F488498

General Info

Members Datasets Scaffolds Average Seq Length
1025 855 347 373

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0394339|Ga0496126_0394339_27_1019
Length 318
Sequence MDQVRGVGADIILGNTYHLMLRPGAERVARLGGLHEFARWPHPILTDSGGFQVMSLSKLRKLTEKGVTFRSHIDGAPYEMSPERSIEIQGLLDSDIQMQLDECTALPAELKEIERAMELSLRWAERCKTAFGDQPGKAMFGIVQGGDNAALRVRSAQALSAMGEPQAVMLEMLDITCPELPADKPRYLMGVGTPDDILKSVARGIDMFDCVMPTRAGRHGLAYTRRGKVNLRNARHADDPRPLDEESDCPAARDYSRAYLHHLVRSQEALGAMLLTWNNLSYYQKLMQDIRAAIETGSFEARGAEISEGWARGDIPVL

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
8 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
9 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
10 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
11 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
12 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
13 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
14 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
15 2512875024 Mesorhizobium loti R88b Isolate Nodule
16 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
17 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
18 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
19 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
20 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
21 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
22 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
23 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
24 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
25 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
26 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
27 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
28 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
29 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
30 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
31 2516143018 Ensifer sp. BR816 Isolate Nodule
32 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
33 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
34 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
35 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
36 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
37 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
38 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
39 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
40 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
41 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
42 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
43 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
44 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
45 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
46 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
47 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
48 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
49 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
50 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
51 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
52 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
53 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
54 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
55 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
56 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
57 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
58 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
59 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
60 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
61 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
62 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
63 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
64 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
65 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
66 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
67 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
68 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
69 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
70 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
71 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
72 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
73 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
74 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
75 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
76 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
77 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
78 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
79 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
80 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
81 2643221557 Ensifer sp. Root558 Isolate Unclassified
82 2643221558 Rhizobium sp. Root149 Isolate Unclassified
83 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
84 2643221582 Rhizobium sp. Root651 Isolate Unclassified
85 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
86 2643221607 Rhizobium sp. Root73 Isolate Unclassified
87 2643221610 Ensifer sp. Root74 Isolate Unclassified
88 2643221618 Ensifer sp. Root231 Isolate Unclassified
89 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
90 2643221626 Ensifer sp. Root31 Isolate Unclassified
91 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
92 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
93 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
94 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
95 2643221655 Ensifer sp. Root1252 Isolate Unclassified
96 2643221659 Ensifer sp. Root127 Isolate Unclassified
97 2643221668 Ensifer sp. Root423 Isolate Unclassified
98 2643221675 Ensifer sp. Root1298 Isolate Unclassified
99 2643221680 Ensifer sp. Root1312 Isolate Unclassified
100 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
101 2643221688 Rhizobium sp. Root482 Isolate Unclassified
102 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
103 2643221693 Rhizobium sp. Root491 Isolate Unclassified
104 2643221698 Ensifer sp. Root142 Isolate Unclassified
105 2643221712 Ensifer sp. Root258 Isolate Unclassified
106 2643221718 Rhizobium sp. Root268 Isolate Unclassified
107 2643221719 Rhizobium sp. Root274 Isolate Unclassified
108 2643221723 Ensifer sp. Root278 Isolate Unclassified
109 2643221726 Ensifer sp. Root954 Isolate Unclassified
110 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
111 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
112 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
113 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
114 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
115 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
116 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
117 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
118 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
119 2738543024 Aminobacter sp. AP02 Isolate Unclassified
120 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
121 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
122 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
123 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
124 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
125 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
126 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
127 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
128 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
129 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
130 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
131 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
132 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
133 2791355256 Rhizobium sp. M10 Isolate Nodule
134 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
135 2791355262 Rhizobium sp. M1 Isolate Nodule
136 2791355263 Rhizobium chutanense C5 Isolate Nodule
137 2791355266 Rhizobium sp. L43 Isolate Nodule
138 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
139 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
140 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
141 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
142 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
143 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
144 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
145 2802429633 Rhizobium anhuiense J3 Isolate Nodule
146 2802429634 Rhizobium anhuiense S10 Isolate Nodule
147 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
148 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
149 2802429637 Rhizobium anhuiense C15 Isolate Nodule
150 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
151 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
152 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
153 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
154 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
155 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
156 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
157 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
158 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
159 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
160 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
161 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
162 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
163 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
164 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
165 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
166 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
167 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
168 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
169 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
170 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
171 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
172 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
173 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
174 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
175 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
176 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
177 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
178 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
179 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
180 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
181 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
182 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
183 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
184 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
185 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
186 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
187 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
188 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
189 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
190 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
191 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
192 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
193 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
194 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
195 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
196 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
197 2844163670 Ensifer sp. 1H6 Isolate Unclassified
198 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
199 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
200 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
201 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
202 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
203 2854911287 Brucella lupini LUP21 Isolate Unclassified
204 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
205 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
206 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
207 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
208 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
209 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
210 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
211 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
212 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
213 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
214 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
215 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
216 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
217 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
218 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
219 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
220 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
221 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
222 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
223 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
224 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
225 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
226 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
227 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
228 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
229 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
230 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
231 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
232 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
233 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
234 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
235 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
236 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
237 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
238 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
239 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
240 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
241 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
242 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
243 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
244 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
245 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
246 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
247 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
248 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
249 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
250 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
251 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
252 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
253 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
254 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
255 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
256 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
257 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
258 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
259 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
260 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
261 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
262 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
263 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
264 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
265 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
266 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
267 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
268 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
269 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
270 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
271 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
272 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
273 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
274 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
275 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
276 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
277 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
278 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
279 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
280 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
281 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
282 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
283 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
284 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
285 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
286 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
287 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
288 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
289 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
290 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
291 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
292 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
293 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
294 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
295 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
296 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
297 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
298 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
299 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
300 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
301 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
302 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
303 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
304 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
305 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
306 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
307 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
308 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
309 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
310 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
311 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
312 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
313 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
314 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
315 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
316 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
317 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
318 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
319 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
320 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
321 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
322 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
323 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
324 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
325 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
326 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
327 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
328 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
329 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
330 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
331 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
332 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
333 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
334 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
335 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
336 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
337 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
338 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
339 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
340 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
341 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
342 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
343 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
344 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
345 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
346 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
347 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
348 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
349 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
350 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
351 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
352 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
353 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
354 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
355 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
356 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
357 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
358 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
359 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
360 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
361 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
362 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
363 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
364 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
365 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
366 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
367 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
368 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
369 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
370 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
371 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
372 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
373 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
374 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
375 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
376 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
377 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
378 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
379 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
380 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
381 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
382 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
383 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
384 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
385 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
386 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
387 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
388 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
389 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
390 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
391 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
392 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
393 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
394 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
395 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
396 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
397 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
398 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
399 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
400 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
401 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
402 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
403 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
404 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
405 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
406 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
407 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
408 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
409 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
410 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
411 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
412 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
413 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
414 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
415 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
416 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
417 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
418 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
419 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
420 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
421 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
422 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
423 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
424 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
425 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
426 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
427 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
428 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
429 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
430 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
431 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
432 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
433 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
434 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
435 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
436 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
437 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
438 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
439 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
440 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
441 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
442 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
443 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
444 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
445 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
446 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
447 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
448 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
449 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
450 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
451 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
452 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
453 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
454 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
455 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
456 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
457 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
458 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
459 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
460 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
461 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
462 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
463 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
464 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
465 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
466 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
467 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
468 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
469 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
470 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
471 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
472 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
473 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
474 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
475 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
476 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
477 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
478 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
479 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
480 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
481 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
482 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
483 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
484 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
485 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
486 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
487 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
488 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
489 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
490 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
491 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
492 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
493 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
494 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
495 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
496 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
497 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
498 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
499 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
500 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
501 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
502 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
503 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
504 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
505 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
506 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
507 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
508 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
509 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
510 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
511 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
512 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
513 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
514 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
515 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
516 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
517 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
518 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
519 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
520 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
521 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
522 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
523 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
524 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
525 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
526 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
527 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
528 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
529 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
530 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
531 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
532 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
533 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
534 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
535 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
536 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
537 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
538 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
539 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
540 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
541 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
542 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
543 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
544 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
545 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
546 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
547 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
548 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
549 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
550 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
551 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
552 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
553 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
554 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
555 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
556 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
557 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
558 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
559 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
560 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
561 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
562 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
563 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
564 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
565 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
566 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
567 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
568 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
569 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
570 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
571 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
572 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
573 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
574 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
575 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
576 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
577 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
578 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
579 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
580 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
581 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
582 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
583 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
584 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
585 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
586 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
587 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
588 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
589 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
590 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
591 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
592 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
593 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
594 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
595 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
596 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
597 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
598 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
599 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
600 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
601 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
602 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
603 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
604 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
605 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
606 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
607 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
608 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
609 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
610 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
611 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
612 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
613 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
614 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
615 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
616 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
617 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
618 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
619 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
620 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
621 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
622 3004167301 Mesorhizobium loti 582 Isolate Unclassified
623 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
624 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
625 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
626 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
627 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
628 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
629 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
630 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
631 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
632 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
633 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
634 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
635 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
636 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
637 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
638 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
639 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
640 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
641 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
642 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
643 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
644 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
645 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
646 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
647 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
648 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
649 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
650 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
651 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
652 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
653 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
654 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
655 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
656 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
657 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
658 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
659 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
660 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
661 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
662 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
663 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
664 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
665 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
666 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
667 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
668 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
669 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
670 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
671 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
672 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
673 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
674 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
675 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
676 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
677 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
678 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
679 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
680 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
681 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
682 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
683 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
684 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
685 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
686 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
687 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
688 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
689 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
690 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
691 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
692 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
693 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
694 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
695 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
696 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
697 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
698 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
699 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
700 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
701 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
702 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
703 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
704 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
705 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
706 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
707 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
708 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
709 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
710 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
711 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
712 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
713 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
714 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
715 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
716 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
717 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
718 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
719 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
720 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
721 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
722 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
723 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
724 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
725 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
726 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
727 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
728 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
729 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
730 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
731 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
732 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
733 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
734 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
735 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
736 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
737 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
738 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
739 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
740 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
741 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
742 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
743 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
744 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
745 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
746 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
747 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
748 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
749 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
750 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
751 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
752 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
753 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
754 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
755 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
756 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
757 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
758 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
759 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
760 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
761 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
762 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
763 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
764 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
765 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
766 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
767 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
768 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
769 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
770 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
771 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
772 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
773 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
774 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
775 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
776 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
777 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
778 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
779 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
780 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
781 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
782 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
783 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
784 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
785 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
786 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
787 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
788 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
789 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
790 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
791 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
792 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
793 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
794 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
795 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
796 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
797 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
798 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
799 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
800 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
801 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
802 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
803 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
804 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
805 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
806 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
807 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
808 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
809 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
810 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
811 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
812 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
813 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
814 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
815 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
816 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
817 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
818 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
819 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
820 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
821 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
822 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
823 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
824 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
825 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
826 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
827 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
828 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
829 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
830 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
831 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
832 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
833 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
834 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
835 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
836 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
837 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
838 8005382845 Rhizobium sp. R634 Isolate Nodule
839 8005395548 Rhizobium sp. R339 Isolate Nodule
840 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
841 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
842 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
843 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
844 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
845 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
846 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
847 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
848 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
849 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
850 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
851 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
852 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
853 8056382006 Rhizobium croatiense 13T Isolate Nodule
854 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
855 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 33.85
Metatranscriptomes 0
Isolates 66.15

Biome Distribution

Category Percentage (%)
Aerial Root 0.39
Bulb 0
Endosphere 11.71
Nodule 50.83
Rhizoplane 1.66
Rhizosphere 19.71
Stem 0
Stem Tuber 0
Unclassified 15.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000030 3300002705 Bacteria 126029
2 JGI25162J39368_1001515 3300002737 Bacteria 12058
3 JGI25154J39366_1000289 3300002738 Bacteria 30213
4 JGI25157J39369_1000010 3300002741 Bacteria 207685
5 JGI25152J39213_1008181 3300002773 Bacteria 2621
6 JGI25150J39212_1000010 3300002774 Bacteria 236260
7 JGI25150J39212_1006773 3300002774 Bacteria 2341
8 JGI25159J45721_1001125 3300002987 Bacteria 11424
9 JGI25151J46595_10000026 3300003187 Bacteria 211045
10 JGI25151J46595_10005052 3300003187 Bacteria 6869
11 JGI25406J46586_10003438 3300003203 Bacteria 7450
12 JGI25165J46597_1000087 3300003214 Bacteria 170335
13 JGI25165J46597_1000139 3300003214 Bacteria 121216
14 JGI25165J46597_1000654 3300003214 Bacteria 28366
15 JGI25165J46597_1001229 3300003214 Bacteria 15248
16 JGI25153J46596_10003622 3300003215 Bacteria 8574
17 JGI25153J46596_10004316 3300003215 Bacteria 7687
18 JGI25153J46596_10011346 3300003215 Bacteria 3943
19 JGI25160J50197_1000011 3300003354 Bacteria 275577
20 JGI25160J50197_1000593 3300003354 Bacteria 20289
21 JGI25160J50197_1016555 3300003354 Bacteria 2372
22 JGI25161J50226_1001660 3300003374 Bacteria 6391
23 JGI25161J50226_1001956 3300003374 Bacteria 5662
24 JGI25161J50226_1002628 3300003374 Bacteria 4505
25 Ga0055526_1006958 3300003771 Bacteria 6004
26 Ga0055526_1010394 3300003771 Bacteria 4335
27 Ga0055524_1006744 3300003775 Bacteria 4956
28 Ga0055536_1000356 3300003781 Bacteria 34069
29 Ga0055540_1005062 3300003792 Bacteria 5702
30 Ga0055540_1015994 3300003792 Bacteria 2155
31 Ga0055531_10003828 3300003794 Bacteria 9428
32 Ga0058692_1002330 3300003856 Bacteria 6416
33 Ga0055543_1000097 3300004625 Bacteria 75364
34 Ga0055543_1000255 3300004625 Bacteria 40071
35 Ga0055543_1001144 3300004625 Bacteria 11331
36 Ga0065165_1000018 3300005262 Bacteria 275082
37 Ga0065165_1008107 3300005262 Bacteria 5004
38 Ga0065165_1010197 3300005262 Bacteria 4097
39 Ga0070665_100068348 3300005548 Bacteria 3562
40 Ga0068852_100136537 3300005616 Bacteria 2265
41 Ga0081455_10011719 3300005937 Bacteria 8790
42 Ga0081539_10010362 3300005985 Bacteria 7585
43 Ga0075365_10000809 3300006038 Bacteria 12860
44 Ga0075365_10001555 3300006038 Bacteria 10502
45 Ga0075365_10028061 3300006038 Bacteria 3587
46 Ga0075368_10002095 3300006042 Bacteria 6447
47 Ga0075368_10003990 3300006042 Bacteria 4969
48 Ga0075363_100016486 3300006048 Bacteria 3650
49 Ga0075363_100029663 3300006048 Bacteria 2826
50 Ga0075364_10012524 3300006051 Bacteria 5191
51 Ga0075367_10009642 3300006178 Bacteria 5054
52 Ga0075369_10010101 3300006186 Bacteria 3687
53 Ga0075366_10021694 3300006195 Bacteria 3734
54 Ga0075366_10026232 3300006195 Bacteria 3411
55 Ga0075370_10000970 3300006353 Bacteria 11849
56 Ga0075370_10001750 3300006353 Bacteria 9672
57 Ga0075370_10138937 3300006353 Bacteria 1420
58 Ga0079104_1001402 3300006946 Bacteria 16290
59 Ga0079104_1006507 3300006946 Bacteria 4403
60 Ga0099826_10000090 3300006948 Bacteria 44830
61 Ga0099826_10004510 3300006948 Bacteria 9777
62 Ga0105240_10000005 3300009093 Bacteria 702630
63 Ga0105241_10186520 3300009174 Bacteria 1724
64 Ga0105237_10000773 3300009545 Bacteria 43739
65 Ga0105237_10007070 3300009545 Bacteria 12341
66 Ga0105238_10004109 3300009551 Bacteria 14443
67 Ga0123341_1000049 3300009765 Bacteria 49561
68 Ga0123342_1012839 3300009766 Bacteria 8588
69 Ga0105239_10004008 3300010375 Bacteria 17836
70 Ga0105239_10020587 3300010375 Bacteria 7278
71 Ga0157373_10002285 3300013100 Bacteria 14521
72 Ga0157371_10000015 3300013102 Bacteria 339838
73 Ga0157370_10000992 3300013104 Bacteria 35815
74 Ga0157370_10003013 3300013104 Bacteria 20000
75 Ga0157370_10055044 3300013104 Bacteria 3792
76 Ga0182007_10000618 3300015262 Bacteria 20687
77 Ga0183363_1281 3300015690 Bacteria 7689
78 Ga0214544_1000129 3300021320 Bacteria 108948
79 Ga0214542_1000828 3300021321 Bacteria 59640
80 Ga0214542_1027439 3300021321 Bacteria 2608
81 Ga0214543_1000010 3300021327 Bacteria 364844
82 Ga0214543_1000134 3300021327 Bacteria 102056
83 Ga0228711_1002680 3300022739 Bacteria 27471
84 Ga0228710_1002851 3300022740 Bacteria 27471
85 Ga0209435_100022 3300025206 Bacteria 207766
86 Ga0209760_104110 3300025207 Bacteria 1262
87 Ga0209436_100507 3300025208 Bacteria 17013
88 Ga0209436_103093 3300025208 Bacteria 4584
89 Ga0209437_100122 3300025233 Bacteria 201364
90 Ga0209437_100160 3300025233 Bacteria 149451
91 Ga0207425_1000010 3300025245 Bacteria 572898
92 Ga0209646_1000078 3300025246 Bacteria 207766
93 Ga0209026_1000065 3300025250 Bacteria 207766
94 Ga0209677_104805 3300025253 Bacteria 3743
95 Ga0209148_1000072 3300025254 Bacteria 325292
96 Ga0209759_1000055 3300025256 Bacteria 207766
97 Ga0209129_1000197 3300025258 Bacteria 78908
98 Ga0209129_1001042 3300025258 Bacteria 16374
99 Ga0209129_1001442 3300025258 Bacteria 13289
100 Ga0209233_1000027 3300025261 Bacteria 652089
101 Ga0209233_1000168 3300025261 Bacteria 149312
102 Ga0209233_1000170 3300025261 Bacteria 147527
103 Ga0209233_1001127 3300025261 Bacteria 10903
104 Ga0209455_1000133 3300025272 Bacteria 155670
105 Ga0209673_1002230 3300025273 Bacteria 14043
106 Ga0209673_1006554 3300025273 Bacteria 5584
107 Ga0209673_1007969 3300025273 Bacteria 4780
108 Ga0209673_1007970 3300025273 Bacteria 4780
109 Ga0209130_1000029 3300025284 Bacteria 323399
110 Ga0209130_1000097 3300025284 Bacteria 143750
111 Ga0209676_1000438 3300025292 Bacteria 71339
112 Ga0209025_1000022 3300025294 Bacteria 574487
113 Ga0209025_1000033 3300025294 Bacteria 414511
114 Ga0209025_1000358 3300025294 Bacteria 97655
115 Ga0209025_1000563 3300025294 Bacteria 68086
116 Ga0209025_1001678 3300025294 Bacteria 27100
117 Ga0209025_1020471 3300025294 Bacteria 3618
118 Ga0209564_1000275 3300025295 Bacteria 107884
119 Ga0209564_1000986 3300025295 Bacteria 35645
120 Ga0209564_1001528 3300025295 Bacteria 22999
121 Ga0209758_1000086 3300025297 Bacteria 254778
122 Ga0209758_1000505 3300025297 Bacteria 63185
123 Ga0209758_1000534 3300025297 Bacteria 60556
124 Ga0209758_1020108 3300025297 Bacteria 3178
125 Ga0209758_1045640 3300025297 Bacteria 1589
126 Ga0209050_1000516 3300025298 Bacteria 64933
127 Ga0209256_1001255 3300025299 Bacteria 27934
128 Ga0209256_1001768 3300025299 Bacteria 20511
129 Ga0207426_1000003 3300025302 Bacteria 1063212
130 Ga0207426_1000074 3300025302 Bacteria 323399
131 Ga0207426_1000408 3300025302 Bacteria 72326
132 Ga0209051_1003377 3300025303 Bacteria 10501
133 Ga0209051_1004697 3300025303 Bacteria 8308
134 Ga0209257_1009229 3300025304 Bacteria 5347
135 Ga0209257_1030233 3300025304 Bacteria 1751
136 Ga0207647_10003836 3300025904 Bacteria 11245
137 Ga0207705_10088769 3300025909 Bacteria 2262
138 Ga0207695_10000011 3300025913 Bacteria 910221
139 Ga0207671_10004599 3300025914 Bacteria 13104
140 Ga0207671_10046567 3300025914 Bacteria 3209
141 Ga0207671_10063925 3300025914 Bacteria 2735
142 Ga0207694_10033192 3300025924 Bacteria 3954
143 Ga0207678_10064346 3300026067 Bacteria 3151
144 Ga0207678_10180755 3300026067 Bacteria 1801
145 Ga0207702_10009685 3300026078 Bacteria 8090
146 Ga0207674_10118013 3300026116 Bacteria 2623
147 Ga0209281_1000508 3300027111 Bacteria 51432
148 Ga0209281_1004020 3300027111 Bacteria 4553
149 Ga0209371_1000178 3300027312 Bacteria 93894
150 Ga0209371_1017786 3300027312 Bacteria 1829
151 Ga0209282_1000116 3300027666 Bacteria 51432
152 Ga0209282_1000235 3300027666 Bacteria 28597
153 Ga0209813_10007397 3300027866 Bacteria 2735
154 Ga0268266_10059721 3300028379 Bacteria 3285
155 Ga0268266_10107615 3300028379 Bacteria 2466
156 Ga0307515_10000233 3300028794 Bacteria 137311
157 Ga0307515_10013071 3300028794 Bacteria 15547
158 Ga0307515_10265602 3300028794 Bacteria 1445
159 Ga0268256_1000251 3300030500 Bacteria 56750
160 Ga0268256_1022835 3300030500 Bacteria 1634
161 Ga0316181_1236523 3300030744 Bacteria 1896
162 Ga0307513_10021520 3300031456 Bacteria 7611
163 Ga0307412_10000449 3300031911 Bacteria 24913
164 Ga0315914_1002646 3300031967 Bacteria 27416
165 Ga0315913_1001232 3300033430 Bacteria 27471
166 Ga0315915_1000058 3300033464 Bacteria 72461
167 Ga0373947_0010286 3300035725 Bacteria 5368
168 Ga0373925_0063164 3300037068 Bacteria 2786
169 Ga0395899_0000073 3300037312 Bacteria 181387
170 Ga0395899_0305665 3300037312 Bacteria 1075
171 Ga0395900_0000027 3300037418 Bacteria 285957
172 Ga0395900_0037124 3300037418 Bacteria 5025
173 Ga0395900_0314024 3300037418 Bacteria 1550
174 Ga0395898_0000255 3300037466 Bacteria 131017
175 Ga0395898_0108397 3300037466 Bacteria 2663
176 Ga0395905_0000032 3300037471 Bacteria 285932
177 Ga0395905_0000386 3300037471 Bacteria 62786
178 Ga0395905_0046935 3300037471 Bacteria 4049
179 Ga0395905_0208393 3300037471 Bacteria 1832
180 Ga0395901_0000110 3300038443 Bacteria 112682
181 Ga0395901_0033538 3300038443 Bacteria 5300
182 Ga0395901_0089747 3300038443 Bacteria 3216
183 Ga0395901_0206055 3300038443 Bacteria 2060
184 Ga0436365_0571926 3300039437 Bacteria 4180
185 Ga0436365_1745677 3300039437 Bacteria 2074
186 Ga0436360_1264804 3300039438 Bacteria 1141
187 Ga0436362_0562496 3300039453 Unclassified 1356
188 Ga0436362_1220355 3300039453 Bacteria 1757
189 Ga0451851_0841148 3300041507 Bacteria 3941
190 Ga0439449_0005586 3300042007 Bacteria 4813
191 Ga0466968_0026106 3300044735 Bacteria 2395
192 Ga0495638_0034607 3300046460 Bacteria 3225
193 Ga0495664_0078795 3300046477 Bacteria 1974
194 Ga0495583_0044363 3300046506 Bacteria 2063
195 Ga0495587_0052935 3300046536 Bacteria 2394
196 Ga0495634_0011375 3300046642 Bacteria 6483
197 Ga0495625_0023055 3300046660 Bacteria 4760
198 Ga0495625_0270331 3300046660 Bacteria 1097
199 Ga0495613_0125857 3300046689 Bacteria 1838
200 Ga0495686_0002178 3300047472 Bacteria 19063
201 Ga0496101_0052923 3300048904 Bacteria 2928
202 Ga0496104_0007867 3300048907 Bacteria 9450
203 Ga0496104_0465763 3300048907 Bacteria 1175
204 Ga0496105_0115440 3300048908 Bacteria 2215
205 Ga0496110_0080939 3300048913 Bacteria 2895
206 Ga0496112_0023334 3300048915 Bacteria 5910
207 Ga0496115_0242934 3300048918 Bacteria 1484
208 Ga0496116_0036906 3300048919 Bacteria 3414
209 Ga0496116_0116082 3300048919 Bacteria 1560
210 Ga0496117_0000002 3300048920 Bacteria 2483758
211 Ga0496117_0002298 3300048920 Bacteria 24600
212 Ga0496117_0012239 3300048920 Bacteria 7587
213 Ga0496118_0000460 3300048921 Bacteria 67445
214 Ga0496118_0003956 3300048921 Bacteria 18115
215 Ga0496118_0011413 3300048921 Bacteria 8672
216 Ga0496118_0031959 3300048921 Bacteria 4348
217 Ga0496119_0047784 3300048922 Bacteria 2659
218 Ga0496120_0000078 3300048923 Bacteria 162312
219 Ga0496120_0007642 3300048923 Bacteria 8010
220 Ga0496121_0002309 3300048924 Bacteria 29564
221 Ga0496121_0009598 3300048924 Bacteria 11087
222 Ga0496121_0010507 3300048924 Bacteria 10428
223 Ga0496122_0000001 3300048925 Bacteria 1827766
224 Ga0496122_0000025 3300048925 Bacteria 362915
225 Ga0496122_0000957 3300048925 Bacteria 52113
226 Ga0496122_0004632 3300048925 Bacteria 16911
227 Ga0496122_0011586 3300048925 Bacteria 8900
228 Ga0496122_0012223 3300048925 Bacteria 8585
229 Ga0496123_0000001 3300048926 Bacteria 1831497
230 Ga0496123_0000032 3300048926 Bacteria 285282
231 Ga0496123_0000043 3300048926 Bacteria 253752
232 Ga0496123_0005205 3300048926 Bacteria 13219
233 Ga0496124_0002623 3300048927 Bacteria 23151
234 Ga0496124_0003161 3300048927 Bacteria 20373
235 Ga0496124_0014237 3300048927 Bacteria 7705
236 Ga0496125_0000311 3300048928 Bacteria 95568
237 Ga0496125_0005370 3300048928 Bacteria 14292
238 Ga0496125_0077891 3300048928 Bacteria 2552
239 Ga0496125_0150703 3300048928 Bacteria 1598
240 Ga0496126_0001233 3300048929 Bacteria 41528
241 Ga0496126_0394339 3300048929 Bacteria 1124
242 Ga0501031_0000217 3300049568 Bacteria 32968
243 Ga0501031_0007446 3300049568 Bacteria 7130
244 Ga0501031_0025811 3300049568 Bacteria 3833
245 Ga0501032_0000009 3300049569 Bacteria 228107
246 Ga0501032_0000064 3300049569 Bacteria 91971
247 Ga0501032_0004360 3300049569 Bacteria 10684
248 Ga0501032_0093103 3300049569 Bacteria 1999
249 Ga0501033_0000019 3300049570 Bacteria 204699
250 Ga0501033_0000330 3300049570 Bacteria 44983
251 Ga0501033_0001030 3300049570 Bacteria 25380
252 Ga0501033_0033887 3300049570 Bacteria 3833
253 Ga0501033_0179189 3300049570 Bacteria 1519
254 Ga0501034_0000044 3300049571 Bacteria 227982
255 Ga0501034_0000174 3300049571 Bacteria 119615
256 Ga0501034_0015374 3300049571 Bacteria 7865
257 Ga0501034_0026260 3300049571 Bacteria 5931
258 Ga0501034_0375761 3300049571 Bacteria 1347
259 Ga0501036_0000008 3300049572 Bacteria 228106
260 Ga0501036_0000399 3300049572 Bacteria 30550
261 Ga0501036_0095797 3300049572 Bacteria 2509
262 Ga0501036_0174211 3300049572 Bacteria 1812
263 Ga0501037_0000163 3300049573 Bacteria 62625
264 Ga0501037_0000267 3300049573 Bacteria 44964
265 Ga0501037_0000448 3300049573 Bacteria 33911
266 Ga0501038_0000006 3300049574 Bacteria 228107
267 Ga0501038_0000031 3300049574 Bacteria 132231
268 Ga0501038_0084809 3300049574 Bacteria 2665
269 Ga0501038_0107639 3300049574 Bacteria 2313
270 Ga0501039_0000014 3300049575 Bacteria 228107
271 Ga0501039_0000057 3300049575 Bacteria 89756
272 Ga0501039_0038919 3300049575 Bacteria 3673
273 Ga0501040_0057227 3300049576 Bacteria 2677
274 Ga0501043_0000048 3300049579 Bacteria 109146
275 Ga0501043_0000294 3300049579 Bacteria 45142
276 Ga0501043_0000566 3300049579 Bacteria 33076
277 Ga0501043_0044900 3300049579 Bacteria 3475
278 Ga0501043_0089584 3300049579 Bacteria 2418
279 Ga0501047_0003119 3300049581 Bacteria 15727
280 Ga0501047_0003704 3300049581 Bacteria 14393
281 Ga0501047_0009890 3300049581 Bacteria 9016
282 Ga0501047_0086262 3300049581 Bacteria 3016
283 Ga0501048_0101550 3300049582 Bacteria 2029
284 Ga0501067_0040840 3300049583 Bacteria 2576
285 Ga0501068_0057312 3300049584 Bacteria 2362
286 Ga0501068_0083040 3300049584 Bacteria 1969
287 Ga0501068_0125193 3300049584 Bacteria 1604
288 Ga0501069_0000084 3300049585 Bacteria 45142
289 Ga0501070_0001180 3300049586 Bacteria 23337
290 Ga0501070_0001515 3300049586 Bacteria 20712
291 Ga0501070_0005785 3300049586 Bacteria 10550
292 Ga0501070_0011207 3300049586 Bacteria 7568
293 Ga0501070_0015976 3300049586 Bacteria 6309
294 Ga0501070_0019103 3300049586 Bacteria 5748
295 Ga0501071_0018777 3300049587 Bacteria 4793
296 Ga0501073_0260312 3300049589 Bacteria 1197
297 Ga0501074_0000085 3300049590 Bacteria 45569
298 Ga0501074_0060749 3300049590 Bacteria 2723
299 Ga0501080_0003149 3300049742 Bacteria 14529
300 Ga0501080_0004202 3300049742 Bacteria 12777
301 Ga0501080_0033670 3300049742 Bacteria 4783
302 Ga0501080_0071228 3300049742 Bacteria 3233
303 Ga0501083_0000078 3300049744 Bacteria 65280
304 Ga0501280_004928 3300049776 Bacteria 1931
305 Ga0501035_0000198 3300049822 Bacteria 73523
306 Ga0501035_0000471 3300049822 Bacteria 45142
307 Ga0501035_0000823 3300049822 Bacteria 33092
308 Ga0501035_0001118 3300049822 Bacteria 28029
309 Ga0501035_0002538 3300049822 Bacteria 17848
310 Ga0501035_0021740 3300049822 Bacteria 5898
311 Ga0501035_0028077 3300049822 Bacteria 5138
312 Ga0501044_0000017 3300049823 Bacteria 228107
313 Ga0501044_0000649 3300049823 Bacteria 42017
314 Ga0501044_0021213 3300049823 Bacteria 6935
315 Ga0501044_0026568 3300049823 Bacteria 6127
316 Ga0501044_0130972 3300049823 Bacteria 2502
317 Ga0501044_0136994 3300049823 Bacteria 2439
318 Ga0501044_0199061 3300049823 Bacteria 1962
319 nmdc:mga03683_3419_c1 3300050489 Bacteria 5117
320 nmdc:mga03n38_44285_c1 3300050490 Bacteria 1954
321 nmdc:mga03n38_4569_c1 3300050490 Bacteria 4607
322 nmdc:mga00v17_49200_c1 3300050491 Bacteria 2557
323 nmdc:mga00v17_59031_c2 3300050491 Bacteria 1572
324 nmdc:mga0yw44_5123_c1 3300050492 Bacteria 6133
325 nmdc:mga0yw44_697_c1 3300050492 Bacteria 12311
326 nmdc:mga0k408_25595_c1 3300050493 Bacteria 3342
327 nmdc:mga06z11_8356_c1 3300050494 Bacteria 4313
328 nmdc:mga06z11_88752_c1 3300050494 Bacteria 1675
329 nmdc:mga04h51_5032_c1 3300050495 Bacteria 3340
330 nmdc:mga0sz30_14502_c1 3300050516 Bacteria 3104
331 nmdc:mga0sz30_4182_c1 3300050516 Bacteria 5200
332 nmdc:mga0sz30_77268_c1 3300050516 Bacteria 1438
333 Ga0495601_0042123 3300053077 Bacteria 2863
334 Ga0495601_0043570 3300053077 Bacteria 2818
335 Ga0495595_0057471 3300053084 Bacteria 1814
336 Ga0495619_0329604 3300053085 Bacteria 1057
337 Ga0500641_0013413 3300053096 Bacteria 3011
338 Ga0500608_074924 3300053122 Bacteria 1605
339 Ga0500652_000214 3300053131 Bacteria 22083
340 Ga0500568_0000592 3300053139 Bacteria 26355
341 Ga0500620_000253 3300053155 Bacteria 10442
342 Ga0500620_001907 3300053155 Bacteria 4023
343 Ga0500622_0000378 3300053156 Bacteria 42912
344 Ga0500622_0000778 3300053156 Bacteria 27680
345 Ga0500627_0012784 3300053158 Bacteria 3159
346 Ga0500636_0005342 3300053177 Bacteria 7322
347 Ga0501082_0016825 3300060353 Bacteria 6297

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0394339 Ga0496126_0394339_27_1019 318
2 iso_pu_bacteria 2937861824 2937867884 322
3 3300006048 Ga0075363_100029663 Ga0075363_1000296634 324
4 iso_pu_bacteria 2977907340 2977910670 327
5 iso_pu_bacteria 2987673487 2987676716 328
6 3300037312 Ga0395899_0305665 Ga0395899_0305665_19_1017 332
7 3300041507 Ga0451851_0841148 Ga0451851_0841148_2921_3919 332
8 3300046506 Ga0495583_0044363 Ga0495583_0044363_19_1017 332
9 3300050516 nmdc:mga0sz30_77268_c1 nmdc:mga0sz30_77268_c1_10_1008 332
10 iso_pu_bacteria 2876406927 2876413257 334
11 iso_pu_bacteria 2977957713 2977961016 334
12 iso_pu_bacteria 2933016740 2933019195 335
13 3300039437 Ga0436365_1745677 Ga0436365_1745677_241_1272 343
14 3300046660 Ga0495625_0270331 Ga0495625_0270331_15_1046 343
15 3300053085 Ga0495619_0329604 Ga0495619_0329604_11_1045 343
16 iso_pu_bacteria 2984518228 2984521728 350
17 3300048919 Ga0496116_0116082 Ga0496116_0116082_23_1087 354
18 3300048921 Ga0496118_0011413 Ga0496118_0011413_7584_8648 354
19 3300049823 Ga0501044_0136994 Ga0501044_0136994_34_1098 354
20 3300039438 Ga0436360_1264804 Ga0436360_1264804_20_1090 356
21 3300025207 Ga0209760_104110 Ga0209760_1041101 357
22 3300049581 Ga0501047_0009890 Ga0501047_0009890_7136_8266 360
23 3300049586 Ga0501070_0005785 Ga0501070_0005785_8065_9195 360
24 3300049590 Ga0501074_0060749 Ga0501074_0060749_1128_2258 360
25 3300049822 Ga0501035_0028077 Ga0501035_0028077_557_1687 360
26 3300005616 Ga0068852_100136537 Ga0068852_1001365373 364
27 3300006048 Ga0075363_100016486 Ga0075363_1000164864 364
28 3300013104 Ga0157370_10055044 Ga0157370_100550444 364
29 3300025909 Ga0207705_10088769 Ga0207705_100887692 364
30 3300049823 Ga0501044_0199061 Ga0501044_0199061_38_1207 364
31 3300050490 nmdc:mga03n38_44285_c1 nmdc:mga03n38_44285_c1_642_1772 364
32 3300044735 Ga0466968_0026106 Ga0466968_0026106_795_1931 365
33 3300006042 Ga0075368_10003990 Ga0075368_100039905 366
34 3300049569 Ga0501032_0093103 Ga0501032_0093103_790_1959 366
35 3300049574 Ga0501038_0107639 Ga0501038_0107639_508_1677 366
36 3300049586 Ga0501070_0019103 Ga0501070_0019103_2954_4123 366
37 3300049822 Ga0501035_0002538 Ga0501035_0002538_9237_10406 366
38 3300050494 nmdc:mga06z11_8356_c1 nmdc:mga06z11_8356_c1_2148_3278 366
39 3300050495 nmdc:mga04h51_5032_c1 nmdc:mga04h51_5032_c1_345_1475 366
40 iso_pu_bacteria 2958137437 2958141991 366
41 3300039453 Ga0436362_0562496 Ga0436362_0562496_88_1194 367
42 3300048907 Ga0496104_0465763 Ga0496104_0465763_21_1127 368
43 iso_pu_bacteria 2643221558 2643811902 369
44 iso_pu_bacteria 8018150411 8018155442 370
45 3300002774 JGI25150J39212_1006773 JGI25150J39212_10067732 371
46 3300025294 Ga0209025_1020471 Ga0209025_10204714 371
47 iso_pu_bacteria 2671180139 2671695808 371
48 iso_pu_bacteria 2503198000 2503202237 372
49 iso_pu_bacteria 2508501122 2509107651 372
50 iso_pu_bacteria 2508501123 2509117046 372
51 iso_pu_bacteria 2508501127 2509140617 372
52 iso_pu_bacteria 2509276018 2509370685 372
53 iso_pu_bacteria 2509276019 2509375989 372
54 iso_pu_bacteria 2509276022 2509396886 372
55 iso_pu_bacteria 2510065057 2510308660 372
56 iso_pu_bacteria 2510065059 2510317478 372
57 iso_pu_bacteria 2510917022 2511134930 372
58 iso_pu_bacteria 2511231052 2511501508 372
59 iso_pu_bacteria 2512875016 2512930861 372
60 iso_pu_bacteria 2512875024 2512958587 372
61 iso_pu_bacteria 2512875026 2512971739 372
62 iso_pu_bacteria 2513237086 2513588111 372
63 iso_pu_bacteria 2513237089 2513605271 372
64 iso_pu_bacteria 2513237090 2513609899 372
65 iso_pu_bacteria 2513237091 2513618702 372
66 iso_pu_bacteria 2513237140 2513886970 372
67 iso_pu_bacteria 2513237143 2513907205 372
68 iso_pu_bacteria 2513237156 2513987069 372
69 iso_pu_bacteria 2513237159 2513997347 372
70 iso_pu_bacteria 2513237160 2514005287 372
71 iso_pu_bacteria 2513237164 2514034997 372
72 iso_pu_bacteria 2513237305 2514418966 372
73 iso_pu_bacteria 2513237351 2514589937 372
74 iso_pu_bacteria 2515154107 2515611351 372
75 iso_pu_bacteria 2515154114 2515645036 372
76 iso_pu_bacteria 2516143018 2516209511 372
77 iso_pu_bacteria 2516653046 2516892826 372
78 iso_pu_bacteria 2517487022 2517569601 372
79 iso_pu_bacteria 2524023207 2524453662 372
80 iso_pu_bacteria 2537561587 2537877785 372
81 iso_pu_bacteria 2551306084 2551674253 372
82 iso_pu_bacteria 2551306084 2551680405 372
83 iso_pu_bacteria 2551306085 2551686545 372
84 iso_pu_bacteria 2551306086 2551691822 372
85 iso_pu_bacteria 2551306087 2551699774 372
86 iso_pu_bacteria 2551306089 2551711740 372
87 iso_pu_bacteria 2551306090 2551719509 372
88 iso_pu_bacteria 2551306091 2551729149 372
89 iso_pu_bacteria 2551306092 2551737099 372
90 iso_pu_bacteria 2551306093 2551742526 372
91 iso_pu_bacteria 2554235003 2554247753 372
92 iso_pu_bacteria 2558860242 2559294886 372
93 iso_pu_bacteria 2558860983 2561466506 372
94 iso_pu_bacteria 2582581283 2585168471 372
95 iso_pu_bacteria 2582581304 2585254506 372
96 iso_pu_bacteria 2582581306 2585270045 372
97 iso_pu_bacteria 2582581307 2585270670 372
98 iso_pu_bacteria 2582581308 2585277011 372
99 iso_pu_bacteria 2582581315 2585323983 372
100 iso_pu_bacteria 2582581316 2585333620 372
101 iso_pu_bacteria 2582581865 2585389750 372
102 iso_pu_bacteria 2582581866 2585393715 372
103 iso_pu_bacteria 2585427527 2585537021 372
104 iso_pu_bacteria 2585427528 2585540496 372
105 iso_pu_bacteria 2585427530 2585551872 372
106 iso_pu_bacteria 2585427531 2585558373 372
107 iso_pu_bacteria 2585427593 2585838712 372
108 iso_pu_bacteria 2585427594 2585846560 372
109 iso_pu_bacteria 2585427608 2585897768 372
110 iso_pu_bacteria 2585427609 2585904638 372
111 iso_pu_bacteria 2585428125 2587980246 372
112 iso_pu_bacteria 2597489875 2597814072 372
113 iso_pu_bacteria 2599185156 2599336304 372
114 iso_pu_bacteria 2599185210 2599604147 372
115 iso_pu_bacteria 2599185301 2599938053 372
116 iso_pu_bacteria 2599185352 2600197124 372
117 iso_pu_bacteria 2600255279 2601608060 372
118 iso_pu_bacteria 2600255308 2601744835 372
119 iso_pu_bacteria 2615840626 2616308385 372
120 iso_pu_bacteria 2615840698 2616556547 372
121 iso_pu_bacteria 2617270742 2617385874 372
122 iso_pu_bacteria 2643221550 2643773749 372
123 iso_pu_bacteria 2643221551 2643775545 372
124 iso_pu_bacteria 2643221555 2643793991 372
125 iso_pu_bacteria 2643221557 2643808723 372
126 iso_pu_bacteria 2643221564 2643837486 372
127 iso_pu_bacteria 2643221582 2643919377 372
128 iso_pu_bacteria 2643221595 2643989415 372
129 iso_pu_bacteria 2643221607 2644049363 372
130 iso_pu_bacteria 2643221610 2644066255 372
131 iso_pu_bacteria 2643221618 2644107979 372
132 iso_pu_bacteria 2643221623 2644132065 372
133 iso_pu_bacteria 2643221626 2644148349 372
134 iso_pu_bacteria 2643221627 2644152987 372
135 iso_pu_bacteria 2643221636 2644204298 372
136 iso_pu_bacteria 2643221637 2644210480 372
137 iso_pu_bacteria 2643221653 2644300654 372
138 iso_pu_bacteria 2643221655 2644309373 372
139 iso_pu_bacteria 2643221659 2644333199 372
140 iso_pu_bacteria 2643221668 2644377795 372
141 iso_pu_bacteria 2643221675 2644415532 372
142 iso_pu_bacteria 2643221680 2644450066 372
143 iso_pu_bacteria 2643221686 2644482397 372
144 iso_pu_bacteria 2643221688 2644494477 372
145 iso_pu_bacteria 2643221689 2644502050 372
146 iso_pu_bacteria 2643221693 2644522279 372
147 iso_pu_bacteria 2643221698 2644545629 372
148 iso_pu_bacteria 2643221712 2644615315 372
149 iso_pu_bacteria 2643221718 2644654032 372
150 iso_pu_bacteria 2643221719 2644658692 372
151 iso_pu_bacteria 2643221723 2644673622 372
152 iso_pu_bacteria 2643221726 2644687623 372
153 iso_pu_bacteria 2657244999 2657683821 372
154 iso_pu_bacteria 2667528174 2671115786 372
155 iso_pu_bacteria 2687453392 2688599400 372
156 iso_pu_bacteria 2690316117 2692316027 372
157 iso_pu_bacteria 2693429783 2694632184 372
158 iso_pu_bacteria 2721755686 2723576352 372
159 iso_pu_bacteria 2738541317 2738945593 372
160 iso_pu_bacteria 2738541333 2739037992 372
161 iso_pu_bacteria 2738543024 2739307890 372
162 iso_pu_bacteria 2751185821 2753458335 372
163 iso_pu_bacteria 2756170246 2756675869 372
164 iso_pu_bacteria 2765235802 2765465588 372
165 iso_pu_bacteria 2775507049 2776913376 372
166 iso_pu_bacteria 2775507266 2778176525 372
167 iso_pu_bacteria 2791355082 2792580745 372
168 iso_pu_bacteria 2791355094 2792639536 372
169 iso_pu_bacteria 2791355123 2792748508 372
170 iso_pu_bacteria 2791355253 2793279679 372
171 iso_pu_bacteria 2791355256 2793298261 372
172 iso_pu_bacteria 2791355259 2793313742 372
173 iso_pu_bacteria 2791355262 2793337049 372
174 iso_pu_bacteria 2791355263 2793341300 372
175 iso_pu_bacteria 2791355266 2793361396 372
176 iso_pu_bacteria 2802428858 2802718737 372
177 iso_pu_bacteria 2802428859 2802726349 372
178 iso_pu_bacteria 2802428860 2802732889 372
179 iso_pu_bacteria 2802428861 2802738244 372
180 iso_pu_bacteria 2802428862 2802744578 372
181 iso_pu_bacteria 2802428863 2802751216 372
182 iso_pu_bacteria 2802429268 2804752084 372
183 iso_pu_bacteria 2802429633 2806045383 372
184 iso_pu_bacteria 2802429634 2806055424 372
185 iso_pu_bacteria 2802429635 2806061467 372
186 iso_pu_bacteria 2802429636 2806068041 372
187 iso_pu_bacteria 2802429637 2806072611 372
188 iso_pu_bacteria 2808606387 2808985344 372
189 iso_pu_bacteria 2818991272 2819241892 372
190 iso_pu_bacteria 2818991439 2819559777 372
191 iso_pu_bacteria 2818991448 2819610358 372
192 iso_pu_bacteria 2818991453 2819638100 372
193 iso_pu_bacteria 2837678835 2837680218 372
194 iso_pu_bacteria 2838029111 2838035090 372
195 iso_pu_bacteria 2838042994 2838043207 372
196 iso_pu_bacteria 2838074704 2838078755 372
197 iso_pu_bacteria 2838675328 2838676188 372
198 iso_pu_bacteria 2838680041 2838682461 372
199 iso_pu_bacteria 2838694306 2838697032 372
200 iso_pu_bacteria 2838707686 2838709727 372
201 iso_pu_bacteria 2838714209 2838715070 372
202 iso_pu_bacteria 2838719591 2838721130 372
203 iso_pu_bacteria 2838724970 2838725829 372
204 iso_pu_bacteria 2839993093 2839995544 372
205 iso_pu_bacteria 2840764183 2840768071 372
206 iso_pu_bacteria 2841734538 2841740039 372
207 iso_pu_bacteria 2841846520 2841848087 372
208 iso_pu_bacteria 2841859092 2841859362 372
209 iso_pu_bacteria 2842077413 2842077901 372
210 iso_pu_bacteria 2842118031 2842119591 372
211 iso_pu_bacteria 2842124991 2842125883 372
212 iso_pu_bacteria 2842130223 2842131082 372
213 iso_pu_bacteria 2842152218 2842153748 372
214 iso_pu_bacteria 2842170452 2842171313 372
215 iso_pu_bacteria 2842175837 2842177368 372
216 iso_pu_bacteria 2842187318 2842188178 372
217 iso_pu_bacteria 2842211629 2842212489 372
218 iso_pu_bacteria 2842224351 2842225892 372
219 iso_pu_bacteria 2842237096 2842239140 372
220 iso_pu_bacteria 2842291075 2842291563 372
221 iso_pu_bacteria 2842370503 2842373028 372
222 iso_pu_bacteria 2842377471 2842377959 372
223 iso_pu_bacteria 2842384541 2842386100 372
224 iso_pu_bacteria 2842475841 2842481858 372
225 iso_pu_bacteria 2842482326 2842487084 372
226 iso_pu_bacteria 2842502639 2842508733 372
227 iso_pu_bacteria 2842509118 2842510259 372
228 iso_pu_bacteria 2842515876 2842516146 372
229 iso_pu_bacteria 2842521101 2842522408 372
230 iso_pu_bacteria 2842922631 2842927723 372
231 iso_pu_bacteria 2844002411 2844006466 372
232 iso_pu_bacteria 2844009547 2844014679 372
233 iso_pu_bacteria 2844163670 2844167285 372
234 iso_pu_bacteria 2847417321 2847418908 372
235 iso_pu_bacteria 2847686936 2847692975 372
236 iso_pu_bacteria 2848992105 2848993945 372
237 iso_pu_bacteria 2850079185 2850081892 372
238 iso_pu_bacteria 2852387548 2852389677 372
239 iso_pu_bacteria 2855825444 2855825603 372
240 iso_pu_bacteria 2855839649 2855840980 372
241 iso_pu_bacteria 2855872281 2855876578 372
242 iso_pu_bacteria 2856314179 2856316105 372
243 iso_pu_bacteria 2856320880 2856325872 372
244 iso_pu_bacteria 2856328259 2856328952 372
245 iso_pu_bacteria 2856334872 2856335305 372
246 iso_pu_bacteria 2856342000 2856343723 372
247 iso_pu_bacteria 2856349417 2856353661 372
248 iso_pu_bacteria 2856356410 2856360207 372
249 iso_pu_bacteria 2856364286 2856368851 372
250 iso_pu_bacteria 2857349434 2857350178 372
251 iso_pu_bacteria 2857367948 2857373634 372
252 iso_pu_bacteria 2858800743 2858801520 372
253 iso_pu_bacteria 2869162929 2869165290 372
254 iso_pu_bacteria 2869169390 2869172533 372
255 iso_pu_bacteria 2869249662 2869251931 372
256 iso_pu_bacteria 2869256925 2869262511 372
257 iso_pu_bacteria 2869264136 2869266575 372
258 iso_pu_bacteria 2869271264 2869272483 372
259 iso_pu_bacteria 2869278585 2869278652 372
260 iso_pu_bacteria 2869285874 2869291346 372
261 iso_pu_bacteria 2871429161 2871433626 372
262 iso_pu_bacteria 2871444079 2871447695 372
263 iso_pu_bacteria 2871451962 2871458170 372
264 iso_pu_bacteria 2871459585 2871459833 372
265 iso_pu_bacteria 2871466892 2871472076 372
266 iso_pu_bacteria 2871474448 2871475333 372
267 iso_pu_bacteria 2871481445 2871486718 372
268 iso_pu_bacteria 2871488783 2871495756 372
269 iso_pu_bacteria 2871495908 2871500719 372
270 iso_pu_bacteria 2874109183 2874113677 372
271 iso_pu_bacteria 2874116593 2874119162 372
272 iso_pu_bacteria 2874123672 2874125971 372
273 iso_pu_bacteria 2874131515 2874136525 372
274 iso_pu_bacteria 2874139085 2874145238 372
275 iso_pu_bacteria 2874146452 2874153227 372
276 iso_pu_bacteria 2874155637 2874160492 372
277 iso_pu_bacteria 2874162495 2874168486 372
278 iso_pu_bacteria 2874168670 2874176231 372
279 iso_pu_bacteria 2876363079 2876365467 372
280 iso_pu_bacteria 2876369609 2876371146 372
281 iso_pu_bacteria 2876377896 2876382676 372
282 iso_pu_bacteria 2876386047 2876386141 372
283 iso_pu_bacteria 2876392853 2876394999 372
284 iso_pu_bacteria 2876399893 2876403116 372
285 iso_pu_bacteria 2876413966 2876419518 372
286 iso_pu_bacteria 2876420981 2876424463 372
287 iso_pu_bacteria 2878035449 2878040374 372
288 iso_pu_bacteria 2878738818 2878743435 372
289 iso_pu_bacteria 2878745973 2878751237 372
290 iso_pu_bacteria 2878753008 2878753445 372
291 iso_pu_bacteria 2878760144 2878764808 372
292 iso_pu_bacteria 2878767105 2878771909 372
293 iso_pu_bacteria 2878774303 2878774843 372
294 iso_pu_bacteria 2878781027 2878787843 372
295 iso_pu_bacteria 2878788777 2878793798 372
296 iso_pu_bacteria 2881147464 2881152835 372
297 iso_pu_bacteria 2881155292 2881156330 372
298 iso_pu_bacteria 2881161766 2881168337 372
299 iso_pu_bacteria 2881845957 2881853128 372
300 iso_pu_bacteria 2881853255 2881857255 372
301 iso_pu_bacteria 2881861095 2881862816 372
302 iso_pu_bacteria 2882632389 2882633871 372
303 iso_pu_bacteria 2882912400 2882915820 372
304 iso_pu_bacteria 2885312484 2885317141 372
305 iso_pu_bacteria 2885318864 2885321594 372
306 iso_pu_bacteria 2885342637 2885344301 372
307 iso_pu_bacteria 2885350715 2885352246 372
308 iso_pu_bacteria 2888337043 2888340168 372
309 iso_pu_bacteria 2888343758 2888347488 372
310 iso_pu_bacteria 2888350351 2888356578 372
311 iso_pu_bacteria 2889010040 2889011483 372
312 iso_pu_bacteria 2889016732 2889016786 372
313 iso_pu_bacteria 2889790730 2889793563 372
314 iso_pu_bacteria 2889914905 2889918703 372
315 iso_pu_bacteria 2891048133 2891051514 372
316 iso_pu_bacteria 2891373044 2891374145 372
317 iso_pu_bacteria 2894817345 2894818325 372
318 iso_pu_bacteria 2896384573 2896390624 372
319 iso_pu_bacteria 2899792073 2899794164 372
320 iso_pu_bacteria 2899803654 2899808862 372
321 iso_pu_bacteria 2899845264 2899846537 372
322 iso_pu_bacteria 2903448605 2903455633 372
323 iso_pu_bacteria 2903492973 2903495300 372
324 iso_pu_bacteria 2903492973 2903501735 372
325 iso_pu_bacteria 2903513507 2903517919 372
326 iso_pu_bacteria 2903521522 2903522823 372
327 iso_pu_bacteria 2903528002 2903533013 372
328 iso_pu_bacteria 2903540706 2903545532 372
329 iso_pu_bacteria 2904578770 2904583182 372
330 iso_pu_bacteria 2904659560 2904661630 372
331 iso_pu_bacteria 2906308376 2906313178 372
332 iso_pu_bacteria 2906321335 2906325889 372
333 iso_pu_bacteria 2906328253 2906335277 372
334 iso_pu_bacteria 2906363423 2906365840 372
335 iso_pu_bacteria 2906370794 2906376527 372
336 iso_pu_bacteria 2906378014 2906381232 372
337 iso_pu_bacteria 2906386501 2906388932 372
338 iso_pu_bacteria 2906393657 2906397797 372
339 iso_pu_bacteria 2906401398 2906402742 372
340 iso_pu_bacteria 2906408224 2906412668 372
341 iso_pu_bacteria 2906414383 2906416242 372
342 iso_pu_bacteria 2906427513 2906433971 372
343 iso_pu_bacteria 2913295892 2913301098 372
344 iso_pu_bacteria 2913308742 2913310302 372
345 iso_pu_bacteria 2915980308 2915985347 372
346 iso_pu_bacteria 2915986958 2915987994 372
347 iso_pu_bacteria 2915993759 2915996322 372
348 iso_pu_bacteria 2916000859 2916001463 372
349 iso_pu_bacteria 2916007675 2916010352 372
350 iso_pu_bacteria 2916014648 2916017090 372
351 iso_pu_bacteria 2916021584 2916022489 372
352 iso_pu_bacteria 2916028427 2916029017 372
353 iso_pu_bacteria 2916035215 2916041673 372
354 iso_pu_bacteria 2916041962 2916047887 372
355 iso_pu_bacteria 2916048683 2916054113 372
356 iso_pu_bacteria 2916055098 2916061631 372
357 iso_pu_bacteria 2916061851 2916062310 372
358 iso_pu_bacteria 2916068649 2916071973 372
359 iso_pu_bacteria 2916076590 2916081968 372
360 iso_pu_bacteria 2919114240 2919115161 372
361 iso_pu_bacteria 2919119836 2919123831 372
362 iso_pu_bacteria 2919408235 2919409840 372
363 iso_pu_bacteria 2920760137 2920765912 372
364 iso_pu_bacteria 2920822456 2920824444 372
365 iso_pu_bacteria 2921201388 2921201570 372
366 iso_pu_bacteria 2921208531 2921210264 372
367 iso_pu_bacteria 2921237296 2921239102 372
368 iso_pu_bacteria 2921244191 2921250408 372
369 iso_pu_bacteria 2921250672 2921253992 372
370 iso_pu_bacteria 2921257292 2921257376 372
371 iso_pu_bacteria 2921263974 2921264600 372
372 iso_pu_bacteria 2921282425 2921283379 372
373 iso_pu_bacteria 2921289301 2921293217 372
374 iso_pu_bacteria 2922130491 2922134387 372
375 iso_pu_bacteria 2922151315 2922157474 372
376 iso_pu_bacteria 2922158528 2922164130 372
377 iso_pu_bacteria 2922172374 2922176404 372
378 iso_pu_bacteria 2922178524 2922184238 372
379 iso_pu_bacteria 2922185730 2922186060 372
380 iso_pu_bacteria 2924144063 2924147430 372
381 iso_pu_bacteria 2924150972 2924151675 372
382 iso_pu_bacteria 2924158325 2924159054 372
383 iso_pu_bacteria 2924165586 2924167819 372
384 iso_pu_bacteria 2924172951 2924176527 372
385 iso_pu_bacteria 2924179722 2924180382 372
386 iso_pu_bacteria 2924186466 2924187600 372
387 iso_pu_bacteria 2924193448 2924200311 372
388 iso_pu_bacteria 2924200457 2924203857 372
389 iso_pu_bacteria 2924207177 2924213803 372
390 iso_pu_bacteria 2924214083 2924217101 372
391 iso_pu_bacteria 2924221636 2924224042 372
392 iso_pu_bacteria 2924228884 2924235070 372
393 iso_pu_bacteria 2924710171 2924715185 372
394 iso_pu_bacteria 2924726620 2924733091 372
395 iso_pu_bacteria 2924733363 2924736226 372
396 iso_pu_bacteria 2924741084 2924742963 372
397 iso_pu_bacteria 2924748358 2924752643 372
398 iso_pu_bacteria 2924754689 2924759538 372
399 iso_pu_bacteria 2924762789 2924768953 372
400 iso_pu_bacteria 2924776078 2924781247 372
401 iso_pu_bacteria 2924784321 2924789640 372
402 iso_pu_bacteria 2926754445 2926756207 372
403 iso_pu_bacteria 2926760298 2926760438 372
404 iso_pu_bacteria 2933006813 2933008394 372
405 iso_pu_bacteria 2933011516 2933013210 372
406 iso_pu_bacteria 2933594066 2933597899 372
407 iso_pu_bacteria 2935894831 2935899102 372
408 iso_pu_bacteria 2936996657 2936998016 372
409 iso_pu_bacteria 2937002841 2937006151 372
410 iso_pu_bacteria 2937009748 2937012650 372
411 iso_pu_bacteria 2937016420 2937019723 372
412 iso_pu_bacteria 2937023124 2937029345 372
413 iso_pu_bacteria 2937029754 2937032702 372
414 iso_pu_bacteria 2937036028 2937042031 372
415 iso_pu_bacteria 2937042894 2937045846 372
416 iso_pu_bacteria 2937049772 2937051298 372
417 iso_pu_bacteria 2937056579 2937057709 372
418 iso_pu_bacteria 2937063883 2937070788 372
419 iso_pu_bacteria 2937071275 2937077582 372
420 iso_pu_bacteria 2937078374 2937082642 372
421 iso_pu_bacteria 2937084907 2937091438 372
422 iso_pu_bacteria 2937091812 2937095870 372
423 iso_pu_bacteria 2937098957 2937100126 372
424 iso_pu_bacteria 2937106411 2937111903 372
425 iso_pu_bacteria 2937113482 2937118408 372
426 iso_pu_bacteria 2937119839 2937125680 372
427 iso_pu_bacteria 2937126314 2937130341 372
428 iso_pu_bacteria 2937813078 2937820671 372
429 iso_pu_bacteria 2937822353 2937827271 372
430 iso_pu_bacteria 2937843397 2937845933 372
431 iso_pu_bacteria 2937848649 2937849108 372
432 iso_pu_bacteria 2937877337 2937879008 372
433 iso_pu_bacteria 2937891427 2937891630 372
434 iso_pu_bacteria 2937972304 2937975246 372
435 iso_pu_bacteria 2937994558 2937999382 372
436 iso_pu_bacteria 2938014810 2938016961 372
437 iso_pu_bacteria 2941499720 2941505043 372
438 iso_pu_bacteria 2957375807 2957379425 372
439 iso_pu_bacteria 2957382221 2957386434 372
440 iso_pu_bacteria 2957388812 2957389832 372
441 iso_pu_bacteria 2957395598 2957399871 372
442 iso_pu_bacteria 2957402308 2957406754 372
443 iso_pu_bacteria 2957408893 2957410211 372
444 iso_pu_bacteria 2957415311 2957421727 372
445 iso_pu_bacteria 2957422303 2957426181 372
446 iso_pu_bacteria 2957430029 2957437167 372
447 iso_pu_bacteria 2957437181 2957441879 372
448 iso_pu_bacteria 2957443900 2957445460 372
449 iso_pu_bacteria 2957450854 2957453885 372
450 iso_pu_bacteria 2957457609 2957459744 372
451 iso_pu_bacteria 2957464669 2957465737 372
452 iso_pu_bacteria 2957471148 2957476554 372
453 iso_pu_bacteria 2957478035 2957478613 372
454 iso_pu_bacteria 2957484790 2957486137 372
455 iso_pu_bacteria 2957491536 2957498185 372
456 iso_pu_bacteria 2957498199 2957502581 372
457 iso_pu_bacteria 2957505466 2957506634 372
458 iso_pu_bacteria 2958034702 2958034768 372
459 iso_pu_bacteria 2958041894 2958043104 372
460 iso_pu_bacteria 2958084443 2958086182 372
461 iso_pu_bacteria 2958092219 2958097727 372
462 iso_pu_bacteria 2958100919 2958106733 372
463 iso_pu_bacteria 2958108152 2958115128 372
464 iso_pu_bacteria 2958115193 2958122280 372
465 iso_pu_bacteria 2958122699 2958123144 372
466 iso_pu_bacteria 2958130278 2958135746 372
467 iso_pu_bacteria 2958144490 2958148788 372
468 iso_pu_bacteria 2958158011 2958158703 372
469 iso_pu_bacteria 2958165035 2958169856 372
470 iso_pu_bacteria 2958172287 2958178581 372
471 iso_pu_bacteria 2958179912 2958185237 372
472 iso_pu_bacteria 2960584000 2960588930 372
473 iso_pu_bacteria 2960591022 2960596283 372
474 iso_pu_bacteria 2960597568 2960603894 372
475 iso_pu_bacteria 2960603979 2960604486 372
476 iso_pu_bacteria 2960610863 2960616528 372
477 iso_pu_bacteria 2960617483 2960618878 372
478 iso_pu_bacteria 2960624210 2960628764 372
479 iso_pu_bacteria 2960631154 2960632643 372
480 iso_pu_bacteria 2960637947 2960645195 372
481 iso_pu_bacteria 2960645483 2960646300 372
482 iso_pu_bacteria 2960652885 2960656286 372
483 iso_pu_bacteria 2960660292 2960664216 372
484 iso_pu_bacteria 2960667422 2960669595 372
485 iso_pu_bacteria 2960674078 2960676825 372
486 iso_pu_bacteria 2960680706 2960686978 372
487 iso_pu_bacteria 2960687367 2960688761 372
488 iso_pu_bacteria 2960693952 2960700135 372
489 iso_pu_bacteria 2961077736 2961083504 372
490 iso_pu_bacteria 2961114664 2961116783 372
491 iso_pu_bacteria 2961127735 2961136783 372
492 iso_pu_bacteria 2961136820 2961139244 372
493 iso_pu_bacteria 2961163497 2961168316 372
494 iso_pu_bacteria 2961170736 2961177889 372
495 iso_pu_bacteria 2961183825 2961189118 372
496 iso_pu_bacteria 2963644680 2963648364 372
497 iso_pu_bacteria 2964607997 2964609319 372
498 iso_pu_bacteria 2964615318 2964616151 372
499 iso_pu_bacteria 2964621998 2964622915 372
500 iso_pu_bacteria 2964628898 2964632097 372
501 iso_pu_bacteria 2964636051 2964639309 372
502 iso_pu_bacteria 2964643177 2964648890 372
503 iso_pu_bacteria 2964649959 2964652087 372
504 iso_pu_bacteria 2964656573 2964662791 372
505 iso_pu_bacteria 2964663802 2964666846 372
506 iso_pu_bacteria 2964670856 2964671281 372
507 iso_pu_bacteria 2964678106 2964681063 372
508 iso_pu_bacteria 2964685014 2964690096 372
509 iso_pu_bacteria 2964691889 2964696953 372
510 iso_pu_bacteria 2964698721 2964699356 372
511 iso_pu_bacteria 2964705432 2964709018 372
512 iso_pu_bacteria 2964712639 2964716205 372
513 iso_pu_bacteria 2964719344 2964724374 372
514 iso_pu_bacteria 2965018300 2965023135 372
515 iso_pu_bacteria 2965025482 2965029501 372
516 iso_pu_bacteria 2965032056 2965035448 372
517 iso_pu_bacteria 2965040258 2965042839 372
518 iso_pu_bacteria 2965047637 2965054304 372
519 iso_pu_bacteria 2965062239 2965069791 372
520 iso_pu_bacteria 2965089291 2965094042 372
521 iso_pu_bacteria 2965110997 2965111160 372
522 iso_pu_bacteria 2965119406 2965121377 372
523 iso_pu_bacteria 2967664464 2967667076 372
524 iso_pu_bacteria 2967671571 2967672800 372
525 iso_pu_bacteria 2967678726 2967683898 372
526 iso_pu_bacteria 2967686174 2967691231 372
527 iso_pu_bacteria 2967693043 2967693511 372
528 iso_pu_bacteria 2967699805 2967700729 372
529 iso_pu_bacteria 2967706974 2967711707 372
530 iso_pu_bacteria 2967714385 2967715649 372
531 iso_pu_bacteria 2967721400 2967726792 372
532 iso_pu_bacteria 2967728569 2967734420 372
533 iso_pu_bacteria 2967735183 2967736514 372
534 iso_pu_bacteria 2967742019 2967742393 372
535 iso_pu_bacteria 2967748971 2967750523 372
536 iso_pu_bacteria 2967755722 2967758258 372
537 iso_pu_bacteria 2967762386 2967765197 372
538 iso_pu_bacteria 2967769361 2967770679 372
539 iso_pu_bacteria 2967775926 2967776542 372
540 iso_pu_bacteria 2967996073 2968003156 372
541 iso_pu_bacteria 2968003550 2968003982 372
542 iso_pu_bacteria 2968016561 2968017823 372
543 iso_pu_bacteria 2968083720 2968084877 372
544 iso_pu_bacteria 2968091066 2968091819 372
545 iso_pu_bacteria 2968097103 2968101607 372
546 iso_pu_bacteria 2968110612 2968112690 372
547 iso_pu_bacteria 2968117919 2968123078 372
548 iso_pu_bacteria 2968128360 2968129881 372
549 iso_pu_bacteria 2968138860 2968143888 372
550 iso_pu_bacteria 2968171901 2968176716 372
551 iso_pu_bacteria 2970019648 2970022530 372
552 iso_pu_bacteria 2970026789 2970032755 372
553 iso_pu_bacteria 2970033650 2970034407 372
554 iso_pu_bacteria 2970040964 2970041584 372
555 iso_pu_bacteria 2970047711 2970052526 372
556 iso_pu_bacteria 2970054988 2970061298 372
557 iso_pu_bacteria 2970061556 2970063076 372
558 iso_pu_bacteria 2970068827 2970074645 372
559 iso_pu_bacteria 2970076120 2970082409 372
560 iso_pu_bacteria 2970082768 2970088197 372
561 iso_pu_bacteria 2970088815 2970095692 372
562 iso_pu_bacteria 2970095765 2970102338 372
563 iso_pu_bacteria 2970102677 2970104187 372
564 iso_pu_bacteria 2970109326 2970114986 372
565 iso_pu_bacteria 2970116247 2970121469 372
566 iso_pu_bacteria 2970122695 2970126904 372
567 iso_pu_bacteria 2970129317 2970130210 372
568 iso_pu_bacteria 2970136068 2970138421 372
569 iso_pu_bacteria 2970143518 2970147727 372
570 iso_pu_bacteria 2970149975 2970154331 372
571 iso_pu_bacteria 2970156795 2970158079 372
572 iso_pu_bacteria 2970164137 2970170443 372
573 iso_pu_bacteria 2970170962 2970172111 372
574 iso_pu_bacteria 2970177841 2970178240 372
575 iso_pu_bacteria 2970184632 2970187247 372
576 iso_pu_bacteria 2970191845 2970193858 372
577 iso_pu_bacteria 2970469710 2970472002 372
578 iso_pu_bacteria 2970489779 2970495847 372
579 iso_pu_bacteria 2970503327 2970510565 372
580 iso_pu_bacteria 2970510686 2970512694 372
581 iso_pu_bacteria 2970524798 2970531737 372
582 iso_pu_bacteria 2970532167 2970536816 372
583 iso_pu_bacteria 2970540015 2970541015 372
584 iso_pu_bacteria 2970547951 2970550438 372
585 iso_pu_bacteria 2970554993 2970559655 372
586 iso_pu_bacteria 2970593180 2970593248 372
587 iso_pu_bacteria 2970619444 2970621088 372
588 iso_pu_bacteria 2970627176 2970631208 372
589 iso_pu_bacteria 2977516862 2977521181 372
590 iso_pu_bacteria 2977523885 2977526802 372
591 iso_pu_bacteria 2977530762 2977535699 372
592 iso_pu_bacteria 2977537788 2977541716 372
593 iso_pu_bacteria 2977544691 2977550761 372
594 iso_pu_bacteria 2977551784 2977554489 372
595 iso_pu_bacteria 2977558990 2977562631 372
596 iso_pu_bacteria 2977565890 2977572334 372
597 iso_pu_bacteria 2977572785 2977577384 372
598 iso_pu_bacteria 2977579622 2977583693 372
599 iso_pu_bacteria 2977821940 2977822615 372
600 iso_pu_bacteria 2977828996 2977832493 372
601 iso_pu_bacteria 2977843712 2977848969 372
602 iso_pu_bacteria 2977851361 2977855322 372
603 iso_pu_bacteria 2977858184 2977858332 372
604 iso_pu_bacteria 2977864932 2977872538 372
605 iso_pu_bacteria 2977872689 2977875592 372
606 iso_pu_bacteria 2977915119 2977917535 372
607 iso_pu_bacteria 2977922695 2977923113 372
608 iso_pu_bacteria 2977935797 2977941430 372
609 iso_pu_bacteria 2977942078 2977948218 372
610 iso_pu_bacteria 2977950692 2977951944 372
611 iso_pu_bacteria 2977971508 2977975619 372
612 iso_pu_bacteria 2977986579 2977992654 372
613 iso_pu_bacteria 2979089926 2979094286 372
614 iso_pu_bacteria 2979095461 2979098333 372
615 iso_pu_bacteria 2979100975 2979103519 372
616 iso_pu_bacteria 2979710463 2979714662 372
617 iso_pu_bacteria 2979764755 2979767243 372
618 iso_pu_bacteria 2979772303 2979774541 372
619 iso_pu_bacteria 2979779861 2979779875 372
620 iso_pu_bacteria 2979793036 2979799785 372
621 iso_pu_bacteria 2979808191 2979815439 372
622 iso_pu_bacteria 2984509177 2984511912 372
623 iso_pu_bacteria 2984537506 2984541025 372
624 iso_pu_bacteria 2984601300 2984603306 372
625 iso_pu_bacteria 2987636660 2987637366 372
626 iso_pu_bacteria 2987645492 2987648085 372
627 iso_pu_bacteria 2987652177 2987655420 372
628 iso_pu_bacteria 2987659509 2987664330 372
629 iso_pu_bacteria 2987666974 2987670631 372
630 iso_pu_bacteria 2989349275 2989352999 372
631 iso_pu_bacteria 2989776772 2989778819 372
632 iso_pu_bacteria 2995392953 2995393606 372
633 iso_pu_bacteria 2996310559 2996311008 372
634 iso_pu_bacteria 2996336353 2996337766 372
635 iso_pu_bacteria 2996341866 2996345236 372
636 iso_pu_bacteria 2996348954 2996350934 372
637 iso_pu_bacteria 2996386984 2996392589 372
638 iso_pu_bacteria 3000135777 3000138461 372
639 iso_pu_bacteria 3002141150 3002143897 372
640 iso_pu_bacteria 3003665799 3003671149 372
641 iso_pu_bacteria 3004167301 3004169615 372
642 iso_pu_bacteria 3004188549 3004193385 372
643 iso_pu_bacteria 3004195979 3004196531 372
644 iso_pu_bacteria 3004203850 3004206237 372
645 iso_pu_bacteria 3004211236 3004211657 372
646 iso_pu_bacteria 3004218560 3004218904 372
647 iso_pu_bacteria 3004232784 3004235262 372
648 iso_pu_bacteria 3004239961 3004244298 372
649 iso_pu_bacteria 3004248173 3004250316 372
650 iso_pu_bacteria 3004268573 3004275224 372
651 iso_pu_bacteria 3004275668 3004277632 372
652 iso_pu_bacteria 3004289098 3004292093 372
653 iso_pu_bacteria 3004334049 3004340973 372
654 iso_pu_bacteria 3005416602 3005420297 372
655 iso_pu_bacteria 3005445848 3005447322 372
656 iso_pu_bacteria 637000159 637073907 372
657 iso_pu_bacteria 643692032 643825786 372
658 iso_pu_bacteria 648276728 648740969 372
659 iso_pu_bacteria 649633066 649873904 372
660 iso_pu_bacteria 8002285264 8002286098 372
661 iso_pu_bacteria 8003570095 8003571202 372
662 iso_pu_bacteria 8003992118 8003993473 372
663 iso_pu_bacteria 8003999396 8004000736 372
664 iso_pu_bacteria 8004300914 8004301053 372
665 iso_pu_bacteria 8004361976 8004368258 372
666 iso_pu_bacteria 8004374579 8004375017 372
667 iso_pu_bacteria 8004387939 8004394098 372
668 iso_pu_bacteria 8004395343 8004400127 372
669 iso_pu_bacteria 8004445564 8004445750 372
670 iso_pu_bacteria 8004640170 8004646705 372
671 iso_pu_bacteria 8004695233 8004700294 372
672 iso_pu_bacteria 8004703790 8004713714 372
673 iso_pu_bacteria 8004714634 8004719435 372
674 iso_pu_bacteria 8004727605 8004734063 372
675 iso_pu_bacteria 8005246636 8005248369 372
676 iso_pu_bacteria 8005314921 8005317248 372
677 iso_pu_bacteria 8005484373 8005486691 372
678 iso_pu_bacteria 8005570704 8005575564 372
679 iso_pu_bacteria 8005645114 8005646169 372
680 iso_pu_bacteria 8005658619 8005659387 372
681 iso_pu_bacteria 8005682033 8005686299 372
682 iso_pu_bacteria 8024486573 8024492637 372
683 iso_pu_bacteria 8045864390 8045865371 372
684 iso_pu_bacteria 8046767195 8046773947 372
685 iso_pu_bacteria 8049293176 8049294626 372
686 iso_pu_bacteria 8054460903 8054462279 372
687 iso_pu_bacteria 8054558443 8054560846 372
688 iso_pu_bacteria 8055617313 8055621555 372
689 iso_pu_bacteria 8056382006 8056388307 372
690 iso_pu_bacteria 8056875544 8056877657 372
691 iso_pu_bacteria 8057575449 8057578327 372
692 iso_pu_bacteria 2510917030 2511193390 373
693 iso_pu_bacteria 2511231027 2511389446 373
694 iso_pu_bacteria 2582581298 2585225791 373
695 iso_pu_bacteria 2585427529 2585546751 373
696 iso_pu_bacteria 2767802442 2770195611 373
697 iso_pu_bacteria 2775506902 2776271527 373
698 iso_pu_bacteria 2775506904 2776279962 373
699 iso_pu_bacteria 2837651117 2837653068 373
700 iso_pu_bacteria 2842871566 2842872740 373
701 iso_pu_bacteria 2894652903 2894654287 373
702 iso_pu_bacteria 2915650412 2915653866 373
703 iso_pu_bacteria 2919100787 2919107875 373
704 iso_pu_bacteria 2928521798 2928523249 373
705 iso_pu_bacteria 2954011201 2954015519 373
706 iso_pu_bacteria 8005382845 8005388121 373
707 iso_pu_bacteria 8005395548 8005396922 373
708 3300006038 Ga0075365_10001555 Ga0075365_1000155512 374
709 3300006178 Ga0075367_10009642 Ga0075367_100096423 374
710 3300049575 Ga0501039_0038919 Ga0501039_0038919_1700_2824 374
711 3300050490 nmdc:mga03n38_4569_c1 nmdc:mga03n38_4569_c1_2427_3554 374
712 3300050491 nmdc:mga00v17_49200_c1 nmdc:mga00v17_49200_c1_1384_2511 374
713 3300050516 nmdc:mga0sz30_14502_c1 nmdc:mga0sz30_14502_c1_1937_3064 374
714 3300053096 Ga0500641_0013413 Ga0500641_0013413_863_1990 374
715 3300009174 Ga0105241_10186520 Ga0105241_101865202 375
716 iso_pu_bacteria 2757320392 2757572064 375
717 3300002705 JGI25156J39149_1000030 JGI25156J39149_1000030107 376
718 3300002737 JGI25162J39368_1001515 JGI25162J39368_100151512 376
719 3300002738 JGI25154J39366_1000289 JGI25154J39366_100028915 376
720 3300002741 JGI25157J39369_1000010 JGI25157J39369_100001019 376
721 3300002773 JGI25152J39213_1008181 JGI25152J39213_10081812 376
722 3300002774 JGI25150J39212_1000010 JGI25150J39212_1000010201 376
723 3300002987 JGI25159J45721_1001125 JGI25159J45721_10011259 376
724 3300003187 JGI25151J46595_10000026 JGI25151J46595_10000026181 376
725 3300003187 JGI25151J46595_10005052 JGI25151J46595_100050522 376
726 3300003203 JGI25406J46586_10003438 JGI25406J46586_100034382 376
727 3300003214 JGI25165J46597_1000087 JGI25165J46597_100008780 376
728 3300003214 JGI25165J46597_1000139 JGI25165J46597_100013925 376
729 3300003214 JGI25165J46597_1000654 JGI25165J46597_100065429 376
730 3300003214 JGI25165J46597_1001229 JGI25165J46597_100122917 376
731 3300003215 JGI25153J46596_10003622 JGI25153J46596_100036229 376
732 3300003215 JGI25153J46596_10004316 JGI25153J46596_100043165 376
733 3300003215 JGI25153J46596_10011346 JGI25153J46596_100113463 376
734 3300003354 JGI25160J50197_1000011 JGI25160J50197_1000011252 376
735 3300003354 JGI25160J50197_1000593 JGI25160J50197_100059315 376
736 3300003354 JGI25160J50197_1016555 JGI25160J50197_10165553 376
737 3300003374 JGI25161J50226_1001660 JGI25161J50226_10016607 376
738 3300003374 JGI25161J50226_1001956 JGI25161J50226_10019563 376
739 3300003374 JGI25161J50226_1002628 JGI25161J50226_10026283 376
740 3300003771 Ga0055526_1006958 Ga0055526_10069588 376
741 3300003771 Ga0055526_1010394 Ga0055526_10103943 376
742 3300003775 Ga0055524_1006744 Ga0055524_10067442 376
743 3300003781 Ga0055536_1000356 Ga0055536_100035629 376
744 3300003792 Ga0055540_1005062 Ga0055540_10050626 376
745 3300003792 Ga0055540_1015994 Ga0055540_10159943 376
746 3300003794 Ga0055531_10003828 Ga0055531_100038289 376
747 3300003856 Ga0058692_1002330 Ga0058692_10023303 376
748 3300004625 Ga0055543_1000097 Ga0055543_10000975 376
749 3300004625 Ga0055543_1000255 Ga0055543_100025532 376
750 3300004625 Ga0055543_1001144 Ga0055543_10011449 376
751 3300005262 Ga0065165_1000018 Ga0065165_1000018252 376
752 3300005262 Ga0065165_1008107 Ga0065165_10081075 376
753 3300005262 Ga0065165_1010197 Ga0065165_10101975 376
754 3300005548 Ga0070665_100068348 Ga0070665_1000683483 376
755 3300005937 Ga0081455_10011719 Ga0081455_100117197 376
756 3300005985 Ga0081539_10010362 Ga0081539_1001036211 376
757 3300006038 Ga0075365_10000809 Ga0075365_1000080911 376
758 3300006038 Ga0075365_10028061 Ga0075365_100280613 376
759 3300006042 Ga0075368_10002095 Ga0075368_100020953 376
760 3300006051 Ga0075364_10012524 Ga0075364_100125244 376
761 3300006186 Ga0075369_10010101 Ga0075369_100101012 376
762 3300006195 Ga0075366_10021694 Ga0075366_100216944 376
763 3300006195 Ga0075366_10026232 Ga0075366_100262323 376
764 3300006353 Ga0075370_10000970 Ga0075370_100009702 376
765 3300006353 Ga0075370_10001750 Ga0075370_1000175011 376
766 3300006353 Ga0075370_10138937 Ga0075370_101389372 376
767 3300006946 Ga0079104_1001402 Ga0079104_100140210 376
768 3300006946 Ga0079104_1006507 Ga0079104_10065076 376
769 3300006948 Ga0099826_10000090 Ga0099826_1000009011 376
770 3300006948 Ga0099826_10004510 Ga0099826_100045105 376
771 3300009093 Ga0105240_10000005 Ga0105240_10000005401 376
772 3300009545 Ga0105237_10000773 Ga0105237_1000077323 376
773 3300009545 Ga0105237_10007070 Ga0105237_1000707012 376
774 3300009551 Ga0105238_10004109 Ga0105238_100041093 376
775 3300009765 Ga0123341_1000049 Ga0123341_100004933 376
776 3300009766 Ga0123342_1012839 Ga0123342_10128399 376
777 3300010375 Ga0105239_10004008 Ga0105239_1000400818 376
778 3300010375 Ga0105239_10020587 Ga0105239_100205872 376
779 3300013100 Ga0157373_10002285 Ga0157373_100022852 376
780 3300013102 Ga0157371_10000015 Ga0157371_10000015193 376
781 3300013104 Ga0157370_10000992 Ga0157370_100009928 376
782 3300013104 Ga0157370_10003013 Ga0157370_1000301318 376
783 3300015262 Ga0182007_10000618 Ga0182007_1000061815 376
784 3300015690 Ga0183363_1281 Ga0183363_12819 376
785 3300021320 Ga0214544_1000129 Ga0214544_100012976 376
786 3300021321 Ga0214542_1000828 Ga0214542_100082817 376
787 3300021321 Ga0214542_1027439 Ga0214542_10274393 376
788 3300021327 Ga0214543_1000010 Ga0214543_1000010140 376
789 3300021327 Ga0214543_1000134 Ga0214543_100013412 376
790 3300022739 Ga0228711_1002680 Ga0228711_100268010 376
791 3300022740 Ga0228710_1002851 Ga0228710_100285110 376
792 3300025206 Ga0209435_100022 Ga0209435_10002217 376
793 3300025208 Ga0209436_100507 Ga0209436_10050712 376
794 3300025208 Ga0209436_103093 Ga0209436_1030932 376
795 3300025233 Ga0209437_100122 Ga0209437_100122158 376
796 3300025233 Ga0209437_100160 Ga0209437_10016016 376
797 3300025245 Ga0207425_1000010 Ga0207425_1000010528 376
798 3300025246 Ga0209646_1000078 Ga0209646_100007817 376
799 3300025250 Ga0209026_1000065 Ga0209026_100006517 376
800 3300025253 Ga0209677_104805 Ga0209677_1048052 376
801 3300025254 Ga0209148_1000072 Ga0209148_1000072234 376
802 3300025256 Ga0209759_1000055 Ga0209759_100005517 376
803 3300025258 Ga0209129_1000197 Ga0209129_100019755 376
804 3300025258 Ga0209129_1001042 Ga0209129_100104211 376
805 3300025258 Ga0209129_1001442 Ga0209129_10014429 376
806 3300025261 Ga0209233_1000027 Ga0209233_1000027341 376
807 3300025261 Ga0209233_1000168 Ga0209233_1000168144 376
808 3300025261 Ga0209233_1000170 Ga0209233_1000170158 376
809 3300025261 Ga0209233_1001127 Ga0209233_10011274 376
810 3300025272 Ga0209455_1000133 Ga0209455_100013351 376
811 3300025273 Ga0209673_1002230 Ga0209673_10022306 376
812 3300025273 Ga0209673_1006554 Ga0209673_10065545 376
813 3300025273 Ga0209673_1007969 Ga0209673_10079697 376
814 3300025273 Ga0209673_1007970 Ga0209673_10079707 376
815 3300025284 Ga0209130_1000029 Ga0209130_10000295 376
816 3300025284 Ga0209130_1000097 Ga0209130_1000097131 376
817 3300025292 Ga0209676_1000438 Ga0209676_10004387 376
818 3300025294 Ga0209025_1000022 Ga0209025_100002255 376
819 3300025294 Ga0209025_1000033 Ga0209025_1000033194 376
820 3300025294 Ga0209025_1000358 Ga0209025_100035895 376
821 3300025294 Ga0209025_1000563 Ga0209025_100056345 376
822 3300025294 Ga0209025_1001678 Ga0209025_100167810 376
823 3300025295 Ga0209564_1000275 Ga0209564_100027594 376
824 3300025295 Ga0209564_1000986 Ga0209564_100098612 376
825 3300025295 Ga0209564_1001528 Ga0209564_100152816 376
826 3300025297 Ga0209758_1000086 Ga0209758_1000086204 376
827 3300025297 Ga0209758_1000505 Ga0209758_100050553 376
828 3300025297 Ga0209758_1000534 Ga0209758_100053453 376
829 3300025297 Ga0209758_1020108 Ga0209758_10201083 376
830 3300025297 Ga0209758_1045640 Ga0209758_10456402 376
831 3300025298 Ga0209050_1000516 Ga0209050_10005165 376
832 3300025299 Ga0209256_1001255 Ga0209256_10012555 376
833 3300025299 Ga0209256_1001768 Ga0209256_100176814 376
834 3300025302 Ga0207426_1000003 Ga0207426_1000003735 376
835 3300025302 Ga0207426_1000074 Ga0207426_1000074292 376
836 3300025302 Ga0207426_1000408 Ga0207426_10004089 376
837 3300025303 Ga0209051_1003377 Ga0209051_100337710 376
838 3300025303 Ga0209051_1004697 Ga0209051_10046972 376
839 3300025304 Ga0209257_1009229 Ga0209257_10092294 376
840 3300025304 Ga0209257_1030233 Ga0209257_10302332 376
841 3300025904 Ga0207647_10003836 Ga0207647_1000383611 376
842 3300025913 Ga0207695_10000011 Ga0207695_10000011516 376
843 3300025914 Ga0207671_10004599 Ga0207671_1000459913 376
844 3300025914 Ga0207671_10046567 Ga0207671_100465673 376
845 3300025914 Ga0207671_10063925 Ga0207671_100639252 376
846 3300025924 Ga0207694_10033192 Ga0207694_100331924 376
847 3300026067 Ga0207678_10064346 Ga0207678_100643464 376
848 3300026067 Ga0207678_10180755 Ga0207678_101807552 376
849 3300026078 Ga0207702_10009685 Ga0207702_100096855 376
850 3300026116 Ga0207674_10118013 Ga0207674_101180133 376
851 3300027111 Ga0209281_1000508 Ga0209281_100050832 376
852 3300027111 Ga0209281_1004020 Ga0209281_10040207 376
853 3300027312 Ga0209371_1000178 Ga0209371_100017857 376
854 3300027312 Ga0209371_1017786 Ga0209371_10177861 376
855 3300027666 Ga0209282_1000116 Ga0209282_100011632 376
856 3300027666 Ga0209282_1000235 Ga0209282_100023517 376
857 3300027866 Ga0209813_10007397 Ga0209813_100073972 376
858 3300028379 Ga0268266_10059721 Ga0268266_100597213 376
859 3300028379 Ga0268266_10107615 Ga0268266_101076153 376
860 3300028794 Ga0307515_10000233 Ga0307515_1000023360 376
861 3300028794 Ga0307515_10013071 Ga0307515_1001307112 376
862 3300028794 Ga0307515_10265602 Ga0307515_102656022 376
863 3300030500 Ga0268256_1000251 Ga0268256_100025132 376
864 3300030500 Ga0268256_1022835 Ga0268256_10228352 376
865 3300030744 Ga0316181_1236523 Ga0316181_12365232 376
866 3300031456 Ga0307513_10021520 Ga0307513_100215208 376
867 3300031911 Ga0307412_10000449 Ga0307412_100004494 376
868 3300031967 Ga0315914_1002646 Ga0315914_100264610 376
869 3300033430 Ga0315913_1001232 Ga0315913_100123210 376
870 3300033464 Ga0315915_1000058 Ga0315915_100005847 376
871 3300035725 Ga0373947_0010286 Ga0373947_0010286_3393_4523 376
872 3300037068 Ga0373925_0063164 Ga0373925_0063164_500_1630 376
873 3300037312 Ga0395899_0000073 Ga0395899_0000073_100363_101493 376
874 3300037418 Ga0395900_0000027 Ga0395900_0000027_204933_206063 376
875 3300037418 Ga0395900_0037124 Ga0395900_0037124_23_1153 376
876 3300037418 Ga0395900_0314024 Ga0395900_0314024_189_1319 376
877 3300037466 Ga0395898_0000255 Ga0395898_0000255_49993_51123 376
878 3300037466 Ga0395898_0108397 Ga0395898_0108397_1023_2153 376
879 3300037471 Ga0395905_0000032 Ga0395905_0000032_79870_81000 376
880 3300037471 Ga0395905_0000386 Ga0395905_0000386_30220_31350 376
881 3300037471 Ga0395905_0046935 Ga0395905_0046935_2273_3403 376
882 3300037471 Ga0395905_0208393 Ga0395905_0208393_539_1669 376
883 3300038443 Ga0395901_0000110 Ga0395901_0000110_79895_81025 376
884 3300038443 Ga0395901_0033538 Ga0395901_0033538_801_1931 376
885 3300038443 Ga0395901_0089747 Ga0395901_0089747_741_1871 376
886 3300038443 Ga0395901_0206055 Ga0395901_0206055_662_1792 376
887 3300039437 Ga0436365_0571926 Ga0436365_0571926_100_1230 376
888 3300039453 Ga0436362_1220355 Ga0436362_1220355_575_1705 376
889 3300042007 Ga0439449_0005586 Ga0439449_0005586_2743_3873 376
890 3300046460 Ga0495638_0034607 Ga0495638_0034607_1887_3017 376
891 3300046477 Ga0495664_0078795 Ga0495664_0078795_134_1264 376
892 3300046536 Ga0495587_0052935 Ga0495587_0052935_621_1751 376
893 3300046642 Ga0495634_0011375 Ga0495634_0011375_802_1932 376
894 3300046660 Ga0495625_0023055 Ga0495625_0023055_1122_2252 376
895 3300046689 Ga0495613_0125857 Ga0495613_0125857_549_1679 376
896 3300047472 Ga0495686_0002178 Ga0495686_0002178_3249_4379 376
897 3300048904 Ga0496101_0052923 Ga0496101_0052923_1503_2633 376
898 3300048907 Ga0496104_0007867 Ga0496104_0007867_2229_3359 376
899 3300048908 Ga0496105_0115440 Ga0496105_0115440_709_1839 376
900 3300048913 Ga0496110_0080939 Ga0496110_0080939_697_1827 376
901 3300048915 Ga0496112_0023334 Ga0496112_0023334_1837_2967 376
902 3300048918 Ga0496115_0242934 Ga0496115_0242934_336_1466 376
903 3300048919 Ga0496116_0036906 Ga0496116_0036906_1811_2941 376
904 3300048920 Ga0496117_0000002 Ga0496117_0000002_927951_929081 376
905 3300048920 Ga0496117_0002298 Ga0496117_0002298_10582_11712 376
906 3300048920 Ga0496117_0012239 Ga0496117_0012239_3197_4327 376
907 3300048921 Ga0496118_0000460 Ga0496118_0000460_54384_55514 376
908 3300048921 Ga0496118_0003956 Ga0496118_0003956_1441_2571 376
909 3300048921 Ga0496118_0031959 Ga0496118_0031959_76_1206 376
910 3300048922 Ga0496119_0047784 Ga0496119_0047784_145_1275 376
911 3300048923 Ga0496120_0000078 Ga0496120_0000078_54815_55945 376
912 3300048923 Ga0496120_0007642 Ga0496120_0007642_1953_3083 376
913 3300048924 Ga0496121_0002309 Ga0496121_0002309_15545_16675 376
914 3300048924 Ga0496121_0009598 Ga0496121_0009598_1329_2459 376
915 3300048924 Ga0496121_0010507 Ga0496121_0010507_1324_2457 376
916 3300048925 Ga0496122_0000001 Ga0496122_0000001_234384_235514 376
917 3300048925 Ga0496122_0000025 Ga0496122_0000025_90932_92062 376
918 3300048925 Ga0496122_0000957 Ga0496122_0000957_49681_50811 376
919 3300048925 Ga0496122_0004632 Ga0496122_0004632_3259_4389 376
920 3300048925 Ga0496122_0011586 Ga0496122_0011586_7640_8770 376
921 3300048925 Ga0496122_0012223 Ga0496122_0012223_1437_2567 376
922 3300048926 Ga0496123_0000001 Ga0496123_0000001_238115_239245 376
923 3300048926 Ga0496123_0000032 Ga0496123_0000032_272151_273281 376
924 3300048926 Ga0496123_0000043 Ga0496123_0000043_157239_158369 376
925 3300048926 Ga0496123_0005205 Ga0496123_0005205_8465_9595 376
926 3300048927 Ga0496124_0002623 Ga0496124_0002623_12760_13890 376
927 3300048927 Ga0496124_0003161 Ga0496124_0003161_5747_6877 376
928 3300048927 Ga0496124_0014237 Ga0496124_0014237_5481_6611 376
929 3300048928 Ga0496125_0000311 Ga0496125_0000311_60324_61454 376
930 3300048928 Ga0496125_0005370 Ga0496125_0005370_8465_9595 376
931 3300048928 Ga0496125_0077891 Ga0496125_0077891_520_1650 376
932 3300048928 Ga0496125_0150703 Ga0496125_0150703_405_1535 376
933 3300048929 Ga0496126_0001233 Ga0496126_0001233_5726_6856 376
934 3300049568 Ga0501031_0000217 Ga0501031_0000217_21582_22715 376
935 3300049568 Ga0501031_0007446 Ga0501031_0007446_5009_6139 376
936 3300049568 Ga0501031_0025811 Ga0501031_0025811_848_1981 376
937 3300049569 Ga0501032_0000009 Ga0501032_0000009_205339_206472 376
938 3300049569 Ga0501032_0000064 Ga0501032_0000064_69954_71084 376
939 3300049569 Ga0501032_0004360 Ga0501032_0004360_2126_3274 376
940 3300049570 Ga0501033_0000019 Ga0501033_0000019_21636_22769 376
941 3300049570 Ga0501033_0000330 Ga0501033_0000330_34571_35701 376
942 3300049570 Ga0501033_0001030 Ga0501033_0001030_1700_2848 376
943 3300049570 Ga0501033_0033887 Ga0501033_0033887_2191_3354 376
944 3300049570 Ga0501033_0179189 Ga0501033_0179189_58_1188 376
945 3300049571 Ga0501034_0000044 Ga0501034_0000044_205339_206472 376
946 3300049571 Ga0501034_0000174 Ga0501034_0000174_74548_75678 376
947 3300049571 Ga0501034_0015374 Ga0501034_0015374_616_1746 376
948 3300049571 Ga0501034_0026260 Ga0501034_0026260_4500_5630 376
949 3300049571 Ga0501034_0375761 Ga0501034_0375761_120_1250 376
950 3300049572 Ga0501036_0000008 Ga0501036_0000008_205339_206472 376
951 3300049572 Ga0501036_0000399 Ga0501036_0000399_11185_12315 376
952 3300049572 Ga0501036_0095797 Ga0501036_0095797_486_1616 376
953 3300049572 Ga0501036_0174211 Ga0501036_0174211_139_1287 376
954 3300049573 Ga0501037_0000163 Ga0501037_0000163_13206_14336 376
955 3300049573 Ga0501037_0000267 Ga0501037_0000267_7544_8692 376
956 3300049573 Ga0501037_0000448 Ga0501037_0000448_11143_12276 376
957 3300049574 Ga0501038_0000006 Ga0501038_0000006_205339_206472 376
958 3300049574 Ga0501038_0000031 Ga0501038_0000031_80836_81966 376
959 3300049574 Ga0501038_0084809 Ga0501038_0084809_118_1281 376
960 3300049575 Ga0501039_0000014 Ga0501039_0000014_21636_22769 376
961 3300049575 Ga0501039_0000057 Ga0501039_0000057_67739_68869 376
962 3300049576 Ga0501040_0057227 Ga0501040_0057227_1103_2236 376
963 3300049579 Ga0501043_0000048 Ga0501043_0000048_74548_75678 376
964 3300049579 Ga0501043_0000294 Ga0501043_0000294_36301_37449 376
965 3300049579 Ga0501043_0000566 Ga0501043_0000566_21628_22761 376
966 3300049579 Ga0501043_0044900 Ga0501043_0044900_1184_2317 376
967 3300049579 Ga0501043_0089584 Ga0501043_0089584_345_1475 376
968 3300049581 Ga0501047_0003119 Ga0501047_0003119_3853_5016 376
969 3300049581 Ga0501047_0003704 Ga0501047_0003704_2503_3636 376
970 3300049581 Ga0501047_0086262 Ga0501047_0086262_266_1399 376
971 3300049582 Ga0501048_0101550 Ga0501048_0101550_494_1627 376
972 3300049583 Ga0501067_0040840 Ga0501067_0040840_905_2053 376
973 3300049584 Ga0501068_0057312 Ga0501068_0057312_334_1482 376
974 3300049584 Ga0501068_0083040 Ga0501068_0083040_450_1583 376
975 3300049584 Ga0501068_0125193 Ga0501068_0125193_329_1462 376
976 3300049585 Ga0501069_0000084 Ga0501069_0000084_36301_37449 376
977 3300049586 Ga0501070_0001180 Ga0501070_0001180_7710_8858 376
978 3300049586 Ga0501070_0001515 Ga0501070_0001515_10442_11605 376
979 3300049586 Ga0501070_0011207 Ga0501070_0011207_951_2084 376
980 3300049586 Ga0501070_0015976 Ga0501070_0015976_4151_5284 376
981 3300049587 Ga0501071_0018777 Ga0501071_0018777_1659_2807 376
982 3300049589 Ga0501073_0260312 Ga0501073_0260312_31_1161 376
983 3300049590 Ga0501074_0000085 Ga0501074_0000085_8121_9269 376
984 3300049742 Ga0501080_0003149 Ga0501080_0003149_6627_7775 376
985 3300049742 Ga0501080_0004202 Ga0501080_0004202_3260_4423 376
986 3300049742 Ga0501080_0033670 Ga0501080_0033670_940_2073 376
987 3300049742 Ga0501080_0071228 Ga0501080_0071228_1418_2548 376
988 3300049744 Ga0501083_0000078 Ga0501083_0000078_47513_48661 376
989 3300049776 Ga0501280_004928 Ga0501280_004928_431_1561 376
990 3300049822 Ga0501035_0000198 Ga0501035_0000198_37809_38939 376
991 3300049822 Ga0501035_0000471 Ga0501035_0000471_36301_37449 376
992 3300049822 Ga0501035_0000823 Ga0501035_0000823_21633_22766 376
993 3300049822 Ga0501035_0001118 Ga0501035_0001118_18161_19324 376
994 3300049822 Ga0501035_0021740 Ga0501035_0021740_242_1372 376
995 3300049823 Ga0501044_0000017 Ga0501044_0000017_21636_22769 376
996 3300049823 Ga0501044_0000649 Ga0501044_0000649_33176_34324 376
997 3300049823 Ga0501044_0021213 Ga0501044_0021213_2778_3947 376
998 3300049823 Ga0501044_0026568 Ga0501044_0026568_1773_2936 376
999 3300049823 Ga0501044_0130972 Ga0501044_0130972_1271_2401 376
1000 3300050489 nmdc:mga03683_3419_c1 nmdc:mga03683_3419_c1_1489_2619 376
1001 3300050491 nmdc:mga00v17_59031_c2 nmdc:mga00v17_59031_c2_373_1503 376
1002 3300050492 nmdc:mga0yw44_5123_c1 nmdc:mga0yw44_5123_c1_4942_6072 376
1003 3300050492 nmdc:mga0yw44_697_c1 nmdc:mga0yw44_697_c1_10162_11292 376
1004 3300050493 nmdc:mga0k408_25595_c1 nmdc:mga0k408_25595_c1_1113_2243 376
1005 3300050494 nmdc:mga06z11_88752_c1 nmdc:mga06z11_88752_c1_500_1630 376
1006 3300050516 nmdc:mga0sz30_4182_c1 nmdc:mga0sz30_4182_c1_4029_5159 376
1007 3300053077 Ga0495601_0042123 Ga0495601_0042123_1685_2815 376
1008 3300053077 Ga0495601_0043570 Ga0495601_0043570_406_1536 376
1009 3300053084 Ga0495595_0057471 Ga0495595_0057471_318_1448 376
1010 3300053122 Ga0500608_074924 Ga0500608_074924_83_1213 376
1011 3300053131 Ga0500652_000214 Ga0500652_000214_12430_13566 376
1012 3300053139 Ga0500568_0000592 Ga0500568_0000592_13474_14607 376
1013 3300053155 Ga0500620_000253 Ga0500620_000253_4561_5691 376
1014 3300053155 Ga0500620_001907 Ga0500620_001907_1507_2637 376
1015 3300053156 Ga0500622_0000378 Ga0500622_0000378_17845_18975 376
1016 3300053156 Ga0500622_0000778 Ga0500622_0000778_17032_18165 376
1017 3300053158 Ga0500627_0012784 Ga0500627_0012784_239_1369 376
1018 3300053177 Ga0500636_0005342 Ga0500636_0005342_6028_7164 376
1019 3300060353 Ga0501082_0016825 Ga0501082_0016825_653_1801 376
1020 iso_pu_bacteria 2854911287 2854911950 376
1021 iso_pu_bacteria 2885326080 2885332836 376
1022 iso_pu_bacteria 2885334103 2885339128 376
1023 iso_pu_bacteria 2958064165 2958067017 376
1024 iso_pu_bacteria 2958071322 2958077534 376
1025 iso_pu_bacteria 8004633249 8004634050 376

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01702

TGT

Queuine tRNA-ribosyltransferase

1

312

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ipp-assembly1.cif.gz_A-2 trna-guanine-transglycosylase (tgt) mutant v262d apo-structure 0.9661 5 368
6ygk-assembly1.cif.gz_A-2 tgt y330f mutant crystallised at ph 8.5 0.9657 5 369
4hqv-assembly1.cif.gz_A-2 trna-guanine transglycosylase y106f, c158v, v233g mutant in complex with queuine 0.965 5 369
4q8m-assembly1.cif.gz_A-2 trna-guanine transglycosylase (tgt) mutant v262t apo structure 0.9646 5 369
1efz-assembly1.cif.gz_A-2 mutagenesis and crystallographic studies of zymomonas mobilis trna-guanine transglycosylase to elucidate the role of serine 103 for enzymatic activity 0.9638 5 368
ID Description Score Start End Superfamily
2ashB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.9567 7 368 3.20.20.105
4jbrA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.9503 2 372 3.20.20.105
2ashB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.949 7 368 3.20.20.105
af_Q23623_1_366_3.20.20.105 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.9445 6 369 3.20.20.105
af_Q4DZ65_34_446_3.20.20.105 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.9422 16 363 3.20.20.105
ID Description Score Start End GO Terms
AF-A0A6A5LDH1-F1-model_v4 deleted 0.9804 23 345
AF-A0A543NYG2-F1-model_v4 deleted 0.9803 2 372
AF-A0A3S2F0V2-F1-model_v4 deleted 0.9798 40 376
AF-D6LPW4-F1-model_v4 deleted 0.9797 1 223
AF-A0A3D3SHC0-F1-model_v4 deleted 0.9794 244 371

Feature Viewer

pLDDT pTM Quality
91.57 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map