F488416

General Info

Members Datasets Scaffolds Average Seq Length
1022 307 2044 113

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10367598|Ga0207661_103675982
Length 135
Sequence MGQTPHGATDTRRARARNHNIMAESNIEVLRGTLDLLILKAVSWGPTHGYGVARWIEQATNDVLRIEEGSLYPALHRLETRGWIESDWGTSENNRRAKFYTLTPKGRAQLRLEAATFTRFAHAVFAALDAPPQPS

Samples

Sample ID Description Type Environment
1 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
198 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
199 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
200 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
202 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
203 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
208 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
218 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
219 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
220 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
221 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
222 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
223 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
237 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
238 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
239 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
240 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
244 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
251 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
252 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
253 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
254 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
255 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
258 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
259 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
260 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
261 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
262 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
263 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
264 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
265 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
266 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
267 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
274 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
275 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
281 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
282 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
283 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
284 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
285 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
286 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
287 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
288 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
300 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
301 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
302 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
303 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
304 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
305 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
306 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
307 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.59
Rhizosphere 98.53
Stem 0
Stem Tuber 0
Unclassified 22.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207661_10367598 3300025944 Bacteria 1300
2 JGI25406J46586_10030228 3300003203 Unclassified 2041
3 Ga0058863_10087649 3300004799 Unclassified 1579
4 Ga0058863_11454414 3300004799 Bacteria 522
5 Ga0065712_10313715 3300005290 Bacteria 833
6 Ga0065707_10294286 3300005295 Bacteria 1018
7 Ga0065707_10595419 3300005295 Unclassified 693
8 Ga0070658_10010790 3300005327 Bacteria 7323
9 Ga0070658_10341340 3300005327 Bacteria 1281
10 Ga0070658_11080453 3300005327 Bacteria 698
11 Ga0070658_11205615 3300005327 Bacteria 658
12 Ga0070676_10129169 3300005328 Unclassified 1596
13 Ga0070676_10649517 3300005328 Unclassified 766
14 Ga0070683_100006898 3300005329 Bacteria 9544
15 Ga0070683_100013364 3300005329 Bacteria 7158
16 Ga0070683_100028508 3300005329 Bacteria 5046
17 Ga0070683_100067932 3300005329 Bacteria 3320
18 Ga0070683_100078687 3300005329 Unclassified 3085
19 Ga0070683_100125677 3300005329 Bacteria 2424
20 Ga0070683_100179633 3300005329 Bacteria 2009
21 Ga0070683_100295346 3300005329 Bacteria 1541
22 Ga0070683_100308417 3300005329 Bacteria 1506
23 Ga0070683_100513154 3300005329 Bacteria 1145
24 Ga0070683_100592153 3300005329 Bacteria 1061
25 Ga0070683_101418132 3300005329 Unclassified 668
26 Ga0070683_101592471 3300005329 Unclassified 628
27 Ga0070690_100005775 3300005330 Bacteria 6972
28 Ga0070690_100433137 3300005330 Bacteria 972
29 Ga0070670_100025103 3300005331 Bacteria 5128
30 Ga0070670_100050294 3300005331 Bacteria 3582
31 Ga0070670_100058848 3300005331 Unclassified 3298
32 Ga0070670_100224888 3300005331 Bacteria 1633
33 Ga0070670_100272993 3300005331 Bacteria 1476
34 Ga0070670_101483055 3300005331 Bacteria 623
35 Ga0070677_10181730 3300005333 Bacteria 1002
36 Ga0070677_10229749 3300005333 Bacteria 911
37 Ga0070677_10468222 3300005333 Bacteria 677
38 Ga0068869_100003430 3300005334 Bacteria 9692
39 Ga0068869_100461187 3300005334 Unclassified 1055
40 Ga0068869_102138405 3300005334 Unclassified 503
41 Ga0070666_10141959 3300005335 Bacteria 1673
42 Ga0070666_10260906 3300005335 Bacteria 1228
43 Ga0070680_100000749 3300005336 Bacteria 22682
44 Ga0070680_100003399 3300005336 Bacteria 11884
45 Ga0070680_100028122 3300005336 Bacteria 4509
46 Ga0070680_100040334 3300005336 Unclassified 3780
47 Ga0070680_100062167 3300005336 Bacteria 3057
48 Ga0070680_100063923 3300005336 Bacteria 3016
49 Ga0070680_100066325 3300005336 Bacteria 2959
50 Ga0070680_100092938 3300005336 Bacteria 2499
51 Ga0070680_100171540 3300005336 Unclassified 1825
52 Ga0070680_100197753 3300005336 Unclassified 1695
53 Ga0070680_101000420 3300005336 Bacteria 722
54 Ga0070680_101559729 3300005336 Unclassified 572
55 Ga0070682_100698145 3300005337 Unclassified 813
56 Ga0068868_100246442 3300005338 Bacteria 1503
57 Ga0068868_100255911 3300005338 Unclassified 1475
58 Ga0068868_100643899 3300005338 Bacteria 943
59 Ga0068868_101108201 3300005338 Unclassified 729
60 Ga0070660_100268148 3300005339 Bacteria 1395
61 Ga0070660_100870442 3300005339 Bacteria 759
62 Ga0070689_100067299 3300005340 Unclassified 2792
63 Ga0070689_100088157 3300005340 Bacteria 2442
64 Ga0070689_100168275 3300005340 Bacteria 1775
65 Ga0070687_100130169 3300005343 Bacteria 1452
66 Ga0070687_100161622 3300005343 Bacteria 1324
67 Ga0070661_100001820 3300005344 Bacteria 14771
68 Ga0070661_100002751 3300005344 Bacteria 12060
69 Ga0070661_100010478 3300005344 Bacteria 6450
70 Ga0070661_100025342 3300005344 Bacteria 4261
71 Ga0070661_100504859 3300005344 Unclassified 968
72 Ga0070661_100921819 3300005344 Bacteria 722
73 Ga0070692_10184407 3300005345 Bacteria 1212
74 Ga0070668_100057860 3300005347 Bacteria 2998
75 Ga0070668_100092072 3300005347 Bacteria 2391
76 Ga0070668_101027405 3300005347 Unclassified 742
77 Ga0070669_100007489 3300005353 Bacteria 7817
78 Ga0070669_100117027 3300005353 Bacteria 2029
79 Ga0070669_100360635 3300005353 Unclassified 1182
80 Ga0070669_100956156 3300005353 Unclassified 733
81 Ga0070669_101075536 3300005353 Unclassified 692
82 Ga0070675_100006208 3300005354 Bacteria 9167
83 Ga0070675_100012350 3300005354 Bacteria 6695
84 Ga0070675_100046085 3300005354 Bacteria 3569
85 Ga0070675_100135415 3300005354 Bacteria 2102
86 Ga0070675_100447298 3300005354 Bacteria 1158
87 Ga0070675_100503806 3300005354 Bacteria 1091
88 Ga0070675_100847229 3300005354 Unclassified 836
89 Ga0070671_100508370 3300005355 Unclassified 1037
90 Ga0070671_100871595 3300005355 Unclassified 786
91 Ga0070674_100136745 3300005356 Bacteria 1834
92 Ga0070674_100178410 3300005356 Bacteria 1625
93 Ga0070674_100811164 3300005356 Unclassified 809
94 Ga0070674_100916670 3300005356 Bacteria 764
95 Ga0070673_100060185 3300005364 Bacteria 3008
96 Ga0070673_100118501 3300005364 Bacteria 2204
97 Ga0070673_100166506 3300005364 Unclassified 1879
98 Ga0070673_100292148 3300005364 Bacteria 1433
99 Ga0070673_100317143 3300005364 Bacteria 1376
100 Ga0070673_100769122 3300005364 Unclassified 888
101 Ga0070673_101425127 3300005364 Unclassified 652
102 Ga0070688_100002762 3300005365 Bacteria 8918
103 Ga0070688_100100467 3300005365 Bacteria 1906
104 Ga0070688_101097112 3300005365 Bacteria 636
105 Ga0070659_100118519 3300005366 Bacteria 2141
106 Ga0070659_100381081 3300005366 Bacteria 1188
107 Ga0070659_100851884 3300005366 Bacteria 795
108 Ga0070659_100972909 3300005366 Unclassified 744
109 Ga0070667_100083063 3300005367 Unclassified 2743
110 Ga0070667_100753521 3300005367 Unclassified 903
111 Ga0070667_100824556 3300005367 Archaea 862
112 Ga0070667_100854793 3300005367 Bacteria 846
113 Ga0070709_10012828 3300005434 Bacteria 4698
114 Ga0070709_10190794 3300005434 Unclassified 1445
115 Ga0070709_10270524 3300005434 Bacteria 1231
116 Ga0070709_11700210 3300005434 Unclassified 515
117 Ga0070714_100007410 3300005435 Bacteria 8539
118 Ga0070714_100050532 3300005435 Bacteria 3542
119 Ga0070714_100209149 3300005435 Bacteria 1788
120 Ga0070714_100225606 3300005435 Bacteria 1724
121 Ga0070714_100579649 3300005435 Bacteria 1076
122 Ga0070713_100000077 3300005436 Bacteria 61320
123 Ga0070713_100008338 3300005436 Bacteria 7350
124 Ga0070713_100019682 3300005436 Bacteria 5161
125 Ga0070713_100033238 3300005436 Bacteria 4129
126 Ga0070713_100073801 3300005436 Unclassified 2889
127 Ga0070713_100150125 3300005436 Unclassified 2072
128 Ga0070713_100464772 3300005436 Bacteria 1190
129 Ga0070710_10119384 3300005437 Bacteria 1594
130 Ga0070710_10450882 3300005437 Bacteria 872
131 Ga0070710_10792978 3300005437 Bacteria 676
132 Ga0070710_11147050 3300005437 Unclassified 572
133 Ga0070701_10263236 3300005438 Unclassified 1046
134 Ga0070701_10274677 3300005438 Bacteria 1027
135 Ga0070701_11115861 3300005438 Bacteria 556
136 Ga0070711_100170110 3300005439 Bacteria 1660
137 Ga0070711_100196432 3300005439 Unclassified 1554
138 Ga0070711_100234106 3300005439 Bacteria 1433
139 Ga0070711_100428086 3300005439 Bacteria 1080
140 Ga0070711_100444953 3300005439 Bacteria 1060
141 Ga0070711_100753841 3300005439 Bacteria 823
142 Ga0070711_101492402 3300005439 Bacteria 590
143 Ga0070705_100570239 3300005440 Bacteria 871
144 Ga0070700_100011966 3300005441 Bacteria 4821
145 Ga0070700_100019793 3300005441 Unclassified 3889
146 Ga0070700_100145114 3300005441 Bacteria 1617
147 Ga0070694_100284145 3300005444 Bacteria 1262
148 Ga0070694_101250593 3300005444 Unclassified 623
149 Ga0070708_100000934 3300005445 Bacteria 22111
150 Ga0070663_100096428 3300005455 Bacteria 2200
151 Ga0070663_100689775 3300005455 Bacteria 867
152 Ga0070678_100174446 3300005456 Bacteria 1754
153 Ga0070678_100339093 3300005456 Bacteria 1289
154 Ga0070678_101250641 3300005456 Bacteria 690
155 Ga0070662_100074738 3300005457 Bacteria 2508
156 Ga0070662_100213078 3300005457 Bacteria 1538
157 Ga0070662_100712729 3300005457 Unclassified 849
158 Ga0070681_10000280 3300005458 Bacteria 40938
159 Ga0070681_10000406 3300005458 Bacteria 35010
160 Ga0070681_10009743 3300005458 Bacteria 9454
161 Ga0070681_10032579 3300005458 Bacteria 5231
162 Ga0070681_10038378 3300005458 Bacteria 4802
163 Ga0070681_10040451 3300005458 Bacteria 4671
164 Ga0070681_10041097 3300005458 Bacteria 4633
165 Ga0070681_10064816 3300005458 Bacteria 3623
166 Ga0070681_10072491 3300005458 Bacteria 3407
167 Ga0070681_10091167 3300005458 Bacteria 2998
168 Ga0070681_10158704 3300005458 Bacteria 2186
169 Ga0070681_10176877 3300005458 Bacteria 2056
170 Ga0070681_10392815 3300005458 Bacteria 1298
171 Ga0070681_10442061 3300005458 Archaea 1212
172 Ga0070681_10504194 3300005458 Bacteria 1123
173 Ga0070681_10616242 3300005458 Bacteria 1000
174 Ga0070681_10696225 3300005458 Unclassified 932
175 Ga0070681_11997294 3300005458 Bacteria 508
176 Ga0068867_100128867 3300005459 Bacteria 1964
177 Ga0068867_100179317 3300005459 Bacteria 1683
178 Ga0068867_101286154 3300005459 Bacteria 675
179 Ga0068867_101302581 3300005459 Unclassified 671
180 Ga0070685_10062955 3300005466 Bacteria 2176
181 Ga0070685_10300980 3300005466 Unclassified 1081
182 Ga0070685_10505222 3300005466 Unclassified 856
183 Ga0070706_100052359 3300005467 Bacteria 3768
184 Ga0070706_100091815 3300005467 Bacteria 2817
185 Ga0070706_100288072 3300005467 Bacteria 1533
186 Ga0070707_100922193 3300005468 Bacteria 838
187 Ga0070707_101718655 3300005468 Bacteria 595
188 Ga0070698_100242098 3300005471 Bacteria 1737
189 Ga0070698_100455068 3300005471 Bacteria 1216
190 Ga0070698_100556329 3300005471 Unclassified 1087
191 Ga0070698_100690245 3300005471 Bacteria 963
192 Ga0070698_101089655 3300005471 Unclassified 747
193 Ga0070699_100188932 3300005518 Bacteria 1829
194 Ga0070699_101991013 3300005518 Bacteria 531
195 Ga0070679_100000050 3300005530 Bacteria 88045
196 Ga0070679_100001297 3300005530 Bacteria 22069
197 Ga0070679_100008346 3300005530 Bacteria 9745
198 Ga0070679_100014843 3300005530 Bacteria 7483
199 Ga0070679_100032831 3300005530 Bacteria 5137
200 Ga0070679_100045977 3300005530 Bacteria 4350
201 Ga0070679_100076976 3300005530 Bacteria 3324
202 Ga0070679_100090912 3300005530 Bacteria 3040
203 Ga0070679_100102096 3300005530 Unclassified 2854
204 Ga0070679_100118269 3300005530 Bacteria 2635
205 Ga0070679_100122057 3300005530 Bacteria 2590
206 Ga0070679_100140255 3300005530 Bacteria 2397
207 Ga0070679_100309069 3300005530 Bacteria 1531
208 Ga0070679_100332827 3300005530 Unclassified 1467
209 Ga0070679_100594343 3300005530 Bacteria 1050
210 Ga0070679_100833231 3300005530 Archaea 866
211 Ga0070679_100862402 3300005530 Bacteria 849
212 Ga0070679_101629038 3300005530 Bacteria 593
213 Ga0070679_101775669 3300005530 Unclassified 565
214 Ga0070679_101918940 3300005530 Bacteria 541
215 Ga0070684_100003048 3300005535 Bacteria 12502
216 Ga0070684_100008393 3300005535 Bacteria 8070
217 Ga0070684_100014182 3300005535 Bacteria 6446
218 Ga0070684_100014419 3300005535 Bacteria 6404
219 Ga0070684_100017321 3300005535 Bacteria 5911
220 Ga0070684_100019213 3300005535 Bacteria 5650
221 Ga0070684_100037417 3300005535 Unclassified 4162
222 Ga0070684_100038842 3300005535 Bacteria 4091
223 Ga0070684_100044798 3300005535 Bacteria 3828
224 Ga0070684_100272863 3300005535 Bacteria 1548
225 Ga0070684_100286511 3300005535 Bacteria 1510
226 Ga0070684_100309777 3300005535 Unclassified 1450
227 Ga0070684_100892560 3300005535 Bacteria 833
228 Ga0070684_102001008 3300005535 Unclassified 547
229 Ga0068853_100048699 3300005539 Bacteria 3641
230 Ga0068853_100061378 3300005539 Bacteria 3251
231 Ga0068853_100077950 3300005539 Bacteria 2895
232 Ga0068853_100871807 3300005539 Bacteria 864
233 Ga0070672_100031677 3300005543 Unclassified 3983
234 Ga0070672_100071110 3300005543 Bacteria 2767
235 Ga0070672_100297311 3300005543 Bacteria 1368
236 Ga0070672_100463339 3300005543 Bacteria 1093
237 Ga0070672_101567541 3300005543 Bacteria 591
238 Ga0070686_100037447 3300005544 Bacteria 3009
239 Ga0070686_100083027 3300005544 Unclassified 2126
240 Ga0070686_101908759 3300005544 Unclassified 507
241 Ga0070695_100271647 3300005545 Bacteria 1242
242 Ga0070695_100407931 3300005545 Bacteria 1032
243 Ga0070696_100720327 3300005546 Archaea 815
244 Ga0070696_101736154 3300005546 Unclassified 538
245 Ga0070693_100002797 3300005547 Bacteria 8026
246 Ga0070693_100005203 3300005547 Bacteria 6227
247 Ga0070693_100007963 3300005547 Bacteria 5201
248 Ga0070693_100010709 3300005547 Bacteria 4598
249 Ga0070693_100291981 3300005547 Unclassified 1096
250 Ga0070693_100854175 3300005547 Unclassified 679
251 Ga0070693_101036093 3300005547 Bacteria 623
252 Ga0070665_100040007 3300005548 Bacteria 4713
253 Ga0070665_100314424 3300005548 Bacteria 1570
254 Ga0070665_100368284 3300005548 Bacteria 1444
255 Ga0070665_100534961 3300005548 Bacteria 1184
256 Ga0070665_101050726 3300005548 Unclassified 826
257 Ga0070665_101723190 3300005548 Unclassified 634
258 Ga0068855_100049051 3300005563 Unclassified 4981
259 Ga0068855_100080116 3300005563 Unclassified 3787
260 Ga0068855_100138498 3300005563 Bacteria 2775
261 Ga0068855_100237479 3300005563 Bacteria 2038
262 Ga0068855_100250129 3300005563 Unclassified 1977
263 Ga0068855_100630372 3300005563 Bacteria 1153
264 Ga0068855_100639244 3300005563 Bacteria 1144
265 Ga0068855_100656950 3300005563 Bacteria 1125
266 Ga0068855_100681980 3300005563 Bacteria 1101
267 Ga0068855_100881508 3300005563 Unclassified 946
268 Ga0068855_101079270 3300005563 Bacteria 840
269 Ga0070664_100002346 3300005564 Bacteria 15208
270 Ga0070664_100002527 3300005564 Bacteria 14753
271 Ga0070664_100033645 3300005564 Unclassified 4295
272 Ga0070664_100090618 3300005564 Bacteria 2646
273 Ga0070664_100323642 3300005564 Bacteria 1397
274 Ga0070664_100505776 3300005564 Bacteria 1114
275 Ga0070664_100951559 3300005564 Unclassified 806
276 Ga0070664_102366244 3300005564 Bacteria 504
277 Ga0068857_100022416 3300005577 Bacteria 5556
278 Ga0068857_101272020 3300005577 Unclassified 713
279 Ga0068857_102009358 3300005577 Bacteria 567
280 Ga0068857_102142235 3300005577 Unclassified 549
281 Ga0068854_100232210 3300005578 Bacteria 1465
282 Ga0068854_100269362 3300005578 Bacteria 1367
283 Ga0068856_100007031 3300005614 Bacteria 10995
284 Ga0068856_100163140 3300005614 Bacteria 2240
285 Ga0068856_100496640 3300005614 Bacteria 1241
286 Ga0068856_100546526 3300005614 Bacteria 1179
287 Ga0068856_100717614 3300005614 Unclassified 1020
288 Ga0068852_100045760 3300005616 Bacteria 3724
289 Ga0068852_100061292 3300005616 Bacteria 3269
290 Ga0068852_100078166 3300005616 Bacteria 2927
291 Ga0068852_101082241 3300005616 Unclassified 822
292 Ga0068852_101214337 3300005616 Bacteria 775
293 Ga0068852_101688015 3300005616 Unclassified 656
294 Ga0068859_101205856 3300005617 Unclassified 834
295 Ga0068859_102386584 3300005617 Bacteria 583
296 Ga0068864_100058413 3300005618 Bacteria 3334
297 Ga0068864_100411253 3300005618 Bacteria 1287
298 Ga0068864_100951989 3300005618 Bacteria 850
299 Ga0068866_10361405 3300005718 Bacteria 925
300 Ga0068861_100036790 3300005719 Bacteria 3636
301 Ga0068861_102480388 3300005719 Unclassified 522
302 Ga0068851_10639616 3300005834 Unclassified 650
303 Ga0068870_10029221 3300005840 Bacteria 2774
304 Ga0068870_10106624 3300005840 Bacteria 1593
305 Ga0068863_100030428 3300005841 Bacteria 5155
306 Ga0068863_100900860 3300005841 Bacteria 885
307 Ga0068863_101174598 3300005841 Bacteria 773
308 Ga0068863_101293589 3300005841 Bacteria 736
309 Ga0068858_100244182 3300005842 Unclassified 1704
310 Ga0068858_101407195 3300005842 Unclassified 687
311 Ga0068860_100248869 3300005843 Bacteria 1730
312 Ga0068862_100022990 3300005844 Bacteria 5220
313 Ga0068862_100031505 3300005844 Bacteria 4477
314 Ga0068862_100075164 3300005844 Bacteria 2921
315 Ga0068862_100557271 3300005844 Bacteria 1095
316 Ga0068862_101532996 3300005844 Unclassified 672
317 Ga0081455_10059993 3300005937 Bacteria 3209
318 Ga0081455_10119850 3300005937 Unclassified 2074
319 Ga0081455_10247724 3300005937 Bacteria 1305
320 Ga0081539_10003628 3300005985 Bacteria 18591
321 Ga0070717_10018971 3300006028 Bacteria 5385
322 Ga0070717_10088017 3300006028 Unclassified 2617
323 Ga0070717_10098345 3300006028 Bacteria 2481
324 Ga0070717_10100307 3300006028 Bacteria 2458
325 Ga0070717_10327371 3300006028 Bacteria 1366
326 Ga0070717_10440026 3300006028 Unclassified 1174
327 Ga0075432_10086604 3300006058 Unclassified 1142
328 Ga0070716_101099883 3300006173 Bacteria 634
329 Ga0070712_100001780 3300006175 Bacteria 13184
330 Ga0070712_100031074 3300006175 Unclassified 3595
331 Ga0070712_100072837 3300006175 Bacteria 2462
332 Ga0070712_100102354 3300006175 Bacteria 2121
333 Ga0070712_100270157 3300006175 Bacteria 1366
334 Ga0070712_100399726 3300006175 Bacteria 1135
335 Ga0097621_100330773 3300006237 Bacteria 1351
336 Ga0097621_101154143 3300006237 Unclassified 729
337 Ga0097621_101430884 3300006237 Unclassified 655
338 Ga0068871_100062427 3300006358 Bacteria 3045
339 Ga0068871_100574233 3300006358 Bacteria 1023
340 Ga0068871_101716769 3300006358 Unclassified 595
341 Ga0075428_100041959 3300006844 Bacteria 5031
342 Ga0075428_100208943 3300006844 Bacteria 2110
343 Ga0075428_100263569 3300006844 Unclassified 1855
344 Ga0075428_102039566 3300006844 Unclassified 594
345 Ga0075428_102193215 3300006844 Unclassified 570
346 Ga0075430_100001246 3300006846 Bacteria 20485
347 Ga0075430_100008251 3300006846 Bacteria 8795
348 Ga0075430_100010224 3300006846 Bacteria 7944
349 Ga0075430_100026418 3300006846 Bacteria 4940
350 Ga0075430_100061609 3300006846 Bacteria 3152
351 Ga0075430_101730639 3300006846 Bacteria 513
352 Ga0075431_100003459 3300006847 Bacteria 15318
353 Ga0075431_100007932 3300006847 Bacteria 10583
354 Ga0075431_100022817 3300006847 Bacteria 6397
355 Ga0075431_100029821 3300006847 Bacteria 5617
356 Ga0075431_100035964 3300006847 Bacteria 5101
357 Ga0075431_100060834 3300006847 Bacteria 3897
358 Ga0075433_10031615 3300006852 Unclassified 4526
359 Ga0075433_10416481 3300006852 Bacteria 1185
360 Ga0075433_10731942 3300006852 Unclassified 866
361 Ga0075434_100015606 3300006871 Bacteria 7290
362 Ga0075434_100033319 3300006871 Bacteria 5083
363 Ga0075434_100061957 3300006871 Bacteria 3723
364 Ga0075434_100139986 3300006871 Bacteria 2439
365 Ga0075434_100141390 3300006871 Bacteria 2427
366 Ga0075434_100350952 3300006871 Bacteria 1496
367 Ga0075434_101566916 3300006871 Bacteria 668
368 Ga0075429_100042917 3300006880 Bacteria 3935
369 Ga0075429_100226049 3300006880 Bacteria 1639
370 Ga0075429_100296149 3300006880 Unclassified 1416
371 Ga0075429_101400166 3300006880 Unclassified 609
372 Ga0068865_100058145 3300006881 Unclassified 2700
373 Ga0068865_100796229 3300006881 Bacteria 815
374 Ga0068865_100842924 3300006881 Bacteria 794
375 Ga0075436_100002597 3300006914 Bacteria 12409
376 Ga0075436_100613644 3300006914 Bacteria 802
377 Ga0097620_100230619 3300006931 Unclassified 1940
378 Ga0097620_101205855 3300006931 Unclassified 834
379 Ga0097620_102386363 3300006931 Bacteria 583
380 Ga0075435_100231222 3300007076 Bacteria 1571
381 Ga0075435_100982757 3300007076 Bacteria 737
382 Ga0075435_101260888 3300007076 Unclassified 647
383 Ga0075435_101727873 3300007076 Bacteria 549
384 Ga0105240_10166111 3300009093 Bacteria 2618
385 Ga0105240_10285461 3300009093 Bacteria 1894
386 Ga0105240_10634446 3300009093 Bacteria 1173
387 Ga0105240_12574448 3300009093 Unclassified 526
388 Ga0105240_12629493 3300009093 Unclassified 520
389 Ga0111539_10045282 3300009094 Bacteria 5267
390 Ga0111539_10204039 3300009094 Bacteria 2305
391 Ga0111539_10204602 3300009094 Bacteria 2301
392 Ga0111539_10323113 3300009094 Bacteria 1796
393 Ga0111539_11114970 3300009094 Bacteria 917
394 Ga0111539_12110613 3300009094 Bacteria 654
395 Ga0105245_10116898 3300009098 Unclassified 2487
396 Ga0105245_10455212 3300009098 Bacteria 1289
397 Ga0105245_10933771 3300009098 Unclassified 910
398 Ga0105245_11756338 3300009098 Bacteria 673
399 Ga0105245_12401801 3300009098 Unclassified 581
400 Ga0105247_10188312 3300009101 Bacteria 1380
401 Ga0105247_10399457 3300009101 Bacteria 979
402 Ga0114129_10000108 3300009147 Bacteria 81939
403 Ga0114129_10019638 3300009147 Bacteria 9618
404 Ga0114129_10127895 3300009147 Unclassified 3492
405 Ga0114129_10605901 3300009147 Bacteria 1418
406 Ga0114129_10623773 3300009147 Bacteria 1394
407 Ga0114129_11422425 3300009147 Bacteria 855
408 Ga0114129_11575567 3300009147 Bacteria 805
409 Ga0114129_12185689 3300009147 Unclassified 666
410 Ga0105243_10073993 3300009148 Bacteria 2762
411 Ga0105243_10179272 3300009148 Bacteria 1841
412 Ga0105243_10428861 3300009148 Unclassified 1235
413 Ga0105243_10863342 3300009148 Unclassified 897
414 Ga0105241_10168985 3300009174 Bacteria 1805
415 Ga0105241_10251799 3300009174 Bacteria 1498
416 Ga0105241_10280877 3300009174 Bacteria 1422
417 Ga0105241_11393574 3300009174 Unclassified 671
418 Ga0105242_10111217 3300009176 Bacteria 2335
419 Ga0105242_10827554 3300009176 Unclassified 919
420 Ga0105242_10866126 3300009176 Bacteria 900
421 Ga0105242_11206876 3300009176 Unclassified 776
422 Ga0105242_11888028 3300009176 Bacteria 637
423 Ga0105248_10186548 3300009177 Unclassified 2337
424 Ga0105248_10208768 3300009177 Bacteria 2200
425 Ga0105248_10405445 3300009177 Bacteria 1535
426 Ga0105248_10518713 3300009177 Bacteria 1344
427 Ga0105248_11037277 3300009177 Bacteria 926
428 Ga0105237_10135152 3300009545 Bacteria 2460
429 Ga0105237_10227538 3300009545 Bacteria 1865
430 Ga0105237_10230857 3300009545 Bacteria 1851
431 Ga0105237_10250837 3300009545 Bacteria 1772
432 Ga0105237_10782502 3300009545 Bacteria 961
433 Ga0105238_10021948 3300009551 Bacteria 6504
434 Ga0105238_11222454 3300009551 Bacteria 776
435 Ga0105238_12736012 3300009551 Unclassified 530
436 Ga0105249_10001803 3300009553 Bacteria 18618
437 Ga0105249_10024953 3300009553 Bacteria 5378
438 Ga0105249_10348899 3300009553 Bacteria 1499
439 Ga0105249_10426139 3300009553 Unclassified 1361
440 Ga0105239_10005522 3300010375 Bacteria 14807
441 Ga0105239_11253398 3300010375 Bacteria 855
442 Ga0105246_11358645 3300011119 Unclassified 661
443 Ga0157373_10268338 3300013100 Bacteria 1208
444 Ga0157373_10822806 3300013100 Unclassified 686
445 Ga0157373_11090571 3300013100 Bacteria 599
446 Ga0157371_10171018 3300013102 Bacteria 1553
447 Ga0157371_10556861 3300013102 Bacteria 850
448 Ga0157370_10019508 3300013104 Bacteria 6799
449 Ga0157370_10127171 3300013104 Bacteria 2378
450 Ga0157370_10187817 3300013104 Bacteria 1918
451 Ga0157370_10251312 3300013104 Bacteria 1635
452 Ga0157370_10481306 3300013104 Bacteria 1141
453 Ga0157370_10514747 3300013104 Bacteria 1098
454 Ga0157370_10988229 3300013104 Bacteria 762
455 Ga0157370_11557781 3300013104 Bacteria 594
456 Ga0157369_10014958 3300013105 Bacteria 8758
457 Ga0157369_10036101 3300013105 Bacteria 5417
458 Ga0157369_10071967 3300013105 Unclassified 3711
459 Ga0157369_10148633 3300013105 Bacteria 2477
460 Ga0157369_10158159 3300013105 Bacteria 2393
461 Ga0157369_10217890 3300013105 Bacteria 1999
462 Ga0157369_11636979 3300013105 Bacteria 654
463 Ga0157369_12106213 3300013105 Bacteria 572
464 Ga0157369_12198542 3300013105 Unclassified 559
465 Ga0157374_10436678 3300013296 Unclassified 1309
466 Ga0157374_11409314 3300013296 Bacteria 720
467 Ga0157378_10005553 3300013297 Bacteria 11045
468 Ga0157378_10767000 3300013297 Bacteria 988
469 Ga0157378_11248385 3300013297 Bacteria 783
470 Ga0163162_10015207 3300013306 Bacteria 7517
471 Ga0163162_10020860 3300013306 Bacteria 6443
472 Ga0163162_10170289 3300013306 Bacteria 2302
473 Ga0163162_10397472 3300013306 Bacteria 1511
474 Ga0157372_10022484 3300013307 Bacteria 6825
475 Ga0157372_10075629 3300013307 Bacteria 3800
476 Ga0157372_10127693 3300013307 Bacteria 2924
477 Ga0157372_10141533 3300013307 Bacteria 2771
478 Ga0157372_11788019 3300013307 Bacteria 707
479 Ga0157375_10265777 3300013308 Unclassified 1877
480 Ga0157375_10343007 3300013308 Bacteria 1659
481 Ga0157375_10440906 3300013308 Bacteria 1468
482 Ga0157375_10707629 3300013308 Bacteria 1161
483 Ga0157375_11189621 3300013308 Bacteria 894
484 Ga0163163_10054195 3300014325 Bacteria 3962
485 Ga0157380_10011975 3300014326 Bacteria 6275
486 Ga0157377_10046330 3300014745 Bacteria 2431
487 Ga0157377_10260210 3300014745 Bacteria 1129
488 Ga0157377_10460730 3300014745 Bacteria 880
489 Ga0157376_11238795 3300014969 Bacteria 775
490 Ga0182007_10013374 3300015262 Bacteria 3131
491 Ga0182007_10407405 3300015262 Unclassified 519
492 Ga0163161_10303897 3300017792 Unclassified 1257
493 Ga0206356_11074160 3300020070 Unclassified 1593
494 Ga0206354_11242480 3300020081 Bacteria 561
495 Ga0206354_11632838 3300020081 Bacteria 1326
496 Ga0213876_10010507 3300021384 Bacteria 4964
497 Ga0213876_10082378 3300021384 Bacteria 1702
498 Ga0213876_10535579 3300021384 Unclassified 623
499 Ga0213876_10722006 3300021384 Bacteria 530
500 Ga0207697_10000506 3300025315 Bacteria 21942
501 Ga0207656_10003452 3300025321 Bacteria 5431
502 Ga0207656_10293393 3300025321 Unclassified 804
503 Ga0207656_10565978 3300025321 Archaea 579
504 Ga0207682_10204752 3300025893 Unclassified 908
505 Ga0207682_10363305 3300025893 Unclassified 683
506 Ga0207692_10208554 3300025898 Bacteria 1152
507 Ga0207692_10364490 3300025898 Bacteria 894
508 Ga0207692_10589557 3300025898 Bacteria 714
509 Ga0207680_10228371 3300025903 Bacteria 1278
510 Ga0207680_10932259 3300025903 Unclassified 622
511 Ga0207699_10024126 3300025906 Bacteria 3321
512 Ga0207699_10100901 3300025906 Bacteria 1831
513 Ga0207699_10179416 3300025906 Unclassified 1422
514 Ga0207699_10514101 3300025906 Unclassified 865
515 Ga0207699_10947164 3300025906 Bacteria 636
516 Ga0207645_10000806 3300025907 Bacteria 26219
517 Ga0207645_10328092 3300025907 Bacteria 1022
518 Ga0207645_10477869 3300025907 Unclassified 843
519 Ga0207643_10008399 3300025908 Bacteria 5539
520 Ga0207643_10050337 3300025908 Bacteria 2362
521 Ga0207705_10191690 3300025909 Bacteria 1546
522 Ga0207705_10369356 3300025909 Bacteria 1107
523 Ga0207705_10628704 3300025909 Unclassified 835
524 Ga0207705_11166823 3300025909 Archaea 592
525 Ga0207705_11476316 3300025909 Unclassified 515
526 Ga0207684_10333169 3300025910 Bacteria 1307
527 Ga0207654_10471431 3300025911 Bacteria 883
528 Ga0207707_10000446 3300025912 Bacteria 42961
529 Ga0207707_10011313 3300025912 Bacteria 7769
530 Ga0207707_10038403 3300025912 Bacteria 4184
531 Ga0207707_10098039 3300025912 Bacteria 2562
532 Ga0207707_10099183 3300025912 Bacteria 2546
533 Ga0207707_10112466 3300025912 Bacteria 2380
534 Ga0207707_10173747 3300025912 Unclassified 1882
535 Ga0207707_10202495 3300025912 Bacteria 1730
536 Ga0207707_10242012 3300025912 Bacteria 1568
537 Ga0207707_10267917 3300025912 Bacteria 1481
538 Ga0207707_10430121 3300025912 Bacteria 1131
539 Ga0207707_10509709 3300025912 Bacteria 1025
540 Ga0207707_10524728 3300025912 Unclassified 1008
541 Ga0207707_10618589 3300025912 Archaea 915
542 Ga0207707_11423692 3300025912 Bacteria 552
543 Ga0207695_10007337 3300025913 Bacteria 14074
544 Ga0207695_10017899 3300025913 Bacteria 8210
545 Ga0207695_10045596 3300025913 Unclassified 4653
546 Ga0207695_10083254 3300025913 Bacteria 3232
547 Ga0207695_10986244 3300025913 Bacteria 722
548 Ga0207695_11511985 3300025913 Unclassified 552
549 Ga0207671_10181512 3300025914 Bacteria 1638
550 Ga0207693_10013442 3300025915 Bacteria 6601
551 Ga0207693_10017163 3300025915 Bacteria 5773
552 Ga0207693_10025634 3300025915 Bacteria 4673
553 Ga0207693_10053818 3300025915 Bacteria 3158
554 Ga0207693_10100466 3300025915 Bacteria 2268
555 Ga0207693_10154432 3300025915 Bacteria 1805
556 Ga0207693_10269269 3300025915 Bacteria 1335
557 Ga0207663_10120523 3300025916 Bacteria 1796
558 Ga0207663_10134163 3300025916 Bacteria 1715
559 Ga0207663_10202177 3300025916 Bacteria 1434
560 Ga0207660_10021178 3300025917 Bacteria 4371
561 Ga0207660_10028616 3300025917 Bacteria 3813
562 Ga0207660_10029908 3300025917 Unclassified 3741
563 Ga0207660_10097702 3300025917 Bacteria 2189
564 Ga0207660_10177788 3300025917 Bacteria 1651
565 Ga0207660_10257714 3300025917 Bacteria 1378
566 Ga0207660_10954969 3300025917 Unclassified 699
567 Ga0207660_11352604 3300025917 Bacteria 578
568 Ga0207660_11711733 3300025917 Unclassified 505
569 Ga0207662_10006233 3300025918 Bacteria 6421
570 Ga0207662_10009077 3300025918 Bacteria 5462
571 Ga0207657_10010879 3300025919 Bacteria 9053
572 Ga0207657_10020035 3300025919 Bacteria 6336
573 Ga0207657_10088573 3300025919 Bacteria 2587
574 Ga0207657_10730720 3300025919 Unclassified 768
575 Ga0207657_11373933 3300025919 Bacteria 531
576 Ga0207649_10003029 3300025920 Bacteria 9258
577 Ga0207649_10127306 3300025920 Bacteria 1725
578 Ga0207649_10173801 3300025920 Bacteria 1503
579 Ga0207649_10230494 3300025920 Bacteria 1324
580 Ga0207649_10559167 3300025920 Unclassified 876
581 Ga0207649_10598380 3300025920 Unclassified 848
582 Ga0207652_10001795 3300025921 Bacteria 18663
583 Ga0207652_10014530 3300025921 Bacteria 6380
584 Ga0207652_10017760 3300025921 Bacteria 5827
585 Ga0207652_10060559 3300025921 Bacteria 3266
586 Ga0207652_10162288 3300025921 Bacteria 2003
587 Ga0207652_10168592 3300025921 Bacteria 1964
588 Ga0207652_10271253 3300025921 Bacteria 1530
589 Ga0207652_10283508 3300025921 Unclassified 1494
590 Ga0207652_10344643 3300025921 Bacteria 1345
591 Ga0207652_10436791 3300025921 Bacteria 1180
592 Ga0207652_10455397 3300025921 Bacteria 1153
593 Ga0207652_10472183 3300025921 Bacteria 1130
594 Ga0207652_10536530 3300025921 Bacteria 1052
595 Ga0207652_10893999 3300025921 Bacteria 785
596 Ga0207652_11144107 3300025921 Bacteria 679
597 Ga0207652_11212985 3300025921 Bacteria 656
598 Ga0207652_11304120 3300025921 Unclassified 629
599 Ga0207652_11398573 3300025921 Bacteria 603
600 Ga0207681_10014089 3300025923 Bacteria 4958
601 Ga0207681_10381158 3300025923 Unclassified 1135
602 Ga0207681_10412972 3300025923 Bacteria 1092
603 Ga0207681_10939521 3300025923 Bacteria 725
604 Ga0207694_10020386 3300025924 Bacteria 5016
605 Ga0207694_10297193 3300025924 Bacteria 1329
606 Ga0207694_10330119 3300025924 Bacteria 1260
607 Ga0207694_10816705 3300025924 Bacteria 788
608 Ga0207650_10038022 3300025925 Unclassified 3511
609 Ga0207650_10053887 3300025925 Bacteria 2982
610 Ga0207650_10287913 3300025925 Bacteria 1339
611 Ga0207650_11253481 3300025925 Unclassified 631
612 Ga0207659_10008926 3300025926 Bacteria 6249
613 Ga0207659_10093809 3300025926 Unclassified 2247
614 Ga0207659_10115609 3300025926 Bacteria 2047
615 Ga0207659_10286217 3300025926 Unclassified 1349
616 Ga0207659_11045992 3300025926 Bacteria 702
617 Ga0207700_10001125 3300025928 Bacteria 15347
618 Ga0207700_10014894 3300025928 Bacteria 5109
619 Ga0207700_10018913 3300025928 Bacteria 4642
620 Ga0207700_10027507 3300025928 Unclassified 3984
621 Ga0207700_10138460 3300025928 Unclassified 1997
622 Ga0207700_10178537 3300025928 Bacteria 1776
623 Ga0207700_10434322 3300025928 Unclassified 1155
624 Ga0207700_10982924 3300025928 Bacteria 755
625 Ga0207664_10003681 3300025929 Bacteria 10275
626 Ga0207664_10027904 3300025929 Bacteria 4285
627 Ga0207664_10157139 3300025929 Bacteria 1937
628 Ga0207664_10199414 3300025929 Bacteria 1727
629 Ga0207664_10366281 3300025929 Bacteria 1277
630 Ga0207664_10385810 3300025929 Bacteria 1244
631 Ga0207664_11514889 3300025929 Bacteria 592
632 Ga0207644_10108507 3300025931 Unclassified 2096
633 Ga0207690_10037327 3300025932 Bacteria 3154
634 Ga0207690_10040818 3300025932 Unclassified 3036
635 Ga0207690_10271790 3300025932 Unclassified 1317
636 Ga0207690_10309248 3300025932 Bacteria 1239
637 Ga0207690_11311991 3300025932 Unclassified 605
638 Ga0207706_10000642 3300025933 Bacteria 37073
639 Ga0207706_10029596 3300025933 Bacteria 4888
640 Ga0207706_10054583 3300025933 Bacteria 3526
641 Ga0207706_10110444 3300025933 Bacteria 2419
642 Ga0207686_10238636 3300025934 Unclassified 1322
643 Ga0207686_10290942 3300025934 Bacteria 1209
644 Ga0207686_10361089 3300025934 Bacteria 1096
645 Ga0207709_10042008 3300025935 Bacteria 2747
646 Ga0207709_10340932 3300025935 Bacteria 1128
647 Ga0207670_10153735 3300025936 Bacteria 1710
648 Ga0207670_11225685 3300025936 Bacteria 635
649 Ga0207669_10401232 3300025937 Bacteria 1074
650 Ga0207704_10444780 3300025938 Archaea 1033
651 Ga0207704_10508969 3300025938 Unclassified 972
652 Ga0207665_10580473 3300025939 Bacteria 874
653 Ga0207691_10001241 3300025940 Bacteria 25452
654 Ga0207691_10040865 3300025940 Bacteria 4284
655 Ga0207691_10041381 3300025940 Bacteria 4255
656 Ga0207691_10042609 3300025940 Bacteria 4184
657 Ga0207691_10138492 3300025940 Bacteria 2145
658 Ga0207691_11024063 3300025940 Bacteria 689
659 Ga0207711_10190450 3300025941 Bacteria 1869
660 Ga0207711_10203192 3300025941 Bacteria 1809
661 Ga0207711_11133787 3300025941 Bacteria 723
662 Ga0207689_10003004 3300025942 Bacteria 15558
663 Ga0207689_11054354 3300025942 Bacteria 685
664 Ga0207689_11650690 3300025942 Unclassified 532
665 Ga0207661_10023403 3300025944 Bacteria 4667
666 Ga0207661_10078459 3300025944 Bacteria 2719
667 Ga0207661_10084601 3300025944 Bacteria 2628
668 Ga0207661_10087673 3300025944 Bacteria 2585
669 Ga0207661_10096650 3300025944 Bacteria 2472
670 Ga0207661_10099539 3300025944 Bacteria 2438
671 Ga0207661_10103028 3300025944 Bacteria 2401
672 Ga0207661_10108565 3300025944 Bacteria 2343
673 Ga0207661_10148766 3300025944 Bacteria 2023
674 Ga0207661_10161672 3300025944 Bacteria 1943
675 Ga0207661_10239488 3300025944 Bacteria 1609
676 Ga0207661_10246218 3300025944 Bacteria 1587
677 Ga0207661_10281172 3300025944 Bacteria 1487
678 Ga0207661_10283196 3300025944 Bacteria 1482
679 Ga0207661_10308365 3300025944 Bacteria 1420
680 Ga0207661_10588575 3300025944 Unclassified 1021
681 Ga0207661_10608537 3300025944 Bacteria 1003
682 Ga0207661_10709318 3300025944 Bacteria 925
683 Ga0207679_10000744 3300025945 Bacteria 21654
684 Ga0207679_10002584 3300025945 Bacteria 11158
685 Ga0207679_10025586 3300025945 Unclassified 4061
686 Ga0207679_10053501 3300025945 Bacteria 2967
687 Ga0207679_10130307 3300025945 Unclassified 2016
688 Ga0207679_10146426 3300025945 Bacteria 1916
689 Ga0207679_10149045 3300025945 Bacteria 1901
690 Ga0207679_10166098 3300025945 Bacteria 1812
691 Ga0207679_10422190 3300025945 Bacteria 1177
692 Ga0207679_10773892 3300025945 Bacteria 874
693 Ga0207679_11098876 3300025945 Unclassified 729
694 Ga0207667_10041659 3300025949 Unclassified 4883
695 Ga0207667_10081200 3300025949 Unclassified 3359
696 Ga0207667_10159252 3300025949 Bacteria 2322
697 Ga0207667_10463734 3300025949 Bacteria 1286
698 Ga0207667_10478352 3300025949 Unclassified 1264
699 Ga0207667_10709749 3300025949 Bacteria 1008
700 Ga0207667_11176865 3300025949 Archaea 747
701 Ga0207667_11279996 3300025949 Bacteria 710
702 Ga0207667_11637450 3300025949 Bacteria 612
703 Ga0207651_10023403 3300025960 Bacteria 3799
704 Ga0207651_10419304 3300025960 Bacteria 1142
705 Ga0207651_11044652 3300025960 Bacteria 731
706 Ga0207651_11154002 3300025960 Bacteria 695
707 Ga0207651_12148872 3300025960 Bacteria 501
708 Ga0207712_10013924 3300025961 Bacteria 5159
709 Ga0207712_10100047 3300025961 Bacteria 2154
710 Ga0207712_10949633 3300025961 Bacteria 761
711 Ga0207668_10123749 3300025972 Bacteria 1963
712 Ga0207668_10130482 3300025972 Bacteria 1918
713 Ga0207640_10155786 3300025981 Bacteria 1684
714 Ga0207640_10237695 3300025981 Bacteria 1406
715 Ga0207658_10045199 3300025986 Bacteria 3210
716 Ga0207677_10413535 3300026023 Bacteria 1147
717 Ga0207677_10587857 3300026023 Bacteria 975
718 Ga0207703_10822928 3300026035 Bacteria 887
719 Ga0207639_10013899 3300026041 Bacteria 5646
720 Ga0207639_10227013 3300026041 Unclassified 1616
721 Ga0207678_10095867 3300026067 Bacteria 2535
722 Ga0207678_10343515 3300026067 Bacteria 1286
723 Ga0207678_10604618 3300026067 Unclassified 961
724 Ga0207678_11039049 3300026067 Unclassified 725
725 Ga0207708_10017851 3300026075 Bacteria 5340
726 Ga0207708_10488442 3300026075 Bacteria 1030
727 Ga0207702_10006041 3300026078 Bacteria 10509
728 Ga0207702_10321268 3300026078 Unclassified 1474
729 Ga0207702_10369937 3300026078 Bacteria 1376
730 Ga0207702_11242249 3300026078 Bacteria 739
731 Ga0207702_11728833 3300026078 Bacteria 618
732 Ga0207641_10342624 3300026088 Bacteria 1423
733 Ga0207641_11914188 3300026088 Unclassified 594
734 Ga0207641_12394448 3300026088 Bacteria 527
735 Ga0207648_10007064 3300026089 Bacteria 11084
736 Ga0207648_10079503 3300026089 Bacteria 2860
737 Ga0207648_10124382 3300026089 Bacteria 2268
738 Ga0207648_10495769 3300026089 Bacteria 1117
739 Ga0207676_10441149 3300026095 Bacteria 1225
740 Ga0207676_10643912 3300026095 Bacteria 1022
741 Ga0207676_10909543 3300026095 Bacteria 863
742 Ga0207674_10000828 3300026116 Bacteria 40263
743 Ga0207674_10002108 3300026116 Bacteria 25182
744 Ga0207674_10020165 3300026116 Bacteria 7210
745 Ga0207674_10682363 3300026116 Bacteria 992
746 Ga0207674_12151806 3300026116 Bacteria 521
747 Ga0207675_100002863 3300026118 Bacteria 16976
748 Ga0207675_100011177 3300026118 Bacteria 8406
749 Ga0207675_101343560 3300026118 Unclassified 735
750 Ga0207683_10348776 3300026121 Bacteria 1358
751 Ga0207683_10500016 3300026121 Bacteria 1123
752 Ga0207698_10053772 3300026142 Bacteria 3094
753 Ga0207698_10120525 3300026142 Bacteria 2219
754 Ga0207698_10246043 3300026142 Bacteria 1633
755 Ga0207698_10622652 3300026142 Bacteria 1066
756 Ga0207428_10046578 3300027907 Bacteria 3487
757 Ga0268266_10782134 3300028379 Unclassified 922
758 Ga0268266_10870065 3300028379 Bacteria 871
759 Ga0268266_11075645 3300028379 Unclassified 778
760 Ga0268266_11540843 3300028379 Unclassified 640
761 Ga0268265_10006098 3300028380 Bacteria 8181
762 Ga0268265_10017756 3300028380 Bacteria 4918
763 Ga0307408_100002224 3300031548 Bacteria 13855
764 Ga0307408_100087966 3300031548 Bacteria 2339
765 Ga0307408_100105322 3300031548 Bacteria 2156
766 Ga0307408_100346513 3300031548 Bacteria 1259
767 Ga0307405_10107243 3300031731 Bacteria 1885
768 Ga0307405_10608656 3300031731 Bacteria 893
769 Ga0307413_10885025 3300031824 Unclassified 757
770 Ga0307413_11483750 3300031824 Unclassified 599
771 Ga0307406_10114219 3300031901 Unclassified 1865
772 Ga0307406_10645623 3300031901 Bacteria 878
773 Ga0307406_10767915 3300031901 Bacteria 811
774 Ga0307406_10848901 3300031901 Bacteria 774
775 Ga0307412_10016067 3300031911 Bacteria 4449
776 Ga0307412_11149067 3300031911 Unclassified 693
777 Ga0307409_101561762 3300031995 Unclassified 688
778 Ga0307409_102683232 3300031995 Bacteria 526
779 Ga0307416_100002716 3300032002 Bacteria 10258
780 Ga0307416_100247709 3300032002 Bacteria 1732
781 Ga0307416_101450893 3300032002 Bacteria 792
782 Ga0307416_102315287 3300032002 Unclassified 637
783 Ga0307416_103818975 3300032002 Bacteria 504
784 Ga0307414_10464528 3300032004 Bacteria 1113
785 Ga0307414_11789422 3300032004 Unclassified 573
786 Ga0307411_10600007 3300032005 Unclassified 947
787 Ga0307411_10934185 3300032005 Bacteria 773
788 Ga0307411_11822931 3300032005 Unclassified 565
789 Ga0373926_0349372 3300035083 Unclassified 581
790 Ga0373934_0001697 3300035086 Bacteria 8093
791 Ga0373934_0010899 3300035086 Bacteria 3417
792 Ga0373944_0013225 3300035089 Bacteria 2286
793 Ga0373944_0221338 3300035089 Bacteria 691
794 Ga0373923_0080629 3300035111 Bacteria 1411
795 Ga0373954_0030416 3300035118 Bacteria 2489
796 Ga0373954_0107995 3300035118 Bacteria 1345
797 Ga0373956_0247527 3300035119 Bacteria 847
798 Ga0373957_0052445 3300035120 Bacteria 1562
799 Ga0373943_0007622 3300035170 Bacteria 4861
800 Ga0373943_0099213 3300035170 Bacteria 1520
801 Ga0373943_0189246 3300035170 Unclassified 1135
802 Ga0373946_0005526 3300035171 Bacteria 4560
803 Ga0373955_0001562 3300035172 Bacteria 9776
804 Ga0373955_0003382 3300035172 Bacteria 7013
805 Ga0373961_0022669 3300035241 Bacteria 1682
806 Ga0373924_0039793 3300035410 Bacteria 1922
807 Ga0373924_0134466 3300035410 Bacteria 1077
808 Ga0373924_0460907 3300035410 Bacteria 570
809 Ga0373935_0019593 3300035692 Bacteria 4125
810 Ga0373935_0056589 3300035692 Unclassified 2501
811 Ga0373927_0016665 3300035695 Bacteria 4847
812 Ga0373927_0034129 3300035695 Bacteria 3310
813 Ga0373927_0142390 3300035695 Bacteria 1569
814 Ga0373933_0024987 3300035724 Bacteria 3423
815 Ga0373933_0117735 3300035724 Bacteria 1661
816 Ga0373933_0161066 3300035724 Unclassified 1425
817 Ga0373947_0037105 3300035725 Unclassified 2891
818 Ga0373947_0071903 3300035725 Bacteria 2122
819 Ga0373947_0181577 3300035725 Bacteria 1370
820 Ga0373947_0585307 3300035725 Bacteria 760
821 Ga0373947_0735980 3300035725 Unclassified 673
822 Ga0373937_0000184 3300036401 Bacteria 61363
823 Ga0373937_0016269 3300036401 Bacteria 6601
824 Ga0373937_0297348 3300036401 Bacteria 1525
825 Ga0373937_1765512 3300036401 Unclassified 565
826 Ga0373925_0023122 3300037068 Bacteria 4535
827 Ga0373925_0104496 3300037068 Unclassified 2181
828 Ga0373925_0141404 3300037068 Bacteria 1884
829 Ga0395905_0375727 3300037471 Bacteria 1315
830 Ga0395905_1238046 3300037471 Unclassified 650
831 Ga0436365_0192547 3300039437 Bacteria 3082
832 Ga0436365_0580076 3300039437 Unclassified 2078
833 Ga0436365_0610992 3300039437 Bacteria 1848
834 Ga0436365_0785923 3300039437 Bacteria 3032
835 Ga0436365_1666798 3300039437 Bacteria 2259
836 Ga0439436_0161934 3300041404 Bacteria 633
837 Ga0439439_0026870 3300041406 Bacteria 1452
838 Ga0451807_2041370 3300041486 Bacteria 903
839 Ga0439448_0271018 3300042005 Unclassified 601
840 Ga0439449_0124874 3300042007 Unclassified 956
841 Ga0439462_0146272 3300042015 Bacteria 663
842 Ga0466963_0152403 3300044694 Bacteria 1606
843 Ga0466963_0293161 3300044694 Bacteria 1144
844 Ga0466957_0162900 3300044842 Bacteria 1449
845 Ga0466957_0295250 3300044842 Bacteria 1088
846 Ga0466957_0599814 3300044842 Bacteria 771
847 Ga0451576_0098807 3300045051 Unclassified 3036
848 Ga0451576_0152519 3300045051 Bacteria 2410
849 Ga0451576_0948262 3300045051 Bacteria 902
850 Ga0451576_1270974 3300045051 Bacteria 768
851 Ga0466958_0118811 3300045836 Bacteria 1654
852 Ga0466958_1119814 3300045836 Unclassified 514
853 Ga0466967_0014965 3300045976 Bacteria 6066
854 Ga0466967_0024085 3300045976 Unclassified 4999
855 Ga0466967_0078180 3300045976 Bacteria 2980
856 Ga0466967_0080702 3300045976 Bacteria 2936
857 Ga0466967_0356512 3300045976 Bacteria 1416
858 Ga0466967_0373740 3300045976 Bacteria 1383
859 Ga0466967_0404128 3300045976 Bacteria 1329
860 Ga0466967_0471671 3300045976 Bacteria 1229
861 Ga0466967_0535564 3300045976 Bacteria 1152
862 Ga0466967_0547852 3300045976 Bacteria 1138
863 Ga0466967_0631105 3300045976 Unclassified 1059
864 Ga0466967_0661224 3300045976 Bacteria 1034
865 Ga0466967_0672006 3300045976 Bacteria 1025
866 Ga0466967_0720133 3300045976 Unclassified 989
867 Ga0466967_1449451 3300045976 Unclassified 684
868 Ga0495603_0006890 3300046455 Bacteria 6820
869 Ga0495629_0045141 3300046459 Bacteria 3092
870 Ga0495629_0186267 3300046459 Unclassified 1438
871 Ga0495638_0215828 3300046460 Bacteria 1075
872 Ga0495651_0027216 3300046462 Bacteria 4454
873 Ga0495651_0036250 3300046462 Unclassified 3840
874 Ga0495653_0044983 3300046463 Bacteria 3424
875 Ga0495580_0003643 3300046472 Bacteria 13046
876 Ga0495580_0238343 3300046472 Bacteria 1248
877 Ga0495580_0283508 3300046472 Bacteria 1130
878 Ga0495580_0481574 3300046472 Unclassified 830
879 Ga0495582_0017540 3300046473 Bacteria 3916
880 Ga0495582_0024867 3300046473 Bacteria 3280
881 Ga0495639_0000731 3300046475 Bacteria 15026
882 Ga0495639_0009668 3300046475 Bacteria 4138
883 Ga0495639_0043467 3300046475 Bacteria 2030
884 Ga0495639_0101210 3300046475 Unclassified 1360
885 Ga0495662_0281176 3300046476 Bacteria 819
886 Ga0495664_0031121 3300046477 Bacteria 3127
887 Ga0495664_0205531 3300046477 Bacteria 1193
888 Ga0495594_0003763 3300046499 Bacteria 7783
889 Ga0495594_0004014 3300046499 Bacteria 7573
890 Ga0495594_0012370 3300046499 Bacteria 4445
891 Ga0495594_0088601 3300046499 Bacteria 1733
892 Ga0495594_0106248 3300046499 Unclassified 1581
893 Ga0495594_0325817 3300046499 Unclassified 875
894 Ga0495594_0870808 3300046499 Bacteria 507
895 Ga0495608_0153348 3300046511 Bacteria 1467
896 Ga0495618_0017804 3300046514 Bacteria 4360
897 Ga0495630_0016699 3300046517 Bacteria 5368
898 Ga0495630_0068286 3300046517 Unclassified 2672
899 Ga0495630_0506393 3300046517 Bacteria 926
900 Ga0495630_0731782 3300046517 Bacteria 756
901 Ga0495652_0008474 3300046529 Bacteria 9380
902 Ga0495665_0000680 3300046531 Bacteria 17434
903 Ga0495665_0035992 3300046531 Unclassified 2643
904 Ga0495586_0014535 3300046535 Bacteria 4182
905 Ga0495586_0193553 3300046535 Bacteria 1152
906 Ga0495587_0007425 3300046536 Bacteria 7099
907 Ga0495587_0012777 3300046536 Bacteria 5282
908 Ga0495645_0000075 3300046543 Bacteria 68269
909 Ga0495645_0004610 3300046543 Bacteria 9408
910 Ga0495645_0580067 3300046543 Unclassified 692
911 Ga0495667_0148328 3300046559 Bacteria 1510
912 Ga0495667_0234221 3300046559 Bacteria 1170
913 Ga0495667_0302228 3300046559 Bacteria 1014
914 Ga0495625_0006357 3300046660 Bacteria 10548
915 Ga0495625_0569452 3300046660 Bacteria 684
916 Ga0495635_0633480 3300046663 Unclassified 696
917 Ga0495659_0144161 3300046664 Archaea 953
918 Ga0495588_0001797 3300046674 Bacteria 9146
919 Ga0495657_0144402 3300046675 Unclassified 1481
920 Ga0495599_0022381 3300046678 Bacteria 3945
921 Ga0495599_0031228 3300046678 Unclassified 3343
922 Ga0495623_0002632 3300046679 Bacteria 11843
923 Ga0495623_0093284 3300046679 Bacteria 1843
924 Ga0495623_0138721 3300046679 Bacteria 1448
925 Ga0495658_0001809 3300046683 Bacteria 10980
926 Ga0495658_0694404 3300046683 Bacteria 652
927 Ga0495613_0035559 3300046689 Bacteria 3696
928 Ga0495613_0230752 3300046689 Unclassified 1297
929 Ga0495613_0650279 3300046689 Unclassified 698
930 Ga0495600_0058838 3300046809 Bacteria 2510
931 Ga0495600_0120213 3300046809 Unclassified 1708
932 Ga0495581_0000907 3300047315 Bacteria 15891
933 Ga0495581_0120499 3300047315 Bacteria 1527
934 Ga0495581_0490531 3300047315 Bacteria 714
935 Ga0495604_0011842 3300047317 Bacteria 6938
936 Ga0495636_0205372 3300047318 Unclassified 901
937 Ga0495636_0418441 3300047318 Unclassified 640
938 Ga0495674_0209886 3300047319 Bacteria 1613
939 Ga0495674_1033563 3300047319 Bacteria 628
940 Ga0495672_0001955 3300047320 Bacteria 19481
941 Ga0495675_0005109 3300047444 Bacteria 7986
942 Ga0495675_0018536 3300047444 Bacteria 4419
943 Ga0495684_0004467 3300047471 Bacteria 10933
944 Ga0495684_0174478 3300047471 Bacteria 1596
945 Ga0495593_0002611 3300047673 Bacteria 10830
946 Ga0495602_0048052 3300048088 Bacteria 3839
947 Ga0495602_0147100 3300048088 Bacteria 1857
948 Ga0495602_0252177 3300048088 Bacteria 1314
949 Ga0495602_0890459 3300048088 Bacteria 593
950 Ga0495614_0006061 3300048089 Bacteria 5433
951 Ga0496102_1336613 3300048905 Bacteria 636
952 Ga0496105_0114376 3300048908 Bacteria 2226
953 Ga0496108_0607502 3300048911 Bacteria 953
954 Ga0496109_0339335 3300048912 Bacteria 1419
955 Ga0496115_0937963 3300048918 Unclassified 665
956 Ga0501290_083955 3300049513 Bacteria 547
957 Ga0501298_047944 3300049521 Unclassified 880
958 Ga0501033_1015968 3300049570 Archaea 554
959 Ga0501034_0168396 3300049571 Bacteria 2159
960 Ga0501039_1056364 3300049575 Bacteria 630
961 Ga0501040_0551428 3300049576 Bacteria 832
962 Ga0501047_0115202 3300049581 Bacteria 2570
963 Ga0501069_1026590 3300049585 Bacteria 504
964 Ga0501070_0052614 3300049586 Bacteria 3380
965 Ga0501070_0576572 3300049586 Bacteria 899
966 Ga0501072_1043675 3300049588 Bacteria 637
967 Ga0501073_0322990 3300049589 Bacteria 1065
968 Ga0501076_0934055 3300049592 Bacteria 715
969 Ga0501207_146930 3300049654 Unclassified 506
970 Ga0501256_017387 3300049685 Unclassified 734
971 Ga0501225_0061625 3300049705 Bacteria 1056
972 Ga0501234_091493 3300049707 Bacteria 546
973 Ga0501080_0573122 3300049742 Bacteria 1004
974 Ga0501263_010679 3300049760 Unclassified 1130
975 Ga0501035_1298108 3300049822 Unclassified 561
976 Ga0501044_1161278 3300049823 Bacteria 640
977 nmdc:mga05p37_1431_c1 3300050507 Bacteria 27718
978 nmdc:mga05p37_216172_c1 3300050507 Bacteria 2315
979 nmdc:mga05p37_28300_c1 3300050507 Bacteria 6834
980 nmdc:mga05p37_558227_c1 3300050507 Unclassified 1302
981 nmdc:mga09592_1045006_c1 3300050508 Bacteria 681
982 nmdc:mga09592_11847_c1 3300050508 Bacteria 7093
983 nmdc:mga09592_17358_c1 3300050508 Bacteria 5896
984 nmdc:mga09592_17584_c1 3300050508 Bacteria 5859
985 nmdc:mga09592_966359_c1 3300050508 Unclassified 713
986 nmdc:mga0qj67_135767_c1 3300050509 Bacteria 1993
987 nmdc:mga0qj67_1486765_c1 3300050509 Bacteria 521
988 nmdc:mga0qj67_161573_c1 3300050509 Unclassified 1818
989 nmdc:mga0qj67_2379_c1 3300050509 Bacteria 13395
990 nmdc:mga0qj67_9693_c1 3300050509 Bacteria 7172
991 nmdc:mga06r32_12948_c1 3300050510 Bacteria 7542
992 nmdc:mga06r32_13823_c1 3300050510 Bacteria 7323
993 nmdc:mga06r32_1868115_c1 3300050510 Bacteria 535
994 nmdc:mga06r32_23989_c1 3300050510 Bacteria 5654
995 nmdc:mga06r32_82916_c1 3300050510 Viruses 3124
996 nmdc:mga06r32_978106_c1 3300050510 Bacteria 800
997 nmdc:mga08y16_236469_c1 3300050511 Bacteria 1889
998 nmdc:mga08y16_311992_c1 3300050511 Bacteria 1620
999 nmdc:mga08y16_44448_c1 3300050511 Bacteria 4653
1000 nmdc:mga08y16_68779_c1 3300050511 Unclassified 3692
1001 nmdc:mga0n895_1381229_c1 3300050512 Bacteria 673
1002 nmdc:mga0n895_1479396_c1 3300050512 Bacteria 646
1003 nmdc:mga0n895_160169_c1 3300050512 Bacteria 2282
1004 nmdc:mga0n895_192475_c1 3300050512 Unclassified 2071
1005 nmdc:mga0n895_210785_c1 3300050512 Unclassified 1973
1006 nmdc:mga0n895_392074_c1 3300050512 Bacteria 1405
1007 nmdc:mga0rr50_1382001_c1 3300050513 Bacteria 596
1008 nmdc:mga0rr50_1418959_c1 3300050513 Bacteria 588
1009 nmdc:mga08x19_265991_c1 3300050514 Bacteria 1186
1010 nmdc:mga08x19_689832_c1 3300050514 Bacteria 725
1011 nmdc:mga0a205_11822_c1 3300050515 Bacteria 8057
1012 nmdc:mga0a205_164972_c1 3300050515 Unclassified 2111
1013 nmdc:mga0a205_28356_c1 3300050515 Bacteria 5353
1014 Ga0495601_0229170 3300053077 Bacteria 1213
1015 Ga0495601_0890823 3300053077 Bacteria 562
1016 Ga0495612_0017223 3300053078 Bacteria 2894
1017 Ga0495595_0046497 3300053084 Bacteria 2000
1018 Ga0495595_0509707 3300053084 Bacteria 613
1019 Ga0495619_0080505 3300053085 Bacteria 2192
1020 Ga0495619_0715101 3300053085 Bacteria 681
1021 Ga0466962_0618871 3300061719 Bacteria 553
1022 Ga0530510_0329264 3300061734 Bacteria 1146
1023 Ga0207661_10367598
1024 JGI25406J46586_10030228
1025 Ga0058863_10087649
1026 Ga0058863_11454414
1027 Ga0065712_10313715
1028 Ga0065707_10294286
1029 Ga0065707_10595419
1030 Ga0070658_10010790
1031 Ga0070658_10341340
1032 Ga0070658_11080453
1033 Ga0070658_11205615
1034 Ga0070676_10129169
1035 Ga0070676_10649517
1036 Ga0070683_100006898
1037 Ga0070683_100013364
1038 Ga0070683_100028508
1039 Ga0070683_100067932
1040 Ga0070683_100078687
1041 Ga0070683_100125677
1042 Ga0070683_100179633
1043 Ga0070683_100295346
1044 Ga0070683_100308417
1045 Ga0070683_100513154
1046 Ga0070683_100592153
1047 Ga0070683_101418132
1048 Ga0070683_101592471
1049 Ga0070690_100005775
1050 Ga0070690_100433137
1051 Ga0070670_100025103
1052 Ga0070670_100050294
1053 Ga0070670_100058848
1054 Ga0070670_100224888
1055 Ga0070670_100272993
1056 Ga0070670_101483055
1057 Ga0070677_10181730
1058 Ga0070677_10229749
1059 Ga0070677_10468222
1060 Ga0068869_100003430
1061 Ga0068869_100461187
1062 Ga0068869_102138405
1063 Ga0070666_10141959
1064 Ga0070666_10260906
1065 Ga0070680_100000749
1066 Ga0070680_100003399
1067 Ga0070680_100028122
1068 Ga0070680_100040334
1069 Ga0070680_100062167
1070 Ga0070680_100063923
1071 Ga0070680_100066325
1072 Ga0070680_100092938
1073 Ga0070680_100171540
1074 Ga0070680_100197753
1075 Ga0070680_101000420
1076 Ga0070680_101559729
1077 Ga0070682_100698145
1078 Ga0068868_100246442
1079 Ga0068868_100255911
1080 Ga0068868_100643899
1081 Ga0068868_101108201
1082 Ga0070660_100268148
1083 Ga0070660_100870442
1084 Ga0070689_100067299
1085 Ga0070689_100088157
1086 Ga0070689_100168275
1087 Ga0070687_100130169
1088 Ga0070687_100161622
1089 Ga0070661_100001820
1090 Ga0070661_100002751
1091 Ga0070661_100010478
1092 Ga0070661_100025342
1093 Ga0070661_100504859
1094 Ga0070661_100921819
1095 Ga0070692_10184407
1096 Ga0070668_100057860
1097 Ga0070668_100092072
1098 Ga0070668_101027405
1099 Ga0070669_100007489
1100 Ga0070669_100117027
1101 Ga0070669_100360635
1102 Ga0070669_100956156
1103 Ga0070669_101075536
1104 Ga0070675_100006208
1105 Ga0070675_100012350
1106 Ga0070675_100046085
1107 Ga0070675_100135415
1108 Ga0070675_100447298
1109 Ga0070675_100503806
1110 Ga0070675_100847229
1111 Ga0070671_100508370
1112 Ga0070671_100871595
1113 Ga0070674_100136745
1114 Ga0070674_100178410
1115 Ga0070674_100811164
1116 Ga0070674_100916670
1117 Ga0070673_100060185
1118 Ga0070673_100118501
1119 Ga0070673_100166506
1120 Ga0070673_100292148
1121 Ga0070673_100317143
1122 Ga0070673_100769122
1123 Ga0070673_101425127
1124 Ga0070688_100002762
1125 Ga0070688_100100467
1126 Ga0070688_101097112
1127 Ga0070659_100118519
1128 Ga0070659_100381081
1129 Ga0070659_100851884
1130 Ga0070659_100972909
1131 Ga0070667_100083063
1132 Ga0070667_100753521
1133 Ga0070667_100824556
1134 Ga0070667_100854793
1135 Ga0070709_10012828
1136 Ga0070709_10190794
1137 Ga0070709_10270524
1138 Ga0070709_11700210
1139 Ga0070714_100007410
1140 Ga0070714_100050532
1141 Ga0070714_100209149
1142 Ga0070714_100225606
1143 Ga0070714_100579649
1144 Ga0070713_100000077
1145 Ga0070713_100008338
1146 Ga0070713_100019682
1147 Ga0070713_100033238
1148 Ga0070713_100073801
1149 Ga0070713_100150125
1150 Ga0070713_100464772
1151 Ga0070710_10119384
1152 Ga0070710_10450882
1153 Ga0070710_10792978
1154 Ga0070710_11147050
1155 Ga0070701_10263236
1156 Ga0070701_10274677
1157 Ga0070701_11115861
1158 Ga0070711_100170110
1159 Ga0070711_100196432
1160 Ga0070711_100234106
1161 Ga0070711_100428086
1162 Ga0070711_100444953
1163 Ga0070711_100753841
1164 Ga0070711_101492402
1165 Ga0070705_100570239
1166 Ga0070700_100011966
1167 Ga0070700_100019793
1168 Ga0070700_100145114
1169 Ga0070694_100284145
1170 Ga0070694_101250593
1171 Ga0070708_100000934
1172 Ga0070663_100096428
1173 Ga0070663_100689775
1174 Ga0070678_100174446
1175 Ga0070678_100339093
1176 Ga0070678_101250641
1177 Ga0070662_100074738
1178 Ga0070662_100213078
1179 Ga0070662_100712729
1180 Ga0070681_10000280
1181 Ga0070681_10000406
1182 Ga0070681_10009743
1183 Ga0070681_10032579
1184 Ga0070681_10038378
1185 Ga0070681_10040451
1186 Ga0070681_10041097
1187 Ga0070681_10064816
1188 Ga0070681_10072491
1189 Ga0070681_10091167
1190 Ga0070681_10158704
1191 Ga0070681_10176877
1192 Ga0070681_10392815
1193 Ga0070681_10442061
1194 Ga0070681_10504194
1195 Ga0070681_10616242
1196 Ga0070681_10696225
1197 Ga0070681_11997294
1198 Ga0068867_100128867
1199 Ga0068867_100179317
1200 Ga0068867_101286154
1201 Ga0068867_101302581
1202 Ga0070685_10062955
1203 Ga0070685_10300980
1204 Ga0070685_10505222
1205 Ga0070706_100052359
1206 Ga0070706_100091815
1207 Ga0070706_100288072
1208 Ga0070707_100922193
1209 Ga0070707_101718655
1210 Ga0070698_100242098
1211 Ga0070698_100455068
1212 Ga0070698_100556329
1213 Ga0070698_100690245
1214 Ga0070698_101089655
1215 Ga0070699_100188932
1216 Ga0070699_101991013
1217 Ga0070679_100000050
1218 Ga0070679_100001297
1219 Ga0070679_100008346
1220 Ga0070679_100014843
1221 Ga0070679_100032831
1222 Ga0070679_100045977
1223 Ga0070679_100076976
1224 Ga0070679_100090912
1225 Ga0070679_100102096
1226 Ga0070679_100118269
1227 Ga0070679_100122057
1228 Ga0070679_100140255
1229 Ga0070679_100309069
1230 Ga0070679_100332827
1231 Ga0070679_100594343
1232 Ga0070679_100833231
1233 Ga0070679_100862402
1234 Ga0070679_101629038
1235 Ga0070679_101775669
1236 Ga0070679_101918940
1237 Ga0070684_100003048
1238 Ga0070684_100008393
1239 Ga0070684_100014182
1240 Ga0070684_100014419
1241 Ga0070684_100017321
1242 Ga0070684_100019213
1243 Ga0070684_100037417
1244 Ga0070684_100038842
1245 Ga0070684_100044798
1246 Ga0070684_100272863
1247 Ga0070684_100286511
1248 Ga0070684_100309777
1249 Ga0070684_100892560
1250 Ga0070684_102001008
1251 Ga0068853_100048699
1252 Ga0068853_100061378
1253 Ga0068853_100077950
1254 Ga0068853_100871807
1255 Ga0070672_100031677
1256 Ga0070672_100071110
1257 Ga0070672_100297311
1258 Ga0070672_100463339
1259 Ga0070672_101567541
1260 Ga0070686_100037447
1261 Ga0070686_100083027
1262 Ga0070686_101908759
1263 Ga0070695_100271647
1264 Ga0070695_100407931
1265 Ga0070696_100720327
1266 Ga0070696_101736154
1267 Ga0070693_100002797
1268 Ga0070693_100005203
1269 Ga0070693_100007963
1270 Ga0070693_100010709
1271 Ga0070693_100291981
1272 Ga0070693_100854175
1273 Ga0070693_101036093
1274 Ga0070665_100040007
1275 Ga0070665_100314424
1276 Ga0070665_100368284
1277 Ga0070665_100534961
1278 Ga0070665_101050726
1279 Ga0070665_101723190
1280 Ga0068855_100049051
1281 Ga0068855_100080116
1282 Ga0068855_100138498
1283 Ga0068855_100237479
1284 Ga0068855_100250129
1285 Ga0068855_100630372
1286 Ga0068855_100639244
1287 Ga0068855_100656950
1288 Ga0068855_100681980
1289 Ga0068855_100881508
1290 Ga0068855_101079270
1291 Ga0070664_100002346
1292 Ga0070664_100002527
1293 Ga0070664_100033645
1294 Ga0070664_100090618
1295 Ga0070664_100323642
1296 Ga0070664_100505776
1297 Ga0070664_100951559
1298 Ga0070664_102366244
1299 Ga0068857_100022416
1300 Ga0068857_101272020
1301 Ga0068857_102009358
1302 Ga0068857_102142235
1303 Ga0068854_100232210
1304 Ga0068854_100269362
1305 Ga0068856_100007031
1306 Ga0068856_100163140
1307 Ga0068856_100496640
1308 Ga0068856_100546526
1309 Ga0068856_100717614
1310 Ga0068852_100045760
1311 Ga0068852_100061292
1312 Ga0068852_100078166
1313 Ga0068852_101082241
1314 Ga0068852_101214337
1315 Ga0068852_101688015
1316 Ga0068859_101205856
1317 Ga0068859_102386584
1318 Ga0068864_100058413
1319 Ga0068864_100411253
1320 Ga0068864_100951989
1321 Ga0068866_10361405
1322 Ga0068861_100036790
1323 Ga0068861_102480388
1324 Ga0068851_10639616
1325 Ga0068870_10029221
1326 Ga0068870_10106624
1327 Ga0068863_100030428
1328 Ga0068863_100900860
1329 Ga0068863_101174598
1330 Ga0068863_101293589
1331 Ga0068858_100244182
1332 Ga0068858_101407195
1333 Ga0068860_100248869
1334 Ga0068862_100022990
1335 Ga0068862_100031505
1336 Ga0068862_100075164
1337 Ga0068862_100557271
1338 Ga0068862_101532996
1339 Ga0081455_10059993
1340 Ga0081455_10119850
1341 Ga0081455_10247724
1342 Ga0081539_10003628
1343 Ga0070717_10018971
1344 Ga0070717_10088017
1345 Ga0070717_10098345
1346 Ga0070717_10100307
1347 Ga0070717_10327371
1348 Ga0070717_10440026
1349 Ga0075432_10086604
1350 Ga0070716_101099883
1351 Ga0070712_100001780
1352 Ga0070712_100031074
1353 Ga0070712_100072837
1354 Ga0070712_100102354
1355 Ga0070712_100270157
1356 Ga0070712_100399726
1357 Ga0097621_100330773
1358 Ga0097621_101154143
1359 Ga0097621_101430884
1360 Ga0068871_100062427
1361 Ga0068871_100574233
1362 Ga0068871_101716769
1363 Ga0075428_100041959
1364 Ga0075428_100208943
1365 Ga0075428_100263569
1366 Ga0075428_102039566
1367 Ga0075428_102193215
1368 Ga0075430_100001246
1369 Ga0075430_100008251
1370 Ga0075430_100010224
1371 Ga0075430_100026418
1372 Ga0075430_100061609
1373 Ga0075430_101730639
1374 Ga0075431_100003459
1375 Ga0075431_100007932
1376 Ga0075431_100022817
1377 Ga0075431_100029821
1378 Ga0075431_100035964
1379 Ga0075431_100060834
1380 Ga0075433_10031615
1381 Ga0075433_10416481
1382 Ga0075433_10731942
1383 Ga0075434_100015606
1384 Ga0075434_100033319
1385 Ga0075434_100061957
1386 Ga0075434_100139986
1387 Ga0075434_100141390
1388 Ga0075434_100350952
1389 Ga0075434_101566916
1390 Ga0075429_100042917
1391 Ga0075429_100226049
1392 Ga0075429_100296149
1393 Ga0075429_101400166
1394 Ga0068865_100058145
1395 Ga0068865_100796229
1396 Ga0068865_100842924
1397 Ga0075436_100002597
1398 Ga0075436_100613644
1399 Ga0097620_100230619
1400 Ga0097620_101205855
1401 Ga0097620_102386363
1402 Ga0075435_100231222
1403 Ga0075435_100982757
1404 Ga0075435_101260888
1405 Ga0075435_101727873
1406 Ga0105240_10166111
1407 Ga0105240_10285461
1408 Ga0105240_10634446
1409 Ga0105240_12574448
1410 Ga0105240_12629493
1411 Ga0111539_10045282
1412 Ga0111539_10204039
1413 Ga0111539_10204602
1414 Ga0111539_10323113
1415 Ga0111539_11114970
1416 Ga0111539_12110613
1417 Ga0105245_10116898
1418 Ga0105245_10455212
1419 Ga0105245_10933771
1420 Ga0105245_11756338
1421 Ga0105245_12401801
1422 Ga0105247_10188312
1423 Ga0105247_10399457
1424 Ga0114129_10000108
1425 Ga0114129_10019638
1426 Ga0114129_10127895
1427 Ga0114129_10605901
1428 Ga0114129_10623773
1429 Ga0114129_11422425
1430 Ga0114129_11575567
1431 Ga0114129_12185689
1432 Ga0105243_10073993
1433 Ga0105243_10179272
1434 Ga0105243_10428861
1435 Ga0105243_10863342
1436 Ga0105241_10168985
1437 Ga0105241_10251799
1438 Ga0105241_10280877
1439 Ga0105241_11393574
1440 Ga0105242_10111217
1441 Ga0105242_10827554
1442 Ga0105242_10866126
1443 Ga0105242_11206876
1444 Ga0105242_11888028
1445 Ga0105248_10186548
1446 Ga0105248_10208768
1447 Ga0105248_10405445
1448 Ga0105248_10518713
1449 Ga0105248_11037277
1450 Ga0105237_10135152
1451 Ga0105237_10227538
1452 Ga0105237_10230857
1453 Ga0105237_10250837
1454 Ga0105237_10782502
1455 Ga0105238_10021948
1456 Ga0105238_11222454
1457 Ga0105238_12736012
1458 Ga0105249_10001803
1459 Ga0105249_10024953
1460 Ga0105249_10348899
1461 Ga0105249_10426139
1462 Ga0105239_10005522
1463 Ga0105239_11253398
1464 Ga0105246_11358645
1465 Ga0157373_10268338
1466 Ga0157373_10822806
1467 Ga0157373_11090571
1468 Ga0157371_10171018
1469 Ga0157371_10556861
1470 Ga0157370_10019508
1471 Ga0157370_10127171
1472 Ga0157370_10187817
1473 Ga0157370_10251312
1474 Ga0157370_10481306
1475 Ga0157370_10514747
1476 Ga0157370_10988229
1477 Ga0157370_11557781
1478 Ga0157369_10014958
1479 Ga0157369_10036101
1480 Ga0157369_10071967
1481 Ga0157369_10148633
1482 Ga0157369_10158159
1483 Ga0157369_10217890
1484 Ga0157369_11636979
1485 Ga0157369_12106213
1486 Ga0157369_12198542
1487 Ga0157374_10436678
1488 Ga0157374_11409314
1489 Ga0157378_10005553
1490 Ga0157378_10767000
1491 Ga0157378_11248385
1492 Ga0163162_10015207
1493 Ga0163162_10020860
1494 Ga0163162_10170289
1495 Ga0163162_10397472
1496 Ga0157372_10022484
1497 Ga0157372_10075629
1498 Ga0157372_10127693
1499 Ga0157372_10141533
1500 Ga0157372_11788019
1501 Ga0157375_10265777
1502 Ga0157375_10343007
1503 Ga0157375_10440906
1504 Ga0157375_10707629
1505 Ga0157375_11189621
1506 Ga0163163_10054195
1507 Ga0157380_10011975
1508 Ga0157377_10046330
1509 Ga0157377_10260210
1510 Ga0157377_10460730
1511 Ga0157376_11238795
1512 Ga0182007_10013374
1513 Ga0182007_10407405
1514 Ga0163161_10303897
1515 Ga0206356_11074160
1516 Ga0206354_11242480
1517 Ga0206354_11632838
1518 Ga0213876_10010507
1519 Ga0213876_10082378
1520 Ga0213876_10535579
1521 Ga0213876_10722006
1522 Ga0207697_10000506
1523 Ga0207656_10003452
1524 Ga0207656_10293393
1525 Ga0207656_10565978
1526 Ga0207682_10204752
1527 Ga0207682_10363305
1528 Ga0207692_10208554
1529 Ga0207692_10364490
1530 Ga0207692_10589557
1531 Ga0207680_10228371
1532 Ga0207680_10932259
1533 Ga0207699_10024126
1534 Ga0207699_10100901
1535 Ga0207699_10179416
1536 Ga0207699_10514101
1537 Ga0207699_10947164
1538 Ga0207645_10000806
1539 Ga0207645_10328092
1540 Ga0207645_10477869
1541 Ga0207643_10008399
1542 Ga0207643_10050337
1543 Ga0207705_10191690
1544 Ga0207705_10369356
1545 Ga0207705_10628704
1546 Ga0207705_11166823
1547 Ga0207705_11476316
1548 Ga0207684_10333169
1549 Ga0207654_10471431
1550 Ga0207707_10000446
1551 Ga0207707_10011313
1552 Ga0207707_10038403
1553 Ga0207707_10098039
1554 Ga0207707_10099183
1555 Ga0207707_10112466
1556 Ga0207707_10173747
1557 Ga0207707_10202495
1558 Ga0207707_10242012
1559 Ga0207707_10267917
1560 Ga0207707_10430121
1561 Ga0207707_10509709
1562 Ga0207707_10524728
1563 Ga0207707_10618589
1564 Ga0207707_11423692
1565 Ga0207695_10007337
1566 Ga0207695_10017899
1567 Ga0207695_10045596
1568 Ga0207695_10083254
1569 Ga0207695_10986244
1570 Ga0207695_11511985
1571 Ga0207671_10181512
1572 Ga0207693_10013442
1573 Ga0207693_10017163
1574 Ga0207693_10025634
1575 Ga0207693_10053818
1576 Ga0207693_10100466
1577 Ga0207693_10154432
1578 Ga0207693_10269269
1579 Ga0207663_10120523
1580 Ga0207663_10134163
1581 Ga0207663_10202177
1582 Ga0207660_10021178
1583 Ga0207660_10028616
1584 Ga0207660_10029908
1585 Ga0207660_10097702
1586 Ga0207660_10177788
1587 Ga0207660_10257714
1588 Ga0207660_10954969
1589 Ga0207660_11352604
1590 Ga0207660_11711733
1591 Ga0207662_10006233
1592 Ga0207662_10009077
1593 Ga0207657_10010879
1594 Ga0207657_10020035
1595 Ga0207657_10088573
1596 Ga0207657_10730720
1597 Ga0207657_11373933
1598 Ga0207649_10003029
1599 Ga0207649_10127306
1600 Ga0207649_10173801
1601 Ga0207649_10230494
1602 Ga0207649_10559167
1603 Ga0207649_10598380
1604 Ga0207652_10001795
1605 Ga0207652_10014530
1606 Ga0207652_10017760
1607 Ga0207652_10060559
1608 Ga0207652_10162288
1609 Ga0207652_10168592
1610 Ga0207652_10271253
1611 Ga0207652_10283508
1612 Ga0207652_10344643
1613 Ga0207652_10436791
1614 Ga0207652_10455397
1615 Ga0207652_10472183
1616 Ga0207652_10536530
1617 Ga0207652_10893999
1618 Ga0207652_11144107
1619 Ga0207652_11212985
1620 Ga0207652_11304120
1621 Ga0207652_11398573
1622 Ga0207681_10014089
1623 Ga0207681_10381158
1624 Ga0207681_10412972
1625 Ga0207681_10939521
1626 Ga0207694_10020386
1627 Ga0207694_10297193
1628 Ga0207694_10330119
1629 Ga0207694_10816705
1630 Ga0207650_10038022
1631 Ga0207650_10053887
1632 Ga0207650_10287913
1633 Ga0207650_11253481
1634 Ga0207659_10008926
1635 Ga0207659_10093809
1636 Ga0207659_10115609
1637 Ga0207659_10286217
1638 Ga0207659_11045992
1639 Ga0207700_10001125
1640 Ga0207700_10014894
1641 Ga0207700_10018913
1642 Ga0207700_10027507
1643 Ga0207700_10138460
1644 Ga0207700_10178537
1645 Ga0207700_10434322
1646 Ga0207700_10982924
1647 Ga0207664_10003681
1648 Ga0207664_10027904
1649 Ga0207664_10157139
1650 Ga0207664_10199414
1651 Ga0207664_10366281
1652 Ga0207664_10385810
1653 Ga0207664_11514889
1654 Ga0207644_10108507
1655 Ga0207690_10037327
1656 Ga0207690_10040818
1657 Ga0207690_10271790
1658 Ga0207690_10309248
1659 Ga0207690_11311991
1660 Ga0207706_10000642
1661 Ga0207706_10029596
1662 Ga0207706_10054583
1663 Ga0207706_10110444
1664 Ga0207686_10238636
1665 Ga0207686_10290942
1666 Ga0207686_10361089
1667 Ga0207709_10042008
1668 Ga0207709_10340932
1669 Ga0207670_10153735
1670 Ga0207670_11225685
1671 Ga0207669_10401232
1672 Ga0207704_10444780
1673 Ga0207704_10508969
1674 Ga0207665_10580473
1675 Ga0207691_10001241
1676 Ga0207691_10040865
1677 Ga0207691_10041381
1678 Ga0207691_10042609
1679 Ga0207691_10138492
1680 Ga0207691_11024063
1681 Ga0207711_10190450
1682 Ga0207711_10203192
1683 Ga0207711_11133787
1684 Ga0207689_10003004
1685 Ga0207689_11054354
1686 Ga0207689_11650690
1687 Ga0207661_10023403
1688 Ga0207661_10078459
1689 Ga0207661_10084601
1690 Ga0207661_10087673
1691 Ga0207661_10096650
1692 Ga0207661_10099539
1693 Ga0207661_10103028
1694 Ga0207661_10108565
1695 Ga0207661_10148766
1696 Ga0207661_10161672
1697 Ga0207661_10239488
1698 Ga0207661_10246218
1699 Ga0207661_10281172
1700 Ga0207661_10283196
1701 Ga0207661_10308365
1702 Ga0207661_10588575
1703 Ga0207661_10608537
1704 Ga0207661_10709318
1705 Ga0207679_10000744
1706 Ga0207679_10002584
1707 Ga0207679_10025586
1708 Ga0207679_10053501
1709 Ga0207679_10130307
1710 Ga0207679_10146426
1711 Ga0207679_10149045
1712 Ga0207679_10166098
1713 Ga0207679_10422190
1714 Ga0207679_10773892
1715 Ga0207679_11098876
1716 Ga0207667_10041659
1717 Ga0207667_10081200
1718 Ga0207667_10159252
1719 Ga0207667_10463734
1720 Ga0207667_10478352
1721 Ga0207667_10709749
1722 Ga0207667_11176865
1723 Ga0207667_11279996
1724 Ga0207667_11637450
1725 Ga0207651_10023403
1726 Ga0207651_10419304
1727 Ga0207651_11044652
1728 Ga0207651_11154002
1729 Ga0207651_12148872
1730 Ga0207712_10013924
1731 Ga0207712_10100047
1732 Ga0207712_10949633
1733 Ga0207668_10123749
1734 Ga0207668_10130482
1735 Ga0207640_10155786
1736 Ga0207640_10237695
1737 Ga0207658_10045199
1738 Ga0207677_10413535
1739 Ga0207677_10587857
1740 Ga0207703_10822928
1741 Ga0207639_10013899
1742 Ga0207639_10227013
1743 Ga0207678_10095867
1744 Ga0207678_10343515
1745 Ga0207678_10604618
1746 Ga0207678_11039049
1747 Ga0207708_10017851
1748 Ga0207708_10488442
1749 Ga0207702_10006041
1750 Ga0207702_10321268
1751 Ga0207702_10369937
1752 Ga0207702_11242249
1753 Ga0207702_11728833
1754 Ga0207641_10342624
1755 Ga0207641_11914188
1756 Ga0207641_12394448
1757 Ga0207648_10007064
1758 Ga0207648_10079503
1759 Ga0207648_10124382
1760 Ga0207648_10495769
1761 Ga0207676_10441149
1762 Ga0207676_10643912
1763 Ga0207676_10909543
1764 Ga0207674_10000828
1765 Ga0207674_10002108
1766 Ga0207674_10020165
1767 Ga0207674_10682363
1768 Ga0207674_12151806
1769 Ga0207675_100002863
1770 Ga0207675_100011177
1771 Ga0207675_101343560
1772 Ga0207683_10348776
1773 Ga0207683_10500016
1774 Ga0207698_10053772
1775 Ga0207698_10120525
1776 Ga0207698_10246043
1777 Ga0207698_10622652
1778 Ga0207428_10046578
1779 Ga0268266_10782134
1780 Ga0268266_10870065
1781 Ga0268266_11075645
1782 Ga0268266_11540843
1783 Ga0268265_10006098
1784 Ga0268265_10017756
1785 Ga0307408_100002224
1786 Ga0307408_100087966
1787 Ga0307408_100105322
1788 Ga0307408_100346513
1789 Ga0307405_10107243
1790 Ga0307405_10608656
1791 Ga0307413_10885025
1792 Ga0307413_11483750
1793 Ga0307406_10114219
1794 Ga0307406_10645623
1795 Ga0307406_10767915
1796 Ga0307406_10848901
1797 Ga0307412_10016067
1798 Ga0307412_11149067
1799 Ga0307409_101561762
1800 Ga0307409_102683232
1801 Ga0307416_100002716
1802 Ga0307416_100247709
1803 Ga0307416_101450893
1804 Ga0307416_102315287
1805 Ga0307416_103818975
1806 Ga0307414_10464528
1807 Ga0307414_11789422
1808 Ga0307411_10600007
1809 Ga0307411_10934185
1810 Ga0307411_11822931
1811 Ga0373926_0349372
1812 Ga0373934_0001697
1813 Ga0373934_0010899
1814 Ga0373944_0013225
1815 Ga0373944_0221338
1816 Ga0373923_0080629
1817 Ga0373954_0030416
1818 Ga0373954_0107995
1819 Ga0373956_0247527
1820 Ga0373957_0052445
1821 Ga0373943_0007622
1822 Ga0373943_0099213
1823 Ga0373943_0189246
1824 Ga0373946_0005526
1825 Ga0373955_0001562
1826 Ga0373955_0003382
1827 Ga0373961_0022669
1828 Ga0373924_0039793
1829 Ga0373924_0134466
1830 Ga0373924_0460907
1831 Ga0373935_0019593
1832 Ga0373935_0056589
1833 Ga0373927_0016665
1834 Ga0373927_0034129
1835 Ga0373927_0142390
1836 Ga0373933_0024987
1837 Ga0373933_0117735
1838 Ga0373933_0161066
1839 Ga0373947_0037105
1840 Ga0373947_0071903
1841 Ga0373947_0181577
1842 Ga0373947_0585307
1843 Ga0373947_0735980
1844 Ga0373937_0000184
1845 Ga0373937_0016269
1846 Ga0373937_0297348
1847 Ga0373937_1765512
1848 Ga0373925_0023122
1849 Ga0373925_0104496
1850 Ga0373925_0141404
1851 Ga0395905_0375727
1852 Ga0395905_1238046
1853 Ga0436365_0192547
1854 Ga0436365_0580076
1855 Ga0436365_0610992
1856 Ga0436365_0785923
1857 Ga0436365_1666798
1858 Ga0439436_0161934
1859 Ga0439439_0026870
1860 Ga0451807_2041370
1861 Ga0439448_0271018
1862 Ga0439449_0124874
1863 Ga0439462_0146272
1864 Ga0466963_0152403
1865 Ga0466963_0293161
1866 Ga0466957_0162900
1867 Ga0466957_0295250
1868 Ga0466957_0599814
1869 Ga0451576_0098807
1870 Ga0451576_0152519
1871 Ga0451576_0948262
1872 Ga0451576_1270974
1873 Ga0466958_0118811
1874 Ga0466958_1119814
1875 Ga0466967_0014965
1876 Ga0466967_0024085
1877 Ga0466967_0078180
1878 Ga0466967_0080702
1879 Ga0466967_0356512
1880 Ga0466967_0373740
1881 Ga0466967_0404128
1882 Ga0466967_0471671
1883 Ga0466967_0535564
1884 Ga0466967_0547852
1885 Ga0466967_0631105
1886 Ga0466967_0661224
1887 Ga0466967_0672006
1888 Ga0466967_0720133
1889 Ga0466967_1449451
1890 Ga0495603_0006890
1891 Ga0495629_0045141
1892 Ga0495629_0186267
1893 Ga0495638_0215828
1894 Ga0495651_0027216
1895 Ga0495651_0036250
1896 Ga0495653_0044983
1897 Ga0495580_0003643
1898 Ga0495580_0238343
1899 Ga0495580_0283508
1900 Ga0495580_0481574
1901 Ga0495582_0017540
1902 Ga0495582_0024867
1903 Ga0495639_0000731
1904 Ga0495639_0009668
1905 Ga0495639_0043467
1906 Ga0495639_0101210
1907 Ga0495662_0281176
1908 Ga0495664_0031121
1909 Ga0495664_0205531
1910 Ga0495594_0003763
1911 Ga0495594_0004014
1912 Ga0495594_0012370
1913 Ga0495594_0088601
1914 Ga0495594_0106248
1915 Ga0495594_0325817
1916 Ga0495594_0870808
1917 Ga0495608_0153348
1918 Ga0495618_0017804
1919 Ga0495630_0016699
1920 Ga0495630_0068286
1921 Ga0495630_0506393
1922 Ga0495630_0731782
1923 Ga0495652_0008474
1924 Ga0495665_0000680
1925 Ga0495665_0035992
1926 Ga0495586_0014535
1927 Ga0495586_0193553
1928 Ga0495587_0007425
1929 Ga0495587_0012777
1930 Ga0495645_0000075
1931 Ga0495645_0004610
1932 Ga0495645_0580067
1933 Ga0495667_0148328
1934 Ga0495667_0234221
1935 Ga0495667_0302228
1936 Ga0495625_0006357
1937 Ga0495625_0569452
1938 Ga0495635_0633480
1939 Ga0495659_0144161
1940 Ga0495588_0001797
1941 Ga0495657_0144402
1942 Ga0495599_0022381
1943 Ga0495599_0031228
1944 Ga0495623_0002632
1945 Ga0495623_0093284
1946 Ga0495623_0138721
1947 Ga0495658_0001809
1948 Ga0495658_0694404
1949 Ga0495613_0035559
1950 Ga0495613_0230752
1951 Ga0495613_0650279
1952 Ga0495600_0058838
1953 Ga0495600_0120213
1954 Ga0495581_0000907
1955 Ga0495581_0120499
1956 Ga0495581_0490531
1957 Ga0495604_0011842
1958 Ga0495636_0205372
1959 Ga0495636_0418441
1960 Ga0495674_0209886
1961 Ga0495674_1033563
1962 Ga0495672_0001955
1963 Ga0495675_0005109
1964 Ga0495675_0018536
1965 Ga0495684_0004467
1966 Ga0495684_0174478
1967 Ga0495593_0002611
1968 Ga0495602_0048052
1969 Ga0495602_0147100
1970 Ga0495602_0252177
1971 Ga0495602_0890459
1972 Ga0495614_0006061
1973 Ga0496102_1336613
1974 Ga0496105_0114376
1975 Ga0496108_0607502
1976 Ga0496109_0339335
1977 Ga0496115_0937963
1978 Ga0501290_083955
1979 Ga0501298_047944
1980 Ga0501033_1015968
1981 Ga0501034_0168396
1982 Ga0501039_1056364
1983 Ga0501040_0551428
1984 Ga0501047_0115202
1985 Ga0501069_1026590
1986 Ga0501070_0052614
1987 Ga0501070_0576572
1988 Ga0501072_1043675
1989 Ga0501073_0322990
1990 Ga0501076_0934055
1991 Ga0501207_146930
1992 Ga0501256_017387
1993 Ga0501225_0061625
1994 Ga0501234_091493
1995 Ga0501080_0573122
1996 Ga0501263_010679
1997 Ga0501035_1298108
1998 Ga0501044_1161278
1999 nmdc:mga05p37_1431_c1
2000 nmdc:mga05p37_216172_c1
2001 nmdc:mga05p37_28300_c1
2002 nmdc:mga05p37_558227_c1
2003 nmdc:mga09592_1045006_c1
2004 nmdc:mga09592_11847_c1
2005 nmdc:mga09592_17358_c1
2006 nmdc:mga09592_17584_c1
2007 nmdc:mga09592_966359_c1
2008 nmdc:mga0qj67_135767_c1
2009 nmdc:mga0qj67_1486765_c1
2010 nmdc:mga0qj67_161573_c1
2011 nmdc:mga0qj67_2379_c1
2012 nmdc:mga0qj67_9693_c1
2013 nmdc:mga06r32_12948_c1
2014 nmdc:mga06r32_13823_c1
2015 nmdc:mga06r32_1868115_c1
2016 nmdc:mga06r32_23989_c1
2017 nmdc:mga06r32_82916_c1
2018 nmdc:mga06r32_978106_c1
2019 nmdc:mga08y16_236469_c1
2020 nmdc:mga08y16_311992_c1
2021 nmdc:mga08y16_44448_c1
2022 nmdc:mga08y16_68779_c1
2023 nmdc:mga0n895_1381229_c1
2024 nmdc:mga0n895_1479396_c1
2025 nmdc:mga0n895_160169_c1
2026 nmdc:mga0n895_192475_c1
2027 nmdc:mga0n895_210785_c1
2028 nmdc:mga0n895_392074_c1
2029 nmdc:mga0rr50_1382001_c1
2030 nmdc:mga0rr50_1418959_c1
2031 nmdc:mga08x19_265991_c1
2032 nmdc:mga08x19_689832_c1
2033 nmdc:mga0a205_11822_c1
2034 nmdc:mga0a205_164972_c1
2035 nmdc:mga0a205_28356_c1
2036 Ga0495601_0229170
2037 Ga0495601_0890823
2038 Ga0495612_0017223
2039 Ga0495595_0046497
2040 Ga0495595_0509707
2041 Ga0495619_0080505
2042 Ga0495619_0715101
2043 Ga0466962_0618871
2044 Ga0530510_0329264

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

38

112

0.97

PF13463

HTH_27

Winged helix DNA-binding domain

53

106

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9075 10 104
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9016 9 107
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.8994 10 104
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.8967 9 105
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.884 9 108
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8994 10 104 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8787 10 113 1.10.10.10
2p4wB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8664 11 82 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8655 9 82 1.10.10.10
af_Q9SU39_105_239_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8578 65 80 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A2V8EA09-F1-model_v4 PadR family transcriptional regulator 1.002 11 88
AF-A0A1F2TUG0-F1-model_v4 PadR family transcriptional regulator 0.9953 11 109
AF-A0A843TB24-F1-model_v4 PadR family transcriptional regulator 0.9909 11 109
AF-A0A2N9MU15-F1-model_v4 Transcriptional regulator, PadR family 0.9908 16 107
AF-E8V6A6-F1-model_v4 Transcriptional regulator, PadR-like family 0.9894 9 111

Map