F488373

General Info

Members Datasets Scaffolds Average Seq Length
1020 340 2040 200

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0125402|Ga0495629_0125402_868_1593
Length 241
Sequence MAETAQVHVPHEMHVARQNQTARSAGRPGLKPNSRLKYNGRISVEYHITHYDLEQGALEIQYIEEYFGEFPSKKTAAEIVRRLSDRPHLILIASGSLPDDPGTVVPVSYKVAHEIRAHDQEPKLAELVHRLRDFVQFDGRKVLYSWIGGTRRDWRGQGHFRALTEQQEHWAIEQGFDEVVVKTKNRFYEMRGTLDHLRFEVIKYERDPIDNAESKVYLSKRLHPELLERHRSSRTVVQATI

Samples

Sample ID Description Type Environment
1 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
110 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
200 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
201 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
202 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
203 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
204 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
205 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
206 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
207 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
208 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
209 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
211 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
212 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
213 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
214 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
215 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
216 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
217 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
218 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
219 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
220 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
221 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
231 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
232 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
233 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
234 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
235 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
236 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
237 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
238 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
239 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
240 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
241 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
242 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
243 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
244 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
247 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
248 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
249 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
252 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
253 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
254 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
255 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
260 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
261 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
262 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
263 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
264 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
265 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
266 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
267 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
268 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
275 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
276 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
277 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
278 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
296 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
297 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
304 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
305 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
306 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
307 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
308 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
309 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
310 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
311 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
312 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
313 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
314 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
315 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
316 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
317 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
320 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
321 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
322 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
323 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
324 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
325 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
326 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
327 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
328 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
329 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
330 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
331 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
332 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
333 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
334 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
335 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
336 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
337 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
338 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
339 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
340 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.08
Nodule 0
Rhizoplane 4.41
Rhizosphere 94.31
Stem 0
Stem Tuber 0
Unclassified 16.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495629_0125402 3300046459 Bacteria 1789
2 MBSR1b_contig_10041855 2162886012 Unclassified 1280
3 JGI24751J29686_10024907 3300002459 Bacteria 1242
4 Ga0065712_10071599 3300005290 Bacteria 5166
5 Ga0065712_10097619 3300005290 Unclassified 2145
6 Ga0065715_10007929 3300005293 Bacteria 2767
7 Ga0065715_10030101 3300005293 Bacteria 1500
8 Ga0065715_10104862 3300005293 Bacteria 2926
9 Ga0065715_10117095 3300005293 Bacteria 2351
10 Ga0065715_10317792 3300005293 Bacteria 1006
11 Ga0065707_10162330 3300005295 Unclassified 1551
12 Ga0065707_10244997 3300005295 Unclassified 1143
13 Ga0070676_10006898 3300005328 Bacteria 6079
14 Ga0070676_10326427 3300005328 Unclassified 1048
15 Ga0070683_100043223 3300005329 Bacteria 4153
16 Ga0070683_100312414 3300005329 Bacteria 1495
17 Ga0070683_100536813 3300005329 Bacteria 1118
18 Ga0070690_100012002 3300005330 Bacteria 5084
19 Ga0070690_100066619 3300005330 Bacteria 2331
20 Ga0070690_100300722 3300005330 Bacteria 1151
21 Ga0070690_100519417 3300005330 Bacteria 893
22 Ga0070670_100053413 3300005331 Bacteria 3470
23 Ga0070670_100083801 3300005331 Bacteria 2739
24 Ga0070670_100151488 3300005331 Unclassified 2007
25 Ga0070670_100414144 3300005331 Bacteria 1191
26 Ga0070677_10032055 3300005333 Bacteria 2013
27 Ga0070677_10205055 3300005333 Unclassified 954
28 Ga0068869_100088619 3300005334 Bacteria 2323
29 Ga0068869_100185682 3300005334 Bacteria 1632
30 Ga0068869_100326326 3300005334 Bacteria 1246
31 Ga0070666_10039396 3300005335 Bacteria 3149
32 Ga0070666_10066204 3300005335 Bacteria 2451
33 Ga0070666_10344813 3300005335 Bacteria 1065
34 Ga0070666_10409532 3300005335 Unclassified 975
35 Ga0070680_100317248 3300005336 Bacteria 1323
36 Ga0070682_100290906 3300005337 Unclassified 1195
37 Ga0070682_100607030 3300005337 Bacteria 865
38 Ga0068868_100040066 3300005338 Bacteria 3644
39 Ga0068868_100046595 3300005338 Bacteria 3394
40 Ga0068868_100084972 3300005338 Bacteria 2542
41 Ga0068868_100187345 3300005338 Bacteria 1720
42 Ga0068868_100193134 3300005338 Bacteria 1694
43 Ga0068868_100858188 3300005338 Bacteria 823
44 Ga0070660_100003029 3300005339 Bacteria 11568
45 Ga0070689_100043680 3300005340 Bacteria 3445
46 Ga0070689_100053759 3300005340 Bacteria 3117
47 Ga0070689_100335978 3300005340 Bacteria 1265
48 Ga0070691_10192077 3300005341 Bacteria 1069
49 Ga0070661_100132694 3300005344 Bacteria 1872
50 Ga0070661_100260478 3300005344 Bacteria 1341
51 Ga0070668_100231502 3300005347 Bacteria 1528
52 Ga0070668_100680417 3300005347 Bacteria 906
53 Ga0070669_100003976 3300005353 Bacteria 10697
54 Ga0070669_100043179 3300005353 Bacteria 3282
55 Ga0070669_100120476 3300005353 Bacteria 2001
56 Ga0070669_100147084 3300005353 Bacteria 1821
57 Ga0070669_100373212 3300005353 Unclassified 1162
58 Ga0070669_100566245 3300005353 Bacteria 949
59 Ga0070675_100000539 3300005354 Bacteria 25935
60 Ga0070675_100000646 3300005354 Bacteria 24086
61 Ga0070675_100081901 3300005354 Bacteria 2692
62 Ga0070671_100003917 3300005355 Bacteria 11707
63 Ga0070671_100005746 3300005355 Bacteria 9879
64 Ga0070671_100048880 3300005355 Bacteria 3519
65 Ga0070671_100080075 3300005355 Bacteria 2731
66 Ga0070674_100004867 3300005356 Bacteria 7697
67 Ga0070674_100060155 3300005356 Bacteria 2647
68 Ga0070674_100071927 3300005356 Bacteria 2447
69 Ga0070674_100179407 3300005356 Bacteria 1621
70 Ga0070674_100181710 3300005356 Bacteria 1611
71 Ga0070673_100002003 3300005364 Bacteria 12294
72 Ga0070673_100074787 3300005364 Bacteria 2731
73 Ga0070673_100109235 3300005364 Bacteria 2291
74 Ga0070673_100123313 3300005364 Bacteria 2165
75 Ga0070673_100674281 3300005364 Bacteria 948
76 Ga0070688_100033140 3300005365 Bacteria 3121
77 Ga0070688_100167736 3300005365 Bacteria 1513
78 Ga0070688_100627684 3300005365 Bacteria 825
79 Ga0070688_100985580 3300005365 Unclassified 669
80 Ga0070659_100132885 3300005366 Bacteria 2022
81 Ga0070659_100446824 3300005366 Bacteria 1096
82 Ga0070667_100012313 3300005367 Bacteria 7076
83 Ga0070667_100012891 3300005367 Bacteria 6908
84 Ga0070667_100281977 3300005367 Unclassified 1492
85 Ga0070709_10178413 3300005434 Unclassified 1490
86 Ga0070709_10235523 3300005434 Bacteria 1312
87 Ga0070709_10269777 3300005434 Unclassified 1233
88 Ga0070714_100014765 3300005435 Bacteria 6276
89 Ga0070713_100003844 3300005436 Bacteria 9947
90 Ga0070713_100099423 3300005436 Bacteria 2517
91 Ga0070713_100726658 3300005436 Bacteria 949
92 Ga0070713_100972927 3300005436 Bacteria 818
93 Ga0070711_100700511 3300005439 Unclassified 853
94 Ga0070705_100010012 3300005440 Bacteria 4733
95 Ga0070700_100011240 3300005441 Bacteria 4957
96 Ga0070700_100110982 3300005441 Bacteria 1823
97 Ga0070700_100396928 3300005441 Bacteria 1036
98 Ga0070708_100319385 3300005445 Bacteria 1463
99 Ga0070663_100578280 3300005455 Bacteria 942
100 Ga0070678_100007344 3300005456 Bacteria 6528
101 Ga0070678_100058665 3300005456 Bacteria 2826
102 Ga0070678_100241174 3300005456 Archaea 1511
103 Ga0070678_100251881 3300005456 Unclassified 1481
104 Ga0070678_100519940 3300005456 Bacteria 1053
105 Ga0070662_100032831 3300005457 Bacteria 3651
106 Ga0070662_100153270 3300005457 Bacteria 1796
107 Ga0070662_100168675 3300005457 Bacteria 1717
108 Ga0070662_100757005 3300005457 Bacteria 824
109 Ga0070681_10119816 3300005458 Bacteria 2567
110 Ga0070681_10180067 3300005458 Bacteria 2035
111 Ga0068867_100017168 3300005459 Bacteria 5142
112 Ga0068867_100042554 3300005459 Bacteria 3323
113 Ga0068867_100042858 3300005459 Bacteria 3312
114 Ga0068867_100080724 3300005459 Unclassified 2450
115 Ga0068867_100098998 3300005459 Bacteria 2224
116 Ga0068867_100164621 3300005459 Bacteria 1751
117 Ga0068867_100422678 3300005459 Bacteria 1129
118 Ga0070685_10024138 3300005466 Bacteria 3337
119 Ga0070706_100405830 3300005467 Bacteria 1269
120 Ga0070706_100685121 3300005467 Bacteria 951
121 Ga0070707_100226206 3300005468 Bacteria 1822
122 Ga0070707_100911319 3300005468 Bacteria 844
123 Ga0070698_100099361 3300005471 Bacteria 2883
124 Ga0070698_100623071 3300005471 Bacteria 1020
125 Ga0070699_100020321 3300005518 Bacteria 5726
126 Ga0070679_100024647 3300005530 Bacteria 5896
127 Ga0070679_100115552 3300005530 Bacteria 2669
128 Ga0070679_100119391 3300005530 Bacteria 2622
129 Ga0070679_100313699 3300005530 Bacteria 1518
130 Ga0070684_100598447 3300005535 Bacteria 1025
131 Ga0070672_100028482 3300005543 Bacteria 4179
132 Ga0070672_100080196 3300005543 Bacteria 2614
133 Ga0070672_100157511 3300005543 Bacteria 1882
134 Ga0070672_101108251 3300005543 Bacteria 704
135 Ga0070686_100076447 3300005544 Bacteria 2205
136 Ga0070686_100078568 3300005544 Bacteria 2179
137 Ga0070686_100145806 3300005544 Unclassified 1653
138 Ga0070686_100514653 3300005544 Unclassified 931
139 Ga0070686_100692656 3300005544 Unclassified 812
140 Ga0070695_100002747 3300005545 Bacteria 10206
141 Ga0070695_100010637 3300005545 Bacteria 5499
142 Ga0070695_100050358 3300005545 Bacteria 2669
143 Ga0070695_100086464 3300005545 Bacteria 2084
144 Ga0070695_100163855 3300005545 Bacteria 1563
145 Ga0070696_100011794 3300005546 Bacteria 5856
146 Ga0070696_100028451 3300005546 Bacteria 3814
147 Ga0070696_100038560 3300005546 Bacteria 3298
148 Ga0070696_100079691 3300005546 Bacteria 2317
149 Ga0070696_100328848 3300005546 Bacteria 1178
150 Ga0070696_100391866 3300005546 Unclassified 1085
151 Ga0070693_100184464 3300005547 Bacteria 1345
152 Ga0070665_100003987 3300005548 Bacteria 15568
153 Ga0070665_100010351 3300005548 Bacteria 9435
154 Ga0070665_100013227 3300005548 Bacteria 8314
155 Ga0070665_100293663 3300005548 Bacteria 1627
156 Ga0070704_100001732 3300005549 Bacteria 11908
157 Ga0070704_100007654 3300005549 Bacteria 6440
158 Ga0070704_100128690 3300005549 Bacteria 1958
159 Ga0070704_100165160 3300005549 Bacteria 1755
160 Ga0070704_100275577 3300005549 Bacteria 1392
161 Ga0068855_100287730 3300005563 Bacteria 1823
162 Ga0068855_101052215 3300005563 Unclassified 853
163 Ga0070664_100003271 3300005564 Bacteria 13098
164 Ga0070664_100214593 3300005564 Bacteria 1720
165 Ga0070664_100228438 3300005564 Bacteria 1667
166 Ga0070664_100259273 3300005564 Bacteria 1564
167 Ga0070664_100391841 3300005564 Bacteria 1269
168 Ga0070664_100555944 3300005564 Bacteria 1061
169 Ga0068857_100009958 3300005577 Bacteria 8253
170 Ga0068857_100914935 3300005577 Unclassified 841
171 Ga0068854_100106567 3300005578 Bacteria 2109
172 Ga0068854_100328339 3300005578 Archaea 1246
173 Ga0068856_100101133 3300005614 Bacteria 2875
174 Ga0068856_100352148 3300005614 Bacteria 1491
175 Ga0070702_100103813 3300005615 Bacteria 1749
176 Ga0070702_100518129 3300005615 Bacteria 879
177 Ga0068852_100207689 3300005616 Bacteria 1856
178 Ga0068859_100003712 3300005617 Bacteria 15561
179 Ga0068859_100019019 3300005617 Bacteria 6898
180 Ga0068859_100029841 3300005617 Bacteria 5471
181 Ga0068859_100075177 3300005617 Bacteria 3419
182 Ga0068859_100107449 3300005617 Bacteria 2851
183 Ga0068859_100412942 3300005617 Unclassified 1446
184 Ga0068859_100424468 3300005617 Bacteria 1426
185 Ga0068859_100501084 3300005617 Bacteria 1309
186 Ga0068859_100664175 3300005617 Bacteria 1134
187 Ga0068859_100949680 3300005617 Bacteria 943
188 Ga0068859_101781985 3300005617 Unclassified 680
189 Ga0068864_100009399 3300005618 Bacteria 8066
190 Ga0068864_100042077 3300005618 Bacteria 3909
191 Ga0068864_100179547 3300005618 Bacteria 1935
192 Ga0068864_100500334 3300005618 Bacteria 1169
193 Ga0068864_100623813 3300005618 Bacteria 1048
194 Ga0068866_10046291 3300005718 Bacteria 2187
195 Ga0068866_10070638 3300005718 Bacteria 1844
196 Ga0068866_10086246 3300005718 Bacteria 1698
197 Ga0068866_10260332 3300005718 Bacteria 1066
198 Ga0068861_100011212 3300005719 Bacteria 6223
199 Ga0068861_100309939 3300005719 Unclassified 1371
200 Ga0068861_100618111 3300005719 Bacteria 997
201 Ga0068861_101026519 3300005719 Bacteria 789
202 Ga0068851_10189813 3300005834 Bacteria 1142
203 Ga0068870_10271741 3300005840 Bacteria 1059
204 Ga0068863_100000577 3300005841 Bacteria 37376
205 Ga0068863_100004770 3300005841 Bacteria 13360
206 Ga0068863_100111680 3300005841 Bacteria 2603
207 Ga0068863_101189841 3300005841 Unclassified 768
208 Ga0068858_100000793 3300005842 Bacteria 33005
209 Ga0068858_100021255 3300005842 Bacteria 6062
210 Ga0068858_100027499 3300005842 Bacteria 5283
211 Ga0068858_100095358 3300005842 Bacteria 2772
212 Ga0068858_100147964 3300005842 Bacteria 2207
213 Ga0068858_100167666 3300005842 Bacteria 2070
214 Ga0068858_100281933 3300005842 Bacteria 1582
215 Ga0068858_100537042 3300005842 Unclassified 1132
216 Ga0068860_100001406 3300005843 Bacteria 26084
217 Ga0068860_100076502 3300005843 Bacteria 3183
218 Ga0068860_100080723 3300005843 Bacteria 3093
219 Ga0068860_100198627 3300005843 Bacteria 1943
220 Ga0068860_100247821 3300005843 Bacteria 1734
221 Ga0068860_100377135 3300005843 Bacteria 1400
222 Ga0068860_100426136 3300005843 Bacteria 1316
223 Ga0068860_100756121 3300005843 Bacteria 984
224 Ga0068862_100026665 3300005844 Bacteria 4858
225 Ga0068862_100090214 3300005844 Bacteria 2668
226 Ga0068862_100105587 3300005844 Bacteria 2468
227 Ga0068862_100292339 3300005844 Unclassified 1496
228 Ga0068862_100418714 3300005844 Bacteria 1257
229 Ga0068862_100580091 3300005844 Bacteria 1074
230 Ga0068862_100648588 3300005844 Unclassified 1018
231 Ga0081455_10042181 3300005937 Bacteria 4005
232 Ga0081455_10199634 3300005937 Bacteria 1499
233 Ga0081539_10072487 3300005985 Unclassified 1840
234 Ga0070717_10072927 3300006028 Bacteria 2868
235 Ga0070717_10338040 3300006028 Bacteria 1344
236 Ga0075365_10250458 3300006038 Bacteria 1245
237 Ga0075364_10040357 3300006051 Bacteria 3027
238 Ga0075364_10081662 3300006051 Bacteria 2137
239 Ga0070715_10046852 3300006163 Bacteria 1840
240 Ga0070716_100485587 3300006173 Bacteria 908
241 Ga0070712_100274830 3300006175 Bacteria 1355
242 Ga0075367_10386306 3300006178 Bacteria 885
243 Ga0075366_10101726 3300006195 Bacteria 1725
244 Ga0097621_100001235 3300006237 Bacteria 17707
245 Ga0097621_100003280 3300006237 Bacteria 11128
246 Ga0097621_100027280 3300006237 Bacteria 4490
247 Ga0097621_100040631 3300006237 Bacteria 3741
248 Ga0097621_100043307 3300006237 Bacteria 3629
249 Ga0097621_100751554 3300006237 Unclassified 901
250 Ga0068871_100001665 3300006358 Bacteria 14939
251 Ga0068871_100004612 3300006358 Bacteria 9621
252 Ga0068871_100013970 3300006358 Bacteria 5973
253 Ga0068871_100015902 3300006358 Bacteria 5650
254 Ga0068871_100021998 3300006358 Bacteria 4912
255 Ga0068871_100072329 3300006358 Bacteria 2839
256 Ga0068871_100112754 3300006358 Bacteria 2289
257 Ga0068871_100121675 3300006358 Bacteria 2205
258 Ga0068871_100325900 3300006358 Bacteria 1354
259 Ga0068871_100687317 3300006358 Bacteria 936
260 Ga0068871_100737561 3300006358 Unclassified 905
261 Ga0075428_100008746 3300006844 Bacteria 11230
262 Ga0075428_100011476 3300006844 Bacteria 9856
263 Ga0075428_100340830 3300006844 Bacteria 1610
264 Ga0075428_100350917 3300006844 Bacteria 1583
265 Ga0075428_100378190 3300006844 Bacteria 1518
266 Ga0075428_100447315 3300006844 Bacteria 1384
267 Ga0075428_100573710 3300006844 Bacteria 1206
268 Ga0075428_100588393 3300006844 Bacteria 1189
269 Ga0075428_101360786 3300006844 Bacteria 746
270 Ga0075430_100004359 3300006846 Bacteria 11948
271 Ga0075430_100072537 3300006846 Bacteria 2887
272 Ga0075431_100117689 3300006847 Bacteria 2742
273 Ga0075431_100124809 3300006847 Bacteria 2656
274 Ga0075431_100184163 3300006847 Bacteria 2142
275 Ga0075431_100446233 3300006847 Bacteria 1290
276 Ga0075431_100948484 3300006847 Bacteria 829
277 Ga0075431_100994579 3300006847 Bacteria 806
278 Ga0075433_10013857 3300006852 Bacteria 6573
279 Ga0075433_10076873 3300006852 Bacteria 2940
280 Ga0075433_10161628 3300006852 Bacteria 1993
281 Ga0075433_10208860 3300006852 Bacteria 1735
282 Ga0075433_10452810 3300006852 Bacteria 1131
283 Ga0075434_100000019 3300006871 Bacteria 73391
284 Ga0075434_100009596 3300006871 Bacteria 9035
285 Ga0075434_100089892 3300006871 Bacteria 3072
286 Ga0075434_100134789 3300006871 Bacteria 2489
287 Ga0075434_100199105 3300006871 Bacteria 2022
288 Ga0075434_100335276 3300006871 Bacteria 1533
289 Ga0075434_100379946 3300006871 Bacteria 1433
290 Ga0075434_101016545 3300006871 Bacteria 843
291 Ga0075434_101042668 3300006871 Bacteria 831
292 Ga0075429_100008301 3300006880 Bacteria 9031
293 Ga0075429_100011082 3300006880 Bacteria 7803
294 Ga0068865_100002139 3300006881 Bacteria 11664
295 Ga0068865_100039505 3300006881 Bacteria 3201
296 Ga0068865_100244300 3300006881 Unclassified 1414
297 Ga0068865_100445274 3300006881 Bacteria 1070
298 Ga0068865_100501653 3300006881 Unclassified 1012
299 Ga0068865_100824497 3300006881 Bacteria 802
300 Ga0075436_100000160 3300006914 Bacteria 41885
301 Ga0097620_100003712 3300006931 Bacteria 15561
302 Ga0097620_100019018 3300006931 Bacteria 6898
303 Ga0097620_100029840 3300006931 Bacteria 5471
304 Ga0097620_100075177 3300006931 Bacteria 3419
305 Ga0097620_100107442 3300006931 Bacteria 2851
306 Ga0097620_100412930 3300006931 Unclassified 1446
307 Ga0097620_100424456 3300006931 Bacteria 1426
308 Ga0097620_100501066 3300006931 Bacteria 1309
309 Ga0097620_100664091 3300006931 Bacteria 1134
310 Ga0097620_100949858 3300006931 Bacteria 943
311 Ga0097620_101781982 3300006931 Unclassified 680
312 Ga0075435_100000041 3300007076 Bacteria 66202
313 Ga0075435_100010613 3300007076 Bacteria 6741
314 Ga0075435_100015015 3300007076 Bacteria 5811
315 Ga0075435_100023759 3300007076 Bacteria 4747
316 Ga0075435_100064648 3300007076 Bacteria 2973
317 Ga0075435_100100722 3300007076 Bacteria 2393
318 Ga0075435_100243245 3300007076 Bacteria 1531
319 Ga0105240_10026833 3300009093 Bacteria 7554
320 Ga0105240_10049314 3300009093 Bacteria 5316
321 Ga0105240_10100310 3300009093 Bacteria 3523
322 Ga0105240_10122197 3300009093 Bacteria 3134
323 Ga0105240_10223455 3300009093 Bacteria 2192
324 Ga0105240_10281211 3300009093 Bacteria 1911
325 Ga0111539_10000246 3300009094 Bacteria 65003
326 Ga0111539_10001003 3300009094 Bacteria 36985
327 Ga0111539_10077184 3300009094 Bacteria 3921
328 Ga0111539_10091352 3300009094 Bacteria 3577
329 Ga0111539_10123034 3300009094 Bacteria 3041
330 Ga0111539_10147513 3300009094 Bacteria 2754
331 Ga0111539_10326997 3300009094 Bacteria 1785
332 Ga0111539_10584312 3300009094 Bacteria 1301
333 Ga0111539_10599284 3300009094 Bacteria 1283
334 Ga0111539_11131875 3300009094 Unclassified 909
335 Ga0105245_10020107 3300009098 Bacteria 5852
336 Ga0105245_10082914 3300009098 Bacteria 2934
337 Ga0105245_10464857 3300009098 Bacteria 1276
338 Ga0105245_10495889 3300009098 Unclassified 1237
339 Ga0105245_10677050 3300009098 Bacteria 1063
340 Ga0105245_10723227 3300009098 Bacteria 1030
341 Ga0105245_11136996 3300009098 Bacteria 828
342 Ga0105247_10037406 3300009101 Bacteria 2962
343 Ga0105247_10169023 3300009101 Unclassified 1453
344 Ga0105247_10170807 3300009101 Bacteria 1445
345 Ga0105247_10242563 3300009101 Bacteria 1228
346 Ga0105247_10281029 3300009101 Bacteria 1148
347 Ga0105247_10285771 3300009101 Bacteria 1139
348 Ga0105247_10365823 3300009101 Bacteria 1018
349 Ga0114129_10005621 3300009147 Bacteria 17738
350 Ga0114129_10017195 3300009147 Bacteria 10301
351 Ga0114129_10021721 3300009147 Bacteria 9108
352 Ga0114129_10024000 3300009147 Bacteria 8643
353 Ga0114129_10040118 3300009147 Bacteria 6600
354 Ga0114129_10041322 3300009147 Bacteria 6499
355 Ga0114129_10044215 3300009147 Bacteria 6265
356 Ga0114129_10060403 3300009147 Bacteria 5300
357 Ga0114129_10209339 3300009147 Bacteria 2637
358 Ga0114129_10622441 3300009147 Bacteria 1396
359 Ga0114129_10782472 3300009147 Bacteria 1219
360 Ga0114129_11312606 3300009147 Bacteria 896
361 Ga0105243_10003634 3300009148 Bacteria 12415
362 Ga0105243_10059764 3300009148 Bacteria 3043
363 Ga0105243_10371861 3300009148 Bacteria 1319
364 Ga0105243_10483953 3300009148 Unclassified 1169
365 Ga0105243_10973346 3300009148 Bacteria 849
366 Ga0105243_11040507 3300009148 Bacteria 824
367 Ga0105243_11308104 3300009148 Bacteria 742
368 Ga0105242_10009659 3300009176 Bacteria 7393
369 Ga0105242_10182766 3300009176 Bacteria 1851
370 Ga0105242_10200563 3300009176 Bacteria 1772
371 Ga0105242_10236511 3300009176 Bacteria 1640
372 Ga0105242_10250968 3300009176 Bacteria 1594
373 Ga0105242_10298920 3300009176 Bacteria 1468
374 Ga0105248_10000477 3300009177 Bacteria 45623
375 Ga0105248_10015104 3300009177 Bacteria 8503
376 Ga0105248_10018671 3300009177 Bacteria 7666
377 Ga0105248_10033567 3300009177 Bacteria 5733
378 Ga0105248_10046875 3300009177 Bacteria 4846
379 Ga0105248_10089478 3300009177 Bacteria 3465
380 Ga0105248_10094244 3300009177 Bacteria 3372
381 Ga0105248_10108396 3300009177 Bacteria 3132
382 Ga0105248_10272366 3300009177 Bacteria 1906
383 Ga0105248_10509876 3300009177 Unclassified 1356
384 Ga0105248_10549604 3300009177 Bacteria 1303
385 Ga0105248_10626194 3300009177 Bacteria 1214
386 Ga0105248_10802592 3300009177 Bacteria 1062
387 Ga0105237_10306172 3300009545 Bacteria 1592
388 Ga0105237_11080136 3300009545 Bacteria 809
389 Ga0105238_10131746 3300009551 Bacteria 2478
390 Ga0105238_10171711 3300009551 Bacteria 2144
391 Ga0105238_10356803 3300009551 Bacteria 1451
392 Ga0105249_10570801 3300009553 Bacteria 1184
393 Ga0105249_10699085 3300009553 Unclassified 1074
394 Ga0105249_10888721 3300009553 Bacteria 957
395 Ga0105249_11415952 3300009553 Bacteria 767
396 Ga0099796_10069602 3300010159 Bacteria 1267
397 Ga0105239_10674900 3300010375 Bacteria 1181
398 Ga0105239_10746932 3300010375 Bacteria 1120
399 Ga0105246_10167207 3300011119 Unclassified 1681
400 Ga0105246_10177752 3300011119 Unclassified 1636
401 Ga0105246_10702156 3300011119 Unclassified 887
402 Ga0157323_1005326 3300012495 Unclassified 857
403 Ga0157338_1010303 3300012515 Bacteria 941
404 Ga0157374_10035182 3300013296 Bacteria 4581
405 Ga0157374_10049408 3300013296 Bacteria 3906
406 Ga0157374_10130500 3300013296 Bacteria 2432
407 Ga0157374_10253109 3300013296 Bacteria 1733
408 Ga0157374_10964738 3300013296 Bacteria 871
409 Ga0157378_10002845 3300013297 Bacteria 15428
410 Ga0157378_10117245 3300013297 Bacteria 2449
411 Ga0157378_10275968 3300013297 Bacteria 1619
412 Ga0157378_10920853 3300013297 Bacteria 906
413 Ga0163162_10006443 3300013306 Bacteria 11370
414 Ga0163162_10020128 3300013306 Bacteria 6552
415 Ga0163162_10190359 3300013306 Bacteria 2179
416 Ga0163162_10254010 3300013306 Bacteria 1890
417 Ga0163162_10881646 3300013306 Unclassified 1009
418 Ga0163162_11031598 3300013306 Unclassified 930
419 Ga0157372_10033180 3300013307 Bacteria 5668
420 Ga0157372_11412304 3300013307 Unclassified 802
421 Ga0157375_10000307 3300013308 Bacteria 44303
422 Ga0157375_10199142 3300013308 Bacteria 2158
423 Ga0157375_10550669 3300013308 Bacteria 1315
424 Ga0157375_10560507 3300013308 Bacteria 1304
425 Ga0163163_10204286 3300014325 Unclassified 2024
426 Ga0163163_10245775 3300014325 Bacteria 1839
427 Ga0163163_10669447 3300014325 Bacteria 1101
428 Ga0157380_10104210 3300014326 Bacteria 2368
429 Ga0157380_10125736 3300014326 Unclassified 2179
430 Ga0157380_10185731 3300014326 Unclassified 1831
431 Ga0157380_10713597 3300014326 Unclassified 1009
432 Ga0157380_11148433 3300014326 Unclassified 818
433 Ga0157380_11333995 3300014326 Unclassified 766
434 Ga0157377_10265372 3300014745 Bacteria 1119
435 Ga0157377_10320256 3300014745 Bacteria 1030
436 Ga0157379_10009835 3300014968 Bacteria 8333
437 Ga0157379_10018728 3300014968 Bacteria 6105
438 Ga0157379_10031620 3300014968 Bacteria 4716
439 Ga0157379_10055084 3300014968 Bacteria 3553
440 Ga0157379_10334593 3300014968 Bacteria 1384
441 Ga0157379_10383528 3300014968 Bacteria 1290
442 Ga0157379_11293063 3300014968 Bacteria 704
443 Ga0157376_10031914 3300014969 Bacteria 4224
444 Ga0157376_10105837 3300014969 Bacteria 2467
445 Ga0157376_10132943 3300014969 Bacteria 2223
446 Ga0157376_10311964 3300014969 Bacteria 1492
447 Ga0157376_10804989 3300014969 Unclassified 952
448 Ga0182007_10042007 3300015262 Bacteria 1523
449 Ga0163161_10073313 3300017792 Bacteria 2509
450 Ga0163161_10477350 3300017792 Bacteria 1012
451 Ga0207697_10002632 3300025315 Bacteria 9224
452 Ga0207697_10078604 3300025315 Bacteria 1388
453 Ga0207656_10156824 3300025321 Bacteria 1081
454 Ga0207656_10345800 3300025321 Bacteria 742
455 Ga0207682_10035090 3300025893 Bacteria 2025
456 Ga0207682_10191477 3300025893 Bacteria 937
457 Ga0207642_10014727 3300025899 Bacteria 2895
458 Ga0207642_10061312 3300025899 Bacteria 1749
459 Ga0207642_10070765 3300025899 Bacteria 1659
460 Ga0207642_10124149 3300025899 Bacteria 1337
461 Ga0207710_10007160 3300025900 Bacteria 4732
462 Ga0207710_10020337 3300025900 Bacteria 2837
463 Ga0207710_10275815 3300025900 Bacteria 845
464 Ga0207688_10015323 3300025901 Bacteria 4158
465 Ga0207680_10023234 3300025903 Bacteria 3382
466 Ga0207647_10249702 3300025904 Bacteria 1018
467 Ga0207685_10046326 3300025905 Bacteria 1654
468 Ga0207699_10156821 3300025906 Unclassified 1512
469 Ga0207699_10296754 3300025906 Bacteria 1127
470 Ga0207645_10005233 3300025907 Bacteria 9455
471 Ga0207645_10035418 3300025907 Bacteria 3205
472 Ga0207645_10038596 3300025907 Bacteria 3062
473 Ga0207645_10053943 3300025907 Bacteria 2568
474 Ga0207645_10088064 3300025907 Bacteria 1995
475 Ga0207645_10226872 3300025907 Unclassified 1232
476 Ga0207645_10542074 3300025907 Bacteria 789
477 Ga0207707_10127219 3300025912 Bacteria 2228
478 Ga0207707_10240621 3300025912 Bacteria 1573
479 Ga0207707_10350265 3300025912 Unclassified 1272
480 Ga0207695_10039253 3300025913 Bacteria 5089
481 Ga0207695_10120687 3300025913 Bacteria 2590
482 Ga0207663_10182752 3300025916 Unclassified 1499
483 Ga0207660_10215590 3300025917 Bacteria 1505
484 Ga0207660_10308314 3300025917 Unclassified 1262
485 Ga0207660_10686304 3300025917 Bacteria 835
486 Ga0207662_10027457 3300025918 Bacteria 3284
487 Ga0207662_10117283 3300025918 Bacteria 1666
488 Ga0207657_10009107 3300025919 Bacteria 10014
489 Ga0207657_10595845 3300025919 Bacteria 863
490 Ga0207649_10079944 3300025920 Bacteria 2113
491 Ga0207652_10079352 3300025921 Bacteria 2867
492 Ga0207652_10130521 3300025921 Bacteria 2241
493 Ga0207646_10230794 3300025922 Bacteria 1672
494 Ga0207681_10013424 3300025923 Bacteria 5071
495 Ga0207681_10082308 3300025923 Bacteria 2275
496 Ga0207681_10090898 3300025923 Bacteria 2180
497 Ga0207681_10093297 3300025923 Bacteria 2154
498 Ga0207681_10109174 3300025923 Bacteria 2009
499 Ga0207650_10075760 3300025925 Bacteria 2540
500 Ga0207650_10119453 3300025925 Bacteria 2050
501 Ga0207650_10126914 3300025925 Unclassified 1992
502 Ga0207650_10193812 3300025925 Bacteria 1625
503 Ga0207650_10362810 3300025925 Bacteria 1194
504 Ga0207650_10661127 3300025925 Bacteria 881
505 Ga0207659_10000495 3300025926 Bacteria 23739
506 Ga0207659_10087493 3300025926 Bacteria 2319
507 Ga0207659_10108418 3300025926 Unclassified 2106
508 Ga0207659_10127157 3300025926 Bacteria 1962
509 Ga0207659_10955837 3300025926 Unclassified 737
510 Ga0207687_10101563 3300025927 Bacteria 2117
511 Ga0207687_10247276 3300025927 Bacteria 1416
512 Ga0207700_10076404 3300025928 Bacteria 2599
513 Ga0207700_10160846 3300025928 Unclassified 1865
514 Ga0207700_10443454 3300025928 Bacteria 1143
515 Ga0207700_10940311 3300025928 Bacteria 774
516 Ga0207644_10051296 3300025931 Bacteria 2961
517 Ga0207644_10071878 3300025931 Bacteria 2532
518 Ga0207644_10226799 3300025931 Bacteria 1483
519 Ga0207644_10314065 3300025931 Bacteria 1266
520 Ga0207644_10795629 3300025931 Unclassified 791
521 Ga0207690_10284486 3300025932 Bacteria 1289
522 Ga0207706_10120080 3300025933 Bacteria 2311
523 Ga0207706_10154363 3300025933 Bacteria 2020
524 Ga0207706_10182523 3300025933 Unclassified 1843
525 Ga0207706_10213983 3300025933 Unclassified 1689
526 Ga0207706_10551169 3300025933 Bacteria 993
527 Ga0207706_10552612 3300025933 Bacteria 991
528 Ga0207706_10805606 3300025933 Bacteria 798
529 Ga0207686_10289396 3300025934 Unclassified 1212
530 Ga0207686_10316554 3300025934 Bacteria 1164
531 Ga0207686_10402967 3300025934 Bacteria 1042
532 Ga0207709_10020844 3300025935 Bacteria 3703
533 Ga0207709_10195703 3300025935 Bacteria 1440
534 Ga0207709_10204432 3300025935 Bacteria 1413
535 Ga0207709_10297027 3300025935 Bacteria 1200
536 Ga0207670_10039527 3300025936 Bacteria 3090
537 Ga0207670_10049460 3300025936 Bacteria 2812
538 Ga0207670_10105199 3300025936 Bacteria 2023
539 Ga0207670_10122892 3300025936 Unclassified 1890
540 Ga0207669_10007563 3300025937 Bacteria 5036
541 Ga0207669_10057706 3300025937 Bacteria 2365
542 Ga0207704_10135998 3300025938 Bacteria 1711
543 Ga0207704_10255053 3300025938 Bacteria 1319
544 Ga0207704_10413926 3300025938 Unclassified 1067
545 Ga0207704_10424934 3300025938 Bacteria 1054
546 Ga0207665_10026989 3300025939 Bacteria 3793
547 Ga0207665_10194622 3300025939 Bacteria 1475
548 Ga0207691_10007728 3300025940 Bacteria 10349
549 Ga0207691_10033229 3300025940 Bacteria 4802
550 Ga0207691_10039086 3300025940 Bacteria 4391
551 Ga0207691_10052961 3300025940 Bacteria 3706
552 Ga0207691_10110803 3300025940 Bacteria 2441
553 Ga0207711_10019925 3300025941 Bacteria 5590
554 Ga0207711_10029252 3300025941 Bacteria 4645
555 Ga0207711_10056870 3300025941 Bacteria 3362
556 Ga0207711_10057510 3300025941 Bacteria 3343
557 Ga0207711_10079552 3300025941 Bacteria 2862
558 Ga0207711_10115057 3300025941 Bacteria 2396
559 Ga0207711_10121498 3300025941 Bacteria 2332
560 Ga0207711_10167831 3300025941 Bacteria 1990
561 Ga0207711_10186045 3300025941 Bacteria 1891
562 Ga0207711_10214569 3300025941 Unclassified 1758
563 Ga0207711_10430622 3300025941 Bacteria 1227
564 Ga0207711_10435413 3300025941 Bacteria 1220
565 Ga0207711_10465654 3300025941 Bacteria 1177
566 Ga0207689_10025676 3300025942 Bacteria 4935
567 Ga0207689_10063151 3300025942 Bacteria 3046
568 Ga0207689_10208859 3300025942 Bacteria 1613
569 Ga0207689_10377457 3300025942 Bacteria 1180
570 Ga0207689_10453073 3300025942 Unclassified 1073
571 Ga0207661_10219150 3300025944 Bacteria 1681
572 Ga0207661_10311955 3300025944 Bacteria 1412
573 Ga0207679_10003210 3300025945 Bacteria 10081
574 Ga0207679_10029425 3300025945 Bacteria 3824
575 Ga0207679_10204473 3300025945 Bacteria 1652
576 Ga0207679_10279365 3300025945 Bacteria 1431
577 Ga0207679_10296626 3300025945 Bacteria 1392
578 Ga0207679_10439884 3300025945 Bacteria 1154
579 Ga0207667_10051628 3300025949 Bacteria 4334
580 Ga0207667_11177897 3300025949 Unclassified 747
581 Ga0207651_10016189 3300025960 Bacteria 4359
582 Ga0207651_10027242 3300025960 Bacteria 3586
583 Ga0207651_10098234 3300025960 Bacteria 2164
584 Ga0207651_10138005 3300025960 Bacteria 1879
585 Ga0207651_10218234 3300025960 Bacteria 1540
586 Ga0207651_10620379 3300025960 Bacteria 947
587 Ga0207651_10743753 3300025960 Unclassified 866
588 Ga0207712_10345808 3300025961 Bacteria 1235
589 Ga0207668_10143994 3300025972 Bacteria 1836
590 Ga0207668_10159013 3300025972 Bacteria 1758
591 Ga0207668_10215614 3300025972 Unclassified 1538
592 Ga0207668_10817982 3300025972 Unclassified 825
593 Ga0207640_10028635 3300025981 Bacteria 3408
594 Ga0207640_10097692 3300025981 Bacteria 2051
595 Ga0207640_10222114 3300025981 Bacteria 1447
596 Ga0207640_10424261 3300025981 Bacteria 1089
597 Ga0207658_10083410 3300025986 Bacteria 2456
598 Ga0207658_10116082 3300025986 Bacteria 2126
599 Ga0207658_10496783 3300025986 Bacteria 1086
600 Ga0207677_10026629 3300026023 Bacteria 3631
601 Ga0207677_10042951 3300026023 Bacteria 3002
602 Ga0207677_10085513 3300026023 Bacteria 2277
603 Ga0207677_10118268 3300026023 Bacteria 1988
604 Ga0207677_10137322 3300026023 Bacteria 1866
605 Ga0207677_10170566 3300026023 Bacteria 1701
606 Ga0207677_10173670 3300026023 Bacteria 1688
607 Ga0207677_10289730 3300026023 Bacteria 1348
608 Ga0207703_10060182 3300026035 Bacteria 3105
609 Ga0207703_10078387 3300026035 Bacteria 2745
610 Ga0207703_10092726 3300026035 Bacteria 2543
611 Ga0207703_10172166 3300026035 Bacteria 1905
612 Ga0207703_10812880 3300026035 Bacteria 893
613 Ga0207639_10361099 3300026041 Bacteria 1300
614 Ga0207678_10303518 3300026067 Unclassified 1372
615 Ga0207678_10335567 3300026067 Bacteria 1302
616 Ga0207708_10016967 3300026075 Bacteria 5482
617 Ga0207708_10029717 3300026075 Bacteria 4142
618 Ga0207708_10048338 3300026075 Bacteria 3238
619 Ga0207708_10325994 3300026075 Bacteria 1254
620 Ga0207702_10098937 3300026078 Bacteria 2570
621 Ga0207641_10000455 3300026088 Bacteria 46777
622 Ga0207641_10001068 3300026088 Bacteria 27583
623 Ga0207641_10115142 3300026088 Bacteria 2390
624 Ga0207641_10159232 3300026088 Bacteria 2051
625 Ga0207641_10198277 3300026088 Bacteria 1849
626 Ga0207641_10335472 3300026088 Bacteria 1437
627 Ga0207641_10364959 3300026088 Bacteria 1380
628 Ga0207641_11550722 3300026088 Unclassified 664
629 Ga0207648_10003721 3300026089 Bacteria 15963
630 Ga0207648_10013498 3300026089 Bacteria 7598
631 Ga0207648_10016394 3300026089 Bacteria 6771
632 Ga0207648_10049235 3300026089 Bacteria 3688
633 Ga0207648_10058711 3300026089 Bacteria 3355
634 Ga0207648_10125732 3300026089 Bacteria 2255
635 Ga0207648_10126326 3300026089 Bacteria 2250
636 Ga0207648_10180189 3300026089 Bacteria 1870
637 Ga0207648_10306718 3300026089 Unclassified 1425
638 Ga0207648_11364435 3300026089 Bacteria 666
639 Ga0207676_10022447 3300026095 Bacteria 4642
640 Ga0207676_10531518 3300026095 Bacteria 1121
641 Ga0207676_10998535 3300026095 Bacteria 824
642 Ga0207674_10009384 3300026116 Bacteria 11189
643 Ga0207674_10397034 3300026116 Bacteria 1333
644 Ga0207674_10480344 3300026116 Unclassified 1201
645 Ga0207675_100001265 3300026118 Bacteria 25256
646 Ga0207675_100012547 3300026118 Bacteria 7917
647 Ga0207675_100037034 3300026118 Bacteria 4551
648 Ga0207675_100219487 3300026118 Unclassified 1831
649 Ga0207675_100332546 3300026118 Bacteria 1485
650 Ga0207675_100431459 3300026118 Unclassified 1303
651 Ga0207675_100620661 3300026118 Unclassified 1085
652 Ga0207675_100633724 3300026118 Unclassified 1074
653 Ga0207675_101349079 3300026118 Bacteria 734
654 Ga0207683_10007265 3300026121 Bacteria 9494
655 Ga0207683_10029754 3300026121 Bacteria 4729
656 Ga0207683_10077810 3300026121 Bacteria 2938
657 Ga0207683_10173433 3300026121 Bacteria 1954
658 Ga0207683_10238766 3300026121 Bacteria 1658
659 Ga0207698_10252058 3300026142 Bacteria 1616
660 Ga0207698_10850838 3300026142 Bacteria 917
661 Ga0209813_10055197 3300027866 Bacteria 1254
662 Ga0207428_10007524 3300027907 Bacteria 9923
663 Ga0207428_10014110 3300027907 Bacteria 6957
664 Ga0207428_10150458 3300027907 Bacteria 1772
665 Ga0207428_10150605 3300027907 Bacteria 1771
666 Ga0207428_10245402 3300027907 Bacteria 1337
667 Ga0207428_10267723 3300027907 Bacteria 1271
668 Ga0268266_10012158 3300028379 Bacteria 7448
669 Ga0268266_10054383 3300028379 Bacteria 3439
670 Ga0268266_10112383 3300028379 Bacteria 2415
671 Ga0268266_10225649 3300028379 Bacteria 1723
672 Ga0268266_10624427 3300028379 Bacteria 1036
673 Ga0268265_10016745 3300028380 Bacteria 5044
674 Ga0268265_10025655 3300028380 Bacteria 4187
675 Ga0268265_10128692 3300028380 Unclassified 2100
676 Ga0268265_10158540 3300028380 Bacteria 1918
677 Ga0268265_10167712 3300028380 Bacteria 1873
678 Ga0268265_10407689 3300028380 Unclassified 1258
679 Ga0268265_10541159 3300028380 Bacteria 1104
680 Ga0268265_10542830 3300028380 Bacteria 1102
681 Ga0268265_10642406 3300028380 Unclassified 1019
682 Ga0268265_10893464 3300028380 Unclassified 872
683 Ga0268264_10027485 3300028381 Bacteria 4650
684 Ga0268264_10048048 3300028381 Bacteria 3549
685 Ga0268264_10086878 3300028381 Bacteria 2688
686 Ga0268264_10285353 3300028381 Bacteria 1548
687 Ga0268264_10369673 3300028381 Bacteria 1370
688 Ga0268264_10676840 3300028381 Bacteria 1023
689 Ga0268264_11179370 3300028381 Unclassified 775
690 Ga0265328_10188477 3300031239 Bacteria 781
691 Ga0265316_10267161 3300031344 Bacteria 1253
692 Ga0307408_100011724 3300031548 Bacteria 5796
693 Ga0307408_100030271 3300031548 Bacteria 3757
694 Ga0307408_100325465 3300031548 Bacteria 1296
695 Ga0307408_100669937 3300031548 Unclassified 929
696 Ga0307405_10009635 3300031731 Bacteria 4961
697 Ga0307405_10054267 3300031731 Unclassified 2501
698 Ga0307405_10148032 3300031731 Unclassified 1647
699 Ga0307413_10130130 3300031824 Bacteria 1721
700 Ga0307410_10207875 3300031852 Bacteria 1498
701 Ga0307406_10292715 3300031901 Unclassified 1247
702 Ga0307412_10230015 3300031911 Bacteria 1427
703 Ga0307409_100061205 3300031995 Bacteria 2941
704 Ga0307409_100450448 3300031995 Unclassified 1242
705 Ga0307409_101374188 3300031995 Bacteria 732
706 Ga0307416_100185940 3300032002 Bacteria 1953
707 Ga0307416_100198336 3300032002 Unclassified 1901
708 Ga0307416_100315154 3300032002 Bacteria 1563
709 Ga0307416_100408750 3300032002 Bacteria 1397
710 Ga0307416_100880704 3300032002 Bacteria 994
711 Ga0307416_101003142 3300032002 Unclassified 938
712 Ga0307414_10456105 3300032004 Unclassified 1122
713 Ga0307411_10056987 3300032005 Bacteria 2578
714 Ga0307411_10157712 3300032005 Unclassified 1695
715 Ga0307411_10881754 3300032005 Bacteria 794
716 Ga0307415_100324055 3300032126 Unclassified 1286
717 Ga0307415_100917699 3300032126 Bacteria 808
718 Ga0373948_0026528 3300034817 Bacteria 1142
719 Ga0373959_0003219 3300034820 Bacteria 2597
720 Ga0373938_0000823 3300034957 Bacteria 5016
721 Ga0373926_0050399 3300035083 Bacteria 1500
722 Ga0373928_0000665 3300035084 Bacteria 6756
723 Ga0373929_0002374 3300035085 Bacteria 3463
724 Ga0373940_0000039 3300035088 Bacteria 14131
725 Ga0373940_0162253 3300035088 Bacteria 718
726 Ga0373949_0001162 3300035090 Bacteria 7856
727 Ga0373949_0048497 3300035090 Bacteria 1064
728 Ga0373951_0002100 3300035091 Bacteria 5107
729 Ga0373951_0101561 3300035091 Bacteria 765
730 Ga0373952_0000679 3300035092 Bacteria 6038
731 Ga0373952_0027694 3300035092 Bacteria 1239
732 Ga0373923_0018295 3300035111 Bacteria 2695
733 Ga0373932_0000279 3300035112 Bacteria 15366
734 Ga0373932_0013191 3300035112 Bacteria 2050
735 Ga0373941_0002183 3300035115 Bacteria 4272
736 Ga0373941_0067943 3300035115 Unclassified 1176
737 Ga0373954_0133808 3300035118 Bacteria 1208
738 Ga0373956_0014427 3300035119 Bacteria 3301
739 Ga0373957_0042527 3300035120 Bacteria 1715
740 Ga0373957_0078177 3300035120 Bacteria 1303
741 Ga0373943_0004513 3300035170 Bacteria 6297
742 Ga0373943_0121581 3300035170 Unclassified 1388
743 Ga0373943_0305530 3300035170 Unclassified 904
744 Ga0373946_0225092 3300035171 Bacteria 907
745 Ga0373955_0014777 3300035172 Bacteria 3807
746 Ga0373955_0023780 3300035172 Bacteria 3126
747 Ga0373955_0123131 3300035172 Bacteria 1509
748 Ga0373942_0000750 3300035207 Bacteria 8943
749 Ga0373942_0007245 3300035207 Bacteria 2571
750 Ga0373961_0002991 3300035241 Bacteria 4263
751 Ga0373962_0027086 3300035242 Bacteria 1549
752 Ga0373962_0061632 3300035242 Bacteria 1103
753 Ga0373962_0065679 3300035242 Bacteria 1074
754 Ga0373924_0306210 3300035410 Bacteria 706
755 Ga0373931_0001453 3300035691 Bacteria 10179
756 Ga0373931_0095057 3300035691 Bacteria 1667
757 Ga0373931_0327107 3300035691 Bacteria 954
758 Ga0373935_0010662 3300035692 Bacteria 5518
759 Ga0373935_0073623 3300035692 Bacteria 2207
760 Ga0373935_0780370 3300035692 Bacteria 705
761 Ga0373927_0088939 3300035695 Bacteria 2005
762 Ga0373933_0005113 3300035724 Bacteria 7156
763 Ga0373947_0228805 3300035725 Bacteria 1224
764 Ga0373947_0431363 3300035725 Bacteria 891
765 Ga0373947_0509215 3300035725 Bacteria 818
766 Ga0373937_0000120 3300036401 Bacteria 74752
767 Ga0373937_0001203 3300036401 Bacteria 21757
768 Ga0373937_0159982 3300036401 Bacteria 2111
769 Ga0373937_0179874 3300036401 Unclassified 1986
770 Ga0373937_0352129 3300036401 Bacteria 1395
771 Ga0373937_0366334 3300036401 Bacteria 1366
772 Ga0373937_0708814 3300036401 Bacteria 953
773 Ga0373937_0807497 3300036401 Bacteria 886
774 Ga0373925_0032679 3300037068 Bacteria 3830
775 Ga0373925_0128760 3300037068 Bacteria 1972
776 Ga0373925_0354119 3300037068 Bacteria 1192
777 Ga0436365_0005852 3300039437 Bacteria 731
778 Ga0439436_0132740 3300041404 Bacteria 698
779 Ga0451853_2377236 3300041512 Unclassified 718
780 Ga0439431_0082111 3300041997 Bacteria 870
781 Ga0439431_0137547 3300041997 Bacteria 689
782 Ga0439450_087194 3300042008 Bacteria 781
783 Ga0439451_073945 3300042009 Bacteria 683
784 Ga0439456_057320 3300042013 Unclassified 854
785 Ga0450920_031489 3300042122 Bacteria 1045
786 Ga0450896_011249 3300042133 Unclassified 1259
787 Ga0439446_0053160 3300042156 Bacteria 1213
788 Ga0450908_000443 3300042184 Bacteria 8059
789 Ga0439434_0142363 3300042435 Bacteria 791
790 Ga0439435_0000974 3300042436 Bacteria 5000
791 Ga0439444_0076916 3300042437 Bacteria 724
792 Ga0439464_0021892 3300042439 Unclassified 1757
793 Ga0439460_0146307 3300042461 Unclassified 786
794 Ga0451577_0746094 3300042876 Bacteria 886
795 Ga0466957_0198906 3300044842 Bacteria 1316
796 Ga0451576_0002751 3300045051 Bacteria 25497
797 Ga0451576_0545161 3300045051 Bacteria 1219
798 Ga0451576_0931599 3300045051 Bacteria 911
799 Ga0495592_0003177 3300046454 Bacteria 11774
800 Ga0495592_0470634 3300046454 Unclassified 784
801 Ga0495603_0248893 3300046455 Unclassified 1023
802 Ga0495629_0306420 3300046459 Unclassified 1087
803 Ga0495629_0409687 3300046459 Unclassified 921
804 Ga0495651_0468053 3300046462 Unclassified 812
805 Ga0495580_0113165 3300046472 Bacteria 1885
806 Ga0495580_0161130 3300046472 Bacteria 1553
807 Ga0495582_0172403 3300046473 Unclassified 1232
808 Ga0495582_0198310 3300046473 Bacteria 1146
809 Ga0495582_0407860 3300046473 Bacteria 784
810 Ga0495639_0187423 3300046475 Bacteria 1009
811 Ga0495664_0350196 3300046477 Unclassified 889
812 Ga0495608_0014987 3300046511 Bacteria 5379
813 Ga0495608_0357530 3300046511 Unclassified 898
814 Ga0495628_0043425 3300046516 Bacteria 3581
815 Ga0495628_0155496 3300046516 Unclassified 1740
816 Ga0495628_0385331 3300046516 Bacteria 1026
817 Ga0495628_0424709 3300046516 Bacteria 968
818 Ga0495630_0033607 3300046517 Bacteria 3825
819 Ga0495652_0079045 3300046529 Bacteria 2721
820 Ga0495652_0243716 3300046529 Bacteria 1336
821 Ga0495665_0126210 3300046531 Bacteria 1340
822 Ga0495640_0215473 3300046533 Bacteria 1212
823 Ga0495586_0030285 3300046535 Bacteria 2896
824 Ga0495586_0142804 3300046535 Unclassified 1344
825 Ga0495586_0328649 3300046535 Bacteria 877
826 Ga0495587_0066276 3300046536 Bacteria 2107
827 Ga0495645_0003631 3300046543 Bacteria 10480
828 Ga0495645_0008546 3300046543 Bacteria 7151
829 Ga0495656_0364633 3300046615 Bacteria 751
830 Ga0495635_0131255 3300046663 Bacteria 1708
831 Ga0495635_0156024 3300046663 Bacteria 1553
832 Ga0495599_0029423 3300046678 Bacteria 3444
833 Ga0495599_0125766 3300046678 Unclassified 1593
834 Ga0495623_0069505 3300046679 Bacteria 2195
835 Ga0495647_0075688 3300046681 Bacteria 1356
836 Ga0495647_0085957 3300046681 Unclassified 1282
837 Ga0495658_0051858 3300046683 Bacteria 2325
838 Ga0495658_0075086 3300046683 Bacteria 1972
839 Ga0495669_0016005 3300046684 Bacteria 3211
840 Ga0495613_0000909 3300046689 Bacteria 22730
841 Ga0495613_0474774 3300046689 Unclassified 845
842 Ga0495624_0487471 3300046690 Unclassified 738
843 Ga0495604_0283063 3300047317 Bacteria 1119
844 Ga0495604_0570979 3300047317 Unclassified 728
845 Ga0495674_0006827 3300047319 Bacteria 10929
846 Ga0495674_0127579 3300047319 Bacteria 2145
847 Ga0495674_0194180 3300047319 Bacteria 1686
848 Ga0495674_0806448 3300047319 Bacteria 730
849 Ga0495675_0090995 3300047444 Bacteria 1915
850 Ga0495684_0000462 3300047471 Bacteria 33252
851 Ga0495684_0042833 3300047471 Bacteria 3467
852 Ga0495684_0056333 3300047471 Bacteria 2997
853 Ga0495593_0122805 3300047673 Bacteria 1321
854 Ga0495614_0163059 3300048089 Bacteria 998
855 Ga0496100_0003788 3300048903 Bacteria 7918
856 Ga0496101_0014885 3300048904 Bacteria 5235
857 Ga0496101_0073862 3300048904 Unclassified 2506
858 Ga0496101_0447090 3300048904 Bacteria 1020
859 Ga0496101_0976892 3300048904 Unclassified 666
860 Ga0496102_0040715 3300048905 Bacteria 4205
861 Ga0496102_0056744 3300048905 Bacteria 3573
862 Ga0496102_0439710 3300048905 Bacteria 1224
863 Ga0496102_0950676 3300048905 Bacteria 780
864 Ga0496103_0194981 3300048906 Unclassified 1302
865 Ga0496103_0283354 3300048906 Bacteria 1066
866 Ga0496104_0479072 3300048907 Unclassified 1156
867 Ga0496104_0896342 3300048907 Unclassified 792
868 Ga0496104_1153566 3300048907 Unclassified 678
869 Ga0496105_0222653 3300048908 Unclassified 1536
870 Ga0496106_0293883 3300048909 Unclassified 1303
871 Ga0496106_0303795 3300048909 Bacteria 1280
872 Ga0496106_0378877 3300048909 Bacteria 1137
873 Ga0496106_0483489 3300048909 Bacteria 995
874 Ga0496106_0488763 3300048909 Bacteria 989
875 Ga0496106_0735655 3300048909 Unclassified 785
876 Ga0496107_0006919 3300048910 Bacteria 7815
877 Ga0496107_0270485 3300048910 Unclassified 1265
878 Ga0496108_0020799 3300048911 Bacteria 5395
879 Ga0496108_0362019 3300048911 Unclassified 1266
880 Ga0496108_0376942 3300048911 Bacteria 1239
881 Ga0496108_0961094 3300048911 Unclassified 731
882 Ga0496108_0979056 3300048911 Unclassified 723
883 Ga0496109_0429540 3300048912 Unclassified 1248
884 Ga0496109_0557320 3300048912 Bacteria 1081
885 Ga0496109_0953295 3300048912 Unclassified 796
886 Ga0496110_0036940 3300048913 Bacteria 4244
887 Ga0496110_0075160 3300048913 Unclassified 3002
888 Ga0496111_0264751 3300048914 Unclassified 1275
889 Ga0496112_0018904 3300048915 Bacteria 6492
890 Ga0496112_0131588 3300048915 Unclassified 2473
891 Ga0496112_0327265 3300048915 Bacteria 1476
892 Ga0496113_0105561 3300048916 Bacteria 2187
893 Ga0496113_0132603 3300048916 Bacteria 1956
894 Ga0496113_0761102 3300048916 Bacteria 771
895 Ga0496114_0000226 3300048917 Bacteria 40968
896 Ga0496114_0228346 3300048917 Bacteria 1635
897 Ga0496114_0434891 3300048917 Unclassified 1162
898 Ga0496114_0506544 3300048917 Bacteria 1068
899 Ga0496115_0005852 3300048918 Bacteria 8961
900 Ga0501291_002169 3300049514 Bacteria 2325
901 Ga0501299_015124 3300049522 Unclassified 1352
902 Ga0501032_0574611 3300049569 Unclassified 718
903 Ga0501034_0172270 3300049571 Bacteria 2131
904 Ga0501040_0074922 3300049576 Bacteria 2339
905 Ga0501041_0040325 3300049577 Bacteria 2834
906 Ga0501046_0350084 3300049580 Unclassified 1073
907 Ga0501047_0799731 3300049581 Bacteria 758
908 Ga0501069_0636694 3300049585 Unclassified 641
909 Ga0501071_0167021 3300049587 Unclassified 1647
910 Ga0501072_0115674 3300049588 Bacteria 2136
911 Ga0501072_0124782 3300049588 Bacteria 2051
912 Ga0501073_0265310 3300049589 Bacteria 1185
913 Ga0501075_0088714 3300049591 Unclassified 2345
914 Ga0501075_0199095 3300049591 Bacteria 1528
915 Ga0501075_0331583 3300049591 Unclassified 1160
916 Ga0501233_014486 3300049668 Unclassified 1612
917 Ga0501249_128585 3300049679 Unclassified 623
918 Ga0501253_033196 3300049683 Unclassified 998
919 Ga0501225_0062860 3300049705 Unclassified 1046
920 Ga0501225_0146297 3300049705 Unclassified 718
921 Ga0501079_0480717 3300049741 Unclassified 976
922 Ga0501079_0516865 3300049741 Bacteria 939
923 Ga0501079_0705013 3300049741 Bacteria 794
924 Ga0501080_1061136 3300049742 Bacteria 701
925 Ga0501081_0844605 3300049743 Unclassified 690
926 Ga0501268_070987 3300049765 Unclassified 704
927 Ga0501283_051357 3300049779 Unclassified 731
928 Ga0501035_0117347 3300049822 Bacteria 2329
929 Ga0501044_0036350 3300049823 Bacteria 5153
930 Ga0501045_0360170 3300049824 Bacteria 1082
931 Ga0501045_0434213 3300049824 Bacteria 977
932 nmdc:mga00v17_41426_c1 3300050491 Bacteria 2766
933 nmdc:mga0yw44_381459_c1 3300050492 Bacteria 952
934 nmdc:mga0k408_99467_c1 3300050493 Bacteria 1714
935 nmdc:mga06z11_86658_c1 3300050494 Bacteria 1692
936 nmdc:mga04h51_65798_c1 3300050495 Bacteria 1254
937 nmdc:mga05p37_10221_c1 3300050507 Bacteria 11145
938 nmdc:mga05p37_1046758_c1 3300050507 Unclassified 861
939 nmdc:mga05p37_117901_c1 3300050507 Bacteria 3262
940 nmdc:mga05p37_1387_c1 3300050507 Bacteria 28190
941 nmdc:mga05p37_138905_c1 3300050507 Bacteria 2978
942 nmdc:mga05p37_30433_c1 3300050507 Bacteria 6586
943 nmdc:mga05p37_401240_c1 3300050507 Bacteria 1601
944 nmdc:mga05p37_41448_c1 3300050507 Bacteria 5652
945 nmdc:mga05p37_43495_c1 3300050507 Bacteria 5526
946 nmdc:mga05p37_45780_c1 3300050507 Bacteria 5380
947 nmdc:mga05p37_57688_c1 3300050507 Bacteria 4782
948 nmdc:mga05p37_588196_c1 3300050507 Bacteria 1259
949 nmdc:mga05p37_777700_c1 3300050507 Unclassified 1051
950 nmdc:mga05p37_993630_c1 3300050507 Bacteria 892
951 nmdc:mga09592_162813_c1 3300050508 Bacteria 1927
952 nmdc:mga09592_192611_c1 3300050508 Bacteria 1765
953 nmdc:mga09592_246862_c1 3300050508 Unclassified 1547
954 nmdc:mga09592_50719_c1 3300050508 Bacteria 3500
955 nmdc:mga0qj67_296328_c1 3300050509 Bacteria 1311
956 nmdc:mga0qj67_34690_c1 3300050509 Bacteria 3942
957 nmdc:mga0qj67_733633_c1 3300050509 Unclassified 784
958 nmdc:mga06r32_13384_c1 3300050510 Bacteria 7428
959 nmdc:mga06r32_577570_c1 3300050510 Bacteria 1096
960 nmdc:mga06r32_613044_c1 3300050510 Bacteria 1058
961 nmdc:mga08y16_1156_c1 3300050511 Bacteria 25993
962 nmdc:mga08y16_152632_c1 3300050511 Bacteria 2401
963 nmdc:mga08y16_20419_c1 3300050511 Bacteria 6992
964 nmdc:mga08y16_362158_c1 3300050511 Bacteria 1489
965 nmdc:mga08y16_458683_c1 3300050511 Bacteria 1299
966 nmdc:mga08y16_517909_c1 3300050511 Bacteria 1210
967 nmdc:mga08y16_58524_c1 3300050511 Bacteria 4027
968 nmdc:mga08y16_6292_c1 3300050511 Bacteria 12450
969 nmdc:mga08y16_676805_c1 3300050511 Unclassified 1034
970 nmdc:mga08y16_73755_c1 3300050511 Unclassified 3556
971 nmdc:mga0n895_1099328_c1 3300050512 Bacteria 772
972 nmdc:mga0n895_1339321_c1 3300050512 Bacteria 686
973 nmdc:mga0n895_287449_c1 3300050512 Bacteria 1667
974 nmdc:mga0n895_306323_c1 3300050512 Bacteria 1610
975 nmdc:mga0n895_323653_c1 3300050512 Bacteria 1562
976 nmdc:mga0n895_434268_c1 3300050512 Bacteria 1327
977 nmdc:mga0n895_441476_c1 3300050512 Bacteria 1315
978 nmdc:mga0n895_50574_c1 3300050512 Bacteria 4074
979 nmdc:mga0n895_529444_c1 3300050512 Unclassified 1186
980 nmdc:mga0n895_558830_c1 3300050512 Bacteria 1150
981 nmdc:mga0n895_602410_c1 3300050512 Bacteria 1101
982 nmdc:mga0n895_81_c1 3300050512 Bacteria 54736
983 nmdc:mga0rr50_14271_c1 3300050513 Bacteria 5205
984 nmdc:mga0rr50_169042_c1 3300050513 Bacteria 1780
985 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
986 nmdc:mga0rr50_21528_c1 3300050513 Bacteria 4403
987 nmdc:mga0rr50_22793_c1 3300050513 Bacteria 4304
988 nmdc:mga0rr50_27862_c1 3300050513 Bacteria 3963
989 nmdc:mga0rr50_363642_c1 3300050513 Bacteria 1218
990 nmdc:mga0rr50_38547_c1 3300050513 Bacteria 1962
991 nmdc:mga0rr50_49780_c1 3300050513 Bacteria 3103
992 nmdc:mga0rr50_622473_c1 3300050513 Unclassified 921
993 nmdc:mga08x19_165520_c1 3300050514 Bacteria 1503
994 nmdc:mga08x19_223759_c1 3300050514 Bacteria 1294
995 nmdc:mga08x19_265_c1 3300050514 Bacteria 39740
996 nmdc:mga08x19_284860_c1 3300050514 Bacteria 1145
997 nmdc:mga08x19_32849_c1 3300050514 Bacteria 3273
998 nmdc:mga08x19_333405_c1 3300050514 Bacteria 1057
999 nmdc:mga08x19_63086_c1 3300050514 Bacteria 2404
1000 nmdc:mga0a205_12309_c1 3300050515 Bacteria 7913
1001 nmdc:mga0a205_277716_c1 3300050515 Bacteria 1551
1002 nmdc:mga0a205_285898_c1 3300050515 Bacteria 1524
1003 nmdc:mga0a205_4415_c1 3300050515 Bacteria 12621
1004 nmdc:mga0a205_89486_c1 3300050515 Bacteria 2975
1005 Ga0495601_0019063 3300053077 Bacteria 4181
1006 Ga0495601_0057619 3300053077 Bacteria 2461
1007 Ga0495601_0323480 3300053077 Unclassified 1004
1008 Ga0495601_0350372 3300053077 Unclassified 960
1009 Ga0495595_0017122 3300053084 Bacteria 3115
1010 Ga0495595_0036785 3300053084 Bacteria 2223
1011 Ga0495595_0104077 3300053084 Bacteria 1372
1012 Ga0495619_0001103 3300053085 Bacteria 17738
1013 Ga0495619_0028564 3300053085 Bacteria 3599
1014 Ga0495619_0032757 3300053085 Bacteria 3373
1015 Ga0495619_0124069 3300053085 Bacteria 1772
1016 Ga0495619_0354979 3300053085 Bacteria 1014
1017 Ga0590071_000472 3300059421 Bacteria 11717
1018 Ga0590074_003726 3300059423 Bacteria 2522
1019 Ga0590075_000097 3300059424 Bacteria 22530
1020 Ga0590077_000274 3300059426 Bacteria 14590
1021 Ga0495629_0125402
1022 MBSR1b_contig_10041855
1023 JGI24751J29686_10024907
1024 Ga0065712_10071599
1025 Ga0065712_10097619
1026 Ga0065715_10007929
1027 Ga0065715_10030101
1028 Ga0065715_10104862
1029 Ga0065715_10117095
1030 Ga0065715_10317792
1031 Ga0065707_10162330
1032 Ga0065707_10244997
1033 Ga0070676_10006898
1034 Ga0070676_10326427
1035 Ga0070683_100043223
1036 Ga0070683_100312414
1037 Ga0070683_100536813
1038 Ga0070690_100012002
1039 Ga0070690_100066619
1040 Ga0070690_100300722
1041 Ga0070690_100519417
1042 Ga0070670_100053413
1043 Ga0070670_100083801
1044 Ga0070670_100151488
1045 Ga0070670_100414144
1046 Ga0070677_10032055
1047 Ga0070677_10205055
1048 Ga0068869_100088619
1049 Ga0068869_100185682
1050 Ga0068869_100326326
1051 Ga0070666_10039396
1052 Ga0070666_10066204
1053 Ga0070666_10344813
1054 Ga0070666_10409532
1055 Ga0070680_100317248
1056 Ga0070682_100290906
1057 Ga0070682_100607030
1058 Ga0068868_100040066
1059 Ga0068868_100046595
1060 Ga0068868_100084972
1061 Ga0068868_100187345
1062 Ga0068868_100193134
1063 Ga0068868_100858188
1064 Ga0070660_100003029
1065 Ga0070689_100043680
1066 Ga0070689_100053759
1067 Ga0070689_100335978
1068 Ga0070691_10192077
1069 Ga0070661_100132694
1070 Ga0070661_100260478
1071 Ga0070668_100231502
1072 Ga0070668_100680417
1073 Ga0070669_100003976
1074 Ga0070669_100043179
1075 Ga0070669_100120476
1076 Ga0070669_100147084
1077 Ga0070669_100373212
1078 Ga0070669_100566245
1079 Ga0070675_100000539
1080 Ga0070675_100000646
1081 Ga0070675_100081901
1082 Ga0070671_100003917
1083 Ga0070671_100005746
1084 Ga0070671_100048880
1085 Ga0070671_100080075
1086 Ga0070674_100004867
1087 Ga0070674_100060155
1088 Ga0070674_100071927
1089 Ga0070674_100179407
1090 Ga0070674_100181710
1091 Ga0070673_100002003
1092 Ga0070673_100074787
1093 Ga0070673_100109235
1094 Ga0070673_100123313
1095 Ga0070673_100674281
1096 Ga0070688_100033140
1097 Ga0070688_100167736
1098 Ga0070688_100627684
1099 Ga0070688_100985580
1100 Ga0070659_100132885
1101 Ga0070659_100446824
1102 Ga0070667_100012313
1103 Ga0070667_100012891
1104 Ga0070667_100281977
1105 Ga0070709_10178413
1106 Ga0070709_10235523
1107 Ga0070709_10269777
1108 Ga0070714_100014765
1109 Ga0070713_100003844
1110 Ga0070713_100099423
1111 Ga0070713_100726658
1112 Ga0070713_100972927
1113 Ga0070711_100700511
1114 Ga0070705_100010012
1115 Ga0070700_100011240
1116 Ga0070700_100110982
1117 Ga0070700_100396928
1118 Ga0070708_100319385
1119 Ga0070663_100578280
1120 Ga0070678_100007344
1121 Ga0070678_100058665
1122 Ga0070678_100241174
1123 Ga0070678_100251881
1124 Ga0070678_100519940
1125 Ga0070662_100032831
1126 Ga0070662_100153270
1127 Ga0070662_100168675
1128 Ga0070662_100757005
1129 Ga0070681_10119816
1130 Ga0070681_10180067
1131 Ga0068867_100017168
1132 Ga0068867_100042554
1133 Ga0068867_100042858
1134 Ga0068867_100080724
1135 Ga0068867_100098998
1136 Ga0068867_100164621
1137 Ga0068867_100422678
1138 Ga0070685_10024138
1139 Ga0070706_100405830
1140 Ga0070706_100685121
1141 Ga0070707_100226206
1142 Ga0070707_100911319
1143 Ga0070698_100099361
1144 Ga0070698_100623071
1145 Ga0070699_100020321
1146 Ga0070679_100024647
1147 Ga0070679_100115552
1148 Ga0070679_100119391
1149 Ga0070679_100313699
1150 Ga0070684_100598447
1151 Ga0070672_100028482
1152 Ga0070672_100080196
1153 Ga0070672_100157511
1154 Ga0070672_101108251
1155 Ga0070686_100076447
1156 Ga0070686_100078568
1157 Ga0070686_100145806
1158 Ga0070686_100514653
1159 Ga0070686_100692656
1160 Ga0070695_100002747
1161 Ga0070695_100010637
1162 Ga0070695_100050358
1163 Ga0070695_100086464
1164 Ga0070695_100163855
1165 Ga0070696_100011794
1166 Ga0070696_100028451
1167 Ga0070696_100038560
1168 Ga0070696_100079691
1169 Ga0070696_100328848
1170 Ga0070696_100391866
1171 Ga0070693_100184464
1172 Ga0070665_100003987
1173 Ga0070665_100010351
1174 Ga0070665_100013227
1175 Ga0070665_100293663
1176 Ga0070704_100001732
1177 Ga0070704_100007654
1178 Ga0070704_100128690
1179 Ga0070704_100165160
1180 Ga0070704_100275577
1181 Ga0068855_100287730
1182 Ga0068855_101052215
1183 Ga0070664_100003271
1184 Ga0070664_100214593
1185 Ga0070664_100228438
1186 Ga0070664_100259273
1187 Ga0070664_100391841
1188 Ga0070664_100555944
1189 Ga0068857_100009958
1190 Ga0068857_100914935
1191 Ga0068854_100106567
1192 Ga0068854_100328339
1193 Ga0068856_100101133
1194 Ga0068856_100352148
1195 Ga0070702_100103813
1196 Ga0070702_100518129
1197 Ga0068852_100207689
1198 Ga0068859_100003712
1199 Ga0068859_100019019
1200 Ga0068859_100029841
1201 Ga0068859_100075177
1202 Ga0068859_100107449
1203 Ga0068859_100412942
1204 Ga0068859_100424468
1205 Ga0068859_100501084
1206 Ga0068859_100664175
1207 Ga0068859_100949680
1208 Ga0068859_101781985
1209 Ga0068864_100009399
1210 Ga0068864_100042077
1211 Ga0068864_100179547
1212 Ga0068864_100500334
1213 Ga0068864_100623813
1214 Ga0068866_10046291
1215 Ga0068866_10070638
1216 Ga0068866_10086246
1217 Ga0068866_10260332
1218 Ga0068861_100011212
1219 Ga0068861_100309939
1220 Ga0068861_100618111
1221 Ga0068861_101026519
1222 Ga0068851_10189813
1223 Ga0068870_10271741
1224 Ga0068863_100000577
1225 Ga0068863_100004770
1226 Ga0068863_100111680
1227 Ga0068863_101189841
1228 Ga0068858_100000793
1229 Ga0068858_100021255
1230 Ga0068858_100027499
1231 Ga0068858_100095358
1232 Ga0068858_100147964
1233 Ga0068858_100167666
1234 Ga0068858_100281933
1235 Ga0068858_100537042
1236 Ga0068860_100001406
1237 Ga0068860_100076502
1238 Ga0068860_100080723
1239 Ga0068860_100198627
1240 Ga0068860_100247821
1241 Ga0068860_100377135
1242 Ga0068860_100426136
1243 Ga0068860_100756121
1244 Ga0068862_100026665
1245 Ga0068862_100090214
1246 Ga0068862_100105587
1247 Ga0068862_100292339
1248 Ga0068862_100418714
1249 Ga0068862_100580091
1250 Ga0068862_100648588
1251 Ga0081455_10042181
1252 Ga0081455_10199634
1253 Ga0081539_10072487
1254 Ga0070717_10072927
1255 Ga0070717_10338040
1256 Ga0075365_10250458
1257 Ga0075364_10040357
1258 Ga0075364_10081662
1259 Ga0070715_10046852
1260 Ga0070716_100485587
1261 Ga0070712_100274830
1262 Ga0075367_10386306
1263 Ga0075366_10101726
1264 Ga0097621_100001235
1265 Ga0097621_100003280
1266 Ga0097621_100027280
1267 Ga0097621_100040631
1268 Ga0097621_100043307
1269 Ga0097621_100751554
1270 Ga0068871_100001665
1271 Ga0068871_100004612
1272 Ga0068871_100013970
1273 Ga0068871_100015902
1274 Ga0068871_100021998
1275 Ga0068871_100072329
1276 Ga0068871_100112754
1277 Ga0068871_100121675
1278 Ga0068871_100325900
1279 Ga0068871_100687317
1280 Ga0068871_100737561
1281 Ga0075428_100008746
1282 Ga0075428_100011476
1283 Ga0075428_100340830
1284 Ga0075428_100350917
1285 Ga0075428_100378190
1286 Ga0075428_100447315
1287 Ga0075428_100573710
1288 Ga0075428_100588393
1289 Ga0075428_101360786
1290 Ga0075430_100004359
1291 Ga0075430_100072537
1292 Ga0075431_100117689
1293 Ga0075431_100124809
1294 Ga0075431_100184163
1295 Ga0075431_100446233
1296 Ga0075431_100948484
1297 Ga0075431_100994579
1298 Ga0075433_10013857
1299 Ga0075433_10076873
1300 Ga0075433_10161628
1301 Ga0075433_10208860
1302 Ga0075433_10452810
1303 Ga0075434_100000019
1304 Ga0075434_100009596
1305 Ga0075434_100089892
1306 Ga0075434_100134789
1307 Ga0075434_100199105
1308 Ga0075434_100335276
1309 Ga0075434_100379946
1310 Ga0075434_101016545
1311 Ga0075434_101042668
1312 Ga0075429_100008301
1313 Ga0075429_100011082
1314 Ga0068865_100002139
1315 Ga0068865_100039505
1316 Ga0068865_100244300
1317 Ga0068865_100445274
1318 Ga0068865_100501653
1319 Ga0068865_100824497
1320 Ga0075436_100000160
1321 Ga0097620_100003712
1322 Ga0097620_100019018
1323 Ga0097620_100029840
1324 Ga0097620_100075177
1325 Ga0097620_100107442
1326 Ga0097620_100412930
1327 Ga0097620_100424456
1328 Ga0097620_100501066
1329 Ga0097620_100664091
1330 Ga0097620_100949858
1331 Ga0097620_101781982
1332 Ga0075435_100000041
1333 Ga0075435_100010613
1334 Ga0075435_100015015
1335 Ga0075435_100023759
1336 Ga0075435_100064648
1337 Ga0075435_100100722
1338 Ga0075435_100243245
1339 Ga0105240_10026833
1340 Ga0105240_10049314
1341 Ga0105240_10100310
1342 Ga0105240_10122197
1343 Ga0105240_10223455
1344 Ga0105240_10281211
1345 Ga0111539_10000246
1346 Ga0111539_10001003
1347 Ga0111539_10077184
1348 Ga0111539_10091352
1349 Ga0111539_10123034
1350 Ga0111539_10147513
1351 Ga0111539_10326997
1352 Ga0111539_10584312
1353 Ga0111539_10599284
1354 Ga0111539_11131875
1355 Ga0105245_10020107
1356 Ga0105245_10082914
1357 Ga0105245_10464857
1358 Ga0105245_10495889
1359 Ga0105245_10677050
1360 Ga0105245_10723227
1361 Ga0105245_11136996
1362 Ga0105247_10037406
1363 Ga0105247_10169023
1364 Ga0105247_10170807
1365 Ga0105247_10242563
1366 Ga0105247_10281029
1367 Ga0105247_10285771
1368 Ga0105247_10365823
1369 Ga0114129_10005621
1370 Ga0114129_10017195
1371 Ga0114129_10021721
1372 Ga0114129_10024000
1373 Ga0114129_10040118
1374 Ga0114129_10041322
1375 Ga0114129_10044215
1376 Ga0114129_10060403
1377 Ga0114129_10209339
1378 Ga0114129_10622441
1379 Ga0114129_10782472
1380 Ga0114129_11312606
1381 Ga0105243_10003634
1382 Ga0105243_10059764
1383 Ga0105243_10371861
1384 Ga0105243_10483953
1385 Ga0105243_10973346
1386 Ga0105243_11040507
1387 Ga0105243_11308104
1388 Ga0105242_10009659
1389 Ga0105242_10182766
1390 Ga0105242_10200563
1391 Ga0105242_10236511
1392 Ga0105242_10250968
1393 Ga0105242_10298920
1394 Ga0105248_10000477
1395 Ga0105248_10015104
1396 Ga0105248_10018671
1397 Ga0105248_10033567
1398 Ga0105248_10046875
1399 Ga0105248_10089478
1400 Ga0105248_10094244
1401 Ga0105248_10108396
1402 Ga0105248_10272366
1403 Ga0105248_10509876
1404 Ga0105248_10549604
1405 Ga0105248_10626194
1406 Ga0105248_10802592
1407 Ga0105237_10306172
1408 Ga0105237_11080136
1409 Ga0105238_10131746
1410 Ga0105238_10171711
1411 Ga0105238_10356803
1412 Ga0105249_10570801
1413 Ga0105249_10699085
1414 Ga0105249_10888721
1415 Ga0105249_11415952
1416 Ga0099796_10069602
1417 Ga0105239_10674900
1418 Ga0105239_10746932
1419 Ga0105246_10167207
1420 Ga0105246_10177752
1421 Ga0105246_10702156
1422 Ga0157323_1005326
1423 Ga0157338_1010303
1424 Ga0157374_10035182
1425 Ga0157374_10049408
1426 Ga0157374_10130500
1427 Ga0157374_10253109
1428 Ga0157374_10964738
1429 Ga0157378_10002845
1430 Ga0157378_10117245
1431 Ga0157378_10275968
1432 Ga0157378_10920853
1433 Ga0163162_10006443
1434 Ga0163162_10020128
1435 Ga0163162_10190359
1436 Ga0163162_10254010
1437 Ga0163162_10881646
1438 Ga0163162_11031598
1439 Ga0157372_10033180
1440 Ga0157372_11412304
1441 Ga0157375_10000307
1442 Ga0157375_10199142
1443 Ga0157375_10550669
1444 Ga0157375_10560507
1445 Ga0163163_10204286
1446 Ga0163163_10245775
1447 Ga0163163_10669447
1448 Ga0157380_10104210
1449 Ga0157380_10125736
1450 Ga0157380_10185731
1451 Ga0157380_10713597
1452 Ga0157380_11148433
1453 Ga0157380_11333995
1454 Ga0157377_10265372
1455 Ga0157377_10320256
1456 Ga0157379_10009835
1457 Ga0157379_10018728
1458 Ga0157379_10031620
1459 Ga0157379_10055084
1460 Ga0157379_10334593
1461 Ga0157379_10383528
1462 Ga0157379_11293063
1463 Ga0157376_10031914
1464 Ga0157376_10105837
1465 Ga0157376_10132943
1466 Ga0157376_10311964
1467 Ga0157376_10804989
1468 Ga0182007_10042007
1469 Ga0163161_10073313
1470 Ga0163161_10477350
1471 Ga0207697_10002632
1472 Ga0207697_10078604
1473 Ga0207656_10156824
1474 Ga0207656_10345800
1475 Ga0207682_10035090
1476 Ga0207682_10191477
1477 Ga0207642_10014727
1478 Ga0207642_10061312
1479 Ga0207642_10070765
1480 Ga0207642_10124149
1481 Ga0207710_10007160
1482 Ga0207710_10020337
1483 Ga0207710_10275815
1484 Ga0207688_10015323
1485 Ga0207680_10023234
1486 Ga0207647_10249702
1487 Ga0207685_10046326
1488 Ga0207699_10156821
1489 Ga0207699_10296754
1490 Ga0207645_10005233
1491 Ga0207645_10035418
1492 Ga0207645_10038596
1493 Ga0207645_10053943
1494 Ga0207645_10088064
1495 Ga0207645_10226872
1496 Ga0207645_10542074
1497 Ga0207707_10127219
1498 Ga0207707_10240621
1499 Ga0207707_10350265
1500 Ga0207695_10039253
1501 Ga0207695_10120687
1502 Ga0207663_10182752
1503 Ga0207660_10215590
1504 Ga0207660_10308314
1505 Ga0207660_10686304
1506 Ga0207662_10027457
1507 Ga0207662_10117283
1508 Ga0207657_10009107
1509 Ga0207657_10595845
1510 Ga0207649_10079944
1511 Ga0207652_10079352
1512 Ga0207652_10130521
1513 Ga0207646_10230794
1514 Ga0207681_10013424
1515 Ga0207681_10082308
1516 Ga0207681_10090898
1517 Ga0207681_10093297
1518 Ga0207681_10109174
1519 Ga0207650_10075760
1520 Ga0207650_10119453
1521 Ga0207650_10126914
1522 Ga0207650_10193812
1523 Ga0207650_10362810
1524 Ga0207650_10661127
1525 Ga0207659_10000495
1526 Ga0207659_10087493
1527 Ga0207659_10108418
1528 Ga0207659_10127157
1529 Ga0207659_10955837
1530 Ga0207687_10101563
1531 Ga0207687_10247276
1532 Ga0207700_10076404
1533 Ga0207700_10160846
1534 Ga0207700_10443454
1535 Ga0207700_10940311
1536 Ga0207644_10051296
1537 Ga0207644_10071878
1538 Ga0207644_10226799
1539 Ga0207644_10314065
1540 Ga0207644_10795629
1541 Ga0207690_10284486
1542 Ga0207706_10120080
1543 Ga0207706_10154363
1544 Ga0207706_10182523
1545 Ga0207706_10213983
1546 Ga0207706_10551169
1547 Ga0207706_10552612
1548 Ga0207706_10805606
1549 Ga0207686_10289396
1550 Ga0207686_10316554
1551 Ga0207686_10402967
1552 Ga0207709_10020844
1553 Ga0207709_10195703
1554 Ga0207709_10204432
1555 Ga0207709_10297027
1556 Ga0207670_10039527
1557 Ga0207670_10049460
1558 Ga0207670_10105199
1559 Ga0207670_10122892
1560 Ga0207669_10007563
1561 Ga0207669_10057706
1562 Ga0207704_10135998
1563 Ga0207704_10255053
1564 Ga0207704_10413926
1565 Ga0207704_10424934
1566 Ga0207665_10026989
1567 Ga0207665_10194622
1568 Ga0207691_10007728
1569 Ga0207691_10033229
1570 Ga0207691_10039086
1571 Ga0207691_10052961
1572 Ga0207691_10110803
1573 Ga0207711_10019925
1574 Ga0207711_10029252
1575 Ga0207711_10056870
1576 Ga0207711_10057510
1577 Ga0207711_10079552
1578 Ga0207711_10115057
1579 Ga0207711_10121498
1580 Ga0207711_10167831
1581 Ga0207711_10186045
1582 Ga0207711_10214569
1583 Ga0207711_10430622
1584 Ga0207711_10435413
1585 Ga0207711_10465654
1586 Ga0207689_10025676
1587 Ga0207689_10063151
1588 Ga0207689_10208859
1589 Ga0207689_10377457
1590 Ga0207689_10453073
1591 Ga0207661_10219150
1592 Ga0207661_10311955
1593 Ga0207679_10003210
1594 Ga0207679_10029425
1595 Ga0207679_10204473
1596 Ga0207679_10279365
1597 Ga0207679_10296626
1598 Ga0207679_10439884
1599 Ga0207667_10051628
1600 Ga0207667_11177897
1601 Ga0207651_10016189
1602 Ga0207651_10027242
1603 Ga0207651_10098234
1604 Ga0207651_10138005
1605 Ga0207651_10218234
1606 Ga0207651_10620379
1607 Ga0207651_10743753
1608 Ga0207712_10345808
1609 Ga0207668_10143994
1610 Ga0207668_10159013
1611 Ga0207668_10215614
1612 Ga0207668_10817982
1613 Ga0207640_10028635
1614 Ga0207640_10097692
1615 Ga0207640_10222114
1616 Ga0207640_10424261
1617 Ga0207658_10083410
1618 Ga0207658_10116082
1619 Ga0207658_10496783
1620 Ga0207677_10026629
1621 Ga0207677_10042951
1622 Ga0207677_10085513
1623 Ga0207677_10118268
1624 Ga0207677_10137322
1625 Ga0207677_10170566
1626 Ga0207677_10173670
1627 Ga0207677_10289730
1628 Ga0207703_10060182
1629 Ga0207703_10078387
1630 Ga0207703_10092726
1631 Ga0207703_10172166
1632 Ga0207703_10812880
1633 Ga0207639_10361099
1634 Ga0207678_10303518
1635 Ga0207678_10335567
1636 Ga0207708_10016967
1637 Ga0207708_10029717
1638 Ga0207708_10048338
1639 Ga0207708_10325994
1640 Ga0207702_10098937
1641 Ga0207641_10000455
1642 Ga0207641_10001068
1643 Ga0207641_10115142
1644 Ga0207641_10159232
1645 Ga0207641_10198277
1646 Ga0207641_10335472
1647 Ga0207641_10364959
1648 Ga0207641_11550722
1649 Ga0207648_10003721
1650 Ga0207648_10013498
1651 Ga0207648_10016394
1652 Ga0207648_10049235
1653 Ga0207648_10058711
1654 Ga0207648_10125732
1655 Ga0207648_10126326
1656 Ga0207648_10180189
1657 Ga0207648_10306718
1658 Ga0207648_11364435
1659 Ga0207676_10022447
1660 Ga0207676_10531518
1661 Ga0207676_10998535
1662 Ga0207674_10009384
1663 Ga0207674_10397034
1664 Ga0207674_10480344
1665 Ga0207675_100001265
1666 Ga0207675_100012547
1667 Ga0207675_100037034
1668 Ga0207675_100219487
1669 Ga0207675_100332546
1670 Ga0207675_100431459
1671 Ga0207675_100620661
1672 Ga0207675_100633724
1673 Ga0207675_101349079
1674 Ga0207683_10007265
1675 Ga0207683_10029754
1676 Ga0207683_10077810
1677 Ga0207683_10173433
1678 Ga0207683_10238766
1679 Ga0207698_10252058
1680 Ga0207698_10850838
1681 Ga0209813_10055197
1682 Ga0207428_10007524
1683 Ga0207428_10014110
1684 Ga0207428_10150458
1685 Ga0207428_10150605
1686 Ga0207428_10245402
1687 Ga0207428_10267723
1688 Ga0268266_10012158
1689 Ga0268266_10054383
1690 Ga0268266_10112383
1691 Ga0268266_10225649
1692 Ga0268266_10624427
1693 Ga0268265_10016745
1694 Ga0268265_10025655
1695 Ga0268265_10128692
1696 Ga0268265_10158540
1697 Ga0268265_10167712
1698 Ga0268265_10407689
1699 Ga0268265_10541159
1700 Ga0268265_10542830
1701 Ga0268265_10642406
1702 Ga0268265_10893464
1703 Ga0268264_10027485
1704 Ga0268264_10048048
1705 Ga0268264_10086878
1706 Ga0268264_10285353
1707 Ga0268264_10369673
1708 Ga0268264_10676840
1709 Ga0268264_11179370
1710 Ga0265328_10188477
1711 Ga0265316_10267161
1712 Ga0307408_100011724
1713 Ga0307408_100030271
1714 Ga0307408_100325465
1715 Ga0307408_100669937
1716 Ga0307405_10009635
1717 Ga0307405_10054267
1718 Ga0307405_10148032
1719 Ga0307413_10130130
1720 Ga0307410_10207875
1721 Ga0307406_10292715
1722 Ga0307412_10230015
1723 Ga0307409_100061205
1724 Ga0307409_100450448
1725 Ga0307409_101374188
1726 Ga0307416_100185940
1727 Ga0307416_100198336
1728 Ga0307416_100315154
1729 Ga0307416_100408750
1730 Ga0307416_100880704
1731 Ga0307416_101003142
1732 Ga0307414_10456105
1733 Ga0307411_10056987
1734 Ga0307411_10157712
1735 Ga0307411_10881754
1736 Ga0307415_100324055
1737 Ga0307415_100917699
1738 Ga0373948_0026528
1739 Ga0373959_0003219
1740 Ga0373938_0000823
1741 Ga0373926_0050399
1742 Ga0373928_0000665
1743 Ga0373929_0002374
1744 Ga0373940_0000039
1745 Ga0373940_0162253
1746 Ga0373949_0001162
1747 Ga0373949_0048497
1748 Ga0373951_0002100
1749 Ga0373951_0101561
1750 Ga0373952_0000679
1751 Ga0373952_0027694
1752 Ga0373923_0018295
1753 Ga0373932_0000279
1754 Ga0373932_0013191
1755 Ga0373941_0002183
1756 Ga0373941_0067943
1757 Ga0373954_0133808
1758 Ga0373956_0014427
1759 Ga0373957_0042527
1760 Ga0373957_0078177
1761 Ga0373943_0004513
1762 Ga0373943_0121581
1763 Ga0373943_0305530
1764 Ga0373946_0225092
1765 Ga0373955_0014777
1766 Ga0373955_0023780
1767 Ga0373955_0123131
1768 Ga0373942_0000750
1769 Ga0373942_0007245
1770 Ga0373961_0002991
1771 Ga0373962_0027086
1772 Ga0373962_0061632
1773 Ga0373962_0065679
1774 Ga0373924_0306210
1775 Ga0373931_0001453
1776 Ga0373931_0095057
1777 Ga0373931_0327107
1778 Ga0373935_0010662
1779 Ga0373935_0073623
1780 Ga0373935_0780370
1781 Ga0373927_0088939
1782 Ga0373933_0005113
1783 Ga0373947_0228805
1784 Ga0373947_0431363
1785 Ga0373947_0509215
1786 Ga0373937_0000120
1787 Ga0373937_0001203
1788 Ga0373937_0159982
1789 Ga0373937_0179874
1790 Ga0373937_0352129
1791 Ga0373937_0366334
1792 Ga0373937_0708814
1793 Ga0373937_0807497
1794 Ga0373925_0032679
1795 Ga0373925_0128760
1796 Ga0373925_0354119
1797 Ga0436365_0005852
1798 Ga0439436_0132740
1799 Ga0451853_2377236
1800 Ga0439431_0082111
1801 Ga0439431_0137547
1802 Ga0439450_087194
1803 Ga0439451_073945
1804 Ga0439456_057320
1805 Ga0450920_031489
1806 Ga0450896_011249
1807 Ga0439446_0053160
1808 Ga0450908_000443
1809 Ga0439434_0142363
1810 Ga0439435_0000974
1811 Ga0439444_0076916
1812 Ga0439464_0021892
1813 Ga0439460_0146307
1814 Ga0451577_0746094
1815 Ga0466957_0198906
1816 Ga0451576_0002751
1817 Ga0451576_0545161
1818 Ga0451576_0931599
1819 Ga0495592_0003177
1820 Ga0495592_0470634
1821 Ga0495603_0248893
1822 Ga0495629_0306420
1823 Ga0495629_0409687
1824 Ga0495651_0468053
1825 Ga0495580_0113165
1826 Ga0495580_0161130
1827 Ga0495582_0172403
1828 Ga0495582_0198310
1829 Ga0495582_0407860
1830 Ga0495639_0187423
1831 Ga0495664_0350196
1832 Ga0495608_0014987
1833 Ga0495608_0357530
1834 Ga0495628_0043425
1835 Ga0495628_0155496
1836 Ga0495628_0385331
1837 Ga0495628_0424709
1838 Ga0495630_0033607
1839 Ga0495652_0079045
1840 Ga0495652_0243716
1841 Ga0495665_0126210
1842 Ga0495640_0215473
1843 Ga0495586_0030285
1844 Ga0495586_0142804
1845 Ga0495586_0328649
1846 Ga0495587_0066276
1847 Ga0495645_0003631
1848 Ga0495645_0008546
1849 Ga0495656_0364633
1850 Ga0495635_0131255
1851 Ga0495635_0156024
1852 Ga0495599_0029423
1853 Ga0495599_0125766
1854 Ga0495623_0069505
1855 Ga0495647_0075688
1856 Ga0495647_0085957
1857 Ga0495658_0051858
1858 Ga0495658_0075086
1859 Ga0495669_0016005
1860 Ga0495613_0000909
1861 Ga0495613_0474774
1862 Ga0495624_0487471
1863 Ga0495604_0283063
1864 Ga0495604_0570979
1865 Ga0495674_0006827
1866 Ga0495674_0127579
1867 Ga0495674_0194180
1868 Ga0495674_0806448
1869 Ga0495675_0090995
1870 Ga0495684_0000462
1871 Ga0495684_0042833
1872 Ga0495684_0056333
1873 Ga0495593_0122805
1874 Ga0495614_0163059
1875 Ga0496100_0003788
1876 Ga0496101_0014885
1877 Ga0496101_0073862
1878 Ga0496101_0447090
1879 Ga0496101_0976892
1880 Ga0496102_0040715
1881 Ga0496102_0056744
1882 Ga0496102_0439710
1883 Ga0496102_0950676
1884 Ga0496103_0194981
1885 Ga0496103_0283354
1886 Ga0496104_0479072
1887 Ga0496104_0896342
1888 Ga0496104_1153566
1889 Ga0496105_0222653
1890 Ga0496106_0293883
1891 Ga0496106_0303795
1892 Ga0496106_0378877
1893 Ga0496106_0483489
1894 Ga0496106_0488763
1895 Ga0496106_0735655
1896 Ga0496107_0006919
1897 Ga0496107_0270485
1898 Ga0496108_0020799
1899 Ga0496108_0362019
1900 Ga0496108_0376942
1901 Ga0496108_0961094
1902 Ga0496108_0979056
1903 Ga0496109_0429540
1904 Ga0496109_0557320
1905 Ga0496109_0953295
1906 Ga0496110_0036940
1907 Ga0496110_0075160
1908 Ga0496111_0264751
1909 Ga0496112_0018904
1910 Ga0496112_0131588
1911 Ga0496112_0327265
1912 Ga0496113_0105561
1913 Ga0496113_0132603
1914 Ga0496113_0761102
1915 Ga0496114_0000226
1916 Ga0496114_0228346
1917 Ga0496114_0434891
1918 Ga0496114_0506544
1919 Ga0496115_0005852
1920 Ga0501291_002169
1921 Ga0501299_015124
1922 Ga0501032_0574611
1923 Ga0501034_0172270
1924 Ga0501040_0074922
1925 Ga0501041_0040325
1926 Ga0501046_0350084
1927 Ga0501047_0799731
1928 Ga0501069_0636694
1929 Ga0501071_0167021
1930 Ga0501072_0115674
1931 Ga0501072_0124782
1932 Ga0501073_0265310
1933 Ga0501075_0088714
1934 Ga0501075_0199095
1935 Ga0501075_0331583
1936 Ga0501233_014486
1937 Ga0501249_128585
1938 Ga0501253_033196
1939 Ga0501225_0062860
1940 Ga0501225_0146297
1941 Ga0501079_0480717
1942 Ga0501079_0516865
1943 Ga0501079_0705013
1944 Ga0501080_1061136
1945 Ga0501081_0844605
1946 Ga0501268_070987
1947 Ga0501283_051357
1948 Ga0501035_0117347
1949 Ga0501044_0036350
1950 Ga0501045_0360170
1951 Ga0501045_0434213
1952 nmdc:mga00v17_41426_c1
1953 nmdc:mga0yw44_381459_c1
1954 nmdc:mga0k408_99467_c1
1955 nmdc:mga06z11_86658_c1
1956 nmdc:mga04h51_65798_c1
1957 nmdc:mga05p37_10221_c1
1958 nmdc:mga05p37_1046758_c1
1959 nmdc:mga05p37_117901_c1
1960 nmdc:mga05p37_1387_c1
1961 nmdc:mga05p37_138905_c1
1962 nmdc:mga05p37_30433_c1
1963 nmdc:mga05p37_401240_c1
1964 nmdc:mga05p37_41448_c1
1965 nmdc:mga05p37_43495_c1
1966 nmdc:mga05p37_45780_c1
1967 nmdc:mga05p37_57688_c1
1968 nmdc:mga05p37_588196_c1
1969 nmdc:mga05p37_777700_c1
1970 nmdc:mga05p37_993630_c1
1971 nmdc:mga09592_162813_c1
1972 nmdc:mga09592_192611_c1
1973 nmdc:mga09592_246862_c1
1974 nmdc:mga09592_50719_c1
1975 nmdc:mga0qj67_296328_c1
1976 nmdc:mga0qj67_34690_c1
1977 nmdc:mga0qj67_733633_c1
1978 nmdc:mga06r32_13384_c1
1979 nmdc:mga06r32_577570_c1
1980 nmdc:mga06r32_613044_c1
1981 nmdc:mga08y16_1156_c1
1982 nmdc:mga08y16_152632_c1
1983 nmdc:mga08y16_20419_c1
1984 nmdc:mga08y16_362158_c1
1985 nmdc:mga08y16_458683_c1
1986 nmdc:mga08y16_517909_c1
1987 nmdc:mga08y16_58524_c1
1988 nmdc:mga08y16_6292_c1
1989 nmdc:mga08y16_676805_c1
1990 nmdc:mga08y16_73755_c1
1991 nmdc:mga0n895_1099328_c1
1992 nmdc:mga0n895_1339321_c1
1993 nmdc:mga0n895_287449_c1
1994 nmdc:mga0n895_306323_c1
1995 nmdc:mga0n895_323653_c1
1996 nmdc:mga0n895_434268_c1
1997 nmdc:mga0n895_441476_c1
1998 nmdc:mga0n895_50574_c1
1999 nmdc:mga0n895_529444_c1
2000 nmdc:mga0n895_558830_c1
2001 nmdc:mga0n895_602410_c1
2002 nmdc:mga0n895_81_c1
2003 nmdc:mga0rr50_14271_c1
2004 nmdc:mga0rr50_169042_c1
2005 nmdc:mga0rr50_1_c1
2006 nmdc:mga0rr50_21528_c1
2007 nmdc:mga0rr50_22793_c1
2008 nmdc:mga0rr50_27862_c1
2009 nmdc:mga0rr50_363642_c1
2010 nmdc:mga0rr50_38547_c1
2011 nmdc:mga0rr50_49780_c1
2012 nmdc:mga0rr50_622473_c1
2013 nmdc:mga08x19_165520_c1
2014 nmdc:mga08x19_223759_c1
2015 nmdc:mga08x19_265_c1
2016 nmdc:mga08x19_284860_c1
2017 nmdc:mga08x19_32849_c1
2018 nmdc:mga08x19_333405_c1
2019 nmdc:mga08x19_63086_c1
2020 nmdc:mga0a205_12309_c1
2021 nmdc:mga0a205_277716_c1
2022 nmdc:mga0a205_285898_c1
2023 nmdc:mga0a205_4415_c1
2024 nmdc:mga0a205_89486_c1
2025 Ga0495601_0019063
2026 Ga0495601_0057619
2027 Ga0495601_0323480
2028 Ga0495601_0350372
2029 Ga0495595_0017122
2030 Ga0495595_0036785
2031 Ga0495595_0104077
2032 Ga0495619_0001103
2033 Ga0495619_0028564
2034 Ga0495619_0032757
2035 Ga0495619_0124069
2036 Ga0495619_0354979
2037 Ga0590071_000472
2038 Ga0590074_003726
2039 Ga0590075_000097
2040 Ga0590077_000274

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v8h-assembly1.cif.gz_A crystal structure of thymidylate synthase from burkholderia thailandensis 0.8686 137 181
3v8h-assembly2.cif.gz_B crystal structure of thymidylate synthase from burkholderia thailandensis 0.8644 137 181
4y49-assembly1.cif.gz_B crystal structure of yeast n-terminal acetyltransferase (ppgpp) nate in complex with a bisubstrate 0.7804 7 186
4pv6-assembly8.cif.gz_N crystal structure analysis of ard1 from thermoplasma volcanium 0.7783 3 183
7ypv-assembly1.cif.gz_B crystal structure of ore-st-f 0.7778 46 180
ID Description Score Start End Superfamily
af_K7LHF0_767_874_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.883 64 140 3.40.630.30
af_A0A0R0LDP2_1_100_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8617 101 181 3.40.630.30
af_B6SUK9_20_214_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8513 56 160 3.40.630.30
1xmtA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8438 101 138 3.40.630.30
1y9wB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8389 46 181 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A353KSB5-F1-model_v4 N-acetyltransferase domain-containing protein 0.9091 103 181 GO:0016747
AF-A0A357LH61-F1-model_v4 N-acetyltransferase domain-containing protein 0.9069 101 181 GO:0016747
AF-A0A2I0Q7A6-F1-model_v4 [Ribosomal protein bS18]-alanine N-acetyltransferase (EC 2.3.1.266) 0.9036 101 181 GO:0005737
GO:0008999
AF-A0A077ZHA8-F1-model_v4 DNA III psi and Acetyltransf 1 domain containing protein 0.9007 101 181 GO:0003887
GO:0006260
GO:0008080
GO:0008408
AF-A0A5R2NB78-F1-model_v4 N-acetyltransferase 0.8941 101 181 GO:0008080

Map