405396 Ga0395901_1405396_234_638 134
888 3300038443 Ga0395901_1736571 Ga0395901_1736571_34_480 134
889 3300038443 Ga0395901_2157864 Ga0395901_2157864_11_415 134
890 3300041405 Ga0439438_122239 Ga0439438_122239_87_491 134
891 3300042006 Ga0439432_004519 Ga0439432_004519_3221_3625 134
892 3300042134 Ga0450898_049869 Ga0450898_049869_202_606 134
893 3300042135 Ga0450899_025489 Ga0450899_025489_33_437 134
894 3300042157 Ga0439458_0011922 Ga0439458_0011922_788_1192 134
895 3300042157 Ga0439458_0175610 Ga0439458_0175610_149_553 134
896 3300044658 Ga0466972_0012993 Ga0466972_0012993_3769_4173 134
897 3300044658 Ga0466972_0165979 Ga0466972_0165979_499_903 134
898 3300044658 Ga0466972_0251012 Ga0466972_0251012_348_752 134
899 3300044683 Ga0466965_0360342 Ga0466965_0360342_229_633 134
900 3300044684 Ga0466966_0000003 Ga0466966_0000003_67947_68351 134
901 3300044684 Ga0466966_0004449 Ga0466966_0004449_4806_5210 134
902 3300044684 Ga0466966_0077444 Ga0466966_0077444_690_1094 134
903 3300044684 Ga0466966_0291809 Ga0466966_0291809_68_472 134
904 3300044684 Ga0466966_0302969 Ga0466966_0302969_433_837 134
905 3300044693 Ga0466961_0342246 Ga0466961_0342246_343_747 134
906 3300044694 Ga0466963_0006348 Ga0466963_0006348_3373_3777 134
907 3300044694 Ga0466963_0027629 Ga0466963_0027629_1387_1791 134
908 3300044694 Ga0466963_0032139 Ga0466963_0032139_788_1192 134
909 3300044694 Ga0466963_0105277 Ga0466963_0105277_961_1365 134
910 3300044694 Ga0466963_0158794 Ga0466963_0158794_616_1020 134
911 3300044694 Ga0466963_0196401 Ga0466963_0196401_173_577 134
912 3300044694 Ga0466963_0254063 Ga0466963_0254063_350_754 134
913 3300044694 Ga0466963_0266319 Ga0466963_0266319_356_760 134
914 3300044694 Ga0466963_0320979 Ga0466963_0320979_253_657 134
915 3300044694 Ga0466963_0626957 Ga0466963_0626957_86_490 134
916 3300044694 Ga0466963_0646646 Ga0466963_0646646_301_705 134
917 3300044706 Ga0466964_0075537 Ga0466964_0075537_1013_1417 134
918 3300044719 Ga0466971_0074134 Ga0466971_0074134_596_1000 134
919 3300044765 Ga0466970_0185014 Ga0466970_0185014_50_454 134
920 3300044842 Ga0466957_0110500 Ga0466957_0110500_1065_1469 134
921 3300044842 Ga0466957_0128913 Ga0466957_0128913_37_441 134
922 3300044842 Ga0466957_0145538 Ga0466957_0145538_130_534 134
923 3300044842 Ga0466957_0255018 Ga0466957_0255018_706_1110 134
924 3300044842 Ga0466957_0463131 Ga0466957_0463131_385_789 134
925 3300044901 Ga0466960_0150832 Ga0466960_0150832_186_590 134
926 3300044901 Ga0466960_0783862 Ga0466960_0783862_157_561 134
927 3300045049 Ga0466959_0299596 Ga0466959_0299596_460_864 134
928 3300045049 Ga0466959_0836032 Ga0466959_0836032_34_438 134
929 3300045836 Ga0466958_0264914 Ga0466958_0264914_216_620 134
930 3300045836 Ga0466958_0372521 Ga0466958_0372521_160_564 134
931 3300045836 Ga0466958_0439889 Ga0466958_0439889_107_511 134
932 3300045976 Ga0466967_0043676 Ga0466967_0043676_1539_1943 134
933 3300045976 Ga0466967_0083855 Ga0466967_0083855_894_1298 134
934 3300045976 Ga0466967_0085523 Ga0466967_0085523_2104_2508 134
935 3300045976 Ga0466967_0162182 Ga0466967_0162182_675_1079 134
936 3300045976 Ga0466967_0216012 Ga0466967_0216012_869_1273 134
937 3300045976 Ga0466967_0360607 Ga0466967_0360607_473_877 134
938 3300045976 Ga0466967_0599350 Ga0466967_0599350_233_637 134
939 3300045976 Ga0466967_0625443 Ga0466967_0625443_314_718 134
940 3300045976 Ga0466967_1344992 Ga0466967_1344992_101_505 134
941 3300045976 Ga0466967_1625837 Ga0466967_1625837_158_562 134
942 3300046459 Ga0495629_0484109 Ga0495629_0484109_229_633 134
943 3300046491 Ga0495584_0469123 Ga0495584_0469123_145_549 134
944 3300046528 Ga0495642_0037967 Ga0495642_0037967_1370_1774 134
945 3300046537 Ga0495598_0000969 Ga0495598_0000969_3181_3585 134
946 3300046539 Ga0495621_0000609 Ga0495621_0000609_459_863 134
947 3300046539 Ga0495621_0111745 Ga0495621_0111745_287_691 134
948 3300046616 Ga0495668_0261016 Ga0495668_0261016_245_649 134
949 3300046684 Ga0495669_0063502 Ga0495669_0063502_1148_1552 134
950 3300046684 Ga0495669_0128390 Ga0495669_0128390_452_856 134
951 3300046684 Ga0495669_0206949 Ga0495669_0206949_148_552 134
952 3300046684 Ga0495669_0250238 Ga0495669_0250238_377_781 134
953 3300046691 Ga0495670_0002361 Ga0495670_0002361_5078_5482 134
954 3300048903 Ga0496100_0009195 Ga0496100_0009195_903_1307 134
955 3300048903 Ga0496100_0417061 Ga0496100_0417061_450_854 134
956 3300048904 Ga0496101_0005978 Ga0496101_0005978_3726_4130 134
957 3300048904 Ga0496101_0322017 Ga0496101_0322017_418_822 134
958 3300048904 Ga0496101_1569938 Ga0496101_1569938_78_482 134
959 3300048905 Ga0496102_0461494 Ga0496102_0461494_573_977 134
960 3300048905 Ga0496102_0819194 Ga0496102_0819194_414_818 134
961 3300048906 Ga0496103_0011091 Ga0496103_0011091_1947_2351 134
962 3300048907 Ga0496104_0205663 Ga0496104_0205663_29_433 134
963 3300048907 Ga0496104_1052041 Ga0496104_1052041_45_449 134
964 3300048908 Ga0496105_0010892 Ga0496105_0010892_4868_5272 134
965 3300048908 Ga0496105_0120864 Ga0496105_0120864_885_1289 134
966 3300048910 Ga0496107_0009344 Ga0496107_0009344_2048_2452 134
967 3300048910 Ga0496107_0217249 Ga0496107_0217249_361_765 134
968 3300048910 Ga0496107_0235021 Ga0496107_0235021_820_1224 134
969 3300048910 Ga0496107_0286131 Ga0496107_0286131_746_1150 134
970 3300048911 Ga0496108_0006649 Ga0496108_0006649_7082_7486 134
971 3300048911 Ga0496108_0022816 Ga0496108_0022816_3466_3870 134
972 3300048911 Ga0496108_1295035 Ga0496108_1295035_173_577 134
973 3300048912 Ga0496109_0010191 Ga0496109_0010191_3253_3657 134
974 3300048912 Ga0496109_0488070 Ga0496109_0488070_444_848 134
975 3300048912 Ga0496109_0733676 Ga0496109_0733676_41_445 134
976 3300048912 Ga0496109_0756955 Ga0496109_0756955_387_791 134
977 3300048912 Ga0496109_1436497 Ga0496109_1436497_58_462 134
978 3300048913 Ga0496110_0019059 Ga0496110_0019059_4588_4992 134
979 3300048914 Ga0496111_0020047 Ga0496111_0020047_1947_2351 134
980 3300048915 Ga0496112_0010385 Ga0496112_0010385_4367_4771 134
981 3300048915 Ga0496112_0078448 Ga0496112_0078448_777_1181 134
982 3300048915 Ga0496112_0125247 Ga0496112_0125247_350_754 134
983 3300048915 Ga0496112_0240243 Ga0496112_0240243_843_1247 134
984 3300048915 Ga0496112_0812790 Ga0496112_0812790_209_613 134
985 3300048916 Ga0496113_0325552 Ga0496113_0325552_662_1066 134
986 3300048916 Ga0496113_0683054 Ga0496113_0683054_294_698 134
987 3300048917 Ga0496114_0000069 Ga0496114_0000069_58365_58769 134
988 3300048917 Ga0496114_0837090 Ga0496114_0837090_13_417 134
989 3300049521 Ga0501298_003475 Ga0501298_003475_679_1083 134
990 3300049576 Ga0501040_0677854 Ga0501040_0677854_219_623 134
991 3300049583 Ga0501067_0050652 Ga0501067_0050652_364_768 134
992 3300049583 Ga0501067_0190404 Ga0501067_0190404_280_684 134
993 3300049587 Ga0501071_0318593 Ga0501071_0318593_511_915 134
994 3300049649 Ga0501198_004657 Ga0501198_004657_823_1227 134
995 3300049650 Ga0501199_003215 Ga0501199_003215_701_1105 134
996 3300049656 Ga0501209_137532 Ga0501209_137532_211_615 134
997 3300049660 Ga0501216_010060 Ga0501216_010060_647_1051 134
998 3300049661 Ga0501217_027089 Ga0501217_027089_306_710 134
999 3300049663 Ga0501223_002822 Ga0501223_002822_123_527 134
1000 3300049663 Ga0501223_044756 Ga0501223_044756_268_678 134
1001 3300049664 Ga0501224_007313 Ga0501224_007313_930_1334 134
1002 3300049668 Ga0501233_033334 Ga0501233_033334_61_465 134
1003 3300049669 Ga0501235_002872 Ga0501235_002872_2565_2969 134
1004 3300049669 Ga0501235_027377 Ga0501235_027377_830_1234 134
1005 3300049677 Ga0501247_063426 Ga0501247_063426_129_533 134
1006 3300049704 Ga0501221_002960 Ga0501221_002960_2168_2572 134
1007 3300049705 Ga0501225_0021079 Ga0501225_0021079_1171_1575 134
1008 3300049707 Ga0501234_019691 Ga0501234_019691_147_551 134
1009 3300049708 Ga0501245_034329 Ga0501245_034329_11_415 134
1010 3300049759 Ga0501262_014071 Ga0501262_014071_178_582 134
1011 3300049760 Ga0501263_035112 Ga0501263_035112_112_516 134
1012 3300049764 Ga0501267_003992 Ga0501267_003992_549_953 134
1013 3300049765 Ga0501268_004296 Ga0501268_004296_299_703 134
1014 3300049767 Ga0501270_002531 Ga0501270_002531_566_970 134
1015 3300049770 Ga0501273_004249 Ga0501273_004249_595_999 134
1016 3300049775 Ga0501279_014247 Ga0501279_014247_463_867 134
1017 3300050491 nmdc:mga00v17_46877_c1 nmdc:mga00v17_46877_c1_1863_2267 134
1018 3300050493 nmdc:mga0k408_304599_c1 nmdc:mga0k408_304599_c1_124_528 134
1019 3300050507 nmdc:mga05p37_1587520_c1 nmdc:mga05p37_1587520_c1_127_531 134
1020 3300050511 nmdc:mga08y16_933203_c1 nmdc:mga08y16_933203_c1_394_798 134
1021 3300050512 nmdc:mga0n895_605609_c1 nmdc:mga0n895_605609_c1_424_828 134
1022 3300050515 nmdc:mga0a205_1473562_c1 nmdc:mga0a205_1473562_c1_60_464 134
1023 3300061719 Ga0466962_0000327 Ga0466962_0000327_13142_13546 134
1024 3300061719 Ga0466962_0018553 Ga0466962_0018553_784_1188 134
1025 3300061719 Ga0466962_0115810 Ga0466962_0115810_270_674 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04002

RadC

RadC-like JAB domain

12

124

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h4n-assembly1.cif.gz_A 1.1 angstrom crystal structure of hypothetical protein ba_2335 from bacillus anthracis 0.9317 34 55
2qlc-assembly5.cif.gz_E the crystal structure of dna repair protein radc from chlorobium tepidum tls 0.8807 10 134
6xe9-assembly1.cif.gz_A 10s myosin ii (smooth muscle) 0.8754 32 54
2qlc-assembly5.cif.gz_E the crystal structure of dna repair protein radc from chlorobium tepidum tls 0.8742 10 134
5t98-assembly2.cif.gz_B crystal structure of bugh2awt 0.8652 33 56
ID Description Score Start End Superfamily
af_Q47685_35_158_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9386 16 134 3.40.140.10
af_P25531_100_221_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.905 12 132 3.40.140.10
4h4nA00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.903 34 53 2.60.40.3750
af_P31337_89_213_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9 8 133 3.40.140.10
af_P31337_89_213_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8933 8 133 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A369RIB7-F1-model_v4 DNA repair protein RadC 0.97 32 134 GO:0006508
GO:0008237
GO:0046872
AF-Q73HE0-F1-model_v4 DNA repair protein RadC, putative 0.9667 32 134 GO:0006508
GO:0008237
GO:0046872
AF-A0A6N6LDC9-F1-model_v4 JAB domain-containing protein 0.9615 32 134 GO:0006508
GO:0008237
GO:0046872
AF-A0A838V4A7-F1-model_v4 MPN domain-containing protein 0.9607 30 134 GO:0006508
GO:0008237
GO:0046872
AF-R5A777-F1-model_v4 RadC-like JAB domain protein 0.9604 10 134 GO:0006508
GO:0008237
GO:0046872

Feature Viewer

pLDDT pTM Quality
89.57 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map