F488416
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1022 | 307 | 2044 | 113 |
Family's Representative Sequence
| Representative Sequence | 3300025944|Ga0207661_10367598|Ga0207661_103675982 |
| Length | 135 |
| Sequence | MGQTPHGATDTRRARARNHNIMAESNIEVLRGTLDLLILKAVSWGPTHGYGVARWIEQATNDVLRIEEGSLYPALHRLETRGWIESDWGTSENNRRAKFYTLTPKGRAQLRLEAATFTRFAHAVFAALDAPPQPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 126 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 189 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 196 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 197 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 198 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 204 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 209 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 211 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 213 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 216 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 217 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 218 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 219 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 220 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 221 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 222 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 223 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 224 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 225 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 226 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 269 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 270 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 273 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 274 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 275 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 286 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 287 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 288 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 289 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 291 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 307 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.51 |
| Metatranscriptomes | 0.49 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.59 |
| Rhizosphere | 98.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 22.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207661_10367598 | 3300025944 | Bacteria | 1300 |
| 2 | JGI25406J46586_10030228 | 3300003203 | Unclassified | 2041 |
| 3 | Ga0058863_10087649 | 3300004799 | Unclassified | 1579 |
| 4 | Ga0058863_11454414 | 3300004799 | Bacteria | 522 |
| 5 | Ga0065712_10313715 | 3300005290 | Bacteria | 833 |
| 6 | Ga0065707_10294286 | 3300005295 | Bacteria | 1018 |
| 7 | Ga0065707_10595419 | 3300005295 | Unclassified | 693 |
| 8 | Ga0070658_10010790 | 3300005327 | Bacteria | 7323 |
| 9 | Ga0070658_10341340 | 3300005327 | Bacteria | 1281 |
| 10 | Ga0070658_11080453 | 3300005327 | Bacteria | 698 |
| 11 | Ga0070658_11205615 | 3300005327 | Bacteria | 658 |
| 12 | Ga0070676_10129169 | 3300005328 | Unclassified | 1596 |
| 13 | Ga0070676_10649517 | 3300005328 | Unclassified | 766 |
| 14 | Ga0070683_100006898 | 3300005329 | Bacteria | 9544 |
| 15 | Ga0070683_100013364 | 3300005329 | Bacteria | 7158 |
| 16 | Ga0070683_100028508 | 3300005329 | Bacteria | 5046 |
| 17 | Ga0070683_100067932 | 3300005329 | Bacteria | 3320 |
| 18 | Ga0070683_100078687 | 3300005329 | Unclassified | 3085 |
| 19 | Ga0070683_100125677 | 3300005329 | Bacteria | 2424 |
| 20 | Ga0070683_100179633 | 3300005329 | Bacteria | 2009 |
| 21 | Ga0070683_100295346 | 3300005329 | Bacteria | 1541 |
| 22 | Ga0070683_100308417 | 3300005329 | Bacteria | 1506 |
| 23 | Ga0070683_100513154 | 3300005329 | Bacteria | 1145 |
| 24 | Ga0070683_100592153 | 3300005329 | Bacteria | 1061 |
| 25 | Ga0070683_101418132 | 3300005329 | Unclassified | 668 |
| 26 | Ga0070683_101592471 | 3300005329 | Unclassified | 628 |
| 27 | Ga0070690_100005775 | 3300005330 | Bacteria | 6972 |
| 28 | Ga0070690_100433137 | 3300005330 | Bacteria | 972 |
| 29 | Ga0070670_100025103 | 3300005331 | Bacteria | 5128 |
| 30 | Ga0070670_100050294 | 3300005331 | Bacteria | 3582 |
| 31 | Ga0070670_100058848 | 3300005331 | Unclassified | 3298 |
| 32 | Ga0070670_100224888 | 3300005331 | Bacteria | 1633 |
| 33 | Ga0070670_100272993 | 3300005331 | Bacteria | 1476 |
| 34 | Ga0070670_101483055 | 3300005331 | Bacteria | 623 |
| 35 | Ga0070677_10181730 | 3300005333 | Bacteria | 1002 |
| 36 | Ga0070677_10229749 | 3300005333 | Bacteria | 911 |
| 37 | Ga0070677_10468222 | 3300005333 | Bacteria | 677 |
| 38 | Ga0068869_100003430 | 3300005334 | Bacteria | 9692 |
| 39 | Ga0068869_100461187 | 3300005334 | Unclassified | 1055 |
| 40 | Ga0068869_102138405 | 3300005334 | Unclassified | 503 |
| 41 | Ga0070666_10141959 | 3300005335 | Bacteria | 1673 |
| 42 | Ga0070666_10260906 | 3300005335 | Bacteria | 1228 |
| 43 | Ga0070680_100000749 | 3300005336 | Bacteria | 22682 |
| 44 | Ga0070680_100003399 | 3300005336 | Bacteria | 11884 |
| 45 | Ga0070680_100028122 | 3300005336 | Bacteria | 4509 |
| 46 | Ga0070680_100040334 | 3300005336 | Unclassified | 3780 |
| 47 | Ga0070680_100062167 | 3300005336 | Bacteria | 3057 |
| 48 | Ga0070680_100063923 | 3300005336 | Bacteria | 3016 |
| 49 | Ga0070680_100066325 | 3300005336 | Bacteria | 2959 |
| 50 | Ga0070680_100092938 | 3300005336 | Bacteria | 2499 |
| 51 | Ga0070680_100171540 | 3300005336 | Unclassified | 1825 |
| 52 | Ga0070680_100197753 | 3300005336 | Unclassified | 1695 |
| 53 | Ga0070680_101000420 | 3300005336 | Bacteria | 722 |
| 54 | Ga0070680_101559729 | 3300005336 | Unclassified | 572 |
| 55 | Ga0070682_100698145 | 3300005337 | Unclassified | 813 |
| 56 | Ga0068868_100246442 | 3300005338 | Bacteria | 1503 |
| 57 | Ga0068868_100255911 | 3300005338 | Unclassified | 1475 |
| 58 | Ga0068868_100643899 | 3300005338 | Bacteria | 943 |
| 59 | Ga0068868_101108201 | 3300005338 | Unclassified | 729 |
| 60 | Ga0070660_100268148 | 3300005339 | Bacteria | 1395 |
| 61 | Ga0070660_100870442 | 3300005339 | Bacteria | 759 |
| 62 | Ga0070689_100067299 | 3300005340 | Unclassified | 2792 |
| 63 | Ga0070689_100088157 | 3300005340 | Bacteria | 2442 |
| 64 | Ga0070689_100168275 | 3300005340 | Bacteria | 1775 |
| 65 | Ga0070687_100130169 | 3300005343 | Bacteria | 1452 |
| 66 | Ga0070687_100161622 | 3300005343 | Bacteria | 1324 |
| 67 | Ga0070661_100001820 | 3300005344 | Bacteria | 14771 |
| 68 | Ga0070661_100002751 | 3300005344 | Bacteria | 12060 |
| 69 | Ga0070661_100010478 | 3300005344 | Bacteria | 6450 |
| 70 | Ga0070661_100025342 | 3300005344 | Bacteria | 4261 |
| 71 | Ga0070661_100504859 | 3300005344 | Unclassified | 968 |
| 72 | Ga0070661_100921819 | 3300005344 | Bacteria | 722 |
| 73 | Ga0070692_10184407 | 3300005345 | Bacteria | 1212 |
| 74 | Ga0070668_100057860 | 3300005347 | Bacteria | 2998 |
| 75 | Ga0070668_100092072 | 3300005347 | Bacteria | 2391 |
| 76 | Ga0070668_101027405 | 3300005347 | Unclassified | 742 |
| 77 | Ga0070669_100007489 | 3300005353 | Bacteria | 7817 |
| 78 | Ga0070669_100117027 | 3300005353 | Bacteria | 2029 |
| 79 | Ga0070669_100360635 | 3300005353 | Unclassified | 1182 |
| 80 | Ga0070669_100956156 | 3300005353 | Unclassified | 733 |
| 81 | Ga0070669_101075536 | 3300005353 | Unclassified | 692 |
| 82 | Ga0070675_100006208 | 3300005354 | Bacteria | 9167 |
| 83 | Ga0070675_100012350 | 3300005354 | Bacteria | 6695 |
| 84 | Ga0070675_100046085 | 3300005354 | Bacteria | 3569 |
| 85 | Ga0070675_100135415 | 3300005354 | Bacteria | 2102 |
| 86 | Ga0070675_100447298 | 3300005354 | Bacteria | 1158 |
| 87 | Ga0070675_100503806 | 3300005354 | Bacteria | 1091 |
| 88 | Ga0070675_100847229 | 3300005354 | Unclassified | 836 |
| 89 | Ga0070671_100508370 | 3300005355 | Unclassified | 1037 |
| 90 | Ga0070671_100871595 | 3300005355 | Unclassified | 786 |
| 91 | Ga0070674_100136745 | 3300005356 | Bacteria | 1834 |
| 92 | Ga0070674_100178410 | 3300005356 | Bacteria | 1625 |
| 93 | Ga0070674_100811164 | 3300005356 | Unclassified | 809 |
| 94 | Ga0070674_100916670 | 3300005356 | Bacteria | 764 |
| 95 | Ga0070673_100060185 | 3300005364 | Bacteria | 3008 |
| 96 | Ga0070673_100118501 | 3300005364 | Bacteria | 2204 |
| 97 | Ga0070673_100166506 | 3300005364 | Unclassified | 1879 |
| 98 | Ga0070673_100292148 | 3300005364 | Bacteria | 1433 |
| 99 | Ga0070673_100317143 | 3300005364 | Bacteria | 1376 |
| 100 | Ga0070673_100769122 | 3300005364 | Unclassified | 888 |
| 101 | Ga0070673_101425127 | 3300005364 | Unclassified | 652 |
| 102 | Ga0070688_100002762 | 3300005365 | Bacteria | 8918 |
| 103 | Ga0070688_100100467 | 3300005365 | Bacteria | 1906 |
| 104 | Ga0070688_101097112 | 3300005365 | Bacteria | 636 |
| 105 | Ga0070659_100118519 | 3300005366 | Bacteria | 2141 |
| 106 | Ga0070659_100381081 | 3300005366 | Bacteria | 1188 |
| 107 | Ga0070659_100851884 | 3300005366 | Bacteria | 795 |
| 108 | Ga0070659_100972909 | 3300005366 | Unclassified | 744 |
| 109 | Ga0070667_100083063 | 3300005367 | Unclassified | 2743 |
| 110 | Ga0070667_100753521 | 3300005367 | Unclassified | 903 |
| 111 | Ga0070667_100824556 | 3300005367 | Archaea | 862 |
| 112 | Ga0070667_100854793 | 3300005367 | Bacteria | 846 |
| 113 | Ga0070709_10012828 | 3300005434 | Bacteria | 4698 |
| 114 | Ga0070709_10190794 | 3300005434 | Unclassified | 1445 |
| 115 | Ga0070709_10270524 | 3300005434 | Bacteria | 1231 |
| 116 | Ga0070709_11700210 | 3300005434 | Unclassified | 515 |
| 117 | Ga0070714_100007410 | 3300005435 | Bacteria | 8539 |
| 118 | Ga0070714_100050532 | 3300005435 | Bacteria | 3542 |
| 119 | Ga0070714_100209149 | 3300005435 | Bacteria | 1788 |
| 120 | Ga0070714_100225606 | 3300005435 | Bacteria | 1724 |
| 121 | Ga0070714_100579649 | 3300005435 | Bacteria | 1076 |
| 122 | Ga0070713_100000077 | 3300005436 | Bacteria | 61320 |
| 123 | Ga0070713_100008338 | 3300005436 | Bacteria | 7350 |
| 124 | Ga0070713_100019682 | 3300005436 | Bacteria | 5161 |
| 125 | Ga0070713_100033238 | 3300005436 | Bacteria | 4129 |
| 126 | Ga0070713_100073801 | 3300005436 | Unclassified | 2889 |
| 127 | Ga0070713_100150125 | 3300005436 | Unclassified | 2072 |
| 128 | Ga0070713_100464772 | 3300005436 | Bacteria | 1190 |
| 129 | Ga0070710_10119384 | 3300005437 | Bacteria | 1594 |
| 130 | Ga0070710_10450882 | 3300005437 | Bacteria | 872 |
| 131 | Ga0070710_10792978 | 3300005437 | Bacteria | 676 |
| 132 | Ga0070710_11147050 | 3300005437 | Unclassified | 572 |
| 133 | Ga0070701_10263236 | 3300005438 | Unclassified | 1046 |
| 134 | Ga0070701_10274677 | 3300005438 | Bacteria | 1027 |
| 135 | Ga0070701_11115861 | 3300005438 | Bacteria | 556 |
| 136 | Ga0070711_100170110 | 3300005439 | Bacteria | 1660 |
| 137 | Ga0070711_100196432 | 3300005439 | Unclassified | 1554 |
| 138 | Ga0070711_100234106 | 3300005439 | Bacteria | 1433 |
| 139 | Ga0070711_100428086 | 3300005439 | Bacteria | 1080 |
| 140 | Ga0070711_100444953 | 3300005439 | Bacteria | 1060 |
| 141 | Ga0070711_100753841 | 3300005439 | Bacteria | 823 |
| 142 | Ga0070711_101492402 | 3300005439 | Bacteria | 590 |
| 143 | Ga0070705_100570239 | 3300005440 | Bacteria | 871 |
| 144 | Ga0070700_100011966 | 3300005441 | Bacteria | 4821 |
| 145 | Ga0070700_100019793 | 3300005441 | Unclassified | 3889 |
| 146 | Ga0070700_100145114 | 3300005441 | Bacteria | 1617 |
| 147 | Ga0070694_100284145 | 3300005444 | Bacteria | 1262 |
| 148 | Ga0070694_101250593 | 3300005444 | Unclassified | 623 |
| 149 | Ga0070708_100000934 | 3300005445 | Bacteria | 22111 |
| 150 | Ga0070663_100096428 | 3300005455 | Bacteria | 2200 |
| 151 | Ga0070663_100689775 | 3300005455 | Bacteria | 867 |
| 152 | Ga0070678_100174446 | 3300005456 | Bacteria | 1754 |
| 153 | Ga0070678_100339093 | 3300005456 | Bacteria | 1289 |
| 154 | Ga0070678_101250641 | 3300005456 | Bacteria | 690 |
| 155 | Ga0070662_100074738 | 3300005457 | Bacteria | 2508 |
| 156 | Ga0070662_100213078 | 3300005457 | Bacteria | 1538 |
| 157 | Ga0070662_100712729 | 3300005457 | Unclassified | 849 |
| 158 | Ga0070681_10000280 | 3300005458 | Bacteria | 40938 |
| 159 | Ga0070681_10000406 | 3300005458 | Bacteria | 35010 |
| 160 | Ga0070681_10009743 | 3300005458 | Bacteria | 9454 |
| 161 | Ga0070681_10032579 | 3300005458 | Bacteria | 5231 |
| 162 | Ga0070681_10038378 | 3300005458 | Bacteria | 4802 |
| 163 | Ga0070681_10040451 | 3300005458 | Bacteria | 4671 |
| 164 | Ga0070681_10041097 | 3300005458 | Bacteria | 4633 |
| 165 | Ga0070681_10064816 | 3300005458 | Bacteria | 3623 |
| 166 | Ga0070681_10072491 | 3300005458 | Bacteria | 3407 |
| 167 | Ga0070681_10091167 | 3300005458 | Bacteria | 2998 |
| 168 | Ga0070681_10158704 | 3300005458 | Bacteria | 2186 |
| 169 | Ga0070681_10176877 | 3300005458 | Bacteria | 2056 |
| 170 | Ga0070681_10392815 | 3300005458 | Bacteria | 1298 |
| 171 | Ga0070681_10442061 | 3300005458 | Archaea | 1212 |
| 172 | Ga0070681_10504194 | 3300005458 | Bacteria | 1123 |
| 173 | Ga0070681_10616242 | 3300005458 | Bacteria | 1000 |
| 174 | Ga0070681_10696225 | 3300005458 | Unclassified | 932 |
| 175 | Ga0070681_11997294 | 3300005458 | Bacteria | 508 |
| 176 | Ga0068867_100128867 | 3300005459 | Bacteria | 1964 |
| 177 | Ga0068867_100179317 | 3300005459 | Bacteria | 1683 |
| 178 | Ga0068867_101286154 | 3300005459 | Bacteria | 675 |
| 179 | Ga0068867_101302581 | 3300005459 | Unclassified | 671 |
| 180 | Ga0070685_10062955 | 3300005466 | Bacteria | 2176 |
| 181 | Ga0070685_10300980 | 3300005466 | Unclassified | 1081 |
| 182 | Ga0070685_10505222 | 3300005466 | Unclassified | 856 |
| 183 | Ga0070706_100052359 | 3300005467 | Bacteria | 3768 |
| 184 | Ga0070706_100091815 | 3300005467 | Bacteria | 2817 |
| 185 | Ga0070706_100288072 | 3300005467 | Bacteria | 1533 |
| 186 | Ga0070707_100922193 | 3300005468 | Bacteria | 838 |
| 187 | Ga0070707_101718655 | 3300005468 | Bacteria | 595 |
| 188 | Ga0070698_100242098 | 3300005471 | Bacteria | 1737 |
| 189 | Ga0070698_100455068 | 3300005471 | Bacteria | 1216 |
| 190 | Ga0070698_100556329 | 3300005471 | Unclassified | 1087 |
| 191 | Ga0070698_100690245 | 3300005471 | Bacteria | 963 |
| 192 | Ga0070698_101089655 | 3300005471 | Unclassified | 747 |
| 193 | Ga0070699_100188932 | 3300005518 | Bacteria | 1829 |
| 194 | Ga0070699_101991013 | 3300005518 | Bacteria | 531 |
| 195 | Ga0070679_100000050 | 3300005530 | Bacteria | 88045 |
| 196 | Ga0070679_100001297 | 3300005530 | Bacteria | 22069 |
| 197 | Ga0070679_100008346 | 3300005530 | Bacteria | 9745 |
| 198 | Ga0070679_100014843 | 3300005530 | Bacteria | 7483 |
| 199 | Ga0070679_100032831 | 3300005530 | Bacteria | 5137 |
| 200 | Ga0070679_100045977 | 3300005530 | Bacteria | 4350 |
| 201 | Ga0070679_100076976 | 3300005530 | Bacteria | 3324 |
| 202 | Ga0070679_100090912 | 3300005530 | Bacteria | 3040 |
| 203 | Ga0070679_100102096 | 3300005530 | Unclassified | 2854 |
| 204 | Ga0070679_100118269 | 3300005530 | Bacteria | 2635 |
| 205 | Ga0070679_100122057 | 3300005530 | Bacteria | 2590 |
| 206 | Ga0070679_100140255 | 3300005530 | Bacteria | 2397 |
| 207 | Ga0070679_100309069 | 3300005530 | Bacteria | 1531 |
| 208 | Ga0070679_100332827 | 3300005530 | Unclassified | 1467 |
| 209 | Ga0070679_100594343 | 3300005530 | Bacteria | 1050 |
| 210 | Ga0070679_100833231 | 3300005530 | Archaea | 866 |
| 211 | Ga0070679_100862402 | 3300005530 | Bacteria | 849 |
| 212 | Ga0070679_101629038 | 3300005530 | Bacteria | 593 |
| 213 | Ga0070679_101775669 | 3300005530 | Unclassified | 565 |
| 214 | Ga0070679_101918940 | 3300005530 | Bacteria | 541 |
| 215 | Ga0070684_100003048 | 3300005535 | Bacteria | 12502 |
| 216 | Ga0070684_100008393 | 3300005535 | Bacteria | 8070 |
| 217 | Ga0070684_100014182 | 3300005535 | Bacteria | 6446 |
| 218 | Ga0070684_100014419 | 3300005535 | Bacteria | 6404 |
| 219 | Ga0070684_100017321 | 3300005535 | Bacteria | 5911 |
| 220 | Ga0070684_100019213 | 3300005535 | Bacteria | 5650 |
| 221 | Ga0070684_100037417 | 3300005535 | Unclassified | 4162 |
| 222 | Ga0070684_100038842 | 3300005535 | Bacteria | 4091 |
| 223 | Ga0070684_100044798 | 3300005535 | Bacteria | 3828 |
| 224 | Ga0070684_100272863 | 3300005535 | Bacteria | 1548 |
| 225 | Ga0070684_100286511 | 3300005535 | Bacteria | 1510 |
| 226 | Ga0070684_100309777 | 3300005535 | Unclassified | 1450 |
| 227 | Ga0070684_100892560 | 3300005535 | Bacteria | 833 |
| 228 | Ga0070684_102001008 | 3300005535 | Unclassified | 547 |
| 229 | Ga0068853_100048699 | 3300005539 | Bacteria | 3641 |
| 230 | Ga0068853_100061378 | 3300005539 | Bacteria | 3251 |
| 231 | Ga0068853_100077950 | 3300005539 | Bacteria | 2895 |
| 232 | Ga0068853_100871807 | 3300005539 | Bacteria | 864 |
| 233 | Ga0070672_100031677 | 3300005543 | Unclassified | 3983 |
| 234 | Ga0070672_100071110 | 3300005543 | Bacteria | 2767 |
| 235 | Ga0070672_100297311 | 3300005543 | Bacteria | 1368 |
| 236 | Ga0070672_100463339 | 3300005543 | Bacteria | 1093 |
| 237 | Ga0070672_101567541 | 3300005543 | Bacteria | 591 |
| 238 | Ga0070686_100037447 | 3300005544 | Bacteria | 3009 |
| 239 | Ga0070686_100083027 | 3300005544 | Unclassified | 2126 |
| 240 | Ga0070686_101908759 | 3300005544 | Unclassified | 507 |
| 241 | Ga0070695_100271647 | 3300005545 | Bacteria | 1242 |
| 242 | Ga0070695_100407931 | 3300005545 | Bacteria | 1032 |
| 243 | Ga0070696_100720327 | 3300005546 | Archaea | 815 |
| 244 | Ga0070696_101736154 | 3300005546 | Unclassified | 538 |
| 245 | Ga0070693_100002797 | 3300005547 | Bacteria | 8026 |
| 246 | Ga0070693_100005203 | 3300005547 | Bacteria | 6227 |
| 247 | Ga0070693_100007963 | 3300005547 | Bacteria | 5201 |
| 248 | Ga0070693_100010709 | 3300005547 | Bacteria | 4598 |
| 249 | Ga0070693_100291981 | 3300005547 | Unclassified | 1096 |
| 250 | Ga0070693_100854175 | 3300005547 | Unclassified | 679 |
| 251 | Ga0070693_101036093 | 3300005547 | Bacteria | 623 |
| 252 | Ga0070665_100040007 | 3300005548 | Bacteria | 4713 |
| 253 | Ga0070665_100314424 | 3300005548 | Bacteria | 1570 |
| 254 | Ga0070665_100368284 | 3300005548 | Bacteria | 1444 |
| 255 | Ga0070665_100534961 | 3300005548 | Bacteria | 1184 |
| 256 | Ga0070665_101050726 | 3300005548 | Unclassified | 826 |
| 257 | Ga0070665_101723190 | 3300005548 | Unclassified | 634 |
| 258 | Ga0068855_100049051 | 3300005563 | Unclassified | 4981 |
| 259 | Ga0068855_100080116 | 3300005563 | Unclassified | 3787 |
| 260 | Ga0068855_100138498 | 3300005563 | Bacteria | 2775 |
| 261 | Ga0068855_100237479 | 3300005563 | Bacteria | 2038 |
| 262 | Ga0068855_100250129 | 3300005563 | Unclassified | 1977 |
| 263 | Ga0068855_100630372 | 3300005563 | Bacteria | 1153 |
| 264 | Ga0068855_100639244 | 3300005563 | Bacteria | 1144 |
| 265 | Ga0068855_100656950 | 3300005563 | Bacteria | 1125 |
| 266 | Ga0068855_100681980 | 3300005563 | Bacteria | 1101 |
| 267 | Ga0068855_100881508 | 3300005563 | Unclassified | 946 |
| 268 | Ga0068855_101079270 | 3300005563 | Bacteria | 840 |
| 269 | Ga0070664_100002346 | 3300005564 | Bacteria | 15208 |
| 270 | Ga0070664_100002527 | 3300005564 | Bacteria | 14753 |
| 271 | Ga0070664_100033645 | 3300005564 | Unclassified | 4295 |
| 272 | Ga0070664_100090618 | 3300005564 | Bacteria | 2646 |
| 273 | Ga0070664_100323642 | 3300005564 | Bacteria | 1397 |
| 274 | Ga0070664_100505776 | 3300005564 | Bacteria | 1114 |
| 275 | Ga0070664_100951559 | 3300005564 | Unclassified | 806 |
| 276 | Ga0070664_102366244 | 3300005564 | Bacteria | 504 |
| 277 | Ga0068857_100022416 | 3300005577 | Bacteria | 5556 |
| 278 | Ga0068857_101272020 | 3300005577 | Unclassified | 713 |
| 279 | Ga0068857_102009358 | 3300005577 | Bacteria | 567 |
| 280 | Ga0068857_102142235 | 3300005577 | Unclassified | 549 |
| 281 | Ga0068854_100232210 | 3300005578 | Bacteria | 1465 |
| 282 | Ga0068854_100269362 | 3300005578 | Bacteria | 1367 |
| 283 | Ga0068856_100007031 | 3300005614 | Bacteria | 10995 |
| 284 | Ga0068856_100163140 | 3300005614 | Bacteria | 2240 |
| 285 | Ga0068856_100496640 | 3300005614 | Bacteria | 1241 |
| 286 | Ga0068856_100546526 | 3300005614 | Bacteria | 1179 |
| 287 | Ga0068856_100717614 | 3300005614 | Unclassified | 1020 |
| 288 | Ga0068852_100045760 | 3300005616 | Bacteria | 3724 |
| 289 | Ga0068852_100061292 | 3300005616 | Bacteria | 3269 |
| 290 | Ga0068852_100078166 | 3300005616 | Bacteria | 2927 |
| 291 | Ga0068852_101082241 | 3300005616 | Unclassified | 822 |
| 292 | Ga0068852_101214337 | 3300005616 | Bacteria | 775 |
| 293 | Ga0068852_101688015 | 3300005616 | Unclassified | 656 |
| 294 | Ga0068859_101205856 | 3300005617 | Unclassified | 834 |
| 295 | Ga0068859_102386584 | 3300005617 | Bacteria | 583 |
| 296 | Ga0068864_100058413 | 3300005618 | Bacteria | 3334 |
| 297 | Ga0068864_100411253 | 3300005618 | Bacteria | 1287 |
| 298 | Ga0068864_100951989 | 3300005618 | Bacteria | 850 |
| 299 | Ga0068866_10361405 | 3300005718 | Bacteria | 925 |
| 300 | Ga0068861_100036790 | 3300005719 | Bacteria | 3636 |
| 301 | Ga0068861_102480388 | 3300005719 | Unclassified | 522 |
| 302 | Ga0068851_10639616 | 3300005834 | Unclassified | 650 |
| 303 | Ga0068870_10029221 | 3300005840 | Bacteria | 2774 |
| 304 | Ga0068870_10106624 | 3300005840 | Bacteria | 1593 |
| 305 | Ga0068863_100030428 | 3300005841 | Bacteria | 5155 |
| 306 | Ga0068863_100900860 | 3300005841 | Bacteria | 885 |
| 307 | Ga0068863_101174598 | 3300005841 | Bacteria | 773 |
| 308 | Ga0068863_101293589 | 3300005841 | Bacteria | 736 |
| 309 | Ga0068858_100244182 | 3300005842 | Unclassified | 1704 |
| 310 | Ga0068858_101407195 | 3300005842 | Unclassified | 687 |
| 311 | Ga0068860_100248869 | 3300005843 | Bacteria | 1730 |
| 312 | Ga0068862_100022990 | 3300005844 | Bacteria | 5220 |
| 313 | Ga0068862_100031505 | 3300005844 | Bacteria | 4477 |
| 314 | Ga0068862_100075164 | 3300005844 | Bacteria | 2921 |
| 315 | Ga0068862_100557271 | 3300005844 | Bacteria | 1095 |
| 316 | Ga0068862_101532996 | 3300005844 | Unclassified | 672 |
| 317 | Ga0081455_10059993 | 3300005937 | Bacteria | 3209 |
| 318 | Ga0081455_10119850 | 3300005937 | Unclassified | 2074 |
| 319 | Ga0081455_10247724 | 3300005937 | Bacteria | 1305 |
| 320 | Ga0081539_10003628 | 3300005985 | Bacteria | 18591 |
| 321 | Ga0070717_10018971 | 3300006028 | Bacteria | 5385 |
| 322 | Ga0070717_10088017 | 3300006028 | Unclassified | 2617 |
| 323 | Ga0070717_10098345 | 3300006028 | Bacteria | 2481 |
| 324 | Ga0070717_10100307 | 3300006028 | Bacteria | 2458 |
| 325 | Ga0070717_10327371 | 3300006028 | Bacteria | 1366 |
| 326 | Ga0070717_10440026 | 3300006028 | Unclassified | 1174 |
| 327 | Ga0075432_10086604 | 3300006058 | Unclassified | 1142 |
| 328 | Ga0070716_101099883 | 3300006173 | Bacteria | 634 |
| 329 | Ga0070712_100001780 | 3300006175 | Bacteria | 13184 |
| 330 | Ga0070712_100031074 | 3300006175 | Unclassified | 3595 |
| 331 | Ga0070712_100072837 | 3300006175 | Bacteria | 2462 |
| 332 | Ga0070712_100102354 | 3300006175 | Bacteria | 2121 |
| 333 | Ga0070712_100270157 | 3300006175 | Bacteria | 1366 |
| 334 | Ga0070712_100399726 | 3300006175 | Bacteria | 1135 |
| 335 | Ga0097621_100330773 | 3300006237 | Bacteria | 1351 |
| 336 | Ga0097621_101154143 | 3300006237 | Unclassified | 729 |
| 337 | Ga0097621_101430884 | 3300006237 | Unclassified | 655 |
| 338 | Ga0068871_100062427 | 3300006358 | Bacteria | 3045 |
| 339 | Ga0068871_100574233 | 3300006358 | Bacteria | 1023 |
| 340 | Ga0068871_101716769 | 3300006358 | Unclassified | 595 |
| 341 | Ga0075428_100041959 | 3300006844 | Bacteria | 5031 |
| 342 | Ga0075428_100208943 | 3300006844 | Bacteria | 2110 |
| 343 | Ga0075428_100263569 | 3300006844 | Unclassified | 1855 |
| 344 | Ga0075428_102039566 | 3300006844 | Unclassified | 594 |
| 345 | Ga0075428_102193215 | 3300006844 | Unclassified | 570 |
| 346 | Ga0075430_100001246 | 3300006846 | Bacteria | 20485 |
| 347 | Ga0075430_100008251 | 3300006846 | Bacteria | 8795 |
| 348 | Ga0075430_100010224 | 3300006846 | Bacteria | 7944 |
| 349 | Ga0075430_100026418 | 3300006846 | Bacteria | 4940 |
| 350 | Ga0075430_100061609 | 3300006846 | Bacteria | 3152 |
| 351 | Ga0075430_101730639 | 3300006846 | Bacteria | 513 |
| 352 | Ga0075431_100003459 | 3300006847 | Bacteria | 15318 |
| 353 | Ga0075431_100007932 | 3300006847 | Bacteria | 10583 |
| 354 | Ga0075431_100022817 | 3300006847 | Bacteria | 6397 |
| 355 | Ga0075431_100029821 | 3300006847 | Bacteria | 5617 |
| 356 | Ga0075431_100035964 | 3300006847 | Bacteria | 5101 |
| 357 | Ga0075431_100060834 | 3300006847 | Bacteria | 3897 |
| 358 | Ga0075433_10031615 | 3300006852 | Unclassified | 4526 |
| 359 | Ga0075433_10416481 | 3300006852 | Bacteria | 1185 |
| 360 | Ga0075433_10731942 | 3300006852 | Unclassified | 866 |
| 361 | Ga0075434_100015606 | 3300006871 | Bacteria | 7290 |
| 362 | Ga0075434_100033319 | 3300006871 | Bacteria | 5083 |
| 363 | Ga0075434_100061957 | 3300006871 | Bacteria | 3723 |
| 364 | Ga0075434_100139986 | 3300006871 | Bacteria | 2439 |
| 365 | Ga0075434_100141390 | 3300006871 | Bacteria | 2427 |
| 366 | Ga0075434_100350952 | 3300006871 | Bacteria | 1496 |
| 367 | Ga0075434_101566916 | 3300006871 | Bacteria | 668 |
| 368 | Ga0075429_100042917 | 3300006880 | Bacteria | 3935 |
| 369 | Ga0075429_100226049 | 3300006880 | Bacteria | 1639 |
| 370 | Ga0075429_100296149 | 3300006880 | Unclassified | 1416 |
| 371 | Ga0075429_101400166 | 3300006880 | Unclassified | 609 |
| 372 | Ga0068865_100058145 | 3300006881 | Unclassified | 2700 |
| 373 | Ga0068865_100796229 | 3300006881 | Bacteria | 815 |
| 374 | Ga0068865_100842924 | 3300006881 | Bacteria | 794 |
| 375 | Ga0075436_100002597 | 3300006914 | Bacteria | 12409 |
| 376 | Ga0075436_100613644 | 3300006914 | Bacteria | 802 |
| 377 | Ga0097620_100230619 | 3300006931 | Unclassified | 1940 |
| 378 | Ga0097620_101205855 | 3300006931 | Unclassified | 834 |
| 379 | Ga0097620_102386363 | 3300006931 | Bacteria | 583 |
| 380 | Ga0075435_100231222 | 3300007076 | Bacteria | 1571 |
| 381 | Ga0075435_100982757 | 3300007076 | Bacteria | 737 |
| 382 | Ga0075435_101260888 | 3300007076 | Unclassified | 647 |
| 383 | Ga0075435_101727873 | 3300007076 | Bacteria | 549 |
| 384 | Ga0105240_10166111 | 3300009093 | Bacteria | 2618 |
| 385 | Ga0105240_10285461 | 3300009093 | Bacteria | 1894 |
| 386 | Ga0105240_10634446 | 3300009093 | Bacteria | 1173 |
| 387 | Ga0105240_12574448 | 3300009093 | Unclassified | 526 |
| 388 | Ga0105240_12629493 | 3300009093 | Unclassified | 520 |
| 389 | Ga0111539_10045282 | 3300009094 | Bacteria | 5267 |
| 390 | Ga0111539_10204039 | 3300009094 | Bacteria | 2305 |
| 391 | Ga0111539_10204602 | 3300009094 | Bacteria | 2301 |
| 392 | Ga0111539_10323113 | 3300009094 | Bacteria | 1796 |
| 393 | Ga0111539_11114970 | 3300009094 | Bacteria | 917 |
| 394 | Ga0111539_12110613 | 3300009094 | Bacteria | 654 |
| 395 | Ga0105245_10116898 | 3300009098 | Unclassified | 2487 |
| 396 | Ga0105245_10455212 | 3300009098 | Bacteria | 1289 |
| 397 | Ga0105245_10933771 | 3300009098 | Unclassified | 910 |
| 398 | Ga0105245_11756338 | 3300009098 | Bacteria | 673 |
| 399 | Ga0105245_12401801 | 3300009098 | Unclassified | 581 |
| 400 | Ga0105247_10188312 | 3300009101 | Bacteria | 1380 |
| 401 | Ga0105247_10399457 | 3300009101 | Bacteria | 979 |
| 402 | Ga0114129_10000108 | 3300009147 | Bacteria | 81939 |
| 403 | Ga0114129_10019638 | 3300009147 | Bacteria | 9618 |
| 404 | Ga0114129_10127895 | 3300009147 | Unclassified | 3492 |
| 405 | Ga0114129_10605901 | 3300009147 | Bacteria | 1418 |
| 406 | Ga0114129_10623773 | 3300009147 | Bacteria | 1394 |
| 407 | Ga0114129_11422425 | 3300009147 | Bacteria | 855 |
| 408 | Ga0114129_11575567 | 3300009147 | Bacteria | 805 |
| 409 | Ga0114129_12185689 | 3300009147 | Unclassified | 666 |
| 410 | Ga0105243_10073993 | 3300009148 | Bacteria | 2762 |
| 411 | Ga0105243_10179272 | 3300009148 | Bacteria | 1841 |
| 412 | Ga0105243_10428861 | 3300009148 | Unclassified | 1235 |
| 413 | Ga0105243_10863342 | 3300009148 | Unclassified | 897 |
| 414 | Ga0105241_10168985 | 3300009174 | Bacteria | 1805 |
| 415 | Ga0105241_10251799 | 3300009174 | Bacteria | 1498 |
| 416 | Ga0105241_10280877 | 3300009174 | Bacteria | 1422 |
| 417 | Ga0105241_11393574 | 3300009174 | Unclassified | 671 |
| 418 | Ga0105242_10111217 | 3300009176 | Bacteria | 2335 |
| 419 | Ga0105242_10827554 | 3300009176 | Unclassified | 919 |
| 420 | Ga0105242_10866126 | 3300009176 | Bacteria | 900 |
| 421 | Ga0105242_11206876 | 3300009176 | Unclassified | 776 |
| 422 | Ga0105242_11888028 | 3300009176 | Bacteria | 637 |
| 423 | Ga0105248_10186548 | 3300009177 | Unclassified | 2337 |
| 424 | Ga0105248_10208768 | 3300009177 | Bacteria | 2200 |
| 425 | Ga0105248_10405445 | 3300009177 | Bacteria | 1535 |
| 426 | Ga0105248_10518713 | 3300009177 | Bacteria | 1344 |
| 427 | Ga0105248_11037277 | 3300009177 | Bacteria | 926 |
| 428 | Ga0105237_10135152 | 3300009545 | Bacteria | 2460 |
| 429 | Ga0105237_10227538 | 3300009545 | Bacteria | 1865 |
| 430 | Ga0105237_10230857 | 3300009545 | Bacteria | 1851 |
| 431 | Ga0105237_10250837 | 3300009545 | Bacteria | 1772 |
| 432 | Ga0105237_10782502 | 3300009545 | Bacteria | 961 |
| 433 | Ga0105238_10021948 | 3300009551 | Bacteria | 6504 |
| 434 | Ga0105238_11222454 | 3300009551 | Bacteria | 776 |
| 435 | Ga0105238_12736012 | 3300009551 | Unclassified | 530 |
| 436 | Ga0105249_10001803 | 3300009553 | Bacteria | 18618 |
| 437 | Ga0105249_10024953 | 3300009553 | Bacteria | 5378 |
| 438 | Ga0105249_10348899 | 3300009553 | Bacteria | 1499 |
| 439 | Ga0105249_10426139 | 3300009553 | Unclassified | 1361 |
| 440 | Ga0105239_10005522 | 3300010375 | Bacteria | 14807 |
| 441 | Ga0105239_11253398 | 3300010375 | Bacteria | 855 |
| 442 | Ga0105246_11358645 | 3300011119 | Unclassified | 661 |
| 443 | Ga0157373_10268338 | 3300013100 | Bacteria | 1208 |
| 444 | Ga0157373_10822806 | 3300013100 | Unclassified | 686 |
| 445 | Ga0157373_11090571 | 3300013100 | Bacteria | 599 |
| 446 | Ga0157371_10171018 | 3300013102 | Bacteria | 1553 |
| 447 | Ga0157371_10556861 | 3300013102 | Bacteria | 850 |
| 448 | Ga0157370_10019508 | 3300013104 | Bacteria | 6799 |
| 449 | Ga0157370_10127171 | 3300013104 | Bacteria | 2378 |
| 450 | Ga0157370_10187817 | 3300013104 | Bacteria | 1918 |
| 451 | Ga0157370_10251312 | 3300013104 | Bacteria | 1635 |
| 452 | Ga0157370_10481306 | 3300013104 | Bacteria | 1141 |
| 453 | Ga0157370_10514747 | 3300013104 | Bacteria | 1098 |
| 454 | Ga0157370_10988229 | 3300013104 | Bacteria | 762 |
| 455 | Ga0157370_11557781 | 3300013104 | Bacteria | 594 |
| 456 | Ga0157369_10014958 | 3300013105 | Bacteria | 8758 |
| 457 | Ga0157369_10036101 | 3300013105 | Bacteria | 5417 |
| 458 | Ga0157369_10071967 | 3300013105 | Unclassified | 3711 |
| 459 | Ga0157369_10148633 | 3300013105 | Bacteria | 2477 |
| 460 | Ga0157369_10158159 | 3300013105 | Bacteria | 2393 |
| 461 | Ga0157369_10217890 | 3300013105 | Bacteria | 1999 |
| 462 | Ga0157369_11636979 | 3300013105 | Bacteria | 654 |
| 463 | Ga0157369_12106213 | 3300013105 | Bacteria | 572 |
| 464 | Ga0157369_12198542 | 3300013105 | Unclassified | 559 |
| 465 | Ga0157374_10436678 | 3300013296 | Unclassified | 1309 |
| 466 | Ga0157374_11409314 | 3300013296 | Bacteria | 720 |
| 467 | Ga0157378_10005553 | 3300013297 | Bacteria | 11045 |
| 468 | Ga0157378_10767000 | 3300013297 | Bacteria | 988 |
| 469 | Ga0157378_11248385 | 3300013297 | Bacteria | 783 |
| 470 | Ga0163162_10015207 | 3300013306 | Bacteria | 7517 |
| 471 | Ga0163162_10020860 | 3300013306 | Bacteria | 6443 |
| 472 | Ga0163162_10170289 | 3300013306 | Bacteria | 2302 |
| 473 | Ga0163162_10397472 | 3300013306 | Bacteria | 1511 |
| 474 | Ga0157372_10022484 | 3300013307 | Bacteria | 6825 |
| 475 | Ga0157372_10075629 | 3300013307 | Bacteria | 3800 |
| 476 | Ga0157372_10127693 | 3300013307 | Bacteria | 2924 |
| 477 | Ga0157372_10141533 | 3300013307 | Bacteria | 2771 |
| 478 | Ga0157372_11788019 | 3300013307 | Bacteria | 707 |
| 479 | Ga0157375_10265777 | 3300013308 | Unclassified | 1877 |
| 480 | Ga0157375_10343007 | 3300013308 | Bacteria | 1659 |
| 481 | Ga0157375_10440906 | 3300013308 | Bacteria | 1468 |
| 482 | Ga0157375_10707629 | 3300013308 | Bacteria | 1161 |
| 483 | Ga0157375_11189621 | 3300013308 | Bacteria | 894 |
| 484 | Ga0163163_10054195 | 3300014325 | Bacteria | 3962 |
| 485 | Ga0157380_10011975 | 3300014326 | Bacteria | 6275 |
| 486 | Ga0157377_10046330 | 3300014745 | Bacteria | 2431 |
| 487 | Ga0157377_10260210 | 3300014745 | Bacteria | 1129 |
| 488 | Ga0157377_10460730 | 3300014745 | Bacteria | 880 |
| 489 | Ga0157376_11238795 | 3300014969 | Bacteria | 775 |
| 490 | Ga0182007_10013374 | 3300015262 | Bacteria | 3131 |
| 491 | Ga0182007_10407405 | 3300015262 | Unclassified | 519 |
| 492 | Ga0163161_10303897 | 3300017792 | Unclassified | 1257 |
| 493 | Ga0206356_11074160 | 3300020070 | Unclassified | 1593 |
| 494 | Ga0206354_11242480 | 3300020081 | Bacteria | 561 |
| 495 | Ga0206354_11632838 | 3300020081 | Bacteria | 1326 |
| 496 | Ga0213876_10010507 | 3300021384 | Bacteria | 4964 |
| 497 | Ga0213876_10082378 | 3300021384 | Bacteria | 1702 |
| 498 | Ga0213876_10535579 | 3300021384 | Unclassified | 623 |
| 499 | Ga0213876_10722006 | 3300021384 | Bacteria | 530 |
| 500 | Ga0207697_10000506 | 3300025315 | Bacteria | 21942 |
| 501 | Ga0207656_10003452 | 3300025321 | Bacteria | 5431 |
| 502 | Ga0207656_10293393 | 3300025321 | Unclassified | 804 |
| 503 | Ga0207656_10565978 | 3300025321 | Archaea | 579 |
| 504 | Ga0207682_10204752 | 3300025893 | Unclassified | 908 |
| 505 | Ga0207682_10363305 | 3300025893 | Unclassified | 683 |
| 506 | Ga0207692_10208554 | 3300025898 | Bacteria | 1152 |
| 507 | Ga0207692_10364490 | 3300025898 | Bacteria | 894 |
| 508 | Ga0207692_10589557 | 3300025898 | Bacteria | 714 |
| 509 | Ga0207680_10228371 | 3300025903 | Bacteria | 1278 |
| 510 | Ga0207680_10932259 | 3300025903 | Unclassified | 622 |
| 511 | Ga0207699_10024126 | 3300025906 | Bacteria | 3321 |
| 512 | Ga0207699_10100901 | 3300025906 | Bacteria | 1831 |
| 513 | Ga0207699_10179416 | 3300025906 | Unclassified | 1422 |
| 514 | Ga0207699_10514101 | 3300025906 | Unclassified | 865 |
| 515 | Ga0207699_10947164 | 3300025906 | Bacteria | 636 |
| 516 | Ga0207645_10000806 | 3300025907 | Bacteria | 26219 |
| 517 | Ga0207645_10328092 | 3300025907 | Bacteria | 1022 |
| 518 | Ga0207645_10477869 | 3300025907 | Unclassified | 843 |
| 519 | Ga0207643_10008399 | 3300025908 | Bacteria | 5539 |
| 520 | Ga0207643_10050337 | 3300025908 | Bacteria | 2362 |
| 521 | Ga0207705_10191690 | 3300025909 | Bacteria | 1546 |
| 522 | Ga0207705_10369356 | 3300025909 | Bacteria | 1107 |
| 523 | Ga0207705_10628704 | 3300025909 | Unclassified | 835 |
| 524 | Ga0207705_11166823 | 3300025909 | Archaea | 592 |
| 525 | Ga0207705_11476316 | 3300025909 | Unclassified | 515 |
| 526 | Ga0207684_10333169 | 3300025910 | Bacteria | 1307 |
| 527 | Ga0207654_10471431 | 3300025911 | Bacteria | 883 |
| 528 | Ga0207707_10000446 | 3300025912 | Bacteria | 42961 |
| 529 | Ga0207707_10011313 | 3300025912 | Bacteria | 7769 |
| 530 | Ga0207707_10038403 | 3300025912 | Bacteria | 4184 |
| 531 | Ga0207707_10098039 | 3300025912 | Bacteria | 2562 |
| 532 | Ga0207707_10099183 | 3300025912 | Bacteria | 2546 |
| 533 | Ga0207707_10112466 | 3300025912 | Bacteria | 2380 |
| 534 | Ga0207707_10173747 | 3300025912 | Unclassified | 1882 |
| 535 | Ga0207707_10202495 | 3300025912 | Bacteria | 1730 |
| 536 | Ga0207707_10242012 | 3300025912 | Bacteria | 1568 |
| 537 | Ga0207707_10267917 | 3300025912 | Bacteria | 1481 |
| 538 | Ga0207707_10430121 | 3300025912 | Bacteria | 1131 |
| 539 | Ga0207707_10509709 | 3300025912 | Bacteria | 1025 |
| 540 | Ga0207707_10524728 | 3300025912 | Unclassified | 1008 |
| 541 | Ga0207707_10618589 | 3300025912 | Archaea | 915 |
| 542 | Ga0207707_11423692 | 3300025912 | Bacteria | 552 |
| 543 | Ga0207695_10007337 | 3300025913 | Bacteria | 14074 |
| 544 | Ga0207695_10017899 | 3300025913 | Bacteria | 8210 |
| 545 | Ga0207695_10045596 | 3300025913 | Unclassified | 4653 |
| 546 | Ga0207695_10083254 | 3300025913 | Bacteria | 3232 |
| 547 | Ga0207695_10986244 | 3300025913 | Bacteria | 722 |
| 548 | Ga0207695_11511985 | 3300025913 | Unclassified | 552 |
| 549 | Ga0207671_10181512 | 3300025914 | Bacteria | 1638 |
| 550 | Ga0207693_10013442 | 3300025915 | Bacteria | 6601 |
| 551 | Ga0207693_10017163 | 3300025915 | Bacteria | 5773 |
| 552 | Ga0207693_10025634 | 3300025915 | Bacteria | 4673 |
| 553 | Ga0207693_10053818 | 3300025915 | Bacteria | 3158 |
| 554 | Ga0207693_10100466 | 3300025915 | Bacteria | 2268 |
| 555 | Ga0207693_10154432 | 3300025915 | Bacteria | 1805 |
| 556 | Ga0207693_10269269 | 3300025915 | Bacteria | 1335 |
| 557 | Ga0207663_10120523 | 3300025916 | Bacteria | 1796 |
| 558 | Ga0207663_10134163 | 3300025916 | Bacteria | 1715 |
| 559 | Ga0207663_10202177 | 3300025916 | Bacteria | 1434 |
| 560 | Ga0207660_10021178 | 3300025917 | Bacteria | 4371 |
| 561 | Ga0207660_10028616 | 3300025917 | Bacteria | 3813 |
| 562 | Ga0207660_10029908 | 3300025917 | Unclassified | 3741 |
| 563 | Ga0207660_10097702 | 3300025917 | Bacteria | 2189 |
| 564 | Ga0207660_10177788 | 3300025917 | Bacteria | 1651 |
| 565 | Ga0207660_10257714 | 3300025917 | Bacteria | 1378 |
| 566 | Ga0207660_10954969 | 3300025917 | Unclassified | 699 |
| 567 | Ga0207660_11352604 | 3300025917 | Bacteria | 578 |
| 568 | Ga0207660_11711733 | 3300025917 | Unclassified | 505 |
| 569 | Ga0207662_10006233 | 3300025918 | Bacteria | 6421 |
| 570 | Ga0207662_10009077 | 3300025918 | Bacteria | 5462 |
| 571 | Ga0207657_10010879 | 3300025919 | Bacteria | 9053 |
| 572 | Ga0207657_10020035 | 3300025919 | Bacteria | 6336 |
| 573 | Ga0207657_10088573 | 3300025919 | Bacteria | 2587 |
| 574 | Ga0207657_10730720 | 3300025919 | Unclassified | 768 |
| 575 | Ga0207657_11373933 | 3300025919 | Bacteria | 531 |
| 576 | Ga0207649_10003029 | 3300025920 | Bacteria | 9258 |
| 577 | Ga0207649_10127306 | 3300025920 | Bacteria | 1725 |
| 578 | Ga0207649_10173801 | 3300025920 | Bacteria | 1503 |
| 579 | Ga0207649_10230494 | 3300025920 | Bacteria | 1324 |
| 580 | Ga0207649_10559167 | 3300025920 | Unclassified | 876 |
| 581 | Ga0207649_10598380 | 3300025920 | Unclassified | 848 |
| 582 | Ga0207652_10001795 | 3300025921 | Bacteria | 18663 |
| 583 | Ga0207652_10014530 | 3300025921 | Bacteria | 6380 |
| 584 | Ga0207652_10017760 | 3300025921 | Bacteria | 5827 |
| 585 | Ga0207652_10060559 | 3300025921 | Bacteria | 3266 |
| 586 | Ga0207652_10162288 | 3300025921 | Bacteria | 2003 |
| 587 | Ga0207652_10168592 | 3300025921 | Bacteria | 1964 |
| 588 | Ga0207652_10271253 | 3300025921 | Bacteria | 1530 |
| 589 | Ga0207652_10283508 | 3300025921 | Unclassified | 1494 |
| 590 | Ga0207652_10344643 | 3300025921 | Bacteria | 1345 |
| 591 | Ga0207652_10436791 | 3300025921 | Bacteria | 1180 |
| 592 | Ga0207652_10455397 | 3300025921 | Bacteria | 1153 |
| 593 | Ga0207652_10472183 | 3300025921 | Bacteria | 1130 |
| 594 | Ga0207652_10536530 | 3300025921 | Bacteria | 1052 |
| 595 | Ga0207652_10893999 | 3300025921 | Bacteria | 785 |
| 596 | Ga0207652_11144107 | 3300025921 | Bacteria | 679 |
| 597 | Ga0207652_11212985 | 3300025921 | Bacteria | 656 |
| 598 | Ga0207652_11304120 | 3300025921 | Unclassified | 629 |
| 599 | Ga0207652_11398573 | 3300025921 | Bacteria | 603 |
| 600 | Ga0207681_10014089 | 3300025923 | Bacteria | 4958 |
| 601 | Ga0207681_10381158 | 3300025923 | Unclassified | 1135 |
| 602 | Ga0207681_10412972 | 3300025923 | Bacteria | 1092 |
| 603 | Ga0207681_10939521 | 3300025923 | Bacteria | 725 |
| 604 | Ga0207694_10020386 | 3300025924 | Bacteria | 5016 |
| 605 | Ga0207694_10297193 | 3300025924 | Bacteria | 1329 |
| 606 | Ga0207694_10330119 | 3300025924 | Bacteria | 1260 |
| 607 | Ga0207694_10816705 | 3300025924 | Bacteria | 788 |
| 608 | Ga0207650_10038022 | 3300025925 | Unclassified | 3511 |
| 609 | Ga0207650_10053887 | 3300025925 | Bacteria | 2982 |
| 610 | Ga0207650_10287913 | 3300025925 | Bacteria | 1339 |
| 611 | Ga0207650_11253481 | 3300025925 | Unclassified | 631 |
| 612 | Ga0207659_10008926 | 3300025926 | Bacteria | 6249 |
| 613 | Ga0207659_10093809 | 3300025926 | Unclassified | 2247 |
| 614 | Ga0207659_10115609 | 3300025926 | Bacteria | 2047 |
| 615 | Ga0207659_10286217 | 3300025926 | Unclassified | 1349 |
| 616 | Ga0207659_11045992 | 3300025926 | Bacteria | 702 |
| 617 | Ga0207700_10001125 | 3300025928 | Bacteria | 15347 |
| 618 | Ga0207700_10014894 | 3300025928 | Bacteria | 5109 |
| 619 | Ga0207700_10018913 | 3300025928 | Bacteria | 4642 |
| 620 | Ga0207700_10027507 | 3300025928 | Unclassified | 3984 |
| 621 | Ga0207700_10138460 | 3300025928 | Unclassified | 1997 |
| 622 | Ga0207700_10178537 | 3300025928 | Bacteria | 1776 |
| 623 | Ga0207700_10434322 | 3300025928 | Unclassified | 1155 |
| 624 | Ga0207700_10982924 | 3300025928 | Bacteria | 755 |
| 625 | Ga0207664_10003681 | 3300025929 | Bacteria | 10275 |
| 626 | Ga0207664_10027904 | 3300025929 | Bacteria | 4285 |
| 627 | Ga0207664_10157139 | 3300025929 | Bacteria | 1937 |
| 628 | Ga0207664_10199414 | 3300025929 | Bacteria | 1727 |
| 629 | Ga0207664_10366281 | 3300025929 | Bacteria | 1277 |
| 630 | Ga0207664_10385810 | 3300025929 | Bacteria | 1244 |
| 631 | Ga0207664_11514889 | 3300025929 | Bacteria | 592 |
| 632 | Ga0207644_10108507 | 3300025931 | Unclassified | 2096 |
| 633 | Ga0207690_10037327 | 3300025932 | Bacteria | 3154 |
| 634 | Ga0207690_10040818 | 3300025932 | Unclassified | 3036 |
| 635 | Ga0207690_10271790 | 3300025932 | Unclassified | 1317 |
| 636 | Ga0207690_10309248 | 3300025932 | Bacteria | 1239 |
| 637 | Ga0207690_11311991 | 3300025932 | Unclassified | 605 |
| 638 | Ga0207706_10000642 | 3300025933 | Bacteria | 37073 |
| 639 | Ga0207706_10029596 | 3300025933 | Bacteria | 4888 |
| 640 | Ga0207706_10054583 | 3300025933 | Bacteria | 3526 |
| 641 | Ga0207706_10110444 | 3300025933 | Bacteria | 2419 |
| 642 | Ga0207686_10238636 | 3300025934 | Unclassified | 1322 |
| 643 | Ga0207686_10290942 | 3300025934 | Bacteria | 1209 |
| 644 | Ga0207686_10361089 | 3300025934 | Bacteria | 1096 |
| 645 | Ga0207709_10042008 | 3300025935 | Bacteria | 2747 |
| 646 | Ga0207709_10340932 | 3300025935 | Bacteria | 1128 |
| 647 | Ga0207670_10153735 | 3300025936 | Bacteria | 1710 |
| 648 | Ga0207670_11225685 | 3300025936 | Bacteria | 635 |
| 649 | Ga0207669_10401232 | 3300025937 | Bacteria | 1074 |
| 650 | Ga0207704_10444780 | 3300025938 | Archaea | 1033 |
| 651 | Ga0207704_10508969 | 3300025938 | Unclassified | 972 |
| 652 | Ga0207665_10580473 | 3300025939 | Bacteria | 874 |
| 653 | Ga0207691_10001241 | 3300025940 | Bacteria | 25452 |
| 654 | Ga0207691_10040865 | 3300025940 | Bacteria | 4284 |
| 655 | Ga0207691_10041381 | 3300025940 | Bacteria | 4255 |
| 656 | Ga0207691_10042609 | 3300025940 | Bacteria | 4184 |
| 657 | Ga0207691_10138492 | 3300025940 | Bacteria | 2145 |
| 658 | Ga0207691_11024063 | 3300025940 | Bacteria | 689 |
| 659 | Ga0207711_10190450 | 3300025941 | Bacteria | 1869 |
| 660 | Ga0207711_10203192 | 3300025941 | Bacteria | 1809 |
| 661 | Ga0207711_11133787 | 3300025941 | Bacteria | 723 |
| 662 | Ga0207689_10003004 | 3300025942 | Bacteria | 15558 |
| 663 | Ga0207689_11054354 | 3300025942 | Bacteria | 685 |
| 664 | Ga0207689_11650690 | 3300025942 | Unclassified | 532 |
| 665 | Ga0207661_10023403 | 3300025944 | Bacteria | 4667 |
| 666 | Ga0207661_10078459 | 3300025944 | Bacteria | 2719 |
| 667 | Ga0207661_10084601 | 3300025944 | Bacteria | 2628 |
| 668 | Ga0207661_10087673 | 3300025944 | Bacteria | 2585 |
| 669 | Ga0207661_10096650 | 3300025944 | Bacteria | 2472 |
| 670 | Ga0207661_10099539 | 3300025944 | Bacteria | 2438 |
| 671 | Ga0207661_10103028 | 3300025944 | Bacteria | 2401 |
| 672 | Ga0207661_10108565 | 3300025944 | Bacteria | 2343 |
| 673 | Ga0207661_10148766 | 3300025944 | Bacteria | 2023 |
| 674 | Ga0207661_10161672 | 3300025944 | Bacteria | 1943 |
| 675 | Ga0207661_10239488 | 3300025944 | Bacteria | 1609 |
| 676 | Ga0207661_10246218 | 3300025944 | Bacteria | 1587 |
| 677 | Ga0207661_10281172 | 3300025944 | Bacteria | 1487 |
| 678 | Ga0207661_10283196 | 3300025944 | Bacteria | 1482 |
| 679 | Ga0207661_10308365 | 3300025944 | Bacteria | 1420 |
| 680 | Ga0207661_10588575 | 3300025944 | Unclassified | 1021 |
| 681 | Ga0207661_10608537 | 3300025944 | Bacteria | 1003 |
| 682 | Ga0207661_10709318 | 3300025944 | Bacteria | 925 |
| 683 | Ga0207679_10000744 | 3300025945 | Bacteria | 21654 |
| 684 | Ga0207679_10002584 | 3300025945 | Bacteria | 11158 |
| 685 | Ga0207679_10025586 | 3300025945 | Unclassified | 4061 |
| 686 | Ga0207679_10053501 | 3300025945 | Bacteria | 2967 |
| 687 | Ga0207679_10130307 | 3300025945 | Unclassified | 2016 |
| 688 | Ga0207679_10146426 | 3300025945 | Bacteria | 1916 |
| 689 | Ga0207679_10149045 | 3300025945 | Bacteria | 1901 |
| 690 | Ga0207679_10166098 | 3300025945 | Bacteria | 1812 |
| 691 | Ga0207679_10422190 | 3300025945 | Bacteria | 1177 |
| 692 | Ga0207679_10773892 | 3300025945 | Bacteria | 874 |
| 693 | Ga0207679_11098876 | 3300025945 | Unclassified | 729 |
| 694 | Ga0207667_10041659 | 3300025949 | Unclassified | 4883 |
| 695 | Ga0207667_10081200 | 3300025949 | Unclassified | 3359 |
| 696 | Ga0207667_10159252 | 3300025949 | Bacteria | 2322 |
| 697 | Ga0207667_10463734 | 3300025949 | Bacteria | 1286 |
| 698 | Ga0207667_10478352 | 3300025949 | Unclassified | 1264 |
| 699 | Ga0207667_10709749 | 3300025949 | Bacteria | 1008 |
| 700 | Ga0207667_11176865 | 3300025949 | Archaea | 747 |
| 701 | Ga0207667_11279996 | 3300025949 | Bacteria | 710 |
| 702 | Ga0207667_11637450 | 3300025949 | Bacteria | 612 |
| 703 | Ga0207651_10023403 | 3300025960 | Bacteria | 3799 |
| 704 | Ga0207651_10419304 | 3300025960 | Bacteria | 1142 |
| 705 | Ga0207651_11044652 | 3300025960 | Bacteria | 731 |
| 706 | Ga0207651_11154002 | 3300025960 | Bacteria | 695 |
| 707 | Ga0207651_12148872 | 3300025960 | Bacteria | 501 |
| 708 | Ga0207712_10013924 | 3300025961 | Bacteria | 5159 |
| 709 | Ga0207712_10100047 | 3300025961 | Bacteria | 2154 |
| 710 | Ga0207712_10949633 | 3300025961 | Bacteria | 761 |
| 711 | Ga0207668_10123749 | 3300025972 | Bacteria | 1963 |
| 712 | Ga0207668_10130482 | 3300025972 | Bacteria | 1918 |
| 713 | Ga0207640_10155786 | 3300025981 | Bacteria | 1684 |
| 714 | Ga0207640_10237695 | 3300025981 | Bacteria | 1406 |
| 715 | Ga0207658_10045199 | 3300025986 | Bacteria | 3210 |
| 716 | Ga0207677_10413535 | 3300026023 | Bacteria | 1147 |
| 717 | Ga0207677_10587857 | 3300026023 | Bacteria | 975 |
| 718 | Ga0207703_10822928 | 3300026035 | Bacteria | 887 |
| 719 | Ga0207639_10013899 | 3300026041 | Bacteria | 5646 |
| 720 | Ga0207639_10227013 | 3300026041 | Unclassified | 1616 |
| 721 | Ga0207678_10095867 | 3300026067 | Bacteria | 2535 |
| 722 | Ga0207678_10343515 | 3300026067 | Bacteria | 1286 |
| 723 | Ga0207678_10604618 | 3300026067 | Unclassified | 961 |
| 724 | Ga0207678_11039049 | 3300026067 | Unclassified | 725 |
| 725 | Ga0207708_10017851 | 3300026075 | Bacteria | 5340 |
| 726 | Ga0207708_10488442 | 3300026075 | Bacteria | 1030 |
| 727 | Ga0207702_10006041 | 3300026078 | Bacteria | 10509 |
| 728 | Ga0207702_10321268 | 3300026078 | Unclassified | 1474 |
| 729 | Ga0207702_10369937 | 3300026078 | Bacteria | 1376 |
| 730 | Ga0207702_11242249 | 3300026078 | Bacteria | 739 |
| 731 | Ga0207702_11728833 | 3300026078 | Bacteria | 618 |
| 732 | Ga0207641_10342624 | 3300026088 | Bacteria | 1423 |
| 733 | Ga0207641_11914188 | 3300026088 | Unclassified | 594 |
| 734 | Ga0207641_12394448 | 3300026088 | Bacteria | 527 |
| 735 | Ga0207648_10007064 | 3300026089 | Bacteria | 11084 |
| 736 | Ga0207648_10079503 | 3300026089 | Bacteria | 2860 |
| 737 | Ga0207648_10124382 | 3300026089 | Bacteria | 2268 |
| 738 | Ga0207648_10495769 | 3300026089 | Bacteria | 1117 |
| 739 | Ga0207676_10441149 | 3300026095 | Bacteria | 1225 |
| 740 | Ga0207676_10643912 | 3300026095 | Bacteria | 1022 |
| 741 | Ga0207676_10909543 | 3300026095 | Bacteria | 863 |
| 742 | Ga0207674_10000828 | 3300026116 | Bacteria | 40263 |
| 743 | Ga0207674_10002108 | 3300026116 | Bacteria | 25182 |
| 744 | Ga0207674_10020165 | 3300026116 | Bacteria | 7210 |
| 745 | Ga0207674_10682363 | 3300026116 | Bacteria | 992 |
| 746 | Ga0207674_12151806 | 3300026116 | Bacteria | 521 |
| 747 | Ga0207675_100002863 | 3300026118 | Bacteria | 16976 |
| 748 | Ga0207675_100011177 | 3300026118 | Bacteria | 8406 |
| 749 | Ga0207675_101343560 | 3300026118 | Unclassified | 735 |
| 750 | Ga0207683_10348776 | 3300026121 | Bacteria | 1358 |
| 751 | Ga0207683_10500016 | 3300026121 | Bacteria | 1123 |
| 752 | Ga0207698_10053772 | 3300026142 | Bacteria | 3094 |
| 753 | Ga0207698_10120525 | 3300026142 | Bacteria | 2219 |
| 754 | Ga0207698_10246043 | 3300026142 | Bacteria | 1633 |
| 755 | Ga0207698_10622652 | 3300026142 | Bacteria | 1066 |
| 756 | Ga0207428_10046578 | 3300027907 | Bacteria | 3487 |
| 757 | Ga0268266_10782134 | 3300028379 | Unclassified | 922 |
| 758 | Ga0268266_10870065 | 3300028379 | Bacteria | 871 |
| 759 | Ga0268266_11075645 | 3300028379 | Unclassified | 778 |
| 760 | Ga0268266_11540843 | 3300028379 | Unclassified | 640 |
| 761 | Ga0268265_10006098 | 3300028380 | Bacteria | 8181 |
| 762 | Ga0268265_10017756 | 3300028380 | Bacteria | 4918 |
| 763 | Ga0307408_100002224 | 3300031548 | Bacteria | 13855 |
| 764 | Ga0307408_100087966 | 3300031548 | Bacteria | 2339 |
| 765 | Ga0307408_100105322 | 3300031548 | Bacteria | 2156 |
| 766 | Ga0307408_100346513 | 3300031548 | Bacteria | 1259 |
| 767 | Ga0307405_10107243 | 3300031731 | Bacteria | 1885 |
| 768 | Ga0307405_10608656 | 3300031731 | Bacteria | 893 |
| 769 | Ga0307413_10885025 | 3300031824 | Unclassified | 757 |
| 770 | Ga0307413_11483750 | 3300031824 | Unclassified | 599 |
| 771 | Ga0307406_10114219 | 3300031901 | Unclassified | 1865 |
| 772 | Ga0307406_10645623 | 3300031901 | Bacteria | 878 |
| 773 | Ga0307406_10767915 | 3300031901 | Bacteria | 811 |
| 774 | Ga0307406_10848901 | 3300031901 | Bacteria | 774 |
| 775 | Ga0307412_10016067 | 3300031911 | Bacteria | 4449 |
| 776 | Ga0307412_11149067 | 3300031911 | Unclassified | 693 |
| 777 | Ga0307409_101561762 | 3300031995 | Unclassified | 688 |
| 778 | Ga0307409_102683232 | 3300031995 | Bacteria | 526 |
| 779 | Ga0307416_100002716 | 3300032002 | Bacteria | 10258 |
| 780 | Ga0307416_100247709 | 3300032002 | Bacteria | 1732 |
| 781 | Ga0307416_101450893 | 3300032002 | Bacteria | 792 |
| 782 | Ga0307416_102315287 | 3300032002 | Unclassified | 637 |
| 783 | Ga0307416_103818975 | 3300032002 | Bacteria | 504 |
| 784 | Ga0307414_10464528 | 3300032004 | Bacteria | 1113 |
| 785 | Ga0307414_11789422 | 3300032004 | Unclassified | 573 |
| 786 | Ga0307411_10600007 | 3300032005 | Unclassified | 947 |
| 787 | Ga0307411_10934185 | 3300032005 | Bacteria | 773 |
| 788 | Ga0307411_11822931 | 3300032005 | Unclassified | 565 |
| 789 | Ga0373926_0349372 | 3300035083 | Unclassified | 581 |
| 790 | Ga0373934_0001697 | 3300035086 | Bacteria | 8093 |
| 791 | Ga0373934_0010899 | 3300035086 | Bacteria | 3417 |
| 792 | Ga0373944_0013225 | 3300035089 | Bacteria | 2286 |
| 793 | Ga0373944_0221338 | 3300035089 | Bacteria | 691 |
| 794 | Ga0373923_0080629 | 3300035111 | Bacteria | 1411 |
| 795 | Ga0373954_0030416 | 3300035118 | Bacteria | 2489 |
| 796 | Ga0373954_0107995 | 3300035118 | Bacteria | 1345 |
| 797 | Ga0373956_0247527 | 3300035119 | Bacteria | 847 |
| 798 | Ga0373957_0052445 | 3300035120 | Bacteria | 1562 |
| 799 | Ga0373943_0007622 | 3300035170 | Bacteria | 4861 |
| 800 | Ga0373943_0099213 | 3300035170 | Bacteria | 1520 |
| 801 | Ga0373943_0189246 | 3300035170 | Unclassified | 1135 |
| 802 | Ga0373946_0005526 | 3300035171 | Bacteria | 4560 |
| 803 | Ga0373955_0001562 | 3300035172 | Bacteria | 9776 |
| 804 | Ga0373955_0003382 | 3300035172 | Bacteria | 7013 |
| 805 | Ga0373961_0022669 | 3300035241 | Bacteria | 1682 |
| 806 | Ga0373924_0039793 | 3300035410 | Bacteria | 1922 |
| 807 | Ga0373924_0134466 | 3300035410 | Bacteria | 1077 |
| 808 | Ga0373924_0460907 | 3300035410 | Bacteria | 570 |
| 809 | Ga0373935_0019593 | 3300035692 | Bacteria | 4125 |
| 810 | Ga0373935_0056589 | 3300035692 | Unclassified | 2501 |
| 811 | Ga0373927_0016665 | 3300035695 | Bacteria | 4847 |
| 812 | Ga0373927_0034129 | 3300035695 | Bacteria | 3310 |
| 813 | Ga0373927_0142390 | 3300035695 | Bacteria | 1569 |
| 814 | Ga0373933_0024987 | 3300035724 | Bacteria | 3423 |
| 815 | Ga0373933_0117735 | 3300035724 | Bacteria | 1661 |
| 816 | Ga0373933_0161066 | 3300035724 | Unclassified | 1425 |
| 817 | Ga0373947_0037105 | 3300035725 | Unclassified | 2891 |
| 818 | Ga0373947_0071903 | 3300035725 | Bacteria | 2122 |
| 819 | Ga0373947_0181577 | 3300035725 | Bacteria | 1370 |
| 820 | Ga0373947_0585307 | 3300035725 | Bacteria | 760 |
| 821 | Ga0373947_0735980 | 3300035725 | Unclassified | 673 |
| 822 | Ga0373937_0000184 | 3300036401 | Bacteria | 61363 |
| 823 | Ga0373937_0016269 | 3300036401 | Bacteria | 6601 |
| 824 | Ga0373937_0297348 | 3300036401 | Bacteria | 1525 |
| 825 | Ga0373937_1765512 | 3300036401 | Unclassified | 565 |
| 826 | Ga0373925_0023122 | 3300037068 | Bacteria | 4535 |
| 827 | Ga0373925_0104496 | 3300037068 | Unclassified | 2181 |
| 828 | Ga0373925_0141404 | 3300037068 | Bacteria | 1884 |
| 829 | Ga0395905_0375727 | 3300037471 | Bacteria | 1315 |
| 830 | Ga0395905_1238046 | 3300037471 | Unclassified | 650 |
| 831 | Ga0436365_0192547 | 3300039437 | Bacteria | 3082 |
| 832 | Ga0436365_0580076 | 3300039437 | Unclassified | 2078 |
| 833 | Ga0436365_0610992 | 3300039437 | Bacteria | 1848 |
| 834 | Ga0436365_0785923 | 3300039437 | Bacteria | 3032 |
| 835 | Ga0436365_1666798 | 3300039437 | Bacteria | 2259 |
| 836 | Ga0439436_0161934 | 3300041404 | Bacteria | 633 |
| 837 | Ga0439439_0026870 | 3300041406 | Bacteria | 1452 |
| 838 | Ga0451807_2041370 | 3300041486 | Bacteria | 903 |
| 839 | Ga0439448_0271018 | 3300042005 | Unclassified | 601 |
| 840 | Ga0439449_0124874 | 3300042007 | Unclassified | 956 |
| 841 | Ga0439462_0146272 | 3300042015 | Bacteria | 663 |
| 842 | Ga0466963_0152403 | 3300044694 | Bacteria | 1606 |
| 843 | Ga0466963_0293161 | 3300044694 | Bacteria | 1144 |
| 844 | Ga0466957_0162900 | 3300044842 | Bacteria | 1449 |
| 845 | Ga0466957_0295250 | 3300044842 | Bacteria | 1088 |
| 846 | Ga0466957_0599814 | 3300044842 | Bacteria | 771 |
| 847 | Ga0451576_0098807 | 3300045051 | Unclassified | 3036 |
| 848 | Ga0451576_0152519 | 3300045051 | Bacteria | 2410 |
| 849 | Ga0451576_0948262 | 3300045051 | Bacteria | 902 |
| 850 | Ga0451576_1270974 | 3300045051 | Bacteria | 768 |
| 851 | Ga0466958_0118811 | 3300045836 | Bacteria | 1654 |
| 852 | Ga0466958_1119814 | 3300045836 | Unclassified | 514 |
| 853 | Ga0466967_0014965 | 3300045976 | Bacteria | 6066 |
| 854 | Ga0466967_0024085 | 3300045976 | Unclassified | 4999 |
| 855 | Ga0466967_0078180 | 3300045976 | Bacteria | 2980 |
| 856 | Ga0466967_0080702 | 3300045976 | Bacteria | 2936 |
| 857 | Ga0466967_0356512 | 3300045976 | Bacteria | 1416 |
| 858 | Ga0466967_0373740 | 3300045976 | Bacteria | 1383 |
| 859 | Ga0466967_0404128 | 3300045976 | Bacteria | 1329 |
| 860 | Ga0466967_0471671 | 3300045976 | Bacteria | 1229 |
| 861 | Ga0466967_0535564 | 3300045976 | Bacteria | 1152 |
| 862 | Ga0466967_0547852 | 3300045976 | Bacteria | 1138 |
| 863 | Ga0466967_0631105 | 3300045976 | Unclassified | 1059 |
| 864 | Ga0466967_0661224 | 3300045976 | Bacteria | 1034 |
| 865 | Ga0466967_0672006 | 3300045976 | Bacteria | 1025 |
| 866 | Ga0466967_0720133 | 3300045976 | Unclassified | 989 |
| 867 | Ga0466967_1449451 | 3300045976 | Unclassified | 684 |
| 868 | Ga0495603_0006890 | 3300046455 | Bacteria | 6820 |
| 869 | Ga0495629_0045141 | 3300046459 | Bacteria | 3092 |
| 870 | Ga0495629_0186267 | 3300046459 | Unclassified | 1438 |
| 871 | Ga0495638_0215828 | 3300046460 | Bacteria | 1075 |
| 872 | Ga0495651_0027216 | 3300046462 | Bacteria | 4454 |
| 873 | Ga0495651_0036250 | 3300046462 | Unclassified | 3840 |
| 874 | Ga0495653_0044983 | 3300046463 | Bacteria | 3424 |
| 875 | Ga0495580_0003643 | 3300046472 | Bacteria | 13046 |
| 876 | Ga0495580_0238343 | 3300046472 | Bacteria | 1248 |
| 877 | Ga0495580_0283508 | 3300046472 | Bacteria | 1130 |
| 878 | Ga0495580_0481574 | 3300046472 | Unclassified | 830 |
| 879 | Ga0495582_0017540 | 3300046473 | Bacteria | 3916 |
| 880 | Ga0495582_0024867 | 3300046473 | Bacteria | 3280 |
| 881 | Ga0495639_0000731 | 3300046475 | Bacteria | 15026 |
| 882 | Ga0495639_0009668 | 3300046475 | Bacteria | 4138 |
| 883 | Ga0495639_0043467 | 3300046475 | Bacteria | 2030 |
| 884 | Ga0495639_0101210 | 3300046475 | Unclassified | 1360 |
| 885 | Ga0495662_0281176 | 3300046476 | Bacteria | 819 |
| 886 | Ga0495664_0031121 | 3300046477 | Bacteria | 3127 |
| 887 | Ga0495664_0205531 | 3300046477 | Bacteria | 1193 |
| 888 | Ga0495594_0003763 | 3300046499 | Bacteria | 7783 |
| 889 | Ga0495594_0004014 | 3300046499 | Bacteria | 7573 |
| 890 | Ga0495594_0012370 | 3300046499 | Bacteria | 4445 |
| 891 | Ga0495594_0088601 | 3300046499 | Bacteria | 1733 |
| 892 | Ga0495594_0106248 | 3300046499 | Unclassified | 1581 |
| 893 | Ga0495594_0325817 | 3300046499 | Unclassified | 875 |
| 894 | Ga0495594_0870808 | 3300046499 | Bacteria | 507 |
| 895 | Ga0495608_0153348 | 3300046511 | Bacteria | 1467 |
| 896 | Ga0495618_0017804 | 3300046514 | Bacteria | 4360 |
| 897 | Ga0495630_0016699 | 3300046517 | Bacteria | 5368 |
| 898 | Ga0495630_0068286 | 3300046517 | Unclassified | 2672 |
| 899 | Ga0495630_0506393 | 3300046517 | Bacteria | 926 |
| 900 | Ga0495630_0731782 | 3300046517 | Bacteria | 756 |
| 901 | Ga0495652_0008474 | 3300046529 | Bacteria | 9380 |
| 902 | Ga0495665_0000680 | 3300046531 | Bacteria | 17434 |
| 903 | Ga0495665_0035992 | 3300046531 | Unclassified | 2643 |
| 904 | Ga0495586_0014535 | 3300046535 | Bacteria | 4182 |
| 905 | Ga0495586_0193553 | 3300046535 | Bacteria | 1152 |
| 906 | Ga0495587_0007425 | 3300046536 | Bacteria | 7099 |
| 907 | Ga0495587_0012777 | 3300046536 | Bacteria | 5282 |
| 908 | Ga0495645_0000075 | 3300046543 | Bacteria | 68269 |
| 909 | Ga0495645_0004610 | 3300046543 | Bacteria | 9408 |
| 910 | Ga0495645_0580067 | 3300046543 | Unclassified | 692 |
| 911 | Ga0495667_0148328 | 3300046559 | Bacteria | 1510 |
| 912 | Ga0495667_0234221 | 3300046559 | Bacteria | 1170 |
| 913 | Ga0495667_0302228 | 3300046559 | Bacteria | 1014 |
| 914 | Ga0495625_0006357 | 3300046660 | Bacteria | 10548 |
| 915 | Ga0495625_0569452 | 3300046660 | Bacteria | 684 |
| 916 | Ga0495635_0633480 | 3300046663 | Unclassified | 696 |
| 917 | Ga0495659_0144161 | 3300046664 | Archaea | 953 |
| 918 | Ga0495588_0001797 | 3300046674 | Bacteria | 9146 |
| 919 | Ga0495657_0144402 | 3300046675 | Unclassified | 1481 |
| 920 | Ga0495599_0022381 | 3300046678 | Bacteria | 3945 |
| 921 | Ga0495599_0031228 | 3300046678 | Unclassified | 3343 |
| 922 | Ga0495623_0002632 | 3300046679 | Bacteria | 11843 |
| 923 | Ga0495623_0093284 | 3300046679 | Bacteria | 1843 |
| 924 | Ga0495623_0138721 | 3300046679 | Bacteria | 1448 |
| 925 | Ga0495658_0001809 | 3300046683 | Bacteria | 10980 |
| 926 | Ga0495658_0694404 | 3300046683 | Bacteria | 652 |
| 927 | Ga0495613_0035559 | 3300046689 | Bacteria | 3696 |
| 928 | Ga0495613_0230752 | 3300046689 | Unclassified | 1297 |
| 929 | Ga0495613_0650279 | 3300046689 | Unclassified | 698 |
| 930 | Ga0495600_0058838 | 3300046809 | Bacteria | 2510 |
| 931 | Ga0495600_0120213 | 3300046809 | Unclassified | 1708 |
| 932 | Ga0495581_0000907 | 3300047315 | Bacteria | 15891 |
| 933 | Ga0495581_0120499 | 3300047315 | Bacteria | 1527 |
| 934 | Ga0495581_0490531 | 3300047315 | Bacteria | 714 |
| 935 | Ga0495604_0011842 | 3300047317 | Bacteria | 6938 |
| 936 | Ga0495636_0205372 | 3300047318 | Unclassified | 901 |
| 937 | Ga0495636_0418441 | 3300047318 | Unclassified | 640 |
| 938 | Ga0495674_0209886 | 3300047319 | Bacteria | 1613 |
| 939 | Ga0495674_1033563 | 3300047319 | Bacteria | 628 |
| 940 | Ga0495672_0001955 | 3300047320 | Bacteria | 19481 |
| 941 | Ga0495675_0005109 | 3300047444 | Bacteria | 7986 |
| 942 | Ga0495675_0018536 | 3300047444 | Bacteria | 4419 |
| 943 | Ga0495684_0004467 | 3300047471 | Bacteria | 10933 |
| 944 | Ga0495684_0174478 | 3300047471 | Bacteria | 1596 |
| 945 | Ga0495593_0002611 | 3300047673 | Bacteria | 10830 |
| 946 | Ga0495602_0048052 | 3300048088 | Bacteria | 3839 |
| 947 | Ga0495602_0147100 | 3300048088 | Bacteria | 1857 |
| 948 | Ga0495602_0252177 | 3300048088 | Bacteria | 1314 |
| 949 | Ga0495602_0890459 | 3300048088 | Bacteria | 593 |
| 950 | Ga0495614_0006061 | 3300048089 | Bacteria | 5433 |
| 951 | Ga0496102_1336613 | 3300048905 | Bacteria | 636 |
| 952 | Ga0496105_0114376 | 3300048908 | Bacteria | 2226 |
| 953 | Ga0496108_0607502 | 3300048911 | Bacteria | 953 |
| 954 | Ga0496109_0339335 | 3300048912 | Bacteria | 1419 |
| 955 | Ga0496115_0937963 | 3300048918 | Unclassified | 665 |
| 956 | Ga0501290_083955 | 3300049513 | Bacteria | 547 |
| 957 | Ga0501298_047944 | 3300049521 | Unclassified | 880 |
| 958 | Ga0501033_1015968 | 3300049570 | Archaea | 554 |
| 959 | Ga0501034_0168396 | 3300049571 | Bacteria | 2159 |
| 960 | Ga0501039_1056364 | 3300049575 | Bacteria | 630 |
| 961 | Ga0501040_0551428 | 3300049576 | Bacteria | 832 |
| 962 | Ga0501047_0115202 | 3300049581 | Bacteria | 2570 |
| 963 | Ga0501069_1026590 | 3300049585 | Bacteria | 504 |
| 964 | Ga0501070_0052614 | 3300049586 | Bacteria | 3380 |
| 965 | Ga0501070_0576572 | 3300049586 | Bacteria | 899 |
| 966 | Ga0501072_1043675 | 3300049588 | Bacteria | 637 |
| 967 | Ga0501073_0322990 | 3300049589 | Bacteria | 1065 |
| 968 | Ga0501076_0934055 | 3300049592 | Bacteria | 715 |
| 969 | Ga0501207_146930 | 3300049654 | Unclassified | 506 |
| 970 | Ga0501256_017387 | 3300049685 | Unclassified | 734 |
| 971 | Ga0501225_0061625 | 3300049705 | Bacteria | 1056 |
| 972 | Ga0501234_091493 | 3300049707 | Bacteria | 546 |
| 973 | Ga0501080_0573122 | 3300049742 | Bacteria | 1004 |
| 974 | Ga0501263_010679 | 3300049760 | Unclassified | 1130 |
| 975 | Ga0501035_1298108 | 3300049822 | Unclassified | 561 |
| 976 | Ga0501044_1161278 | 3300049823 | Bacteria | 640 |
| 977 | nmdc:mga05p37_1431_c1 | 3300050507 | Bacteria | 27718 |
| 978 | nmdc:mga05p37_216172_c1 | 3300050507 | Bacteria | 2315 |
| 979 | nmdc:mga05p37_28300_c1 | 3300050507 | Bacteria | 6834 |
| 980 | nmdc:mga05p37_558227_c1 | 3300050507 | Unclassified | 1302 |
| 981 | nmdc:mga09592_1045006_c1 | 3300050508 | Bacteria | 681 |
| 982 | nmdc:mga09592_11847_c1 | 3300050508 | Bacteria | 7093 |
| 983 | nmdc:mga09592_17358_c1 | 3300050508 | Bacteria | 5896 |
| 984 | nmdc:mga09592_17584_c1 | 3300050508 | Bacteria | 5859 |
| 985 | nmdc:mga09592_966359_c1 | 3300050508 | Unclassified | 713 |
| 986 | nmdc:mga0qj67_135767_c1 | 3300050509 | Bacteria | 1993 |
| 987 | nmdc:mga0qj67_1486765_c1 | 3300050509 | Bacteria | 521 |
| 988 | nmdc:mga0qj67_161573_c1 | 3300050509 | Unclassified | 1818 |
| 989 | nmdc:mga0qj67_2379_c1 | 3300050509 | Bacteria | 13395 |
| 990 | nmdc:mga0qj67_9693_c1 | 3300050509 | Bacteria | 7172 |
| 991 | nmdc:mga06r32_12948_c1 | 3300050510 | Bacteria | 7542 |
| 992 | nmdc:mga06r32_13823_c1 | 3300050510 | Bacteria | 7323 |
| 993 | nmdc:mga06r32_1868115_c1 | 3300050510 | Bacteria | 535 |
| 994 | nmdc:mga06r32_23989_c1 | 3300050510 | Bacteria | 5654 |
| 995 | nmdc:mga06r32_82916_c1 | 3300050510 | Viruses | 3124 |
| 996 | nmdc:mga06r32_978106_c1 | 3300050510 | Bacteria | 800 |
| 997 | nmdc:mga08y16_236469_c1 | 3300050511 | Bacteria | 1889 |
| 998 | nmdc:mga08y16_311992_c1 | 3300050511 | Bacteria | 1620 |
| 999 | nmdc:mga08y16_44448_c1 | 3300050511 | Bacteria | 4653 |
| 1000 | nmdc:mga08y16_68779_c1 | 3300050511 | Unclassified | 3692 |
| 1001 | nmdc:mga0n895_1381229_c1 | 3300050512 | Bacteria | 673 |
| 1002 | nmdc:mga0n895_1479396_c1 | 3300050512 | Bacteria | 646 |
| 1003 | nmdc:mga0n895_160169_c1 | 3300050512 | Bacteria | 2282 |
| 1004 | nmdc:mga0n895_192475_c1 | 3300050512 | Unclassified | 2071 |
| 1005 | nmdc:mga0n895_210785_c1 | 3300050512 | Unclassified | 1973 |
| 1006 | nmdc:mga0n895_392074_c1 | 3300050512 | Bacteria | 1405 |
| 1007 | nmdc:mga0rr50_1382001_c1 | 3300050513 | Bacteria | 596 |
| 1008 | nmdc:mga0rr50_1418959_c1 | 3300050513 | Bacteria | 588 |
| 1009 | nmdc:mga08x19_265991_c1 | 3300050514 | Bacteria | 1186 |
| 1010 | nmdc:mga08x19_689832_c1 | 3300050514 | Bacteria | 725 |
| 1011 | nmdc:mga0a205_11822_c1 | 3300050515 | Bacteria | 8057 |
| 1012 | nmdc:mga0a205_164972_c1 | 3300050515 | Unclassified | 2111 |
| 1013 | nmdc:mga0a205_28356_c1 | 3300050515 | Bacteria | 5353 |
| 1014 | Ga0495601_0229170 | 3300053077 | Bacteria | 1213 |
| 1015 | Ga0495601_0890823 | 3300053077 | Bacteria | 562 |
| 1016 | Ga0495612_0017223 | 3300053078 | Bacteria | 2894 |
| 1017 | Ga0495595_0046497 | 3300053084 | Bacteria | 2000 |
| 1018 | Ga0495595_0509707 | 3300053084 | Bacteria | 613 |
| 1019 | Ga0495619_0080505 | 3300053085 | Bacteria | 2192 |
| 1020 | Ga0495619_0715101 | 3300053085 | Bacteria | 681 |
| 1021 | Ga0466962_0618871 | 3300061719 | Bacteria | 553 |
| 1022 | Ga0530510_0329264 | 3300061734 | Bacteria | 1146 |
| 1023 | Ga0207661_10367598 | |||
| 1024 | JGI25406J46586_10030228 | |||
| 1025 | Ga0058863_10087649 | |||
| 1026 | Ga0058863_11454414 | |||
| 1027 | Ga0065712_10313715 | |||
| 1028 | Ga0065707_10294286 | |||
| 1029 | Ga0065707_10595419 | |||
| 1030 | Ga0070658_10010790 | |||
| 1031 | Ga0070658_10341340 | |||
| 1032 | Ga0070658_11080453 | |||
| 1033 | Ga0070658_11205615 | |||
| 1034 | Ga0070676_10129169 | |||
| 1035 | Ga0070676_10649517 | |||
| 1036 | Ga0070683_100006898 | |||
| 1037 | Ga0070683_100013364 | |||
| 1038 | Ga0070683_100028508 | |||
| 1039 | Ga0070683_100067932 | |||
| 1040 | Ga0070683_100078687 | |||
| 1041 | Ga0070683_100125677 | |||
| 1042 | Ga0070683_100179633 | |||
| 1043 | Ga0070683_100295346 | |||
| 1044 | Ga0070683_100308417 | |||
| 1045 | Ga0070683_100513154 | |||
| 1046 | Ga0070683_100592153 | |||
| 1047 | Ga0070683_101418132 | |||
| 1048 | Ga0070683_101592471 | |||
| 1049 | Ga0070690_100005775 | |||
| 1050 | Ga0070690_100433137 | |||
| 1051 | Ga0070670_100025103 | |||
| 1052 | Ga0070670_100050294 | |||
| 1053 | Ga0070670_100058848 | |||
| 1054 | Ga0070670_100224888 | |||
| 1055 | Ga0070670_100272993 | |||
| 1056 | Ga0070670_101483055 | |||
| 1057 | Ga0070677_10181730 | |||
| 1058 | Ga0070677_10229749 | |||
| 1059 | Ga0070677_10468222 | |||
| 1060 | Ga0068869_100003430 | |||
| 1061 | Ga0068869_100461187 | |||
| 1062 | Ga0068869_102138405 | |||
| 1063 | Ga0070666_10141959 | |||
| 1064 | Ga0070666_10260906 | |||
| 1065 | Ga0070680_100000749 | |||
| 1066 | Ga0070680_100003399 | |||
| 1067 | Ga0070680_100028122 | |||
| 1068 | Ga0070680_100040334 | |||
| 1069 | Ga0070680_100062167 | |||
| 1070 | Ga0070680_100063923 | |||
| 1071 | Ga0070680_100066325 | |||
| 1072 | Ga0070680_100092938 | |||
| 1073 | Ga0070680_100171540 | |||
| 1074 | Ga0070680_100197753 | |||
| 1075 | Ga0070680_101000420 | |||
| 1076 | Ga0070680_101559729 | |||
| 1077 | Ga0070682_100698145 | |||
| 1078 | Ga0068868_100246442 | |||
| 1079 | Ga0068868_100255911 | |||
| 1080 | Ga0068868_100643899 | |||
| 1081 | Ga0068868_101108201 | |||
| 1082 | Ga0070660_100268148 | |||
| 1083 | Ga0070660_100870442 | |||
| 1084 | Ga0070689_100067299 | |||
| 1085 | Ga0070689_100088157 | |||
| 1086 | Ga0070689_100168275 | |||
| 1087 | Ga0070687_100130169 | |||
| 1088 | Ga0070687_100161622 | |||
| 1089 | Ga0070661_100001820 | |||
| 1090 | Ga0070661_100002751 | |||
| 1091 | Ga0070661_100010478 | |||
| 1092 | Ga0070661_100025342 | |||
| 1093 | Ga0070661_100504859 | |||
| 1094 | Ga0070661_100921819 | |||
| 1095 | Ga0070692_10184407 | |||
| 1096 | Ga0070668_100057860 | |||
| 1097 | Ga0070668_100092072 | |||
| 1098 | Ga0070668_101027405 | |||
| 1099 | Ga0070669_100007489 | |||
| 1100 | Ga0070669_100117027 | |||
| 1101 | Ga0070669_100360635 | |||
| 1102 | Ga0070669_100956156 | |||
| 1103 | Ga0070669_101075536 | |||
| 1104 | Ga0070675_100006208 | |||
| 1105 | Ga0070675_100012350 | |||
| 1106 | Ga0070675_100046085 | |||
| 1107 | Ga0070675_100135415 | |||
| 1108 | Ga0070675_100447298 | |||
| 1109 | Ga0070675_100503806 | |||
| 1110 | Ga0070675_100847229 | |||
| 1111 | Ga0070671_100508370 | |||
| 1112 | Ga0070671_100871595 | |||
| 1113 | Ga0070674_100136745 | |||
| 1114 | Ga0070674_100178410 | |||
| 1115 | Ga0070674_100811164 | |||
| 1116 | Ga0070674_100916670 | |||
| 1117 | Ga0070673_100060185 | |||
| 1118 | Ga0070673_100118501 | |||
| 1119 | Ga0070673_100166506 | |||
| 1120 | Ga0070673_100292148 | |||
| 1121 | Ga0070673_100317143 | |||
| 1122 | Ga0070673_100769122 | |||
| 1123 | Ga0070673_101425127 | |||
| 1124 | Ga0070688_100002762 | |||
| 1125 | Ga0070688_100100467 | |||
| 1126 | Ga0070688_101097112 | |||
| 1127 | Ga0070659_100118519 | |||
| 1128 | Ga0070659_100381081 | |||
| 1129 | Ga0070659_100851884 | |||
| 1130 | Ga0070659_100972909 | |||
| 1131 | Ga0070667_100083063 | |||
| 1132 | Ga0070667_100753521 | |||
| 1133 | Ga0070667_100824556 | |||
| 1134 | Ga0070667_100854793 | |||
| 1135 | Ga0070709_10012828 | |||
| 1136 | Ga0070709_10190794 | |||
| 1137 | Ga0070709_10270524 | |||
| 1138 | Ga0070709_11700210 | |||
| 1139 | Ga0070714_100007410 | |||
| 1140 | Ga0070714_100050532 | |||
| 1141 | Ga0070714_100209149 | |||
| 1142 | Ga0070714_100225606 | |||
| 1143 | Ga0070714_100579649 | |||
| 1144 | Ga0070713_100000077 | |||
| 1145 | Ga0070713_100008338 | |||
| 1146 | Ga0070713_100019682 | |||
| 1147 | Ga0070713_100033238 | |||
| 1148 | Ga0070713_100073801 | |||
| 1149 | Ga0070713_100150125 | |||
| 1150 | Ga0070713_100464772 | |||
| 1151 | Ga0070710_10119384 | |||
| 1152 | Ga0070710_10450882 | |||
| 1153 | Ga0070710_10792978 | |||
| 1154 | Ga0070710_11147050 | |||
| 1155 | Ga0070701_10263236 | |||
| 1156 | Ga0070701_10274677 | |||
| 1157 | Ga0070701_11115861 | |||
| 1158 | Ga0070711_100170110 | |||
| 1159 | Ga0070711_100196432 | |||
| 1160 | Ga0070711_100234106 | |||
| 1161 | Ga0070711_100428086 | |||
| 1162 | Ga0070711_100444953 | |||
| 1163 | Ga0070711_100753841 | |||
| 1164 | Ga0070711_101492402 | |||
| 1165 | Ga0070705_100570239 | |||
| 1166 | Ga0070700_100011966 | |||
| 1167 | Ga0070700_100019793 | |||
| 1168 | Ga0070700_100145114 | |||
| 1169 | Ga0070694_100284145 | |||
| 1170 | Ga0070694_101250593 | |||
| 1171 | Ga0070708_100000934 | |||
| 1172 | Ga0070663_100096428 | |||
| 1173 | Ga0070663_100689775 | |||
| 1174 | Ga0070678_100174446 | |||
| 1175 | Ga0070678_100339093 | |||
| 1176 | Ga0070678_101250641 | |||
| 1177 | Ga0070662_100074738 | |||
| 1178 | Ga0070662_100213078 | |||
| 1179 | Ga0070662_100712729 | |||
| 1180 | Ga0070681_10000280 | |||
| 1181 | Ga0070681_10000406 | |||
| 1182 | Ga0070681_10009743 | |||
| 1183 | Ga0070681_10032579 | |||
| 1184 | Ga0070681_10038378 | |||
| 1185 | Ga0070681_10040451 | |||
| 1186 | Ga0070681_10041097 | |||
| 1187 | Ga0070681_10064816 | |||
| 1188 | Ga0070681_10072491 | |||
| 1189 | Ga0070681_10091167 | |||
| 1190 | Ga0070681_10158704 | |||
| 1191 | Ga0070681_10176877 | |||
| 1192 | Ga0070681_10392815 | |||
| 1193 | Ga0070681_10442061 | |||
| 1194 | Ga0070681_10504194 | |||
| 1195 | Ga0070681_10616242 | |||
| 1196 | Ga0070681_10696225 | |||
| 1197 | Ga0070681_11997294 | |||
| 1198 | Ga0068867_100128867 | |||
| 1199 | Ga0068867_100179317 | |||
| 1200 | Ga0068867_101286154 | |||
| 1201 | Ga0068867_101302581 | |||
| 1202 | Ga0070685_10062955 | |||
| 1203 | Ga0070685_10300980 | |||
| 1204 | Ga0070685_10505222 | |||
| 1205 | Ga0070706_100052359 | |||
| 1206 | Ga0070706_100091815 | |||
| 1207 | Ga0070706_100288072 | |||
| 1208 | Ga0070707_100922193 | |||
| 1209 | Ga0070707_101718655 | |||
| 1210 | Ga0070698_100242098 | |||
| 1211 | Ga0070698_100455068 | |||
| 1212 | Ga0070698_100556329 | |||
| 1213 | Ga0070698_100690245 | |||
| 1214 | Ga0070698_101089655 | |||
| 1215 | Ga0070699_100188932 | |||
| 1216 | Ga0070699_101991013 | |||
| 1217 | Ga0070679_100000050 | |||
| 1218 | Ga0070679_100001297 | |||
| 1219 | Ga0070679_100008346 | |||
| 1220 | Ga0070679_100014843 | |||
| 1221 | Ga0070679_100032831 | |||
| 1222 | Ga0070679_100045977 | |||
| 1223 | Ga0070679_100076976 | |||
| 1224 | Ga0070679_100090912 | |||
| 1225 | Ga0070679_100102096 | |||
| 1226 | Ga0070679_100118269 | |||
| 1227 | Ga0070679_100122057 | |||
| 1228 | Ga0070679_100140255 | |||
| 1229 | Ga0070679_100309069 | |||
| 1230 | Ga0070679_100332827 | |||
| 1231 | Ga0070679_100594343 | |||
| 1232 | Ga0070679_100833231 | |||
| 1233 | Ga0070679_100862402 | |||
| 1234 | Ga0070679_101629038 | |||
| 1235 | Ga0070679_101775669 | |||
| 1236 | Ga0070679_101918940 | |||
| 1237 | Ga0070684_100003048 | |||
| 1238 | Ga0070684_100008393 | |||
| 1239 | Ga0070684_100014182 | |||
| 1240 | Ga0070684_100014419 | |||
| 1241 | Ga0070684_100017321 | |||
| 1242 | Ga0070684_100019213 | |||
| 1243 | Ga0070684_100037417 | |||
| 1244 | Ga0070684_100038842 | |||
| 1245 | Ga0070684_100044798 | |||
| 1246 | Ga0070684_100272863 | |||
| 1247 | Ga0070684_100286511 | |||
| 1248 | Ga0070684_100309777 | |||
| 1249 | Ga0070684_100892560 | |||
| 1250 | Ga0070684_102001008 | |||
| 1251 | Ga0068853_100048699 | |||
| 1252 | Ga0068853_100061378 | |||
| 1253 | Ga0068853_100077950 | |||
| 1254 | Ga0068853_100871807 | |||
| 1255 | Ga0070672_100031677 | |||
| 1256 | Ga0070672_100071110 | |||
| 1257 | Ga0070672_100297311 | |||
| 1258 | Ga0070672_100463339 | |||
| 1259 | Ga0070672_101567541 | |||
| 1260 | Ga0070686_100037447 | |||
| 1261 | Ga0070686_100083027 | |||
| 1262 | Ga0070686_101908759 | |||
| 1263 | Ga0070695_100271647 | |||
| 1264 | Ga0070695_100407931 | |||
| 1265 | Ga0070696_100720327 | |||
| 1266 | Ga0070696_101736154 | |||
| 1267 | Ga0070693_100002797 | |||
| 1268 | Ga0070693_100005203 | |||
| 1269 | Ga0070693_100007963 | |||
| 1270 | Ga0070693_100010709 | |||
| 1271 | Ga0070693_100291981 | |||
| 1272 | Ga0070693_100854175 | |||
| 1273 | Ga0070693_101036093 | |||
| 1274 | Ga0070665_100040007 | |||
| 1275 | Ga0070665_100314424 | |||
| 1276 | Ga0070665_100368284 | |||
| 1277 | Ga0070665_100534961 | |||
| 1278 | Ga0070665_101050726 | |||
| 1279 | Ga0070665_101723190 | |||
| 1280 | Ga0068855_100049051 | |||
| 1281 | Ga0068855_100080116 | |||
| 1282 | Ga0068855_100138498 | |||
| 1283 | Ga0068855_100237479 | |||
| 1284 | Ga0068855_100250129 | |||
| 1285 | Ga0068855_100630372 | |||
| 1286 | Ga0068855_100639244 | |||
| 1287 | Ga0068855_100656950 | |||
| 1288 | Ga0068855_100681980 | |||
| 1289 | Ga0068855_100881508 | |||
| 1290 | Ga0068855_101079270 | |||
| 1291 | Ga0070664_100002346 | |||
| 1292 | Ga0070664_100002527 | |||
| 1293 | Ga0070664_100033645 | |||
| 1294 | Ga0070664_100090618 | |||
| 1295 | Ga0070664_100323642 | |||
| 1296 | Ga0070664_100505776 | |||
| 1297 | Ga0070664_100951559 | |||
| 1298 | Ga0070664_102366244 | |||
| 1299 | Ga0068857_100022416 | |||
| 1300 | Ga0068857_101272020 | |||
| 1301 | Ga0068857_102009358 | |||
| 1302 | Ga0068857_102142235 | |||
| 1303 | Ga0068854_100232210 | |||
| 1304 | Ga0068854_100269362 | |||
| 1305 | Ga0068856_100007031 | |||
| 1306 | Ga0068856_100163140 | |||
| 1307 | Ga0068856_100496640 | |||
| 1308 | Ga0068856_100546526 | |||
| 1309 | Ga0068856_100717614 | |||
| 1310 | Ga0068852_100045760 | |||
| 1311 | Ga0068852_100061292 | |||
| 1312 | Ga0068852_100078166 | |||
| 1313 | Ga0068852_101082241 | |||
| 1314 | Ga0068852_101214337 | |||
| 1315 | Ga0068852_101688015 | |||
| 1316 | Ga0068859_101205856 | |||
| 1317 | Ga0068859_102386584 | |||
| 1318 | Ga0068864_100058413 | |||
| 1319 | Ga0068864_100411253 | |||
| 1320 | Ga0068864_100951989 | |||
| 1321 | Ga0068866_10361405 | |||
| 1322 | Ga0068861_100036790 | |||
| 1323 | Ga0068861_102480388 | |||
| 1324 | Ga0068851_10639616 | |||
| 1325 | Ga0068870_10029221 | |||
| 1326 | Ga0068870_10106624 | |||
| 1327 | Ga0068863_100030428 | |||
| 1328 | Ga0068863_100900860 | |||
| 1329 | Ga0068863_101174598 | |||
| 1330 | Ga0068863_101293589 | |||
| 1331 | Ga0068858_100244182 | |||
| 1332 | Ga0068858_101407195 | |||
| 1333 | Ga0068860_100248869 | |||
| 1334 | Ga0068862_100022990 | |||
| 1335 | Ga0068862_100031505 | |||
| 1336 | Ga0068862_100075164 | |||
| 1337 | Ga0068862_100557271 | |||
| 1338 | Ga0068862_101532996 | |||
| 1339 | Ga0081455_10059993 | |||
| 1340 | Ga0081455_10119850 | |||
| 1341 | Ga0081455_10247724 | |||
| 1342 | Ga0081539_10003628 | |||
| 1343 | Ga0070717_10018971 | |||
| 1344 | Ga0070717_10088017 | |||
| 1345 | Ga0070717_10098345 | |||
| 1346 | Ga0070717_10100307 | |||
| 1347 | Ga0070717_10327371 | |||
| 1348 | Ga0070717_10440026 | |||
| 1349 | Ga0075432_10086604 | |||
| 1350 | Ga0070716_101099883 | |||
| 1351 | Ga0070712_100001780 | |||
| 1352 | Ga0070712_100031074 | |||
| 1353 | Ga0070712_100072837 | |||
| 1354 | Ga0070712_100102354 | |||
| 1355 | Ga0070712_100270157 | |||
| 1356 | Ga0070712_100399726 | |||
| 1357 | Ga0097621_100330773 | |||
| 1358 | Ga0097621_101154143 | |||
| 1359 | Ga0097621_101430884 | |||
| 1360 | Ga0068871_100062427 | |||
| 1361 | Ga0068871_100574233 | |||
| 1362 | Ga0068871_101716769 | |||
| 1363 | Ga0075428_100041959 | |||
| 1364 | Ga0075428_100208943 | |||
| 1365 | Ga0075428_100263569 | |||
| 1366 | Ga0075428_102039566 | |||
| 1367 | Ga0075428_102193215 | |||
| 1368 | Ga0075430_100001246 | |||
| 1369 | Ga0075430_100008251 | |||
| 1370 | Ga0075430_100010224 | |||
| 1371 | Ga0075430_100026418 | |||
| 1372 | Ga0075430_100061609 | |||
| 1373 | Ga0075430_101730639 | |||
| 1374 | Ga0075431_100003459 | |||
| 1375 | Ga0075431_100007932 | |||
| 1376 | Ga0075431_100022817 | |||
| 1377 | Ga0075431_100029821 | |||
| 1378 | Ga0075431_100035964 | |||
| 1379 | Ga0075431_100060834 | |||
| 1380 | Ga0075433_10031615 | |||
| 1381 | Ga0075433_10416481 | |||
| 1382 | Ga0075433_10731942 | |||
| 1383 | Ga0075434_100015606 | |||
| 1384 | Ga0075434_100033319 | |||
| 1385 | Ga0075434_100061957 | |||
| 1386 | Ga0075434_100139986 | |||
| 1387 | Ga0075434_100141390 | |||
| 1388 | Ga0075434_100350952 | |||
| 1389 | Ga0075434_101566916 | |||
| 1390 | Ga0075429_100042917 | |||
| 1391 | Ga0075429_100226049 | |||
| 1392 | Ga0075429_100296149 | |||
| 1393 | Ga0075429_101400166 | |||
| 1394 | Ga0068865_100058145 | |||
| 1395 | Ga0068865_100796229 | |||
| 1396 | Ga0068865_100842924 | |||
| 1397 | Ga0075436_100002597 | |||
| 1398 | Ga0075436_100613644 | |||
| 1399 | Ga0097620_100230619 | |||
| 1400 | Ga0097620_101205855 | |||
| 1401 | Ga0097620_102386363 | |||
| 1402 | Ga0075435_100231222 | |||
| 1403 | Ga0075435_100982757 | |||
| 1404 | Ga0075435_101260888 | |||
| 1405 | Ga0075435_101727873 | |||
| 1406 | Ga0105240_10166111 | |||
| 1407 | Ga0105240_10285461 | |||
| 1408 | Ga0105240_10634446 | |||
| 1409 | Ga0105240_12574448 | |||
| 1410 | Ga0105240_12629493 | |||
| 1411 | Ga0111539_10045282 | |||
| 1412 | Ga0111539_10204039 | |||
| 1413 | Ga0111539_10204602 | |||
| 1414 | Ga0111539_10323113 | |||
| 1415 | Ga0111539_11114970 | |||
| 1416 | Ga0111539_12110613 | |||
| 1417 | Ga0105245_10116898 | |||
| 1418 | Ga0105245_10455212 | |||
| 1419 | Ga0105245_10933771 | |||
| 1420 | Ga0105245_11756338 | |||
| 1421 | Ga0105245_12401801 | |||
| 1422 | Ga0105247_10188312 | |||
| 1423 | Ga0105247_10399457 | |||
| 1424 | Ga0114129_10000108 | |||
| 1425 | Ga0114129_10019638 | |||
| 1426 | Ga0114129_10127895 | |||
| 1427 | Ga0114129_10605901 | |||
| 1428 | Ga0114129_10623773 | |||
| 1429 | Ga0114129_11422425 | |||
| 1430 | Ga0114129_11575567 | |||
| 1431 | Ga0114129_12185689 | |||
| 1432 | Ga0105243_10073993 | |||
| 1433 | Ga0105243_10179272 | |||
| 1434 | Ga0105243_10428861 | |||
| 1435 | Ga0105243_10863342 | |||
| 1436 | Ga0105241_10168985 | |||
| 1437 | Ga0105241_10251799 | |||
| 1438 | Ga0105241_10280877 | |||
| 1439 | Ga0105241_11393574 | |||
| 1440 | Ga0105242_10111217 | |||
| 1441 | Ga0105242_10827554 | |||
| 1442 | Ga0105242_10866126 | |||
| 1443 | Ga0105242_11206876 | |||
| 1444 | Ga0105242_11888028 | |||
| 1445 | Ga0105248_10186548 | |||
| 1446 | Ga0105248_10208768 | |||
| 1447 | Ga0105248_10405445 | |||
| 1448 | Ga0105248_10518713 | |||
| 1449 | Ga0105248_11037277 | |||
| 1450 | Ga0105237_10135152 | |||
| 1451 | Ga0105237_10227538 | |||
| 1452 | Ga0105237_10230857 | |||
| 1453 | Ga0105237_10250837 | |||
| 1454 | Ga0105237_10782502 | |||
| 1455 | Ga0105238_10021948 | |||
| 1456 | Ga0105238_11222454 | |||
| 1457 | Ga0105238_12736012 | |||
| 1458 | Ga0105249_10001803 | |||
| 1459 | Ga0105249_10024953 | |||
| 1460 | Ga0105249_10348899 | |||
| 1461 | Ga0105249_10426139 | |||
| 1462 | Ga0105239_10005522 | |||
| 1463 | Ga0105239_11253398 | |||
| 1464 | Ga0105246_11358645 | |||
| 1465 | Ga0157373_10268338 | |||
| 1466 | Ga0157373_10822806 | |||
| 1467 | Ga0157373_11090571 | |||
| 1468 | Ga0157371_10171018 | |||
| 1469 | Ga0157371_10556861 | |||
| 1470 | Ga0157370_10019508 | |||
| 1471 | Ga0157370_10127171 | |||
| 1472 | Ga0157370_10187817 | |||
| 1473 | Ga0157370_10251312 | |||
| 1474 | Ga0157370_10481306 | |||
| 1475 | Ga0157370_10514747 | |||
| 1476 | Ga0157370_10988229 | |||
| 1477 | Ga0157370_11557781 | |||
| 1478 | Ga0157369_10014958 | |||
| 1479 | Ga0157369_10036101 | |||
| 1480 | Ga0157369_10071967 | |||
| 1481 | Ga0157369_10148633 | |||
| 1482 | Ga0157369_10158159 | |||
| 1483 | Ga0157369_10217890 | |||
| 1484 | Ga0157369_11636979 | |||
| 1485 | Ga0157369_12106213 | |||
| 1486 | Ga0157369_12198542 | |||
| 1487 | Ga0157374_10436678 | |||
| 1488 | Ga0157374_11409314 | |||
| 1489 | Ga0157378_10005553 | |||
| 1490 | Ga0157378_10767000 | |||
| 1491 | Ga0157378_11248385 | |||
| 1492 | Ga0163162_10015207 | |||
| 1493 | Ga0163162_10020860 | |||
| 1494 | Ga0163162_10170289 | |||
| 1495 | Ga0163162_10397472 | |||
| 1496 | Ga0157372_10022484 | |||
| 1497 | Ga0157372_10075629 | |||
| 1498 | Ga0157372_10127693 | |||
| 1499 | Ga0157372_10141533 | |||
| 1500 | Ga0157372_11788019 | |||
| 1501 | Ga0157375_10265777 | |||
| 1502 | Ga0157375_10343007 | |||
| 1503 | Ga0157375_10440906 | |||
| 1504 | Ga0157375_10707629 | |||
| 1505 | Ga0157375_11189621 | |||
| 1506 | Ga0163163_10054195 | |||
| 1507 | Ga0157380_10011975 | |||
| 1508 | Ga0157377_10046330 | |||
| 1509 | Ga0157377_10260210 | |||
| 1510 | Ga0157377_10460730 | |||
| 1511 | Ga0157376_11238795 | |||
| 1512 | Ga0182007_10013374 | |||
| 1513 | Ga0182007_10407405 | |||
| 1514 | Ga0163161_10303897 | |||
| 1515 | Ga0206356_11074160 | |||
| 1516 | Ga0206354_11242480 | |||
| 1517 | Ga0206354_11632838 | |||
| 1518 | Ga0213876_10010507 | |||
| 1519 | Ga0213876_10082378 | |||
| 1520 | Ga0213876_10535579 | |||
| 1521 | Ga0213876_10722006 | |||
| 1522 | Ga0207697_10000506 | |||
| 1523 | Ga0207656_10003452 | |||
| 1524 | Ga0207656_10293393 | |||
| 1525 | Ga0207656_10565978 | |||
| 1526 | Ga0207682_10204752 | |||
| 1527 | Ga0207682_10363305 | |||
| 1528 | Ga0207692_10208554 | |||
| 1529 | Ga0207692_10364490 | |||
| 1530 | Ga0207692_10589557 | |||
| 1531 | Ga0207680_10228371 | |||
| 1532 | Ga0207680_10932259 | |||
| 1533 | Ga0207699_10024126 | |||
| 1534 | Ga0207699_10100901 | |||
| 1535 | Ga0207699_10179416 | |||
| 1536 | Ga0207699_10514101 | |||
| 1537 | Ga0207699_10947164 | |||
| 1538 | Ga0207645_10000806 | |||
| 1539 | Ga0207645_10328092 | |||
| 1540 | Ga0207645_10477869 | |||
| 1541 | Ga0207643_10008399 | |||
| 1542 | Ga0207643_10050337 | |||
| 1543 | Ga0207705_10191690 | |||
| 1544 | Ga0207705_10369356 | |||
| 1545 | Ga0207705_10628704 | |||
| 1546 | Ga0207705_11166823 | |||
| 1547 | Ga0207705_11476316 | |||
| 1548 | Ga0207684_10333169 | |||
| 1549 | Ga0207654_10471431 | |||
| 1550 | Ga0207707_10000446 | |||
| 1551 | Ga0207707_10011313 | |||
| 1552 | Ga0207707_10038403 | |||
| 1553 | Ga0207707_10098039 | |||
| 1554 | Ga0207707_10099183 | |||
| 1555 | Ga0207707_10112466 | |||
| 1556 | Ga0207707_10173747 | |||
| 1557 | Ga0207707_10202495 | |||
| 1558 | Ga0207707_10242012 | |||
| 1559 | Ga0207707_10267917 | |||
| 1560 | Ga0207707_10430121 | |||
| 1561 | Ga0207707_10509709 | |||
| 1562 | Ga0207707_10524728 | |||
| 1563 | Ga0207707_10618589 | |||
| 1564 | Ga0207707_11423692 | |||
| 1565 | Ga0207695_10007337 | |||
| 1566 | Ga0207695_10017899 | |||
| 1567 | Ga0207695_10045596 | |||
| 1568 | Ga0207695_10083254 | |||
| 1569 | Ga0207695_10986244 | |||
| 1570 | Ga0207695_11511985 | |||
| 1571 | Ga0207671_10181512 | |||
| 1572 | Ga0207693_10013442 | |||
| 1573 | Ga0207693_10017163 | |||
| 1574 | Ga0207693_10025634 | |||
| 1575 | Ga0207693_10053818 | |||
| 1576 | Ga0207693_10100466 | |||
| 1577 | Ga0207693_10154432 | |||
| 1578 | Ga0207693_10269269 | |||
| 1579 | Ga0207663_10120523 | |||
| 1580 | Ga0207663_10134163 | |||
| 1581 | Ga0207663_10202177 | |||
| 1582 | Ga0207660_10021178 | |||
| 1583 | Ga0207660_10028616 | |||
| 1584 | Ga0207660_10029908 | |||
| 1585 | Ga0207660_10097702 | |||
| 1586 | Ga0207660_10177788 | |||
| 1587 | Ga0207660_10257714 | |||
| 1588 | Ga0207660_10954969 | |||
| 1589 | Ga0207660_11352604 | |||
| 1590 | Ga0207660_11711733 | |||
| 1591 | Ga0207662_10006233 | |||
| 1592 | Ga0207662_10009077 | |||
| 1593 | Ga0207657_10010879 | |||
| 1594 | Ga0207657_10020035 | |||
| 1595 | Ga0207657_10088573 | |||
| 1596 | Ga0207657_10730720 | |||
| 1597 | Ga0207657_11373933 | |||
| 1598 | Ga0207649_10003029 | |||
| 1599 | Ga0207649_10127306 | |||
| 1600 | Ga0207649_10173801 | |||
| 1601 | Ga0207649_10230494 | |||
| 1602 | Ga0207649_10559167 | |||
| 1603 | Ga0207649_10598380 | |||
| 1604 | Ga0207652_10001795 | |||
| 1605 | Ga0207652_10014530 | |||
| 1606 | Ga0207652_10017760 | |||
| 1607 | Ga0207652_10060559 | |||
| 1608 | Ga0207652_10162288 | |||
| 1609 | Ga0207652_10168592 | |||
| 1610 | Ga0207652_10271253 | |||
| 1611 | Ga0207652_10283508 | |||
| 1612 | Ga0207652_10344643 | |||
| 1613 | Ga0207652_10436791 | |||
| 1614 | Ga0207652_10455397 | |||
| 1615 | Ga0207652_10472183 | |||
| 1616 | Ga0207652_10536530 | |||
| 1617 | Ga0207652_10893999 | |||
| 1618 | Ga0207652_11144107 | |||
| 1619 | Ga0207652_11212985 | |||
| 1620 | Ga0207652_11304120 | |||
| 1621 | Ga0207652_11398573 | |||
| 1622 | Ga0207681_10014089 | |||
| 1623 | Ga0207681_10381158 | |||
| 1624 | Ga0207681_10412972 | |||
| 1625 | Ga0207681_10939521 | |||
| 1626 | Ga0207694_10020386 | |||
| 1627 | Ga0207694_10297193 | |||
| 1628 | Ga0207694_10330119 | |||
| 1629 | Ga0207694_10816705 | |||
| 1630 | Ga0207650_10038022 | |||
| 1631 | Ga0207650_10053887 | |||
| 1632 | Ga0207650_10287913 | |||
| 1633 | Ga0207650_11253481 | |||
| 1634 | Ga0207659_10008926 | |||
| 1635 | Ga0207659_10093809 | |||
| 1636 | Ga0207659_10115609 | |||
| 1637 | Ga0207659_10286217 | |||
| 1638 | Ga0207659_11045992 | |||
| 1639 | Ga0207700_10001125 | |||
| 1640 | Ga0207700_10014894 | |||
| 1641 | Ga0207700_10018913 | |||
| 1642 | Ga0207700_10027507 | |||
| 1643 | Ga0207700_10138460 | |||
| 1644 | Ga0207700_10178537 | |||
| 1645 | Ga0207700_10434322 | |||
| 1646 | Ga0207700_10982924 | |||
| 1647 | Ga0207664_10003681 | |||
| 1648 | Ga0207664_10027904 | |||
| 1649 | Ga0207664_10157139 | |||
| 1650 | Ga0207664_10199414 | |||
| 1651 | Ga0207664_10366281 | |||
| 1652 | Ga0207664_10385810 | |||
| 1653 | Ga0207664_11514889 | |||
| 1654 | Ga0207644_10108507 | |||
| 1655 | Ga0207690_10037327 | |||
| 1656 | Ga0207690_10040818 | |||
| 1657 | Ga0207690_10271790 | |||
| 1658 | Ga0207690_10309248 | |||
| 1659 | Ga0207690_11311991 | |||
| 1660 | Ga0207706_10000642 | |||
| 1661 | Ga0207706_10029596 | |||
| 1662 | Ga0207706_10054583 | |||
| 1663 | Ga0207706_10110444 | |||
| 1664 | Ga0207686_10238636 | |||
| 1665 | Ga0207686_10290942 | |||
| 1666 | Ga0207686_10361089 | |||
| 1667 | Ga0207709_10042008 | |||
| 1668 | Ga0207709_10340932 | |||
| 1669 | Ga0207670_10153735 | |||
| 1670 | Ga0207670_11225685 | |||
| 1671 | Ga0207669_10401232 | |||
| 1672 | Ga0207704_10444780 | |||
| 1673 | Ga0207704_10508969 | |||
| 1674 | Ga0207665_10580473 | |||
| 1675 | Ga0207691_10001241 | |||
| 1676 | Ga0207691_10040865 | |||
| 1677 | Ga0207691_10041381 | |||
| 1678 | Ga0207691_10042609 | |||
| 1679 | Ga0207691_10138492 | |||
| 1680 | Ga0207691_11024063 | |||
| 1681 | Ga0207711_10190450 | |||
| 1682 | Ga0207711_10203192 | |||
| 1683 | Ga0207711_11133787 | |||
| 1684 | Ga0207689_10003004 | |||
| 1685 | Ga0207689_11054354 | |||
| 1686 | Ga0207689_11650690 | |||
| 1687 | Ga0207661_10023403 | |||
| 1688 | Ga0207661_10078459 | |||
| 1689 | Ga0207661_10084601 | |||
| 1690 | Ga0207661_10087673 | |||
| 1691 | Ga0207661_10096650 | |||
| 1692 | Ga0207661_10099539 | |||
| 1693 | Ga0207661_10103028 | |||
| 1694 | Ga0207661_10108565 | |||
| 1695 | Ga0207661_10148766 | |||
| 1696 | Ga0207661_10161672 | |||
| 1697 | Ga0207661_10239488 | |||
| 1698 | Ga0207661_10246218 | |||
| 1699 | Ga0207661_10281172 | |||
| 1700 | Ga0207661_10283196 | |||
| 1701 | Ga0207661_10308365 | |||
| 1702 | Ga0207661_10588575 | |||
| 1703 | Ga0207661_10608537 | |||
| 1704 | Ga0207661_10709318 | |||
| 1705 | Ga0207679_10000744 | |||
| 1706 | Ga0207679_10002584 | |||
| 1707 | Ga0207679_10025586 | |||
| 1708 | Ga0207679_10053501 | |||
| 1709 | Ga0207679_10130307 | |||
| 1710 | Ga0207679_10146426 | |||
| 1711 | Ga0207679_10149045 | |||
| 1712 | Ga0207679_10166098 | |||
| 1713 | Ga0207679_10422190 | |||
| 1714 | Ga0207679_10773892 | |||
| 1715 | Ga0207679_11098876 | |||
| 1716 | Ga0207667_10041659 | |||
| 1717 | Ga0207667_10081200 | |||
| 1718 | Ga0207667_10159252 | |||
| 1719 | Ga0207667_10463734 | |||
| 1720 | Ga0207667_10478352 | |||
| 1721 | Ga0207667_10709749 | |||
| 1722 | Ga0207667_11176865 | |||
| 1723 | Ga0207667_11279996 | |||
| 1724 | Ga0207667_11637450 | |||
| 1725 | Ga0207651_10023403 | |||
| 1726 | Ga0207651_10419304 | |||
| 1727 | Ga0207651_11044652 | |||
| 1728 | Ga0207651_11154002 | |||
| 1729 | Ga0207651_12148872 | |||
| 1730 | Ga0207712_10013924 | |||
| 1731 | Ga0207712_10100047 | |||
| 1732 | Ga0207712_10949633 | |||
| 1733 | Ga0207668_10123749 | |||
| 1734 | Ga0207668_10130482 | |||
| 1735 | Ga0207640_10155786 | |||
| 1736 | Ga0207640_10237695 | |||
| 1737 | Ga0207658_10045199 | |||
| 1738 | Ga0207677_10413535 | |||
| 1739 | Ga0207677_10587857 | |||
| 1740 | Ga0207703_10822928 | |||
| 1741 | Ga0207639_10013899 | |||
| 1742 | Ga0207639_10227013 | |||
| 1743 | Ga0207678_10095867 | |||
| 1744 | Ga0207678_10343515 | |||
| 1745 | Ga0207678_10604618 | |||
| 1746 | Ga0207678_11039049 | |||
| 1747 | Ga0207708_10017851 | |||
| 1748 | Ga0207708_10488442 | |||
| 1749 | Ga0207702_10006041 | |||
| 1750 | Ga0207702_10321268 | |||
| 1751 | Ga0207702_10369937 | |||
| 1752 | Ga0207702_11242249 | |||
| 1753 | Ga0207702_11728833 | |||
| 1754 | Ga0207641_10342624 | |||
| 1755 | Ga0207641_11914188 | |||
| 1756 | Ga0207641_12394448 | |||
| 1757 | Ga0207648_10007064 | |||
| 1758 | Ga0207648_10079503 | |||
| 1759 | Ga0207648_10124382 | |||
| 1760 | Ga0207648_10495769 | |||
| 1761 | Ga0207676_10441149 | |||
| 1762 | Ga0207676_10643912 | |||
| 1763 | Ga0207676_10909543 | |||
| 1764 | Ga0207674_10000828 | |||
| 1765 | Ga0207674_10002108 | |||
| 1766 | Ga0207674_10020165 | |||
| 1767 | Ga0207674_10682363 | |||
| 1768 | Ga0207674_12151806 | |||
| 1769 | Ga0207675_100002863 | |||
| 1770 | Ga0207675_100011177 | |||
| 1771 | Ga0207675_101343560 | |||
| 1772 | Ga0207683_10348776 | |||
| 1773 | Ga0207683_10500016 | |||
| 1774 | Ga0207698_10053772 | |||
| 1775 | Ga0207698_10120525 | |||
| 1776 | Ga0207698_10246043 | |||
| 1777 | Ga0207698_10622652 | |||
| 1778 | Ga0207428_10046578 | |||
| 1779 | Ga0268266_10782134 | |||
| 1780 | Ga0268266_10870065 | |||
| 1781 | Ga0268266_11075645 | |||
| 1782 | Ga0268266_11540843 | |||
| 1783 | Ga0268265_10006098 | |||
| 1784 | Ga0268265_10017756 | |||
| 1785 | Ga0307408_100002224 | |||
| 1786 | Ga0307408_100087966 | |||
| 1787 | Ga0307408_100105322 | |||
| 1788 | Ga0307408_100346513 | |||
| 1789 | Ga0307405_10107243 | |||
| 1790 | Ga0307405_10608656 | |||
| 1791 | Ga0307413_10885025 | |||
| 1792 | Ga0307413_11483750 | |||
| 1793 | Ga0307406_10114219 | |||
| 1794 | Ga0307406_10645623 | |||
| 1795 | Ga0307406_10767915 | |||
| 1796 | Ga0307406_10848901 | |||
| 1797 | Ga0307412_10016067 | |||
| 1798 | Ga0307412_11149067 | |||
| 1799 | Ga0307409_101561762 | |||
| 1800 | Ga0307409_102683232 | |||
| 1801 | Ga0307416_100002716 | |||
| 1802 | Ga0307416_100247709 | |||
| 1803 | Ga0307416_101450893 | |||
| 1804 | Ga0307416_102315287 | |||
| 1805 | Ga0307416_103818975 | |||
| 1806 | Ga0307414_10464528 | |||
| 1807 | Ga0307414_11789422 | |||
| 1808 | Ga0307411_10600007 | |||
| 1809 | Ga0307411_10934185 | |||
| 1810 | Ga0307411_11822931 | |||
| 1811 | Ga0373926_0349372 | |||
| 1812 | Ga0373934_0001697 | |||
| 1813 | Ga0373934_0010899 | |||
| 1814 | Ga0373944_0013225 | |||
| 1815 | Ga0373944_0221338 | |||
| 1816 | Ga0373923_0080629 | |||
| 1817 | Ga0373954_0030416 | |||
| 1818 | Ga0373954_0107995 | |||
| 1819 | Ga0373956_0247527 | |||
| 1820 | Ga0373957_0052445 | |||
| 1821 | Ga0373943_0007622 | |||
| 1822 | Ga0373943_0099213 | |||
| 1823 | Ga0373943_0189246 | |||
| 1824 | Ga0373946_0005526 | |||
| 1825 | Ga0373955_0001562 | |||
| 1826 | Ga0373955_0003382 | |||
| 1827 | Ga0373961_0022669 | |||
| 1828 | Ga0373924_0039793 | |||
| 1829 | Ga0373924_0134466 | |||
| 1830 | Ga0373924_0460907 | |||
| 1831 | Ga0373935_0019593 | |||
| 1832 | Ga0373935_0056589 | |||
| 1833 | Ga0373927_0016665 | |||
| 1834 | Ga0373927_0034129 | |||
| 1835 | Ga0373927_0142390 | |||
| 1836 | Ga0373933_0024987 | |||
| 1837 | Ga0373933_0117735 | |||
| 1838 | Ga0373933_0161066 | |||
| 1839 | Ga0373947_0037105 | |||
| 1840 | Ga0373947_0071903 | |||
| 1841 | Ga0373947_0181577 | |||
| 1842 | Ga0373947_0585307 | |||
| 1843 | Ga0373947_0735980 | |||
| 1844 | Ga0373937_0000184 | |||
| 1845 | Ga0373937_0016269 | |||
| 1846 | Ga0373937_0297348 | |||
| 1847 | Ga0373937_1765512 | |||
| 1848 | Ga0373925_0023122 | |||
| 1849 | Ga0373925_0104496 | |||
| 1850 | Ga0373925_0141404 | |||
| 1851 | Ga0395905_0375727 | |||
| 1852 | Ga0395905_1238046 | |||
| 1853 | Ga0436365_0192547 | |||
| 1854 | Ga0436365_0580076 | |||
| 1855 | Ga0436365_0610992 | |||
| 1856 | Ga0436365_0785923 | |||
| 1857 | Ga0436365_1666798 | |||
| 1858 | Ga0439436_0161934 | |||
| 1859 | Ga0439439_0026870 | |||
| 1860 | Ga0451807_2041370 | |||
| 1861 | Ga0439448_0271018 | |||
| 1862 | Ga0439449_0124874 | |||
| 1863 | Ga0439462_0146272 | |||
| 1864 | Ga0466963_0152403 | |||
| 1865 | Ga0466963_0293161 | |||
| 1866 | Ga0466957_0162900 | |||
| 1867 | Ga0466957_0295250 | |||
| 1868 | Ga0466957_0599814 | |||
| 1869 | Ga0451576_0098807 | |||
| 1870 | Ga0451576_0152519 | |||
| 1871 | Ga0451576_0948262 | |||
| 1872 | Ga0451576_1270974 | |||
| 1873 | Ga0466958_0118811 | |||
| 1874 | Ga0466958_1119814 | |||
| 1875 | Ga0466967_0014965 | |||
| 1876 | Ga0466967_0024085 | |||
| 1877 | Ga0466967_0078180 | |||
| 1878 | Ga0466967_0080702 | |||
| 1879 | Ga0466967_0356512 | |||
| 1880 | Ga0466967_0373740 | |||
| 1881 | Ga0466967_0404128 | |||
| 1882 | Ga0466967_0471671 | |||
| 1883 | Ga0466967_0535564 | |||
| 1884 | Ga0466967_0547852 | |||
| 1885 | Ga0466967_0631105 | |||
| 1886 | Ga0466967_0661224 | |||
| 1887 | Ga0466967_0672006 | |||
| 1888 | Ga0466967_0720133 | |||
| 1889 | Ga0466967_1449451 | |||
| 1890 | Ga0495603_0006890 | |||
| 1891 | Ga0495629_0045141 | |||
| 1892 | Ga0495629_0186267 | |||
| 1893 | Ga0495638_0215828 | |||
| 1894 | Ga0495651_0027216 | |||
| 1895 | Ga0495651_0036250 | |||
| 1896 | Ga0495653_0044983 | |||
| 1897 | Ga0495580_0003643 | |||
| 1898 | Ga0495580_0238343 | |||
| 1899 | Ga0495580_0283508 | |||
| 1900 | Ga0495580_0481574 | |||
| 1901 | Ga0495582_0017540 | |||
| 1902 | Ga0495582_0024867 | |||
| 1903 | Ga0495639_0000731 | |||
| 1904 | Ga0495639_0009668 | |||
| 1905 | Ga0495639_0043467 | |||
| 1906 | Ga0495639_0101210 | |||
| 1907 | Ga0495662_0281176 | |||
| 1908 | Ga0495664_0031121 | |||
| 1909 | Ga0495664_0205531 | |||
| 1910 | Ga0495594_0003763 | |||
| 1911 | Ga0495594_0004014 | |||
| 1912 | Ga0495594_0012370 | |||
| 1913 | Ga0495594_0088601 | |||
| 1914 | Ga0495594_0106248 | |||
| 1915 | Ga0495594_0325817 | |||
| 1916 | Ga0495594_0870808 | |||
| 1917 | Ga0495608_0153348 | |||
| 1918 | Ga0495618_0017804 | |||
| 1919 | Ga0495630_0016699 | |||
| 1920 | Ga0495630_0068286 | |||
| 1921 | Ga0495630_0506393 | |||
| 1922 | Ga0495630_0731782 | |||
| 1923 | Ga0495652_0008474 | |||
| 1924 | Ga0495665_0000680 | |||
| 1925 | Ga0495665_0035992 | |||
| 1926 | Ga0495586_0014535 | |||
| 1927 | Ga0495586_0193553 | |||
| 1928 | Ga0495587_0007425 | |||
| 1929 | Ga0495587_0012777 | |||
| 1930 | Ga0495645_0000075 | |||
| 1931 | Ga0495645_0004610 | |||
| 1932 | Ga0495645_0580067 | |||
| 1933 | Ga0495667_0148328 | |||
| 1934 | Ga0495667_0234221 | |||
| 1935 | Ga0495667_0302228 | |||
| 1936 | Ga0495625_0006357 | |||
| 1937 | Ga0495625_0569452 | |||
| 1938 | Ga0495635_0633480 | |||
| 1939 | Ga0495659_0144161 | |||
| 1940 | Ga0495588_0001797 | |||
| 1941 | Ga0495657_0144402 | |||
| 1942 | Ga0495599_0022381 | |||
| 1943 | Ga0495599_0031228 | |||
| 1944 | Ga0495623_0002632 | |||
| 1945 | Ga0495623_0093284 | |||
| 1946 | Ga0495623_0138721 | |||
| 1947 | Ga0495658_0001809 | |||
| 1948 | Ga0495658_0694404 | |||
| 1949 | Ga0495613_0035559 | |||
| 1950 | Ga0495613_0230752 | |||
| 1951 | Ga0495613_0650279 | |||
| 1952 | Ga0495600_0058838 | |||
| 1953 | Ga0495600_0120213 | |||
| 1954 | Ga0495581_0000907 | |||
| 1955 | Ga0495581_0120499 | |||
| 1956 | Ga0495581_0490531 | |||
| 1957 | Ga0495604_0011842 | |||
| 1958 | Ga0495636_0205372 | |||
| 1959 | Ga0495636_0418441 | |||
| 1960 | Ga0495674_0209886 | |||
| 1961 | Ga0495674_1033563 | |||
| 1962 | Ga0495672_0001955 | |||
| 1963 | Ga0495675_0005109 | |||
| 1964 | Ga0495675_0018536 | |||
| 1965 | Ga0495684_0004467 | |||
| 1966 | Ga0495684_0174478 | |||
| 1967 | Ga0495593_0002611 | |||
| 1968 | Ga0495602_0048052 | |||
| 1969 | Ga0495602_0147100 | |||
| 1970 | Ga0495602_0252177 | |||
| 1971 | Ga0495602_0890459 | |||
| 1972 | Ga0495614_0006061 | |||
| 1973 | Ga0496102_1336613 | |||
| 1974 | Ga0496105_0114376 | |||
| 1975 | Ga0496108_0607502 | |||
| 1976 | Ga0496109_0339335 | |||
| 1977 | Ga0496115_0937963 | |||
| 1978 | Ga0501290_083955 | |||
| 1979 | Ga0501298_047944 | |||
| 1980 | Ga0501033_1015968 | |||
| 1981 | Ga0501034_0168396 | |||
| 1982 | Ga0501039_1056364 | |||
| 1983 | Ga0501040_0551428 | |||
| 1984 | Ga0501047_0115202 | |||
| 1985 | Ga0501069_1026590 | |||
| 1986 | Ga0501070_0052614 | |||
| 1987 | Ga0501070_0576572 | |||
| 1988 | Ga0501072_1043675 | |||
| 1989 | Ga0501073_0322990 | |||
| 1990 | Ga0501076_0934055 | |||
| 1991 | Ga0501207_146930 | |||
| 1992 | Ga0501256_017387 | |||
| 1993 | Ga0501225_0061625 | |||
| 1994 | Ga0501234_091493 | |||
| 1995 | Ga0501080_0573122 | |||
| 1996 | Ga0501263_010679 | |||
| 1997 | Ga0501035_1298108 | |||
| 1998 | Ga0501044_1161278 | |||
| 1999 | nmdc:mga05p37_1431_c1 | |||
| 2000 | nmdc:mga05p37_216172_c1 | |||
| 2001 | nmdc:mga05p37_28300_c1 | |||
| 2002 | nmdc:mga05p37_558227_c1 | |||
| 2003 | nmdc:mga09592_1045006_c1 | |||
| 2004 | nmdc:mga09592_11847_c1 | |||
| 2005 | nmdc:mga09592_17358_c1 | |||
| 2006 | nmdc:mga09592_17584_c1 | |||
| 2007 | nmdc:mga09592_966359_c1 | |||
| 2008 | nmdc:mga0qj67_135767_c1 | |||
| 2009 | nmdc:mga0qj67_1486765_c1 | |||
| 2010 | nmdc:mga0qj67_161573_c1 | |||
| 2011 | nmdc:mga0qj67_2379_c1 | |||
| 2012 | nmdc:mga0qj67_9693_c1 | |||
| 2013 | nmdc:mga06r32_12948_c1 | |||
| 2014 | nmdc:mga06r32_13823_c1 | |||
| 2015 | nmdc:mga06r32_1868115_c1 | |||
| 2016 | nmdc:mga06r32_23989_c1 | |||
| 2017 | nmdc:mga06r32_82916_c1 | |||
| 2018 | nmdc:mga06r32_978106_c1 | |||
| 2019 | nmdc:mga08y16_236469_c1 | |||
| 2020 | nmdc:mga08y16_311992_c1 | |||
| 2021 | nmdc:mga08y16_44448_c1 | |||
| 2022 | nmdc:mga08y16_68779_c1 | |||
| 2023 | nmdc:mga0n895_1381229_c1 | |||
| 2024 | nmdc:mga0n895_1479396_c1 | |||
| 2025 | nmdc:mga0n895_160169_c1 | |||
| 2026 | nmdc:mga0n895_192475_c1 | |||
| 2027 | nmdc:mga0n895_210785_c1 | |||
| 2028 | nmdc:mga0n895_392074_c1 | |||
| 2029 | nmdc:mga0rr50_1382001_c1 | |||
| 2030 | nmdc:mga0rr50_1418959_c1 | |||
| 2031 | nmdc:mga08x19_265991_c1 | |||
| 2032 | nmdc:mga08x19_689832_c1 | |||
| 2033 | nmdc:mga0a205_11822_c1 | |||
| 2034 | nmdc:mga0a205_164972_c1 | |||
| 2035 | nmdc:mga0a205_28356_c1 | |||
| 2036 | Ga0495601_0229170 | |||
| 2037 | Ga0495601_0890823 | |||
| 2038 | Ga0495612_0017223 | |||
| 2039 | Ga0495595_0046497 | |||
| 2040 | Ga0495595_0509707 | |||
| 2041 | Ga0495619_0080505 | |||
| 2042 | Ga0495619_0715101 | |||
| 2043 | Ga0466962_0618871 | |||
| 2044 | Ga0530510_0329264 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xma-assembly1.cif.gz_B-2 | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9075 | 10 | 104 |
| 3hhh-assembly1.cif.gz_B | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.9016 | 9 | 107 |
| 1xma-assembly1.cif.gz_A | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.8994 | 10 | 104 |
| 6abq-assembly1.cif.gz_A | crystal structure of transcription factor from listeria monocytogenes | 0.8967 | 9 | 105 |
| 3hhh-assembly1.cif.gz_A | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.884 | 9 | 108 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xmaA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8994 | 10 | 104 | 1.10.10.10 |
| af_Q2FUS4_1_110_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8787 | 10 | 113 | 1.10.10.10 |
| 2p4wB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8664 | 11 | 82 | 1.10.10.10 |
| af_Q57682_5_95_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8655 | 9 | 82 | 1.10.10.10 |
| af_Q9SU39_105_239_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8578 | 65 | 80 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8EA09-F1-model_v4 | PadR family transcriptional regulator | 1.002 | 11 | 88 |
|
| AF-A0A1F2TUG0-F1-model_v4 | PadR family transcriptional regulator | 0.9953 | 11 | 109 |
|
| AF-A0A843TB24-F1-model_v4 | PadR family transcriptional regulator | 0.9909 | 11 | 109 |
|
| AF-A0A2N9MU15-F1-model_v4 | Transcriptional regulator, PadR family | 0.9908 | 16 | 107 |
|
| AF-E8V6A6-F1-model_v4 | Transcriptional regulator, PadR-like family | 0.9894 | 9 | 111 |
|