F488403

General Info

Members Datasets Scaffolds Average Seq Length
1021 774 461 379

Family's Representative Sequence

Representative Sequence 3300046530|Ga0495654_0000758|Ga0495654_0000758_16162_17409
Length 415
Sequence MGNADNPTGAGGQSSDPYGKAEVLPASVDLVIVGGGIMGLWAAVKAERRGIRTVLVDAGLLGQGTSGGLLGALMPHMPDKWNDKKQFQFDALLSLQDEVAAIEAATGLSCGYRRSGRLIPLPKPHLRAIALRYNQEAVTNWYPGPEGDRGSDGDQGGRRFRWDVLDQSPHAGWPDVSFIEAGLVHDTFAARVSPRKLTAALAAALRAGRHVTIAEGLEVQRIDAGAGRIEFSDGGKITFGTCIVAAGHRAFPLIEGVSAPLAHPLGQPVKGQAALLRAGIDPDLPLLYLNGLYLVPHDNGDVALGSTSEEEFDEPFSTDTKLDDLVEKARALVPALAAAPVIERWAGLRPKAIDRDPMVGPHPDHANVIALGGGFKVSFGIAHLLADAALEALAGKPMAVPASFSLVNHMAAASR

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
11 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
12 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
13 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
14 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
15 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
16 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
17 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
18 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
19 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
20 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
21 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
22 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
23 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
24 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
25 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
26 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
27 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
28 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
29 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
30 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
31 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
32 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
33 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
34 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
35 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
36 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
37 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
38 2516143018 Ensifer sp. BR816 Isolate Nodule
39 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
40 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
41 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
42 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
43 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
44 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
45 2519899620 Rhizobium sp. Pop5 Isolate Nodule
46 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
47 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
48 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
49 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
50 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
51 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
52 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
53 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
54 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
55 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
56 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
57 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
58 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
59 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
60 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
61 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
62 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
63 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
64 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
65 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
66 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
67 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
68 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
69 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
70 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
71 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
72 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
73 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
74 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
75 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
76 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
77 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
78 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
79 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
80 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
81 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
82 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
83 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
84 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
85 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
86 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
87 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
88 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
89 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
90 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
91 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
92 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
93 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
94 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
95 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
96 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
97 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
98 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
99 2643221557 Ensifer sp. Root558 Isolate Unclassified
100 2643221558 Rhizobium sp. Root149 Isolate Unclassified
101 2643221568 Rhizobium sp. Root564 Isolate Unclassified
102 2643221582 Rhizobium sp. Root651 Isolate Unclassified
103 2643221599 Rhizobium sp. Root708 Isolate Unclassified
104 2643221607 Rhizobium sp. Root73 Isolate Unclassified
105 2643221610 Ensifer sp. Root74 Isolate Unclassified
106 2643221618 Ensifer sp. Root231 Isolate Unclassified
107 2643221626 Ensifer sp. Root31 Isolate Unclassified
108 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
109 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
110 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
111 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
112 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
113 2643221655 Ensifer sp. Root1252 Isolate Unclassified
114 2643221659 Ensifer sp. Root127 Isolate Unclassified
115 2643221668 Ensifer sp. Root423 Isolate Unclassified
116 2643221675 Ensifer sp. Root1298 Isolate Unclassified
117 2643221680 Ensifer sp. Root1312 Isolate Unclassified
118 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
119 2643221688 Rhizobium sp. Root482 Isolate Unclassified
120 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
121 2643221693 Rhizobium sp. Root491 Isolate Unclassified
122 2643221698 Ensifer sp. Root142 Isolate Unclassified
123 2643221712 Ensifer sp. Root258 Isolate Unclassified
124 2643221718 Rhizobium sp. Root268 Isolate Unclassified
125 2643221719 Rhizobium sp. Root274 Isolate Unclassified
126 2643221723 Ensifer sp. Root278 Isolate Unclassified
127 2643221726 Ensifer sp. Root954 Isolate Unclassified
128 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
129 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
130 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
131 2718217882 Rhizobium sp. N741 Isolate Nodule
132 2718217927 Rhizobium sp. N324 Isolate Nodule
133 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
134 2718218009 Rhizobium sp. N561 Isolate Nodule
135 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
136 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
137 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
138 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
139 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
140 2718218363 Rhizobium sp. N113 Isolate Nodule
141 2718218365 Rhizobium sp. N731 Isolate Nodule
142 2718218366 Rhizobium sp. N621 Isolate Nodule
143 2718218423 Rhizobium sp. N941 Isolate Nodule
144 2721755514 Rhizobium sp. N6212 Isolate Nodule
145 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
146 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
147 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
148 2721755809 Rhizobium sp. N541 Isolate Nodule
149 2721755810 Rhizobium sp. N871 Isolate Nodule
150 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
151 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
152 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
153 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
154 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
155 2728369365 Rhizobium sp. N1341 Isolate Nodule
156 2728369397 Rhizobium sp. N1314 Isolate Nodule
157 2738541293 Rhizobium sp. GV031 Isolate Unclassified
158 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
159 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
160 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
161 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
162 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
163 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
164 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
165 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
166 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
167 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
168 2791355256 Rhizobium sp. M10 Isolate Nodule
169 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
170 2791355260 Rhizobium sp. L9 Isolate Nodule
171 2791355261 Rhizobium sp. J15 Isolate Nodule
172 2791355262 Rhizobium sp. M1 Isolate Nodule
173 2791355263 Rhizobium chutanense C5 Isolate Nodule
174 2791355264 Rhizobium sp. S9 Isolate Nodule
175 2791355265 Rhizobium sp. H4 Isolate Nodule
176 2791355266 Rhizobium sp. L43 Isolate Nodule
177 2791355267 Rhizobium sp. L18 Isolate Nodule
178 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
179 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
180 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
181 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
182 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
183 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
184 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
185 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
186 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
187 2802429633 Rhizobium anhuiense J3 Isolate Nodule
188 2802429634 Rhizobium anhuiense S10 Isolate Nodule
189 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
190 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
191 2802429637 Rhizobium anhuiense C15 Isolate Nodule
192 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
193 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
194 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
195 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
196 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
197 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
198 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
199 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
200 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
201 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
202 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
203 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
204 2838048938 Rhizobium pisi 27/80 Isolate Nodule
205 2838061910 Rhizobium phaseoli L15 Isolate Nodule
206 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
207 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
208 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
209 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
210 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
211 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
212 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
213 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
214 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
215 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
216 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
217 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
218 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
219 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
220 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
221 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
222 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
223 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
224 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
225 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
226 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
227 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
228 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
229 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
230 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
231 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
232 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
233 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
234 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
235 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
236 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
237 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
238 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
239 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
240 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
241 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
242 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
243 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
244 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
245 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
246 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
247 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
248 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
249 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
250 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
251 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
252 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
253 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
254 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
255 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
256 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
257 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
258 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
259 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
260 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
261 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
262 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
263 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
264 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
265 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
266 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
267 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
268 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
269 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
270 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
271 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
272 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
273 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
274 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
275 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
276 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
277 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
278 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
279 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
280 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
281 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
282 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
283 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
284 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
285 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
286 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
287 2844163670 Ensifer sp. 1H6 Isolate Unclassified
288 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
289 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
290 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
291 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
292 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
293 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
294 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
295 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
296 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
297 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
298 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
299 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
300 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
301 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
302 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
303 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
304 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
305 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
306 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
307 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
308 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
309 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
310 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
311 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
312 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
313 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
314 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
315 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
316 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
317 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
318 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
319 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
320 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
321 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
322 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
323 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
324 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
325 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
326 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
327 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
328 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
329 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
330 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
331 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
332 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
333 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
334 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
335 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
336 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
337 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
338 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
339 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
340 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
341 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
342 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
343 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
344 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
345 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
346 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
347 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
348 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
349 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
350 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
351 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
352 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
353 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
354 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
355 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
356 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
357 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
358 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
359 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
360 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
361 2933599457 Rhizobium phaseoli M3 Isolate Nodule
362 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
363 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
364 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
365 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
366 2936381700 Rhizobium chutanense C16 Isolate Unclassified
367 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
368 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
369 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
370 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
371 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
372 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
373 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
374 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
375 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
376 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
377 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
378 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
379 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
380 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
381 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
382 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
383 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
384 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
385 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
386 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
387 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
388 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
389 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
390 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
391 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
392 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
393 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
394 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
395 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
396 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
397 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
398 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
399 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
400 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
401 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
402 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
403 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
404 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
405 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
406 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
407 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
408 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
409 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
410 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
411 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
412 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
413 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
414 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
415 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
416 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
417 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
418 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
419 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
420 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
421 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
422 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
423 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
424 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
425 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
426 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
427 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
428 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
429 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
430 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
431 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
432 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
433 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
434 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
435 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
436 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
437 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
438 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
439 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
440 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
441 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
442 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
443 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
444 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
445 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
446 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
447 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
448 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
449 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
450 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
451 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
452 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
453 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
454 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
455 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
456 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
457 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
458 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
459 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
460 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
461 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
462 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
463 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
464 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
465 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
466 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
467 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
468 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
469 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
470 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
471 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
472 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
473 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
474 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
475 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
476 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
477 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
478 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
479 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
480 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
481 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
482 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
483 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
484 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
485 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
486 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
487 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
488 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
489 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
490 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
491 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
492 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
493 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
494 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
495 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
496 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
497 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
498 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
499 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
500 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
501 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
502 2996887358 Rhizobium sp. R711 Isolate Nodule
503 2996893221 Rhizobium sp. R635 Isolate Nodule
504 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
505 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
506 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
507 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
508 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
509 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
510 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
511 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
512 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
513 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
514 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
515 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
516 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
517 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
518 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
519 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
520 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
521 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
522 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
523 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
524 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
525 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
526 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
527 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
528 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
529 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
530 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
531 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
532 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
533 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
534 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
535 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
536 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
537 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
538 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
539 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
540 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
541 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
542 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
543 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
544 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
545 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
546 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
547 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
548 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
549 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
550 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
551 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
552 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
553 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
554 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
555 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
556 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
557 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
558 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
559 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
560 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
561 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
562 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
563 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
564 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
565 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
566 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
567 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
568 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
569 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
570 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
571 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
572 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
573 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
574 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
575 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
576 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
577 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
578 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
579 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
580 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
581 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
582 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
583 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
584 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
585 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
586 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
587 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
588 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
589 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
590 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
591 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
592 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
593 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
594 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
595 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
596 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
597 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
598 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
599 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
600 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
601 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
602 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
603 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
604 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
605 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
606 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
607 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
608 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
609 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
610 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
611 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
612 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
613 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
614 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
615 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
616 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
617 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
618 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
619 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
620 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
621 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
622 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
623 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
624 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
625 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
626 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
627 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
628 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
629 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
630 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
631 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
632 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
633 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
634 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
635 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
636 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
637 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
638 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
639 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
640 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
641 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
642 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
643 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
644 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
645 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
646 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
647 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
648 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
649 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
650 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
651 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
652 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
653 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
654 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
655 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
656 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
657 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
658 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
659 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
660 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
661 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
662 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
663 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
664 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
665 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
666 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
667 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
668 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
669 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
670 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
671 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
672 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
673 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
674 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
675 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
676 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
677 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
678 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
679 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
680 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
681 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
682 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
683 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
684 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
685 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
686 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
687 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
688 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
689 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
690 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
691 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
692 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
693 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
694 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
695 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
696 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
697 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
698 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
699 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
700 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
701 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
702 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
703 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
704 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
705 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
706 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
707 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
708 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
709 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
710 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
711 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
712 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
713 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
714 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
715 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
716 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
717 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
718 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
719 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
720 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
721 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
722 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
723 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
724 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
725 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
726 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
727 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
728 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
729 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
730 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
731 8005258706 Rhizobium sp. R693 Isolate Nodule
732 8005275841 Rhizobium sp. N4311 Isolate Nodule
733 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
734 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
735 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
736 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
737 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
738 8005321885 Rhizobium sp. R72 Isolate Nodule
739 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
740 8005382845 Rhizobium sp. R634 Isolate Nodule
741 8005395548 Rhizobium sp. R339 Isolate Nodule
742 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
743 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
744 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
745 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
746 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
747 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
748 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
749 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
750 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
751 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
752 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
753 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
754 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
755 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
756 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
757 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
758 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
759 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
760 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
761 8018176218 Rhizobium sp. N122 Isolate Nodule
762 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
763 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
764 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
765 8024501048 Rhizobium sp. H4 Isolate Nodule
766 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
767 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
768 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
769 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
770 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
771 8056382006 Rhizobium croatiense 13T Isolate Nodule
772 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
773 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
774 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 45.15
Metatranscriptomes 0
Isolates 54.85

Biome Distribution

Category Percentage (%)
Aerial Root 0.49
Bulb 0
Endosphere 17.73
Nodule 41.92
Rhizoplane 2.45
Rhizosphere 16.36
Stem 0
Stem Tuber 0
Unclassified 21.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007862 3300001979 Bacteria 4302
2 JGI25155J39150_1000014 3300002704 Bacteria 196159
3 JGI25156J39149_1000083 3300002705 Bacteria 70138
4 JGI25162J39368_1000217 3300002737 Bacteria 59945
5 JGI25162J39368_1000272 3300002737 Bacteria 49890
6 JGI25162J39368_1000416 3300002737 Bacteria 34791
7 JGI25154J39366_1000052 3300002738 Bacteria 120209
8 JGI25158J39367_1000097 3300002739 Bacteria 20403
9 JGI25157J39369_1000110 3300002741 Bacteria 69643
10 JGI25152J39213_1002158 3300002773 Bacteria 7716
11 JGI25152J39213_1005874 3300002773 Bacteria 3469
12 JGI25152J39213_1019264 3300002773 Bacteria 1244
13 JGI25152J39213_1019273 3300002773 Bacteria 1244
14 JGI25150J39212_1000100 3300002774 Bacteria 49138
15 JGI25150J39212_1002765 3300002774 Bacteria 4262
16 JGI25159J45721_1000004 3300002987 Bacteria 215789
17 JGI25159J45721_1002615 3300002987 Bacteria 6738
18 JGI25151J46595_10000146 3300003187 Bacteria 93373
19 JGI25151J46595_10003013 3300003187 Bacteria 9572
20 JGI25151J46595_10012519 3300003187 Bacteria 3855
21 JGI25151J46595_10017075 3300003187 Bacteria 3159
22 JGI25151J46595_10020722 3300003187 Bacteria 2766
23 JGI25165J46597_1000363 3300003214 Bacteria 50542
24 JGI25165J46597_1000767 3300003214 Bacteria 24591
25 JGI25153J46596_10000764 3300003215 Bacteria 19680
26 JGI25153J46596_10002359 3300003215 Bacteria 10937
27 JGI25153J46596_10004820 3300003215 Bacteria 7185
28 JGI25153J46596_10048278 3300003215 Bacteria 1244
29 JGI25153J46596_10048289 3300003215 Bacteria 1244
30 rootH1_10055212 3300003316 Bacteria 2479
31 rootH2_10026824 3300003320 Bacteria 1393
32 rootH1_10042649 3300003323 Bacteria 1697
33 JGI25160J50197_1000021 3300003354 Bacteria 215789
34 JGI25160J50197_1000351 3300003354 Bacteria 30617
35 JGI25160J50197_1006792 3300003354 Bacteria 4582
36 JGI25160J50197_1008702 3300003354 Bacteria 3844
37 JGI25161J50226_1000167 3300003374 Bacteria 45203
38 JGI25161J50226_1000534 3300003374 Bacteria 16346
39 Ga0055526_1000842 3300003771 Bacteria 22899
40 Ga0055526_1003643 3300003771 Bacteria 9648
41 Ga0055526_1004423 3300003771 Bacteria 8446
42 Ga0055524_1000572 3300003775 Bacteria 27327
43 Ga0055524_1002425 3300003775 Bacteria 9616
44 Ga0055524_1003892 3300003775 Bacteria 7079
45 Ga0055524_1017337 3300003775 Bacteria 2544
46 Ga0055536_1001497 3300003781 Bacteria 14045
47 Ga0055536_1010331 3300003781 Bacteria 3720
48 Ga0055528_1000158 3300003790 Bacteria 56769
49 Ga0055528_1000707 3300003790 Bacteria 23679
50 Ga0055528_1000749 3300003790 Bacteria 22632
51 Ga0055528_1003189 3300003790 Bacteria 8389
52 Ga0055540_1000518 3300003792 Bacteria 29203
53 Ga0055540_1006013 3300003792 Bacteria 4916
54 Ga0055540_1018452 3300003792 Bacteria 1911
55 Ga0055531_10001986 3300003794 Bacteria 14211
56 Ga0058692_1004992 3300003856 Bacteria 3843
57 Ga0055543_1000060 3300004625 Bacteria 98330
58 Ga0055543_1000102 3300004625 Bacteria 73861
59 Ga0055543_1000699 3300004625 Bacteria 17145
60 Ga0065165_1000033 3300005262 Bacteria 215827
61 Ga0065165_1002490 3300005262 Bacteria 15444
62 Ga0065165_1004363 3300005262 Bacteria 8852
63 Ga0065165_1007452 3300005262 Bacteria 5371
64 Ga0065165_1008586 3300005262 Bacteria 4748
65 Ga0070670_100001104 3300005331 Bacteria 21445
66 Ga0070668_100155931 3300005347 Bacteria 1850
67 Ga0070663_100013668 3300005455 Bacteria 5186
68 Ga0070665_100007074 3300005548 Bacteria 11401
69 Ga0070665_100069762 3300005548 Bacteria 3523
70 Ga0068856_100036153 3300005614 Bacteria 4843
71 Ga0075365_10005037 3300006038 Bacteria 7086
72 Ga0075365_10010140 3300006038 Bacteria 5469
73 Ga0075363_100011370 3300006048 Bacteria 4260
74 Ga0075363_100024884 3300006048 Bacteria 3047
75 Ga0075364_10000029 3300006051 Bacteria 50718
76 Ga0075362_10009629 3300006177 Bacteria 3743
77 Ga0075362_10012636 3300006177 Bacteria 3360
78 Ga0075367_10000779 3300006178 Bacteria 12517
79 Ga0075369_10042472 3300006186 Bacteria 1949
80 Ga0075366_10003058 3300006195 Bacteria 8734
81 Ga0075370_10003951 3300006353 Bacteria 7122
82 Ga0075370_10108910 3300006353 Bacteria 1608
83 Ga0079104_1000015 3300006946 Bacteria 321803
84 Ga0079104_1006455 3300006946 Bacteria 4434
85 Ga0099826_10000462 3300006948 Bacteria 19553
86 Ga0099826_10010687 3300006948 Bacteria 6885
87 Ga0105251_10010023 3300009011 Bacteria 5538
88 Ga0105240_10000014 3300009093 Bacteria 482033
89 Ga0105243_10130163 3300009148 Bacteria 2134
90 Ga0105248_10251851 3300009177 Bacteria 1988
91 Ga0105237_10002158 3300009545 Bacteria 24754
92 Ga0123341_1000035 3300009765 Bacteria 62072
93 Ga0123342_1009440 3300009766 Bacteria 11684
94 Ga0123342_1014884 3300009766 Bacteria 7280
95 Ga0105239_10016073 3300010375 Bacteria 8280
96 Ga0157371_10000017 3300013102 Bacteria 320830
97 Ga0157370_10000329 3300013104 Bacteria 59662
98 Ga0157370_10001031 3300013104 Bacteria 35059
99 Ga0157369_10024034 3300013105 Bacteria 6781
100 Ga0157369_10042281 3300013105 Bacteria 4972
101 Ga0171463_1007 3300013249 Bacteria 301198
102 Ga0182007_10003468 3300015262 Bacteria 7427
103 Ga0182005_1000982 3300015265 Bacteria 12354
104 Ga0183363_1071 3300015690 Bacteria 30324
105 Ga0214544_1000110 3300021320 Bacteria 113143
106 Ga0214542_1000268 3300021321 Bacteria 87082
107 Ga0214543_1000022 3300021327 Bacteria 241930
108 Ga0214543_1000219 3300021327 Bacteria 87102
109 Ga0228711_1000911 3300022739 Bacteria 40698
110 Ga0228710_1001018 3300022740 Bacteria 40304
111 Ga0209435_100027 3300025206 Bacteria 196217
112 Ga0209436_100081 3300025208 Bacteria 48215
113 Ga0209436_101492 3300025208 Bacteria 8099
114 Ga0209563_107790 3300025230 Bacteria 1734
115 Ga0209437_100051 3300025233 Bacteria 392523
116 Ga0209437_100060 3300025233 Bacteria 355034
117 Ga0207425_1000046 3300025245 Bacteria 189433
118 Ga0207425_1004231 3300025245 Bacteria 4356
119 Ga0209646_1000086 3300025246 Bacteria 196217
120 Ga0209646_1004688 3300025246 Bacteria 2466
121 Ga0209026_1000082 3300025250 Bacteria 196315
122 Ga0209677_100540 3300025253 Bacteria 21044
123 Ga0209148_1009625 3300025254 Bacteria 1870
124 Ga0209759_1000063 3300025256 Bacteria 196315
125 Ga0209129_1000171 3300025258 Bacteria 95724
126 Ga0209129_1000283 3300025258 Bacteria 48305
127 Ga0209129_1000450 3300025258 Bacteria 30620
128 Ga0209129_1001443 3300025258 Bacteria 13284
129 Ga0209129_1001916 3300025258 Bacteria 10956
130 Ga0209129_1004411 3300025258 Bacteria 5500
131 Ga0209129_1005600 3300025258 Bacteria 4373
132 Ga0209233_1000095 3300025261 Bacteria 303783
133 Ga0209233_1000190 3300025261 Bacteria 130713
134 Ga0209233_1000228 3300025261 Bacteria 100100
135 Ga0209673_1000010 3300025273 Bacteria 596656
136 Ga0209673_1000025 3300025273 Bacteria 404572
137 Ga0209673_1000112 3300025273 Bacteria 179676
138 Ga0209673_1000637 3300025273 Bacteria 53013
139 Ga0209673_1003653 3300025273 Bacteria 8892
140 Ga0209673_1004043 3300025273 Bacteria 8113
141 Ga0209130_1000017 3300025284 Bacteria 388431
142 Ga0209130_1000023 3300025284 Bacteria 359355
143 Ga0209130_1009106 3300025284 Bacteria 2862
144 Ga0209676_1003467 3300025292 Bacteria 9684
145 Ga0209676_1007006 3300025292 Bacteria 5415
146 Ga0209676_1019600 3300025292 Bacteria 2324
147 Ga0209025_1000091 3300025294 Bacteria 250401
148 Ga0209025_1000137 3300025294 Bacteria 190136
149 Ga0209025_1000154 3300025294 Bacteria 170288
150 Ga0209025_1000161 3300025294 Bacteria 166506
151 Ga0209025_1000545 3300025294 Bacteria 70608
152 Ga0209025_1001424 3300025294 Bacteria 31618
153 Ga0209025_1004971 3300025294 Bacteria 11123
154 Ga0209025_1011337 3300025294 Bacteria 5889
155 Ga0209025_1014587 3300025294 Bacteria 4815
156 Ga0209564_1000013 3300025295 Bacteria 775755
157 Ga0209564_1000564 3300025295 Bacteria 58801
158 Ga0209564_1000672 3300025295 Bacteria 50497
159 Ga0209564_1003798 3300025295 Bacteria 9803
160 Ga0209564_1008415 3300025295 Bacteria 5092
161 Ga0209758_1000058 3300025297 Bacteria 331603
162 Ga0209758_1000123 3300025297 Bacteria 190136
163 Ga0209758_1000725 3300025297 Bacteria 48331
164 Ga0209758_1000863 3300025297 Bacteria 41967
165 Ga0209758_1001901 3300025297 Bacteria 22797
166 Ga0209758_1001960 3300025297 Bacteria 22253
167 Ga0209758_1002718 3300025297 Bacteria 17421
168 Ga0209758_1006925 3300025297 Bacteria 7909
169 Ga0209758_1008591 3300025297 Bacteria 6570
170 Ga0209050_1002725 3300025298 Bacteria 14282
171 Ga0209050_1005641 3300025298 Bacteria 7757
172 Ga0209256_1000153 3300025299 Bacteria 144736
173 Ga0209256_1000914 3300025299 Bacteria 36121
174 Ga0209256_1001132 3300025299 Bacteria 30392
175 Ga0209256_1001499 3300025299 Bacteria 23682
176 Ga0209256_1002031 3300025299 Bacteria 17999
177 Ga0209256_1003097 3300025299 Bacteria 12188
178 Ga0209256_1016662 3300025299 Bacteria 2489
179 Ga0207426_1000006 3300025302 Bacteria 1025969
180 Ga0207426_1000008 3300025302 Bacteria 848730
181 Ga0207426_1000228 3300025302 Bacteria 129261
182 Ga0207426_1020140 3300025302 Bacteria 2321
183 Ga0209051_1000462 3300025303 Bacteria 53349
184 Ga0209051_1000785 3300025303 Bacteria 33541
185 Ga0209051_1001635 3300025303 Bacteria 18178
186 Ga0209051_1007538 3300025303 Bacteria 5929
187 Ga0209051_1021723 3300025303 Bacteria 2721
188 Ga0209051_1022515 3300025303 Bacteria 2650
189 Ga0209051_1028422 3300025303 Bacteria 2208
190 Ga0209257_1003221 3300025304 Bacteria 14390
191 Ga0209257_1018875 3300025304 Bacteria 2627
192 Ga0209257_1043660 3300025304 Bacteria 1313
193 Ga0207695_10000037 3300025913 Bacteria 476303
194 Ga0207671_10001228 3300025914 Bacteria 30331
195 Ga0207650_10001248 3300025925 Bacteria 18474
196 Ga0207709_10055844 3300025935 Bacteria 2442
197 Ga0207678_10025462 3300026067 Bacteria 5164
198 Ga0207702_10175275 3300026078 Bacteria 1970
199 Ga0207698_10047528 3300026142 Bacteria 3252
200 Ga0209281_1000034 3300027111 Bacteria 382562
201 Ga0209281_1000314 3300027111 Bacteria 86424
202 Ga0209281_1001051 3300027111 Bacteria 20858
203 Ga0209371_1000022 3300027312 Bacteria 536342
204 Ga0209371_1000341 3300027312 Bacteria 50975
205 Ga0209282_1000068 3300027666 Bacteria 85817
206 Ga0209282_1002798 3300027666 Bacteria 10209
207 Ga0268266_10005469 3300028379 Bacteria 11831
208 Ga0307515_10000017 3300028794 Bacteria 550465
209 Ga0307515_10006213 3300028794 Bacteria 23994
210 Ga0307515_10019245 3300028794 Bacteria 12305
211 Ga0307515_10029550 3300028794 Bacteria 9255
212 Ga0268256_1000019 3300030500 Bacteria 587949
213 Ga0268256_1001403 3300030500 Bacteria 14620
214 Ga0307513_10001095 3300031456 Bacteria 39184
215 Ga0307513_10009210 3300031456 Bacteria 12501
216 Ga0307405_10003197 3300031731 Bacteria 7461
217 Ga0307405_10106434 3300031731 Bacteria 1892
218 Ga0307412_10004052 3300031911 Bacteria 8165
219 Ga0315914_1000937 3300031967 Bacteria 41175
220 Ga0307409_100120972 3300031995 Bacteria 2217
221 Ga0307416_100101011 3300032002 Bacteria 2511
222 Ga0307414_10185448 3300032004 Bacteria 1678
223 Ga0315913_1000094 3300033430 Bacteria 51134
224 Ga0315915_1000007 3300033464 Bacteria 319225
225 Ga0439436_0023412 3300041404 Bacteria 1827
226 Ga0439465_0035999 3300041413 Bacteria 1588
227 Ga0451841_0039604 3300041498 Bacteria 6606
228 Ga0451845_0606012 3300041501 Bacteria 2310
229 Ga0451847_0140826 3300041503 Bacteria 1838
230 Ga0451849_0223659 3300041505 Bacteria 2628
231 Ga0451843_0363805 3300041509 Bacteria 1174
232 Ga0451855_1540700 3300041511 Bacteria 3436
233 Ga0439449_0073186 3300042007 Bacteria 1263
234 Ga0466966_0028464 3300044684 Bacteria 3640
235 Ga0466970_0000872 3300044765 Bacteria 14575
236 Ga0495638_0000953 3300046460 Bacteria 29358
237 Ga0495605_0001474 3300046474 Bacteria 15363
238 Ga0495605_0051054 3300046474 Bacteria 2015
239 Ga0495662_0003309 3300046476 Bacteria 8162
240 Ga0495585_0011346 3300046492 Bacteria 5275
241 Ga0495585_0028890 3300046492 Bacteria 3160
242 Ga0495607_0029710 3300046501 Bacteria 3362
243 Ga0495607_0064680 3300046501 Bacteria 2065
244 Ga0495607_0094773 3300046501 Bacteria 1610
245 Ga0495583_0003748 3300046506 Bacteria 11302
246 Ga0495583_0012759 3300046506 Bacteria 4732
247 Ga0495606_0002168 3300046507 Bacteria 23621
248 Ga0495606_0007555 3300046507 Bacteria 9692
249 Ga0495610_0003874 3300046512 Bacteria 11364
250 Ga0495610_0056086 3300046512 Bacteria 1896
251 Ga0495616_0014083 3300046513 Bacteria 4490
252 Ga0495620_0008486 3300046515 Bacteria 5512
253 Ga0495631_0006631 3300046518 Bacteria 5953
254 Ga0495631_0035148 3300046518 Bacteria 2243
255 Ga0495632_0004091 3300046519 Bacteria 10059
256 Ga0495632_0013526 3300046519 Bacteria 4654
257 Ga0495632_0041967 3300046519 Bacteria 2295
258 Ga0495643_0010861 3300046522 Bacteria 5580
259 Ga0495643_0022449 3300046522 Bacteria 3601
260 Ga0495643_0031031 3300046522 Bacteria 2978
261 Ga0495648_0010074 3300046524 Bacteria 7243
262 Ga0495654_0000758 3300046530 Bacteria 24982
263 Ga0495640_0090534 3300046533 Bacteria 2019
264 Ga0495609_0026484 3300046538 Bacteria 2655
265 Ga0495622_0032920 3300046557 Bacteria 2420
266 Ga0495633_0053247 3300046558 Bacteria 1905
267 Ga0495656_0008409 3300046615 Bacteria 3682
268 Ga0495668_0003159 3300046616 Bacteria 12699
269 Ga0495668_0046522 3300046616 Bacteria 2410
270 Ga0495668_0131734 3300046616 Bacteria 1368
271 Ga0495625_0005331 3300046660 Bacteria 11778
272 Ga0495625_0018174 3300046660 Bacteria 5494
273 Ga0495625_0067546 3300046660 Bacteria 2516
274 Ga0495625_0082862 3300046660 Bacteria 2230
275 Ga0495625_0198764 3300046660 Bacteria 1324
276 Ga0495661_0038286 3300046665 Bacteria 2989
277 Ga0495588_0006717 3300046674 Bacteria 5198
278 Ga0495670_0003394 3300046691 Bacteria 7829
279 Ga0495671_0048089 3300046692 Bacteria 2129
280 Ga0495649_0020903 3300046694 Bacteria 3668
281 Ga0495660_0049890 3300046810 Bacteria 2282
282 Ga0495604_0031909 3300047317 Bacteria 4176
283 Ga0495672_0003408 3300047320 Bacteria 13639
284 Ga0495687_026142 3300047443 Bacteria 2752
285 Ga0495681_0010603 3300047470 Bacteria 5569
286 Ga0495681_0024138 3300047470 Bacteria 3213
287 Ga0495686_0004112 3300047472 Bacteria 12114
288 Ga0495686_0011015 3300047472 Bacteria 6396
289 Ga0495686_0024888 3300047472 Bacteria 3928
290 Ga0495686_0055394 3300047472 Bacteria 2480
291 Ga0495686_0090345 3300047472 Bacteria 1860
292 Ga0496100_0027162 3300048903 Bacteria 3517
293 Ga0496102_0004330 3300048905 Bacteria 12011
294 Ga0496102_0218466 3300048905 Bacteria 1796
295 Ga0496103_0005296 3300048906 Bacteria 7740
296 Ga0496104_0015245 3300048907 Bacteria 6959
297 Ga0496104_0025629 3300048907 Bacteria 5438
298 Ga0496105_0117401 3300048908 Bacteria 2194
299 Ga0496106_0001496 3300048909 Bacteria 17571
300 Ga0496106_0069311 3300048909 Bacteria 2692
301 Ga0496106_0118267 3300048909 Bacteria 2069
302 Ga0496108_0245925 3300048911 Bacteria 1556
303 Ga0496110_0128688 3300048913 Bacteria 2285
304 Ga0496110_0138956 3300048913 Bacteria 2196
305 Ga0496111_0000579 3300048914 Bacteria 19155
306 Ga0496113_0093756 3300048916 Bacteria 2318
307 Ga0496114_0443684 3300048917 Bacteria 1149
308 Ga0496116_0000105 3300048919 Bacteria 192704
309 Ga0496116_0010698 3300048919 Bacteria 7660
310 Ga0496116_0015579 3300048919 Bacteria 6003
311 Ga0496116_0040939 3300048919 Bacteria 3184
312 Ga0496116_0069515 3300048919 Bacteria 2238
313 Ga0496116_0073970 3300048919 Bacteria 2145
314 Ga0496116_0117087 3300048919 Bacteria 1551
315 Ga0496117_0000002 3300048920 Bacteria 2483758
316 Ga0496117_0002241 3300048920 Bacteria 24957
317 Ga0496117_0003292 3300048920 Bacteria 18915
318 Ga0496117_0016281 3300048920 Bacteria 6282
319 Ga0496117_0065176 3300048920 Bacteria 2478
320 Ga0496117_0104330 3300048920 Bacteria 1784
321 Ga0496117_0171916 3300048920 Bacteria 1256
322 Ga0496118_0001193 3300048921 Bacteria 40048
323 Ga0496118_0001388 3300048921 Bacteria 36504
324 Ga0496118_0004636 3300048921 Bacteria 16127
325 Ga0496118_0015283 3300048921 Bacteria 7118
326 Ga0496118_0018167 3300048921 Bacteria 6354
327 Ga0496118_0019763 3300048921 Bacteria 6006
328 Ga0496118_0028169 3300048921 Bacteria 4739
329 Ga0496118_0116059 3300048921 Bacteria 1761
330 Ga0496119_0012822 3300048922 Bacteria 6761
331 Ga0496119_0012920 3300048922 Bacteria 6720
332 Ga0496119_0022399 3300048922 Bacteria 4524
333 Ga0496119_0044519 3300048922 Bacteria 2793
334 Ga0496119_0047169 3300048922 Bacteria 2682
335 Ga0496119_0120819 3300048922 Bacteria 1440
336 Ga0496120_0000309 3300048923 Bacteria 81375
337 Ga0496120_0049279 3300048923 Bacteria 2418
338 Ga0496120_0051471 3300048923 Bacteria 2351
339 Ga0496120_0076250 3300048923 Bacteria 1828
340 Ga0496120_0077461 3300048923 Bacteria 1809
341 Ga0496121_0000003 3300048924 Bacteria 1191431
342 Ga0496121_0001287 3300048924 Bacteria 43216
343 Ga0496121_0002836 3300048924 Bacteria 25580
344 Ga0496121_0009257 3300048924 Bacteria 11372
345 Ga0496121_0014795 3300048924 Bacteria 8242
346 Ga0496121_0022524 3300048924 Bacteria 6108
347 Ga0496121_0028932 3300048924 Bacteria 5143
348 Ga0496121_0037292 3300048924 Bacteria 4320
349 Ga0496121_0043048 3300048924 Bacteria 3916
350 Ga0496121_0044847 3300048924 Bacteria 3807
351 Ga0496121_0051874 3300048924 Bacteria 3451
352 Ga0496121_0055438 3300048924 Bacteria 3302
353 Ga0496121_0191893 3300048924 Bacteria 1464
354 Ga0496121_0234592 3300048924 Bacteria 1283
355 Ga0496122_0000004 3300048925 Bacteria 645283
356 Ga0496122_0000414 3300048925 Bacteria 90664
357 Ga0496122_0000462 3300048925 Bacteria 84546
358 Ga0496122_0015193 3300048925 Bacteria 7376
359 Ga0496122_0015640 3300048925 Bacteria 7237
360 Ga0496122_0016318 3300048925 Bacteria 7039
361 Ga0496122_0029531 3300048925 Bacteria 4622
362 Ga0496122_0038867 3300048925 Bacteria 3803
363 Ga0496122_0050047 3300048925 Bacteria 3190
364 Ga0496122_0052128 3300048925 Bacteria 3101
365 Ga0496122_0061915 3300048925 Bacteria 2742
366 Ga0496122_0169991 3300048925 Bacteria 1315
367 Ga0496123_0000007 3300048926 Bacteria 645283
368 Ga0496123_0000048 3300048926 Bacteria 244152
369 Ga0496123_0000147 3300048926 Bacteria 143834
370 Ga0496123_0004704 3300048926 Bacteria 14130
371 Ga0496123_0009287 3300048926 Bacteria 8877
372 Ga0496123_0012460 3300048926 Bacteria 7247
373 Ga0496123_0028162 3300048926 Bacteria 4166
374 Ga0496123_0028649 3300048926 Bacteria 4117
375 Ga0496123_0054736 3300048926 Bacteria 2624
376 Ga0496123_0061061 3300048926 Bacteria 2425
377 Ga0496123_0116613 3300048926 Bacteria 1512
378 Ga0496124_0000067 3300048927 Bacteria 222576
379 Ga0496124_0000348 3300048927 Bacteria 84728
380 Ga0496124_0006920 3300048927 Bacteria 12188
381 Ga0496124_0013437 3300048927 Bacteria 7990
382 Ga0496124_0016988 3300048927 Bacteria 6887
383 Ga0496124_0024351 3300048927 Bacteria 5506
384 Ga0496124_0033989 3300048927 Bacteria 4480
385 Ga0496124_0040694 3300048927 Bacteria 4018
386 Ga0496124_0042986 3300048927 Bacteria 3887
387 Ga0496124_0053449 3300048927 Bacteria 3423
388 Ga0496124_0139661 3300048927 Bacteria 1913
389 Ga0496124_0158035 3300048927 Bacteria 1770
390 Ga0496124_0190127 3300048927 Bacteria 1572
391 Ga0496125_0001144 3300048928 Bacteria 40287
392 Ga0496125_0001465 3300048928 Bacteria 34178
393 Ga0496125_0004586 3300048928 Bacteria 15799
394 Ga0496125_0008427 3300048928 Bacteria 10794
395 Ga0496125_0014864 3300048928 Bacteria 7559
396 Ga0496125_0015081 3300048928 Bacteria 7500
397 Ga0496125_0031593 3300048928 Bacteria 4716
398 Ga0496125_0086451 3300048928 Bacteria 2371
399 Ga0496125_0167019 3300048928 Bacteria 1485
400 Ga0496125_0183520 3300048928 Bacteria 1390
401 Ga0496126_0000188 3300048929 Bacteria 139625
402 Ga0496126_0000879 3300048929 Bacteria 52860
403 Ga0496126_0012445 3300048929 Bacteria 8714
404 Ga0496126_0017664 3300048929 Bacteria 7106
405 Ga0496126_0026521 3300048929 Bacteria 5555
406 Ga0496126_0067348 3300048929 Bacteria 3199
407 Ga0496126_0202470 3300048929 Bacteria 1675
408 Ga0496126_0240564 3300048929 Bacteria 1512
409 Ga0495678_008240 3300049459 Bacteria 5284
410 Ga0501032_0024801 3300049569 Bacteria 4137
411 Ga0501033_0002870 3300049570 Bacteria 14437
412 Ga0501033_0074199 3300049570 Bacteria 2497
413 Ga0501033_0128979 3300049570 Bacteria 1833
414 Ga0501034_0056607 3300049571 Bacteria 3944
415 Ga0501036_0057659 3300049572 Bacteria 3290
416 Ga0501038_0074345 3300049574 Bacteria 2875
417 Ga0501039_0040948 3300049575 Bacteria 3577
418 Ga0501046_0071572 3300049580 Bacteria 2694
419 Ga0501080_0092649 3300049742 Bacteria 2806
420 Ga0501083_0028656 3300049744 Bacteria 3837
421 Ga0501035_0006588 3300049822 Bacteria 10874
422 Ga0501044_0068200 3300049823 Bacteria 3623
423 nmdc:mga03683_8605_c1 3300050489 Bacteria 3594
424 nmdc:mga03n38_14153_c1 3300050490 Bacteria 3051
425 nmdc:mga00v17_144_c1 3300050491 Bacteria 41064
426 nmdc:mga00v17_7_c1 3300050491 Bacteria 167228
427 nmdc:mga0yw44_3218_c1 3300050492 Bacteria 7189
428 nmdc:mga0k408_22786_c1 3300050493 Bacteria 3529
429 nmdc:mga07m45_435_c1 3300050496 Bacteria 17361
430 nmdc:mga0sz30_27411_c1 3300050516 Bacteria 2340
431 Ga0500610_0002704 3300053079 Bacteria 6610
432 Ga0500578_0085440 3300053086 Bacteria 2004
433 Ga0500583_0095092 3300053092 Bacteria 1454
434 Ga0500560_004635 3300053107 Bacteria 2948
435 Ga0500594_0000568 3300053118 Bacteria 7964
436 Ga0500608_060642 3300053122 Bacteria 1809
437 Ga0500618_000056 3300053125 Bacteria 98509
438 Ga0500618_000304 3300053125 Bacteria 36803
439 Ga0500658_0005794 3300053134 Bacteria 4602
440 Ga0500658_0007104 3300053134 Bacteria 4140
441 Ga0500659_0044803 3300053135 Bacteria 2396
442 Ga0500561_0000236 3300053137 Bacteria 9886
443 Ga0500568_0001459 3300053139 Bacteria 15147
444 Ga0500568_0009854 3300053139 Bacteria 4514
445 Ga0500568_0028393 3300053139 Bacteria 2333
446 Ga0500573_0001176 3300053140 Bacteria 12218
447 Ga0500573_0004052 3300053140 Bacteria 7663
448 Ga0500604_0010108 3300053151 Bacteria 2521
449 Ga0500616_0000363 3300053153 Bacteria 64277
450 Ga0500616_0005056 3300053153 Bacteria 9116
451 Ga0500622_0001665 3300053156 Bacteria 17370
452 Ga0500624_001429 3300053157 Bacteria 3893
453 Ga0500627_0019208 3300053158 Bacteria 2719
454 Ga0500627_0036887 3300053158 Bacteria 2084
455 Ga0500633_0004554 3300053160 Bacteria 3196
456 Ga0500634_0027598 3300053161 Bacteria 3093
457 Ga0500636_0000003 3300053177 Bacteria 240189
458 Ga0500636_0001041 3300053177 Bacteria 14876
459 Ga0500636_0138528 3300053177 Bacteria 1349
460 Ga0501082_0076077 3300060353 Bacteria 2893
461 Ga0466962_0044526 3300061719 Bacteria 2123

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2964636051 2964640658 310
2 iso_pu_bacteria 2957437181 2957440569 314
3 3300046810 Ga0495660_0049890 Ga0495660_0049890_16_1011 318
4 3300048925 Ga0496122_0029531 Ga0496122_0029531_44_1033 319
5 3300048926 Ga0496123_0116613 Ga0496123_0116613_479_1474 322
6 3300053086 Ga0500578_0085440 Ga0500578_0085440_996_1991 322
7 iso_pu_bacteria 2964678106 2964679736 325
8 3300046692 Ga0495671_0048089 Ga0495671_0048089_18_1043 326
9 iso_pu_bacteria 2551306091 2551729139 331
10 3300053177 Ga0500636_0000003 Ga0500636_0000003_16101_17294 334
11 3300046501 Ga0495607_0064680 Ga0495607_0064680_968_2002 335
12 3300046660 Ga0495625_0198764 Ga0495625_0198764_264_1298 335
13 3300048920 Ga0496117_0002241 Ga0496117_0002241_5277_6455 336
14 3300046660 Ga0495625_0067546 Ga0495625_0067546_1136_2320 341
15 3300048922 Ga0496119_0120819 Ga0496119_0120819_103_1287 341
16 3300048924 Ga0496121_0043048 Ga0496121_0043048_940_2124 341
17 3300048928 Ga0496125_0183520 Ga0496125_0183520_269_1378 341
18 iso_pu_bacteria 2551306092 2551737650 341
19 3300025246 Ga0209646_1004688 Ga0209646_10046883 344
20 3300006186 Ga0075369_10042472 Ga0075369_100424721 345
21 3300009766 Ga0123342_1014884 Ga0123342_10148845 345
22 3300003771 Ga0055526_1003643 Ga0055526_100364311 346
23 3300003790 Ga0055528_1000707 Ga0055528_100070711 346
24 3300025273 Ga0209673_1000025 Ga0209673_1000025143 346
25 3300025295 Ga0209564_1000672 Ga0209564_100067214 346
26 3300025299 Ga0209256_1000914 Ga0209256_10009143 346
27 3300048919 Ga0496116_0117087 Ga0496116_0117087_184_1383 346
28 3300002774 JGI25150J39212_1000100 JGI25150J39212_100010047 348
29 3300003187 JGI25151J46595_10000146 JGI25151J46595_1000014689 348
30 3300003215 JGI25153J46596_10000764 JGI25153J46596_100007644 348
31 3300025245 Ga0207425_1000046 Ga0207425_100004685 348
32 3300025258 Ga0209129_1000171 Ga0209129_100017117 348
33 3300025294 Ga0209025_1000137 Ga0209025_1000137106 348
34 3300025297 Ga0209758_1000123 Ga0209758_1000123106 348
35 3300031911 Ga0307412_10004052 Ga0307412_1000405210 348
36 3300048919 Ga0496116_0010698 Ga0496116_0010698_3605_4783 348
37 3300048919 Ga0496116_0040939 Ga0496116_0040939_952_2130 348
38 3300048920 Ga0496117_0065176 Ga0496117_0065176_1152_2330 348
39 3300048921 Ga0496118_0018167 Ga0496118_0018167_4917_6095 348
40 3300048924 Ga0496121_0009257 Ga0496121_0009257_2316_3494 348
41 3300048924 Ga0496121_0022524 Ga0496121_0022524_1074_2252 348
42 3300048925 Ga0496122_0015640 Ga0496122_0015640_4943_6121 348
43 3300048925 Ga0496122_0169991 Ga0496122_0169991_28_1152 348
44 3300048926 Ga0496123_0004704 Ga0496123_0004704_7702_8880 348
45 3300048926 Ga0496123_0061061 Ga0496123_0061061_1074_2252 348
46 3300048927 Ga0496124_0013437 Ga0496124_0013437_5312_6490 348
47 3300048927 Ga0496124_0042986 Ga0496124_0042986_1615_2793 348
48 3300048928 Ga0496125_0014864 Ga0496125_0014864_5191_6369 348
49 3300048928 Ga0496125_0167019 Ga0496125_0167019_94_1272 348
50 3300048929 Ga0496126_0017664 Ga0496126_0017664_5155_6333 348
51 3300003323 rootH1_10042649 rootH1_100426492 351
52 3300031456 Ga0307513_10009210 Ga0307513_1000921019 351
53 3300025230 Ga0209563_107790 Ga0209563_1077901 352
54 3300048924 Ga0496121_0051874 Ga0496121_0051874_2281_3405 352
55 3300048928 Ga0496125_0086451 Ga0496125_0086451_1214_2338 352
56 3300049570 Ga0501033_0002870 Ga0501033_0002870_3383_4558 352
57 3300049822 Ga0501035_0006588 Ga0501035_0006588_2357_3532 352
58 iso_pu_bacteria 2551306087 2551697929 352
59 iso_pu_bacteria 2585427633 2585996768 352
60 iso_pu_bacteria 2585427634 2586001353 352
61 iso_pu_bacteria 2582581298 2585225339 353
62 iso_pu_bacteria 2585427529 2585547895 353
63 iso_pu_bacteria 2643221599 2644006976 353
64 iso_pu_bacteria 2989771324 2989773257 353
65 3300006353 Ga0075370_10108910 Ga0075370_101089102 354
66 3300025253 Ga0209677_100540 Ga0209677_1005408 354
67 3300025261 Ga0209233_1000228 Ga0209233_100022871 354
68 3300046460 Ga0495638_0000953 Ga0495638_0000953_11268_12446 354
69 3300046474 Ga0495605_0001474 Ga0495605_0001474_5687_6865 354
70 3300046492 Ga0495585_0011346 Ga0495585_0011346_887_2065 354
71 3300046506 Ga0495583_0012759 Ga0495583_0012759_3475_4653 354
72 3300046513 Ga0495616_0014083 Ga0495616_0014083_1252_2430 354
73 3300046518 Ga0495631_0006631 Ga0495631_0006631_3935_5113 354
74 3300046519 Ga0495632_0013526 Ga0495632_0013526_3391_4569 354
75 3300046538 Ga0495609_0026484 Ga0495609_0026484_362_1540 354
76 3300046616 Ga0495668_0003159 Ga0495668_0003159_4342_5520 354
77 3300046660 Ga0495625_0005331 Ga0495625_0005331_7795_8973 354
78 3300046691 Ga0495670_0003394 Ga0495670_0003394_6298_7476 354
79 3300047320 Ga0495672_0003408 Ga0495672_0003408_8708_9886 354
80 3300049459 Ga0495678_008240 Ga0495678_008240_859_2037 354
81 3300053079 Ga0500610_0002704 Ga0500610_0002704_4508_5686 354
82 3300053092 Ga0500583_0095092 Ga0500583_0095092_284_1408 354
83 3300053118 Ga0500594_0000568 Ga0500594_0000568_6618_7796 354
84 3300053139 Ga0500568_0001459 Ga0500568_0001459_7308_8486 354
85 3300053153 Ga0500616_0005056 Ga0500616_0005056_5390_6568 354
86 3300053158 Ga0500627_0036887 Ga0500627_0036887_422_1600 354
87 iso_pu_bacteria 2509276033 2509447408 354
88 iso_pu_bacteria 2510065019 2510134245 354
89 iso_pu_bacteria 2510461076 2510895681 354
90 iso_pu_bacteria 2510917030 2511199324 354
91 iso_pu_bacteria 2513237084 2513567678 354
92 iso_pu_bacteria 2513237085 2513577960 354
93 iso_pu_bacteria 2513237088 2513597606 354
94 iso_pu_bacteria 2513237093 2513631887 354
95 iso_pu_bacteria 2513237103 2513707915 354
96 iso_pu_bacteria 2513237138 2513870169 354
97 iso_pu_bacteria 2513237162 2514018008 354
98 iso_pu_bacteria 2515075009 2515113407 354
99 iso_pu_bacteria 2515154113 2515635129 354
100 iso_pu_bacteria 2515154114 2515645571 354
101 iso_pu_bacteria 2515154116 2515655048 354
102 iso_pu_bacteria 2515154134 2515739778 354
103 iso_pu_bacteria 2554235003 2554248449 354
104 iso_pu_bacteria 2558860242 2559295565 354
105 iso_pu_bacteria 2582581304 2585258203 354
106 iso_pu_bacteria 2582581867 2585401022 354
107 iso_pu_bacteria 2585427526 2585524802 354
108 iso_pu_bacteria 2585427528 2585538483 354
109 iso_pu_bacteria 2585427590 2585822077 354
110 iso_pu_bacteria 2585427593 2585836436 354
111 iso_pu_bacteria 2585427594 2585843544 354
112 iso_pu_bacteria 2615840624 2616293072 354
113 iso_pu_bacteria 2643221582 2643920117 354
114 iso_pu_bacteria 2643221637 2644208747 354
115 iso_pu_bacteria 2643221643 2644242616 354
116 iso_pu_bacteria 2643221693 2644521740 354
117 iso_pu_bacteria 2643221718 2644652277 354
118 iso_pu_bacteria 2718217882 2719182080 354
119 iso_pu_bacteria 2718217927 2719386697 354
120 iso_pu_bacteria 2718218009 2719732796 354
121 iso_pu_bacteria 2718218232 2720614331 354
122 iso_pu_bacteria 2718218233 2720621103 354
123 iso_pu_bacteria 2718218235 2720632429 354
124 iso_pu_bacteria 2718218269 2720776154 354
125 iso_pu_bacteria 2718218363 2721148171 354
126 iso_pu_bacteria 2718218365 2721159624 354
127 iso_pu_bacteria 2718218366 2721165007 354
128 iso_pu_bacteria 2718218423 2721400403 354
129 iso_pu_bacteria 2721755514 2722841177 354
130 iso_pu_bacteria 2721755556 2723027751 354
131 iso_pu_bacteria 2721755684 2723561381 354
132 iso_pu_bacteria 2721755685 2723568004 354
133 iso_pu_bacteria 2721755809 2724039216 354
134 iso_pu_bacteria 2721755810 2724045552 354
135 iso_pu_bacteria 2721755819 2724090761 354
136 iso_pu_bacteria 2721755822 2724105269 354
137 iso_pu_bacteria 2721755823 2724111096 354
138 iso_pu_bacteria 2724679232 2725950356 354
139 iso_pu_bacteria 2728369352 2730108687 354
140 iso_pu_bacteria 2728369365 2730165315 354
141 iso_pu_bacteria 2728369397 2730299256 354
142 iso_pu_bacteria 2738541333 2739033125 354
143 iso_pu_bacteria 2765235942 2766066169 354
144 iso_pu_bacteria 2791355256 2793294144 354
145 iso_pu_bacteria 2791355259 2793318143 354
146 iso_pu_bacteria 2791355260 2793319464 354
147 iso_pu_bacteria 2791355261 2793328909 354
148 iso_pu_bacteria 2791355262 2793334902 354
149 iso_pu_bacteria 2791355263 2793339562 354
150 iso_pu_bacteria 2791355264 2793346967 354
151 iso_pu_bacteria 2791355265 2793351551 354
152 iso_pu_bacteria 2791355266 2793362482 354
153 iso_pu_bacteria 2791355267 2793367605 354
154 iso_pu_bacteria 2802429605 2805926783 354
155 iso_pu_bacteria 2802429606 2805932695 354
156 iso_pu_bacteria 2802429633 2806045264 354
157 iso_pu_bacteria 2802429634 2806049941 354
158 iso_pu_bacteria 2802429635 2806056779 354
159 iso_pu_bacteria 2802429636 2806064161 354
160 iso_pu_bacteria 2802429637 2806071429 354
161 iso_pu_bacteria 2808606387 2808987702 354
162 iso_pu_bacteria 2818991439 2819559281 354
163 iso_pu_bacteria 2838042994 2838045260 354
164 iso_pu_bacteria 2842489311 2842493626 354
165 iso_pu_bacteria 2996893221 2996897935 354
166 iso_pu_bacteria 8005275841 8005281507 354
167 3300005548 Ga0070665_100069762 Ga0070665_1000697621 355
168 3300006946 Ga0079104_1006455 Ga0079104_10064552 355
169 3300009093 Ga0105240_10000014 Ga0105240_10000014240 355
170 3300009545 Ga0105237_10002158 Ga0105237_100021588 355
171 3300010375 Ga0105239_10016073 Ga0105239_100160734 355
172 3300013104 Ga0157370_10000329 Ga0157370_1000032953 355
173 3300013105 Ga0157369_10042281 Ga0157369_100422813 355
174 3300015262 Ga0182007_10003468 Ga0182007_100034685 355
175 3300015265 Ga0182005_1000982 Ga0182005_100098210 355
176 3300021320 Ga0214544_1000110 Ga0214544_100011038 355
177 3300021321 Ga0214542_1000268 Ga0214542_100026812 355
178 3300021327 Ga0214543_1000022 Ga0214543_1000022142 355
179 3300021327 Ga0214543_1000219 Ga0214543_100021913 355
180 3300022739 Ga0228711_1000911 Ga0228711_100091130 355
181 3300022740 Ga0228710_1001018 Ga0228710_100101830 355
182 3300025913 Ga0207695_10000037 Ga0207695_10000037241 355
183 3300025914 Ga0207671_10001228 Ga0207671_100012285 355
184 3300026142 Ga0207698_10047528 Ga0207698_100475281 355
185 3300027111 Ga0209281_1000314 Ga0209281_100031411 355
186 3300027111 Ga0209281_1001051 Ga0209281_100105118 355
187 3300027666 Ga0209282_1000068 Ga0209282_100006811 355
188 3300031967 Ga0315914_1000937 Ga0315914_100093730 355
189 3300032002 Ga0307416_100101011 Ga0307416_1001010112 355
190 3300033430 Ga0315913_1000094 Ga0315913_10000949 355
191 3300033464 Ga0315915_1000007 Ga0315915_1000007252 355
192 3300046501 Ga0495607_0094773 Ga0495607_0094773_391_1560 355
193 3300046507 Ga0495606_0002168 Ga0495606_0002168_9982_11166 355
194 3300046616 Ga0495668_0046522 Ga0495668_0046522_189_1373 355
195 3300048903 Ga0496100_0027162 Ga0496100_0027162_1163_2347 355
196 3300048905 Ga0496102_0004330 Ga0496102_0004330_5999_7183 355
197 3300048906 Ga0496103_0005296 Ga0496103_0005296_2025_3209 355
198 3300048909 Ga0496106_0118267 Ga0496106_0118267_733_1917 355
199 3300048913 Ga0496110_0138956 Ga0496110_0138956_488_1702 355
200 3300048914 Ga0496111_0000579 Ga0496111_0000579_12377_13591 355
201 3300048919 Ga0496116_0069515 Ga0496116_0069515_86_1270 355
202 3300048920 Ga0496117_0003292 Ga0496117_0003292_10878_12062 355
203 3300048920 Ga0496117_0016281 Ga0496117_0016281_4762_5940 355
204 3300048921 Ga0496118_0001388 Ga0496118_0001388_28628_29812 355
205 3300048921 Ga0496118_0015283 Ga0496118_0015283_1153_2331 355
206 3300048922 Ga0496119_0012920 Ga0496119_0012920_3068_4252 355
207 3300048923 Ga0496120_0051471 Ga0496120_0051471_318_1502 355
208 3300048924 Ga0496121_0001287 Ga0496121_0001287_6996_8180 355
209 3300048924 Ga0496121_0037292 Ga0496121_0037292_1147_2331 355
210 3300048925 Ga0496122_0015193 Ga0496122_0015193_1121_2299 355
211 3300048925 Ga0496122_0016318 Ga0496122_0016318_2788_3972 355
212 3300048926 Ga0496123_0009287 Ga0496123_0009287_2916_4100 355
213 3300048926 Ga0496123_0012460 Ga0496123_0012460_2911_4125 355
214 3300048926 Ga0496123_0054736 Ga0496123_0054736_1282_2460 355
215 3300048927 Ga0496124_0006920 Ga0496124_0006920_4963_6141 355
216 3300048928 Ga0496125_0015081 Ga0496125_0015081_1320_2504 355
217 3300049570 Ga0501033_0128979 Ga0501033_0128979_232_1410 355
218 3300049574 Ga0501038_0074345 Ga0501038_0074345_443_1621 355
219 3300049575 Ga0501039_0040948 Ga0501039_0040948_695_1873 355
220 3300049742 Ga0501080_0092649 Ga0501080_0092649_1173_2351 355
221 3300049744 Ga0501083_0028656 Ga0501083_0028656_1071_2249 355
222 3300049823 Ga0501044_0068200 Ga0501044_0068200_591_1769 355
223 iso_pu_bacteria 2508501122 2509108107 355
224 iso_pu_bacteria 2509276019 2509376717 355
225 iso_pu_bacteria 2510065057 2510302711 355
226 iso_pu_bacteria 2511231052 2511497762 355
227 iso_pu_bacteria 2512047086 2512528795 355
228 iso_pu_bacteria 2512875026 2512969581 355
229 iso_pu_bacteria 2513237086 2513584580 355
230 iso_pu_bacteria 2513237089 2513606195 355
231 iso_pu_bacteria 2513237091 2513616406 355
232 iso_pu_bacteria 2513237140 2513883873 355
233 iso_pu_bacteria 2513237143 2513902022 355
234 iso_pu_bacteria 2513237156 2513985096 355
235 iso_pu_bacteria 2513237160 2514007910 355
236 iso_pu_bacteria 2515154107 2515612027 355
237 iso_pu_bacteria 2516143018 2516206148 355
238 iso_pu_bacteria 2516653046 2516896587 355
239 iso_pu_bacteria 2517487022 2517565541 355
240 iso_pu_bacteria 2524023207 2524452085 355
241 iso_pu_bacteria 2551306084 2551681444 355
242 iso_pu_bacteria 2551306085 2551684681 355
243 iso_pu_bacteria 2558860100 2558863918 355
244 iso_pu_bacteria 2582581866 2585395373 355
245 iso_pu_bacteria 2599185156 2599332046 355
246 iso_pu_bacteria 2690316117 2692315244 355
247 iso_pu_bacteria 2751185821 2753462397 355
248 iso_pu_bacteria 2791355091 2792620543 355
249 iso_pu_bacteria 2791355092 2792625901 355
250 iso_pu_bacteria 2791355094 2792638841 355
251 iso_pu_bacteria 2791355253 2793280068 355
252 iso_pu_bacteria 2802428858 2802716011 355
253 iso_pu_bacteria 2802428859 2802722965 355
254 iso_pu_bacteria 2802428860 2802728903 355
255 iso_pu_bacteria 2802428861 2802735269 355
256 iso_pu_bacteria 2802428862 2802742127 355
257 iso_pu_bacteria 2802428863 2802748574 355
258 iso_pu_bacteria 2818991461 2819685326 355
259 iso_pu_bacteria 2842922631 2842924381 355
260 iso_pu_bacteria 2847417321 2847419699 355
261 iso_pu_bacteria 2848992105 2848994701 355
262 iso_pu_bacteria 2850079185 2850081719 355
263 iso_pu_bacteria 2855825444 2855828579 355
264 iso_pu_bacteria 2855839649 2855843704 355
265 iso_pu_bacteria 2855872281 2855877216 355
266 iso_pu_bacteria 2858800743 2858807050 355
267 iso_pu_bacteria 2913295892 2913296158 355
268 iso_pu_bacteria 2915980308 2915983676 355
269 iso_pu_bacteria 2915986958 2915988049 355
270 iso_pu_bacteria 2915993759 2915998173 355
271 iso_pu_bacteria 2916000859 2916007313 355
272 iso_pu_bacteria 2916007675 2916011290 355
273 iso_pu_bacteria 2916014648 2916020551 355
274 iso_pu_bacteria 2916021584 2916028111 355
275 iso_pu_bacteria 2916028427 2916032832 355
276 iso_pu_bacteria 2916035215 2916038218 355
277 iso_pu_bacteria 2916041962 2916045011 355
278 iso_pu_bacteria 2916048683 2916051948 355
279 iso_pu_bacteria 2916055098 2916059484 355
280 iso_pu_bacteria 2916061851 2916068313 355
281 iso_pu_bacteria 2916076590 2916077788 355
282 iso_pu_bacteria 2921201388 2921203170 355
283 iso_pu_bacteria 2921208531 2921213275 355
284 iso_pu_bacteria 2921237296 2921240542 355
285 iso_pu_bacteria 2921244191 2921245745 355
286 iso_pu_bacteria 2921250672 2921256915 355
287 iso_pu_bacteria 2921257292 2921260057 355
288 iso_pu_bacteria 2921263974 2921268431 355
289 iso_pu_bacteria 2921282425 2921284654 355
290 iso_pu_bacteria 2921289301 2921292127 355
291 iso_pu_bacteria 2921296804 2921296992 355
292 iso_pu_bacteria 2924144063 2924148130 355
293 iso_pu_bacteria 2924150972 2924154753 355
294 iso_pu_bacteria 2924158325 2924163936 355
295 iso_pu_bacteria 2924165586 2924168427 355
296 iso_pu_bacteria 2924172951 2924177195 355
297 iso_pu_bacteria 2924179722 2924182048 355
298 iso_pu_bacteria 2924186466 2924188923 355
299 iso_pu_bacteria 2924193448 2924195774 355
300 iso_pu_bacteria 2924200457 2924202957 355
301 iso_pu_bacteria 2924207177 2924209991 355
302 iso_pu_bacteria 2924214083 2924221317 355
303 iso_pu_bacteria 2924221636 2924228374 355
304 iso_pu_bacteria 2924228884 2924233772 355
305 iso_pu_bacteria 2936996657 2937001540 355
306 iso_pu_bacteria 2937002841 2937005871 355
307 iso_pu_bacteria 2937009748 2937014294 355
308 iso_pu_bacteria 2937016420 2937021567 355
309 iso_pu_bacteria 2937023124 2937023954 355
310 iso_pu_bacteria 2937029754 2937035028 355
311 iso_pu_bacteria 2937036028 2937039259 355
312 iso_pu_bacteria 2937042894 2937043362 355
313 iso_pu_bacteria 2937049772 2937054051 355
314 iso_pu_bacteria 2937056579 2937056848 355
315 iso_pu_bacteria 2937063883 2937066089 355
316 iso_pu_bacteria 2937071275 2937075405 355
317 iso_pu_bacteria 2937078374 2937084328 355
318 iso_pu_bacteria 2937084907 2937090730 355
319 iso_pu_bacteria 2937091812 2937096117 355
320 iso_pu_bacteria 2937098957 2937105167 355
321 iso_pu_bacteria 2937106411 2937110530 355
322 iso_pu_bacteria 2937113482 2937118844 355
323 iso_pu_bacteria 2937119839 2937125814 355
324 iso_pu_bacteria 2937126314 2937131061 355
325 iso_pu_bacteria 2957375807 2957379056 355
326 iso_pu_bacteria 2957382221 2957383000 355
327 iso_pu_bacteria 2957388812 2957391955 355
328 iso_pu_bacteria 2957395598 2957396267 355
329 iso_pu_bacteria 2957402308 2957402948 355
330 iso_pu_bacteria 2957408893 2957410720 355
331 iso_pu_bacteria 2957415311 2957421349 355
332 iso_pu_bacteria 2957422303 2957427274 355
333 iso_pu_bacteria 2957430029 2957435269 355
334 iso_pu_bacteria 2957443900 2957445226 355
335 iso_pu_bacteria 2957450854 2957454893 355
336 iso_pu_bacteria 2957457609 2957459353 355
337 iso_pu_bacteria 2957464669 2957464842 355
338 iso_pu_bacteria 2957471148 2957476847 355
339 iso_pu_bacteria 2957478035 2957482398 355
340 iso_pu_bacteria 2957484790 2957490026 355
341 iso_pu_bacteria 2957491536 2957491707 355
342 iso_pu_bacteria 2957498199 2957501626 355
343 iso_pu_bacteria 2957505466 2957510248 355
344 iso_pu_bacteria 2960584000 2960585010 355
345 iso_pu_bacteria 2960591022 2960596748 355
346 iso_pu_bacteria 2960597568 2960598452 355
347 iso_pu_bacteria 2960603979 2960609520 355
348 iso_pu_bacteria 2960610863 2960614235 355
349 iso_pu_bacteria 2960617483 2960621881 355
350 iso_pu_bacteria 2960624210 2960629127 355
351 iso_pu_bacteria 2960631154 2960634396 355
352 iso_pu_bacteria 2960637947 2960642797 355
353 iso_pu_bacteria 2960645483 2960645658 355
354 iso_pu_bacteria 2960652885 2960658117 355
355 iso_pu_bacteria 2960660292 2960661983 355
356 iso_pu_bacteria 2960667422 2960669757 355
357 iso_pu_bacteria 2960674078 2960680337 355
358 iso_pu_bacteria 2960680706 2960683376 355
359 iso_pu_bacteria 2960687367 2960690869 355
360 iso_pu_bacteria 2960693952 2960695227 355
361 iso_pu_bacteria 2964607997 2964610781 355
362 iso_pu_bacteria 2964615318 2964619299 355
363 iso_pu_bacteria 2964621998 2964624191 355
364 iso_pu_bacteria 2964628898 2964632550 355
365 iso_pu_bacteria 2964643177 2964644588 355
366 iso_pu_bacteria 2964649959 2964655034 355
367 iso_pu_bacteria 2964656573 2964661699 355
368 iso_pu_bacteria 2964663802 2964666807 355
369 iso_pu_bacteria 2964685014 2964689293 355
370 iso_pu_bacteria 2964691889 2964692548 355
371 iso_pu_bacteria 2964698721 2964703236 355
372 iso_pu_bacteria 2964705432 2964709575 355
373 iso_pu_bacteria 2964712639 2964714014 355
374 iso_pu_bacteria 2964719344 2964725284 355
375 iso_pu_bacteria 2967664464 2967668551 355
376 iso_pu_bacteria 2967671571 2967677069 355
377 iso_pu_bacteria 2967678726 2967684741 355
378 iso_pu_bacteria 2967686174 2967687949 355
379 iso_pu_bacteria 2967693043 2967697813 355
380 iso_pu_bacteria 2967699805 2967700283 355
381 iso_pu_bacteria 2967706974 2967707663 355
382 iso_pu_bacteria 2967721400 2967725191 355
383 iso_pu_bacteria 2967728569 2967732707 355
384 iso_pu_bacteria 2967735183 2967736542 355
385 iso_pu_bacteria 2967742019 2967745661 355
386 iso_pu_bacteria 2967748971 2967750843 355
387 iso_pu_bacteria 2967755722 2967761673 355
388 iso_pu_bacteria 2967762386 2967766026 355
389 iso_pu_bacteria 2967769361 2967772293 355
390 iso_pu_bacteria 2970019648 2970023542 355
391 iso_pu_bacteria 2970026789 2970028870 355
392 iso_pu_bacteria 2970033650 2970038245 355
393 iso_pu_bacteria 2970040964 2970046511 355
394 iso_pu_bacteria 2970047711 2970053724 355
395 iso_pu_bacteria 2970054988 2970058655 355
396 iso_pu_bacteria 2970061556 2970062404 355
397 iso_pu_bacteria 2970068827 2970071292 355
398 iso_pu_bacteria 2970082768 2970083975 355
399 iso_pu_bacteria 2970088815 2970094757 355
400 iso_pu_bacteria 2970095765 2970097357 355
401 iso_pu_bacteria 2970102677 2970105832 355
402 iso_pu_bacteria 2970109326 2970114803 355
403 iso_pu_bacteria 2970116247 2970119604 355
404 iso_pu_bacteria 2970122695 2970126633 355
405 iso_pu_bacteria 2970129317 2970134942 355
406 iso_pu_bacteria 2970143518 2970148408 355
407 iso_pu_bacteria 2970149975 2970154119 355
408 iso_pu_bacteria 2970156795 2970162943 355
409 iso_pu_bacteria 2970164137 2970164639 355
410 iso_pu_bacteria 2970170962 2970174305 355
411 iso_pu_bacteria 2970177841 2970182353 355
412 iso_pu_bacteria 2970184632 2970189393 355
413 iso_pu_bacteria 2970191845 2970194667 355
414 iso_pu_bacteria 2977516862 2977518804 355
415 iso_pu_bacteria 2977523885 2977526619 355
416 iso_pu_bacteria 2977530762 2977533874 355
417 iso_pu_bacteria 2977537788 2977541327 355
418 iso_pu_bacteria 2977544691 2977547962 355
419 iso_pu_bacteria 2977551784 2977557711 355
420 iso_pu_bacteria 2977558990 2977559578 355
421 iso_pu_bacteria 2977565890 2977569222 355
422 iso_pu_bacteria 2977572785 2977578765 355
423 iso_pu_bacteria 2977579622 2977584708 355
424 iso_pu_bacteria 643692032 643826595 355
425 iso_pu_bacteria 648276728 648739906 355
426 iso_pu_bacteria 8003992118 8003996265 355
427 iso_pu_bacteria 8003999396 8004004018 355
428 3300003781 Ga0055536_1001497 Ga0055536_10014973 356
429 3300003794 Ga0055531_10001986 Ga0055531_1000198611 356
430 3300005262 Ga0065165_1002490 Ga0065165_100249012 356
431 3300006038 Ga0075365_10005037 Ga0075365_100050373 356
432 3300006946 Ga0079104_1000015 Ga0079104_100001592 356
433 3300025292 Ga0209676_1003467 Ga0209676_10034676 356
434 3300025297 Ga0209758_1000058 Ga0209758_1000058152 356
435 3300025298 Ga0209050_1002725 Ga0209050_100272518 356
436 3300025303 Ga0209051_1000785 Ga0209051_100078515 356
437 3300027111 Ga0209281_1000034 Ga0209281_1000034367 356
438 3300046530 Ga0495654_0000758 Ga0495654_0000758_16162_17409 356
439 3300048924 Ga0496121_0028932 Ga0496121_0028932_1090_2313 356
440 3300048925 Ga0496122_0000462 Ga0496122_0000462_41254_42471 356
441 3300048926 Ga0496123_0000048 Ga0496123_0000048_42076_43293 356
442 3300048929 Ga0496126_0026521 Ga0496126_0026521_1386_2576 356
443 3300050492 nmdc:mga0yw44_3218_c1 nmdc:mga0yw44_3218_c1_3011_4201 356
444 3300053125 Ga0500618_000056 Ga0500618_000056_7541_8770 356
445 3300053125 Ga0500618_000304 Ga0500618_000304_9055_10281 356
446 3300053153 Ga0500616_0000363 Ga0500616_0000363_48994_50184 356
447 3300053158 Ga0500627_0019208 Ga0500627_0019208_191_1438 356
448 iso_pu_bacteria 2510461069 2510840606 356
449 iso_pu_bacteria 2582581308 2585279345 356
450 iso_pu_bacteria 2582581315 2585323050 356
451 iso_pu_bacteria 2582581316 2585331162 356
452 iso_pu_bacteria 2585427527 2585531170 356
453 iso_pu_bacteria 2585427530 2585552906 356
454 iso_pu_bacteria 2599185236 2599721720 356
455 iso_pu_bacteria 2600254933 2600374039 356
456 iso_pu_bacteria 2615840626 2616311088 356
457 iso_pu_bacteria 2615840698 2616554525 356
458 iso_pu_bacteria 2617270742 2617385408 356
459 iso_pu_bacteria 2643221558 2643811262 356
460 iso_pu_bacteria 2657244999 2657681768 356
461 iso_pu_bacteria 2667528174 2671111157 356
462 iso_pu_bacteria 2775507266 2778175707 356
463 iso_pu_bacteria 2791355082 2792581482 356
464 iso_pu_bacteria 2802429268 2804752953 356
465 iso_pu_bacteria 2818991448 2819609413 356
466 iso_pu_bacteria 2818991453 2819641275 356
467 iso_pu_bacteria 2821123053 2821125835 356
468 iso_pu_bacteria 2838736955 2838737715 356
469 iso_pu_bacteria 2841840854 2841841916 356
470 iso_pu_bacteria 2842140634 2842141695 356
471 iso_pu_bacteria 2854896431 2854901433 356
472 iso_pu_bacteria 2854916844 2854918954 356
473 iso_pu_bacteria 2857531043 2857532396 356
474 iso_pu_bacteria 2919171160 2919173062 356
475 iso_pu_bacteria 8049293176 8049295563 356
476 iso_pu_bacteria 8054558443 8054561974 356
477 3300002987 JGI25159J45721_1000004 JGI25159J45721_100000419 357
478 3300003187 JGI25151J46595_10012519 JGI25151J46595_100125193 357
479 3300003187 JGI25151J46595_10020722 JGI25151J46595_100207223 357
480 3300003354 JGI25160J50197_1000021 JGI25160J50197_1000021190 357
481 3300003374 JGI25161J50226_1000534 JGI25161J50226_10005349 357
482 3300003775 Ga0055524_1000572 Ga0055524_10005728 357
483 3300003781 Ga0055536_1010331 Ga0055536_10103314 357
484 3300004625 Ga0055543_1000102 Ga0055543_100010219 357
485 3300005262 Ga0065165_1000033 Ga0065165_1000033190 357
486 3300006051 Ga0075364_10000029 Ga0075364_1000002950 357
487 3300013105 Ga0157369_10024034 Ga0157369_100240342 357
488 3300013249 Ga0171463_1007 Ga0171463_100790 357
489 3300015690 Ga0183363_1071 Ga0183363_107113 357
490 3300025208 Ga0209436_101492 Ga0209436_1014922 357
491 3300025284 Ga0209130_1000017 Ga0209130_1000017193 357
492 3300025292 Ga0209676_1007006 Ga0209676_10070066 357
493 3300025294 Ga0209025_1000161 Ga0209025_100016118 357
494 3300025294 Ga0209025_1000545 Ga0209025_10005459 357
495 3300025295 Ga0209564_1000013 Ga0209564_1000013641 357
496 3300025298 Ga0209050_1005641 Ga0209050_10056414 357
497 3300025299 Ga0209256_1000153 Ga0209256_1000153125 357
498 3300025299 Ga0209256_1002031 Ga0209256_10020313 357
499 3300025302 Ga0207426_1000006 Ga0207426_1000006192 357
500 3300025304 Ga0209257_1018875 Ga0209257_10188753 357
501 3300025304 Ga0209257_1043660 Ga0209257_10436601 357
502 3300031731 Ga0307405_10106434 Ga0307405_101064341 357
503 3300048919 Ga0496116_0000105 Ga0496116_0000105_123056_124249 357
504 3300048921 Ga0496118_0116059 Ga0496118_0116059_631_1737 357
505 3300048923 Ga0496120_0076250 Ga0496120_0076250_81_1259 357
506 3300048924 Ga0496121_0002836 Ga0496121_0002836_6428_7603 357
507 3300048925 Ga0496122_0000414 Ga0496122_0000414_52897_54075 357
508 3300048926 Ga0496123_0000147 Ga0496123_0000147_129167_130345 357
509 3300048927 Ga0496124_0000348 Ga0496124_0000348_59178_60356 357
510 3300048927 Ga0496124_0139661 Ga0496124_0139661_71_1309 357
511 3300048928 Ga0496125_0001465 Ga0496125_0001465_134_1312 357
512 3300048928 Ga0496125_0004586 Ga0496125_0004586_274_1452 357
513 3300048929 Ga0496126_0000188 Ga0496126_0000188_70367_71605 357
514 3300048929 Ga0496126_0000879 Ga0496126_0000879_38543_39721 357
515 3300048929 Ga0496126_0012445 Ga0496126_0012445_4215_5393 357
516 3300049570 Ga0501033_0074199 Ga0501033_0074199_55_1233 357
517 3300049571 Ga0501034_0056607 Ga0501034_0056607_2601_3779 357
518 3300049572 Ga0501036_0057659 Ga0501036_0057659_1885_3063 357
519 3300050491 nmdc:mga00v17_144_c1 nmdc:mga00v17_144_c1_33964_35139 357
520 3300053122 Ga0500608_060642 Ga0500608_060642_330_1508 357
521 3300053177 Ga0500636_0001041 Ga0500636_0001041_6905_8098 357
522 iso_pu_bacteria 2558860983 2561469501 357
523 iso_pu_bacteria 2582581306 2585265728 357
524 iso_pu_bacteria 2582581865 2585388934 357
525 iso_pu_bacteria 2599185352 2600194891 357
526 iso_pu_bacteria 2643221557 2643804151 357
527 iso_pu_bacteria 2643221568 2643856527 357
528 iso_pu_bacteria 2643221610 2644065073 357
529 iso_pu_bacteria 2643221618 2644105215 357
530 iso_pu_bacteria 2643221626 2644145709 357
531 iso_pu_bacteria 2643221655 2644309628 357
532 iso_pu_bacteria 2643221659 2644331204 357
533 iso_pu_bacteria 2643221668 2644376516 357
534 iso_pu_bacteria 2643221675 2644416746 357
535 iso_pu_bacteria 2643221680 2644449786 357
536 iso_pu_bacteria 2643221698 2644543357 357
537 iso_pu_bacteria 2643221712 2644616152 357
538 iso_pu_bacteria 2643221723 2644675778 357
539 iso_pu_bacteria 2643221726 2644689918 357
540 iso_pu_bacteria 2818991272 2819241017 357
541 iso_pu_bacteria 2844163670 2844163972 357
542 iso_pu_bacteria 2891373044 2891373632 357
543 iso_pu_bacteria 2919166419 2919169549 357
544 iso_pu_bacteria 2920822456 2920825531 357
545 iso_pu_bacteria 2941499720 2941504685 357
546 iso_pu_bacteria 2978969890 2978971952 357
547 iso_pu_bacteria 2984587000 2984590237 357
548 iso_pu_bacteria 2989349275 2989350112 357
549 iso_pu_bacteria 3005452660 3005454981 357
550 iso_pu_bacteria 8018150411 8018151277 357
551 iso_pu_bacteria 8054460903 8054463196 357
552 iso_pu_bacteria 8056875544 8056875852 357
553 3300002739 JGI25158J39367_1000097 JGI25158J39367_10000975 358
554 3300002773 JGI25152J39213_1002158 JGI25152J39213_10021582 358
555 3300002773 JGI25152J39213_1005874 JGI25152J39213_10058742 358
556 3300002773 JGI25152J39213_1019264 JGI25152J39213_10192641 358
557 3300002773 JGI25152J39213_1019273 JGI25152J39213_10192731 358
558 3300002774 JGI25150J39212_1002765 JGI25150J39212_10027657 358
559 3300002987 JGI25159J45721_1002615 JGI25159J45721_10026155 358
560 3300003187 JGI25151J46595_10003013 JGI25151J46595_1000301313 358
561 3300003187 JGI25151J46595_10017075 JGI25151J46595_100170753 358
562 3300003215 JGI25153J46596_10002359 JGI25153J46596_1000235913 358
563 3300003215 JGI25153J46596_10004820 JGI25153J46596_100048209 358
564 3300003215 JGI25153J46596_10048278 JGI25153J46596_100482781 358
565 3300003215 JGI25153J46596_10048289 JGI25153J46596_100482891 358
566 3300003320 rootH2_10026824 rootH2_100268241 358
567 3300003354 JGI25160J50197_1000351 JGI25160J50197_100035116 358
568 3300003354 JGI25160J50197_1006792 JGI25160J50197_10067924 358
569 3300003354 JGI25160J50197_1008702 JGI25160J50197_10087025 358
570 3300003374 JGI25161J50226_1000167 JGI25161J50226_100016718 358
571 3300003771 Ga0055526_1000842 Ga0055526_10008429 358
572 3300003771 Ga0055526_1004423 Ga0055526_10044234 358
573 3300003775 Ga0055524_1002425 Ga0055524_10024253 358
574 3300003775 Ga0055524_1003892 Ga0055524_100389211 358
575 3300003775 Ga0055524_1017337 Ga0055524_10173372 358
576 3300003790 Ga0055528_1000158 Ga0055528_100015862 358
577 3300003790 Ga0055528_1000749 Ga0055528_100074917 358
578 3300003790 Ga0055528_1003189 Ga0055528_10031893 358
579 3300003792 Ga0055540_1000518 Ga0055540_100051824 358
580 3300003792 Ga0055540_1006013 Ga0055540_10060131 358
581 3300003792 Ga0055540_1018452 Ga0055540_10184522 358
582 3300003856 Ga0058692_1004992 Ga0058692_10049923 358
583 3300004625 Ga0055543_1000060 Ga0055543_10000606 358
584 3300004625 Ga0055543_1000699 Ga0055543_10006997 358
585 3300005262 Ga0065165_1004363 Ga0065165_10043638 358
586 3300005262 Ga0065165_1007452 Ga0065165_10074521 358
587 3300005262 Ga0065165_1008586 Ga0065165_10085863 358
588 3300005347 Ga0070668_100155931 Ga0070668_1001559311 358
589 3300005455 Ga0070663_100013668 Ga0070663_1000136688 358
590 3300005548 Ga0070665_100007074 Ga0070665_1000070743 358
591 3300006038 Ga0075365_10010140 Ga0075365_100101407 358
592 3300006048 Ga0075363_100011370 Ga0075363_1000113702 358
593 3300006048 Ga0075363_100024884 Ga0075363_1000248843 358
594 3300006177 Ga0075362_10009629 Ga0075362_100096292 358
595 3300006177 Ga0075362_10012636 Ga0075362_100126362 358
596 3300006178 Ga0075367_10000779 Ga0075367_1000077911 358
597 3300006195 Ga0075366_10003058 Ga0075366_100030589 358
598 3300006353 Ga0075370_10003951 Ga0075370_100039519 358
599 3300006948 Ga0099826_10000462 Ga0099826_1000046217 358
600 3300006948 Ga0099826_10010687 Ga0099826_100106874 358
601 3300009011 Ga0105251_10010023 Ga0105251_100100236 358
602 3300009148 Ga0105243_10130163 Ga0105243_101301632 358
603 3300009177 Ga0105248_10251851 Ga0105248_102518512 358
604 3300009765 Ga0123341_1000035 Ga0123341_100003527 358
605 3300009766 Ga0123342_1009440 Ga0123342_10094405 358
606 3300013102 Ga0157371_10000017 Ga0157371_10000017280 358
607 3300013104 Ga0157370_10001031 Ga0157370_1000103125 358
608 3300025208 Ga0209436_100081 Ga0209436_10008144 358
609 3300025245 Ga0207425_1004231 Ga0207425_10042313 358
610 3300025258 Ga0209129_1000283 Ga0209129_100028327 358
611 3300025258 Ga0209129_1000450 Ga0209129_100045024 358
612 3300025258 Ga0209129_1001443 Ga0209129_10014432 358
613 3300025258 Ga0209129_1001916 Ga0209129_10019161 358
614 3300025258 Ga0209129_1004411 Ga0209129_10044113 358
615 3300025258 Ga0209129_1005600 Ga0209129_10056002 358
616 3300025273 Ga0209673_1000010 Ga0209673_1000010574 358
617 3300025273 Ga0209673_1000112 Ga0209673_100011278 358
618 3300025273 Ga0209673_1000637 Ga0209673_100063750 358
619 3300025273 Ga0209673_1003653 Ga0209673_10036532 358
620 3300025273 Ga0209673_1004043 Ga0209673_100404311 358
621 3300025284 Ga0209130_1000023 Ga0209130_100002352 358
622 3300025284 Ga0209130_1009106 Ga0209130_10091062 358
623 3300025292 Ga0209676_1019600 Ga0209676_10196002 358
624 3300025294 Ga0209025_1000091 Ga0209025_1000091192 358
625 3300025294 Ga0209025_1000154 Ga0209025_100015484 358
626 3300025294 Ga0209025_1001424 Ga0209025_100142414 358
627 3300025294 Ga0209025_1004971 Ga0209025_10049712 358
628 3300025294 Ga0209025_1011337 Ga0209025_10113376 358
629 3300025294 Ga0209025_1014587 Ga0209025_10145876 358
630 3300025295 Ga0209564_1000564 Ga0209564_100056434 358
631 3300025295 Ga0209564_1003798 Ga0209564_10037983 358
632 3300025295 Ga0209564_1008415 Ga0209564_10084152 358
633 3300025297 Ga0209758_1000725 Ga0209758_100072531 358
634 3300025297 Ga0209758_1000863 Ga0209758_100086316 358
635 3300025297 Ga0209758_1001901 Ga0209758_10019018 358
636 3300025297 Ga0209758_1001960 Ga0209758_100196010 358
637 3300025297 Ga0209758_1002718 Ga0209758_100271814 358
638 3300025297 Ga0209758_1006925 Ga0209758_10069254 358
639 3300025297 Ga0209758_1008591 Ga0209758_10085913 358
640 3300025299 Ga0209256_1001132 Ga0209256_100113222 358
641 3300025299 Ga0209256_1001499 Ga0209256_100149912 358
642 3300025299 Ga0209256_1003097 Ga0209256_10030974 358
643 3300025299 Ga0209256_1016662 Ga0209256_10166623 358
644 3300025302 Ga0207426_1000008 Ga0207426_100000818 358
645 3300025302 Ga0207426_1000228 Ga0207426_1000228104 358
646 3300025302 Ga0207426_1020140 Ga0207426_10201401 358
647 3300025303 Ga0209051_1000462 Ga0209051_100046246 358
648 3300025303 Ga0209051_1001635 Ga0209051_10016359 358
649 3300025303 Ga0209051_1007538 Ga0209051_10075382 358
650 3300025303 Ga0209051_1021723 Ga0209051_10217232 358
651 3300025303 Ga0209051_1022515 Ga0209051_10225152 358
652 3300025303 Ga0209051_1028422 Ga0209051_10284221 358
653 3300025304 Ga0209257_1003221 Ga0209257_100322111 358
654 3300025935 Ga0207709_10055844 Ga0207709_100558442 358
655 3300026067 Ga0207678_10025462 Ga0207678_100254628 358
656 3300027312 Ga0209371_1000022 Ga0209371_1000022308 358
657 3300027312 Ga0209371_1000341 Ga0209371_100034140 358
658 3300027666 Ga0209282_1002798 Ga0209282_10027984 358
659 3300028379 Ga0268266_10005469 Ga0268266_100054693 358
660 3300028794 Ga0307515_10006213 Ga0307515_1000621312 358
661 3300028794 Ga0307515_10019245 Ga0307515_1001924511 358
662 3300028794 Ga0307515_10029550 Ga0307515_100295508 358
663 3300030500 Ga0268256_1000019 Ga0268256_1000019212 358
664 3300030500 Ga0268256_1001403 Ga0268256_10014033 358
665 3300031731 Ga0307405_10003197 Ga0307405_100031975 358
666 3300031995 Ga0307409_100120972 Ga0307409_1001209722 358
667 3300032004 Ga0307414_10185448 Ga0307414_101854482 358
668 3300041404 Ga0439436_0023412 Ga0439436_0023412_588_1742 358
669 3300041413 Ga0439465_0035999 Ga0439465_0035999_272_1450 358
670 3300041498 Ga0451841_0039604 Ga0451841_0039604_4576_5754 358
671 3300041501 Ga0451845_0606012 Ga0451845_0606012_168_1346 358
672 3300041503 Ga0451847_0140826 Ga0451847_0140826_618_1796 358
673 3300041505 Ga0451849_0223659 Ga0451849_0223659_257_1435 358
674 3300041509 Ga0451843_0363805 Ga0451843_0363805_37_1164 358
675 3300041511 Ga0451855_1540700 Ga0451855_1540700_1011_2189 358
676 3300042007 Ga0439449_0073186 Ga0439449_0073186_40_1218 358
677 3300046474 Ga0495605_0051054 Ga0495605_0051054_32_1210 358
678 3300046501 Ga0495607_0029710 Ga0495607_0029710_739_1917 358
679 3300046506 Ga0495583_0003748 Ga0495583_0003748_10113_11291 358
680 3300046507 Ga0495606_0007555 Ga0495606_0007555_4984_6111 358
681 3300046512 Ga0495610_0003874 Ga0495610_0003874_1347_2525 358
682 3300046512 Ga0495610_0056086 Ga0495610_0056086_654_1832 358
683 3300046515 Ga0495620_0008486 Ga0495620_0008486_3222_4349 358
684 3300046518 Ga0495631_0035148 Ga0495631_0035148_818_1996 358
685 3300046519 Ga0495632_0004091 Ga0495632_0004091_7577_8755 358
686 3300046519 Ga0495632_0041967 Ga0495632_0041967_99_1277 358
687 3300046522 Ga0495643_0010861 Ga0495643_0010861_3136_4314 358
688 3300046522 Ga0495643_0022449 Ga0495643_0022449_1905_3083 358
689 3300046522 Ga0495643_0031031 Ga0495643_0031031_984_2111 358
690 3300046524 Ga0495648_0010074 Ga0495648_0010074_1253_2431 358
691 3300046558 Ga0495633_0053247 Ga0495633_0053247_497_1660 358
692 3300046616 Ga0495668_0131734 Ga0495668_0131734_38_1165 358
693 3300046660 Ga0495625_0018174 Ga0495625_0018174_3851_5029 358
694 3300046665 Ga0495661_0038286 Ga0495661_0038286_1108_2286 358
695 3300046674 Ga0495588_0006717 Ga0495588_0006717_1191_2354 358
696 3300046694 Ga0495649_0020903 Ga0495649_0020903_1907_3094 358
697 3300047443 Ga0495687_026142 Ga0495687_026142_1362_2540 358
698 3300047470 Ga0495681_0010603 Ga0495681_0010603_1221_2447 358
699 3300047472 Ga0495686_0011015 Ga0495686_0011015_1311_2489 358
700 3300047472 Ga0495686_0055394 Ga0495686_0055394_668_1846 358
701 3300047472 Ga0495686_0090345 Ga0495686_0090345_742_1845 358
702 3300048905 Ga0496102_0218466 Ga0496102_0218466_66_1244 358
703 3300048907 Ga0496104_0015245 Ga0496104_0015245_786_1964 358
704 3300048907 Ga0496104_0025629 Ga0496104_0025629_3083_4297 358
705 3300048908 Ga0496105_0117401 Ga0496105_0117401_838_2016 358
706 3300048909 Ga0496106_0001496 Ga0496106_0001496_7813_8991 358
707 3300048909 Ga0496106_0069311 Ga0496106_0069311_1306_2481 358
708 3300048911 Ga0496108_0245925 Ga0496108_0245925_232_1410 358
709 3300048913 Ga0496110_0128688 Ga0496110_0128688_892_2070 358
710 3300048916 Ga0496113_0093756 Ga0496113_0093756_105_1268 358
711 3300048917 Ga0496114_0443684 Ga0496114_0443684_36_1139 358
712 3300048919 Ga0496116_0015579 Ga0496116_0015579_3604_4782 358
713 3300048919 Ga0496116_0073970 Ga0496116_0073970_568_1746 358
714 3300048920 Ga0496117_0000002 Ga0496117_0000002_239577_240740 358
715 3300048920 Ga0496117_0104330 Ga0496117_0104330_242_1441 358
716 3300048920 Ga0496117_0171916 Ga0496117_0171916_20_1186 358
717 3300048921 Ga0496118_0001193 Ga0496118_0001193_37663_38826 358
718 3300048921 Ga0496118_0004636 Ga0496118_0004636_7886_9064 358
719 3300048921 Ga0496118_0019763 Ga0496118_0019763_3597_4811 358
720 3300048921 Ga0496118_0028169 Ga0496118_0028169_1149_2327 358
721 3300048922 Ga0496119_0022399 Ga0496119_0022399_1497_2711 358
722 3300048922 Ga0496119_0044519 Ga0496119_0044519_204_1403 358
723 3300048922 Ga0496119_0047169 Ga0496119_0047169_959_2122 358
724 3300048923 Ga0496120_0000309 Ga0496120_0000309_19129_20292 358
725 3300048923 Ga0496120_0077461 Ga0496120_0077461_564_1763 358
726 3300048924 Ga0496121_0000003 Ga0496121_0000003_620485_621684 358
727 3300048924 Ga0496121_0014795 Ga0496121_0014795_3021_4199 358
728 3300048924 Ga0496121_0044847 Ga0496121_0044847_1846_3024 358
729 3300048924 Ga0496121_0055438 Ga0496121_0055438_1205_2380 358
730 3300048924 Ga0496121_0234592 Ga0496121_0234592_57_1244 358
731 3300048925 Ga0496122_0000004 Ga0496122_0000004_404936_406099 358
732 3300048925 Ga0496122_0050047 Ga0496122_0050047_713_1891 358
733 3300048925 Ga0496122_0052128 Ga0496122_0052128_1035_2234 358
734 3300048925 Ga0496122_0061915 Ga0496122_0061915_92_1267 358
735 3300048926 Ga0496123_0000007 Ga0496123_0000007_404936_406099 358
736 3300048926 Ga0496123_0028649 Ga0496123_0028649_2403_3578 358
737 3300048927 Ga0496124_0000067 Ga0496124_0000067_139241_140437 358
738 3300048927 Ga0496124_0016988 Ga0496124_0016988_2745_3872 358
739 3300048927 Ga0496124_0024351 Ga0496124_0024351_3075_4274 358
740 3300048927 Ga0496124_0033989 Ga0496124_0033989_578_1756 358
741 3300048927 Ga0496124_0053449 Ga0496124_0053449_854_2032 358
742 3300048927 Ga0496124_0158035 Ga0496124_0158035_139_1242 358
743 3300048927 Ga0496124_0190127 Ga0496124_0190127_259_1386 358
744 3300048928 Ga0496125_0001144 Ga0496125_0001144_11213_12412 358
745 3300048928 Ga0496125_0008427 Ga0496125_0008427_1533_2747 358
746 3300048928 Ga0496125_0031593 Ga0496125_0031593_780_1958 358
747 3300048929 Ga0496126_0067348 Ga0496126_0067348_745_1923 358
748 3300048929 Ga0496126_0202470 Ga0496126_0202470_87_1250 358
749 3300048929 Ga0496126_0240564 Ga0496126_0240564_93_1268 358
750 3300049569 Ga0501032_0024801 Ga0501032_0024801_635_1813 358
751 3300049580 Ga0501046_0071572 Ga0501046_0071572_250_1428 358
752 3300050489 nmdc:mga03683_8605_c1 nmdc:mga03683_8605_c1_304_1482 358
753 3300050490 nmdc:mga03n38_14153_c1 nmdc:mga03n38_14153_c1_1698_2876 358
754 3300050491 nmdc:mga00v17_7_c1 nmdc:mga00v17_7_c1_30213_31376 358
755 3300050493 nmdc:mga0k408_22786_c1 nmdc:mga0k408_22786_c1_1902_3080 358
756 3300050496 nmdc:mga07m45_435_c1 nmdc:mga07m45_435_c1_7255_8433 358
757 3300050516 nmdc:mga0sz30_27411_c1 nmdc:mga0sz30_27411_c1_977_2155 358
758 3300053107 Ga0500560_004635 Ga0500560_004635_1541_2752 358
759 3300053134 Ga0500658_0005794 Ga0500658_0005794_72_1250 358
760 3300053134 Ga0500658_0007104 Ga0500658_0007104_1134_2321 358
761 3300053135 Ga0500659_0044803 Ga0500659_0044803_521_1648 358
762 3300053137 Ga0500561_0000236 Ga0500561_0000236_6365_7528 358
763 3300053139 Ga0500568_0009854 Ga0500568_0009854_2300_3478 358
764 3300053139 Ga0500568_0028393 Ga0500568_0028393_74_1261 358
765 3300053140 Ga0500573_0001176 Ga0500573_0001176_4359_5540 358
766 3300053140 Ga0500573_0004052 Ga0500573_0004052_1650_2831 358
767 3300053151 Ga0500604_0010108 Ga0500604_0010108_947_2125 358
768 3300053156 Ga0500622_0001665 Ga0500622_0001665_7645_8832 358
769 3300053157 Ga0500624_001429 Ga0500624_001429_579_1730 358
770 3300053160 Ga0500633_0004554 Ga0500633_0004554_1507_2685 358
771 3300053161 Ga0500634_0027598 Ga0500634_0027598_487_1713 358
772 3300060353 Ga0501082_0076077 Ga0501082_0076077_1273_2451 358
773 iso_pu_bacteria 2509276021 2509391731 358
774 iso_pu_bacteria 2510917028 2511182413 358
775 iso_pu_bacteria 2513237144 2513908472 358
776 iso_pu_bacteria 2513237146 2513928164 358
777 iso_pu_bacteria 2513237159 2513997626 358
778 iso_pu_bacteria 2516653077 2517037010 358
779 iso_pu_bacteria 2516653085 2517077374 358
780 iso_pu_bacteria 2517093000 2517096133 358
781 iso_pu_bacteria 2517287029 2517407754 358
782 iso_pu_bacteria 2519899620 2520380348 358
783 iso_pu_bacteria 2529292951 2530646504 358
784 iso_pu_bacteria 2534681796 2535517165 358
785 iso_pu_bacteria 2537561587 2537877205 358
786 iso_pu_bacteria 2582581283 2585167501 358
787 iso_pu_bacteria 2582581294 2585201940 358
788 iso_pu_bacteria 2582581299 2585228583 358
789 iso_pu_bacteria 2599185170 2599416946 358
790 iso_pu_bacteria 2599185210 2599601888 358
791 iso_pu_bacteria 2600255279 2601609858 358
792 iso_pu_bacteria 2600255308 2601746633 358
793 iso_pu_bacteria 2643221607 2644050177 358
794 iso_pu_bacteria 2643221634 2644191757 358
795 iso_pu_bacteria 2643221636 2644204762 358
796 iso_pu_bacteria 2643221653 2644298972 358
797 iso_pu_bacteria 2643221686 2644483097 358
798 iso_pu_bacteria 2643221688 2644494266 358
799 iso_pu_bacteria 2643221689 2644497744 358
800 iso_pu_bacteria 2643221719 2644657200 358
801 iso_pu_bacteria 2718217997 2719666450 358
802 iso_pu_bacteria 2718218199 2720492870 358
803 iso_pu_bacteria 2738541293 2738804975 358
804 iso_pu_bacteria 2838016132 2838020062 358
805 iso_pu_bacteria 2838022645 2838023564 358
806 iso_pu_bacteria 2838035591 2838041724 358
807 iso_pu_bacteria 2838048938 2838053264 358
808 iso_pu_bacteria 2838061910 2838065380 358
809 iso_pu_bacteria 2838068647 2838069857 358
810 iso_pu_bacteria 2838074704 2838079747 358
811 iso_pu_bacteria 2838661181 2838661301 358
812 iso_pu_bacteria 2838668709 2838674809 358
813 iso_pu_bacteria 2838675328 2838675548 358
814 iso_pu_bacteria 2838680041 2838683155 358
815 iso_pu_bacteria 2838686498 2838686751 358
816 iso_pu_bacteria 2838694306 2838697901 358
817 iso_pu_bacteria 2838701080 2838707138 358
818 iso_pu_bacteria 2838707686 2838711016 358
819 iso_pu_bacteria 2838714209 2838714429 358
820 iso_pu_bacteria 2838719591 2838721769 358
821 iso_pu_bacteria 2838724970 2838725190 358
822 iso_pu_bacteria 2838729681 2838730291 358
823 iso_pu_bacteria 2838742623 2838742694 358
824 iso_pu_bacteria 2841846520 2841848753 358
825 iso_pu_bacteria 2841851746 2841854579 358
826 iso_pu_bacteria 2841859092 2841862355 358
827 iso_pu_bacteria 2841864319 2841867254 358
828 iso_pu_bacteria 2842077413 2842079191 358
829 iso_pu_bacteria 2842110456 2842112971 358
830 iso_pu_bacteria 2842118031 2842118298 358
831 iso_pu_bacteria 2842124991 2842125216 358
832 iso_pu_bacteria 2842130223 2842130443 358
833 iso_pu_bacteria 2842146304 2842151782 358
834 iso_pu_bacteria 2842152218 2842154387 358
835 iso_pu_bacteria 2842156927 2842158401 358
836 iso_pu_bacteria 2842163707 2842170223 358
837 iso_pu_bacteria 2842170452 2842170672 358
838 iso_pu_bacteria 2842175837 2842178007 358
839 iso_pu_bacteria 2842180545 2842182017 358
840 iso_pu_bacteria 2842187318 2842187538 358
841 iso_pu_bacteria 2842192696 2842195764 358
842 iso_pu_bacteria 2842198810 2842199078 358
843 iso_pu_bacteria 2842205361 2842209521 358
844 iso_pu_bacteria 2842211629 2842211849 358
845 iso_pu_bacteria 2842217011 2842218241 358
846 iso_pu_bacteria 2842224351 2842226531 358
847 iso_pu_bacteria 2842229732 2842229984 358
848 iso_pu_bacteria 2842237096 2842240212 358
849 iso_pu_bacteria 2842243621 2842243873 358
850 iso_pu_bacteria 2842250916 2842256976 358
851 iso_pu_bacteria 2842257432 2842258042 358
852 iso_pu_bacteria 2842264693 2842267780 358
853 iso_pu_bacteria 2842271015 2842271711 358
854 iso_pu_bacteria 2842278818 2842282975 358
855 iso_pu_bacteria 2842285085 2842285318 358
856 iso_pu_bacteria 2842291075 2842292853 358
857 iso_pu_bacteria 2842304105 2842305342 358
858 iso_pu_bacteria 2842311132 2842313930 358
859 iso_pu_bacteria 2842317721 2842319833 358
860 iso_pu_bacteria 2842341865 2842348142 358
861 iso_pu_bacteria 2842363717 2842368388 358
862 iso_pu_bacteria 2842370503 2842373785 358
863 iso_pu_bacteria 2842377471 2842379250 358
864 iso_pu_bacteria 2842384541 2842384809 358
865 iso_pu_bacteria 2842395702 2842400048 358
866 iso_pu_bacteria 2842402390 2842402678 358
867 iso_pu_bacteria 2842409023 2842409951 358
868 iso_pu_bacteria 2842415677 2842416599 358
869 iso_pu_bacteria 2842422224 2842423471 358
870 iso_pu_bacteria 2842428310 2842430424 358
871 iso_pu_bacteria 2842434925 2842436764 358
872 iso_pu_bacteria 2842441272 2842443394 358
873 iso_pu_bacteria 2842447887 2842449265 358
874 iso_pu_bacteria 2842462802 2842466678 358
875 iso_pu_bacteria 2842469257 2842471366 358
876 iso_pu_bacteria 2842495871 2842497777 358
877 iso_pu_bacteria 2842515876 2842519139 358
878 iso_pu_bacteria 2842521101 2842522131 358
879 iso_pu_bacteria 2844454524 2844458048 358
880 iso_pu_bacteria 2857516855 2857517126 358
881 iso_pu_bacteria 2896384573 2896391138 358
882 iso_pu_bacteria 2899792073 2899794045 358
883 iso_pu_bacteria 2899803654 2899806746 358
884 iso_pu_bacteria 2899845264 2899848825 358
885 iso_pu_bacteria 2919100787 2919106158 358
886 iso_pu_bacteria 2919114240 2919114466 358
887 iso_pu_bacteria 2920760137 2920761269 358
888 iso_pu_bacteria 2923556063 2923561154 358
889 iso_pu_bacteria 2926754445 2926755480 358
890 iso_pu_bacteria 2926760298 2926762611 358
891 iso_pu_bacteria 2929138655 2929141079 358
892 iso_pu_bacteria 2933006813 2933009032 358
893 iso_pu_bacteria 2933011516 2933014687 358
894 iso_pu_bacteria 2933016740 2933018550 358
895 iso_pu_bacteria 2933570622 2933571149 358
896 iso_pu_bacteria 2933586486 2933588972 358
897 iso_pu_bacteria 2933594066 2933596369 358
898 iso_pu_bacteria 2933599457 2933600663 358
899 iso_pu_bacteria 2935894831 2935896714 358
900 iso_pu_bacteria 2935901341 2935901657 358
901 iso_pu_bacteria 2936367885 2936371749 358
902 iso_pu_bacteria 2936375103 2936379584 358
903 iso_pu_bacteria 2936381700 2936388396 358
904 iso_pu_bacteria 2979089926 2979092077 358
905 iso_pu_bacteria 2979095461 2979100534 358
906 iso_pu_bacteria 2979100975 2979104136 358
907 iso_pu_bacteria 2984509177 2984511294 358
908 iso_pu_bacteria 2984518228 2984522345 358
909 iso_pu_bacteria 2984537506 2984541647 358
910 iso_pu_bacteria 2984601300 2984603920 358
911 iso_pu_bacteria 2989776772 2989779540 358
912 iso_pu_bacteria 2996887358 2996892753 358
913 iso_pu_bacteria 3005409236 3005414265 358
914 iso_pu_bacteria 3005445848 3005448746 358
915 iso_pu_bacteria 639633055 639649465 358
916 iso_pu_bacteria 650716007 650740774 358
917 iso_pu_bacteria 8003570095 8003571850 358
918 iso_pu_bacteria 8005246636 8005249854 358
919 iso_pu_bacteria 8005258706 8005259480 358
920 iso_pu_bacteria 8005282627 8005284524 358
921 iso_pu_bacteria 8005289223 8005295806 358
922 iso_pu_bacteria 8005301065 8005303414 358
923 iso_pu_bacteria 8005307578 8005313894 358
924 iso_pu_bacteria 8005321885 8005327280 358
925 iso_pu_bacteria 8005376324 8005381218 358
926 iso_pu_bacteria 8005382845 8005388821 358
927 iso_pu_bacteria 8005395548 8005395802 358
928 iso_pu_bacteria 8005430974 8005437573 358
929 iso_pu_bacteria 8005460587 8005464091 358
930 iso_pu_bacteria 8005497431 8005501187 358
931 iso_pu_bacteria 8005542996 8005545980 358
932 iso_pu_bacteria 8005556819 8005561512 358
933 iso_pu_bacteria 8005563573 8005568290 358
934 iso_pu_bacteria 8005570704 8005573170 358
935 iso_pu_bacteria 8005619151 8005622554 358
936 iso_pu_bacteria 8005626139 8005630056 358
937 iso_pu_bacteria 8005668836 8005672605 358
938 iso_pu_bacteria 8005688590 8005691814 358
939 iso_pu_bacteria 8005695170 8005697706 358
940 iso_pu_bacteria 8018127388 8018127429 358
941 iso_pu_bacteria 8018163183 8018164276 358
942 iso_pu_bacteria 8018176218 8018179527 358
943 iso_pu_bacteria 8023680758 8023682870 358
944 iso_pu_bacteria 8024479707 8024486285 358
945 iso_pu_bacteria 8024501048 8024504730 358
946 iso_pu_bacteria 8056375014 8056377550 358
947 iso_pu_bacteria 8056382006 8056387202 358
948 iso_pu_bacteria 8057874678 8057882062 358
949 3300005331 Ga0070670_100001104 Ga0070670_10000110415 359
950 3300025925 Ga0207650_10001248 Ga0207650_1000124817 359
951 3300028794 Ga0307515_10000017 Ga0307515_10000017146 359
952 3300031456 Ga0307513_10001095 Ga0307513_1000109516 359
953 iso_pu_bacteria 3003930520 3003934521 359
954 3300001979 JGI24740J21852_10007862 JGI24740J21852_100078625 360
955 3300002704 JGI25155J39150_1000014 JGI25155J39150_1000014148 360
956 3300002705 JGI25156J39149_1000083 JGI25156J39149_100008318 360
957 3300002737 JGI25162J39368_1000217 JGI25162J39368_10002173 360
958 3300002737 JGI25162J39368_1000272 JGI25162J39368_100027242 360
959 3300002737 JGI25162J39368_1000416 JGI25162J39368_10004166 360
960 3300002738 JGI25154J39366_1000052 JGI25154J39366_100005218 360
961 3300002741 JGI25157J39369_1000110 JGI25157J39369_100011061 360
962 3300003214 JGI25165J46597_1000363 JGI25165J46597_100036340 360
963 3300003214 JGI25165J46597_1000767 JGI25165J46597_100076719 360
964 3300003316 rootH1_10055212 rootH1_100552123 360
965 3300005614 Ga0068856_100036153 Ga0068856_1000361533 360
966 3300025206 Ga0209435_100027 Ga0209435_100027144 360
967 3300025233 Ga0209437_100051 Ga0209437_10005117 360
968 3300025233 Ga0209437_100060 Ga0209437_100060238 360
969 3300025246 Ga0209646_1000086 Ga0209646_1000086144 360
970 3300025250 Ga0209026_1000082 Ga0209026_1000082144 360
971 3300025254 Ga0209148_1009625 Ga0209148_10096252 360
972 3300025256 Ga0209759_1000063 Ga0209759_100006357 360
973 3300025261 Ga0209233_1000095 Ga0209233_100009510 360
974 3300025261 Ga0209233_1000190 Ga0209233_1000190122 360
975 3300026078 Ga0207702_10175275 Ga0207702_101752752 360
976 3300044684 Ga0466966_0028464 Ga0466966_0028464_1276_2460 360
977 3300044765 Ga0466970_0000872 Ga0466970_0000872_6852_8036 360
978 3300046476 Ga0495662_0003309 Ga0495662_0003309_3575_4783 360
979 3300046492 Ga0495585_0028890 Ga0495585_0028890_966_2150 360
980 3300046533 Ga0495640_0090534 Ga0495640_0090534_23_1231 360
981 3300046557 Ga0495622_0032920 Ga0495622_0032920_544_1752 360
982 3300046615 Ga0495656_0008409 Ga0495656_0008409_1015_2199 360
983 3300046660 Ga0495625_0082862 Ga0495625_0082862_14_1174 360
984 3300047317 Ga0495604_0031909 Ga0495604_0031909_2802_4010 360
985 3300047470 Ga0495681_0024138 Ga0495681_0024138_1003_2187 360
986 3300047472 Ga0495686_0004112 Ga0495686_0004112_1329_2528 360
987 3300047472 Ga0495686_0024888 Ga0495686_0024888_1189_2373 360
988 3300048922 Ga0496119_0012822 Ga0496119_0012822_434_1618 360
989 3300048923 Ga0496120_0049279 Ga0496120_0049279_1107_2291 360
990 3300048924 Ga0496121_0191893 Ga0496121_0191893_135_1319 360
991 3300048925 Ga0496122_0038867 Ga0496122_0038867_1572_2756 360
992 3300048926 Ga0496123_0028162 Ga0496123_0028162_1732_2916 360
993 3300048927 Ga0496124_0040694 Ga0496124_0040694_1577_2761 360
994 3300053177 Ga0500636_0138528 Ga0500636_0138528_10_1194 360
995 3300061719 Ga0466962_0044526 Ga0466962_0044526_738_1922 360
996 iso_pu_bacteria 2510917022 2511134088 360
997 iso_pu_bacteria 2524023209 2524458918 360
998 iso_pu_bacteria 2582581307 2585271407 360
999 iso_pu_bacteria 2585427531 2585559150 360
1000 iso_pu_bacteria 2585427608 2585898533 360
1001 iso_pu_bacteria 2585427609 2585903904 360
1002 iso_pu_bacteria 2585428125 2587980978 360
1003 iso_pu_bacteria 2775507049 2776914258 360
1004 iso_pu_bacteria 2838029111 2838033324 360
1005 iso_pu_bacteria 2842298080 2842298270 360
1006 iso_pu_bacteria 2842357229 2842360130 360
1007 iso_pu_bacteria 2842475841 2842480011 360
1008 iso_pu_bacteria 2842482326 2842483794 360
1009 iso_pu_bacteria 2842502639 2842505204 360
1010 iso_pu_bacteria 2842509118 2842514213 360
1011 iso_pu_bacteria 2852387548 2852390552 360
1012 iso_pu_bacteria 2919408235 2919410276 360
1013 iso_pu_bacteria 3005416602 3005418903 360
1014 iso_pu_bacteria 8005314921 8005318205 360
1015 iso_pu_bacteria 8005484373 8005488918 360
1016 iso_pu_bacteria 8005645114 8005646000 360
1017 iso_pu_bacteria 8005658619 8005658801 360
1018 iso_pu_bacteria 8005682033 8005682610 360
1019 iso_pu_bacteria 8024486573 8024488326 360
1020 iso_pu_bacteria 8046767195 8046772364 360
1021 iso_pu_bacteria 8057575449 8057576680 360

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00890

FAD_binding_2

FAD binding domain

29

108

0.81

PF01266

DAO

FAD dependent oxidoreductase

29

388

0.78

PF12831

FAD_oxidored

FAD dependent oxidoreductase

29

133

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5na1-assembly1.cif.gz_A nadh:quinone oxidoreductase (ndh-ii) from staphylococcus aureus - holoprotein structure - 2.32 a resolution 0.9311 152 188
5na4-assembly1.cif.gz_A nadh:quinone oxidoreductase (ndh-ii) from staphylococcus aureus - e172s mutant 0.9306 152 188
3klj-assembly1.cif.gz_A crystal structure of nadh:rubredoxin oxidoreductase from clostridium acetobutylicum 0.9226 153 188
4nwz-assembly1.cif.gz_A structure of bacterial type ii nadh dehydrogenase from caldalkalibacillus thermarum at 2.5a resolution 0.9212 152 188
4eqw-assembly1.cif.gz_B crystal structure of the y361f, y419f mutant of staphylococcus aureus coadr 0.9172 153 188
ID Description Score Start End Superfamily
5kmpB00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.8892 152 188 3.50.50.100
af_Q2FZW0_1_353_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.8636 150 188 3.50.50.100
1xhcA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8558 152 191 3.50.50.60
3if9B01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8544 3 338 3.50.50.60
3vrdB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8517 153 189 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A286ICB1-F1-model_v4 Glycine/D-amino acid oxidase-like deaminating enzyme 0.9514 3 354 GO:0005737
AF-A0A1U9YYL5-F1-model_v4 Hydrogen cyanide synthase subunit HcnC (EC 1.4.99.5) 0.9441 1 360 GO:0005737
GO:0050622
AF-A0A849KV79-F1-model_v4 FAD-binding oxidoreductase 0.9418 3 354 GO:0005737
GO:0016020
AF-A0A1U9YYL5-F1-model_v4 Hydrogen cyanide synthase subunit HcnC (EC 1.4.99.5) 0.9416 1 360 GO:0005737
GO:0050622
AF-A0A6N1VAT2-F1-model_v4 FAD-binding oxidoreductase 0.9365 3 351 GO:0005737

Feature Viewer

pLDDT pTM Quality
91.54 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map