F488371
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1020 | 338 | 1020 | 372 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0000838|Ga0395900_0000838_30449_31699 |
| Length | 416 |
| Sequence | LALRTLQLSLSLTQFPVVLAELFRRRAGSSPRCQDRLVQRPGWAPDALSLFVELAALPSPSGEERAVADRVLDYLRALGLEVDEDDTGARIGSTMGNLLCRLEPRGNGDGAPLFFCAHLDTVPPEGPIEPVVGEDGIVRNGAGTILGADDKSAVAAMLEAAARLVEDGRPHAGVELLFTPKEEVGLVGAAAFDENRLAARLGYVYDHAGPVGEVIVGAPYQQKLDVHFRGRAAHAGMYPEEGRSAIAAAARAIADLRLGRLDEETSANVGRIEGGTARNVIPEHCRLAAEARSHDERKLADLVQEMLDTVTFAASLAECEVETQVAPASRGYRFRRDAEAVELAASALARVGREPSFVLSGGGADANVFNERGLQCVNLANGMTDIHTPDERIAVDDLEAMVDVTLALVDEAARRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 107 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 161 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 162 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 163 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 164 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 167 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 169 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 170 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 171 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 174 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 175 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 176 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 180 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 181 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 182 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 183 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 184 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 185 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 187 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 193 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 203 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 204 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 205 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 206 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 209 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 210 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 211 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 212 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 213 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 214 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 215 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 216 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 217 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 218 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 219 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 220 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 221 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 222 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 223 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 224 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 225 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 226 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 227 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 289 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 290 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 291 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 292 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 293 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 294 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 297 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 298 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 299 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 300 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 301 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 302 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 303 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 336 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 338 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.02 |
| Metatranscriptomes | 0.98 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.2 |
| Nodule | 0 |
| Rhizoplane | 11.37 |
| Rhizosphere | 87.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001919 | 3300001979 | Bacteria | 9526 |
| 2 | Ga0070658_10001917 | 3300005327 | Bacteria | 17524 |
| 3 | Ga0070658_10009008 | 3300005327 | Bacteria | 8024 |
| 4 | Ga0070658_10010832 | 3300005327 | Bacteria | 7310 |
| 5 | Ga0070683_100122099 | 3300005329 | Bacteria | 2461 |
| 6 | Ga0070683_100166019 | 3300005329 | Bacteria | 2095 |
| 7 | Ga0070690_100021377 | 3300005330 | Bacteria | 3950 |
| 8 | Ga0068869_100102301 | 3300005334 | Bacteria | 2168 |
| 9 | Ga0070680_100079285 | 3300005336 | Bacteria | 2706 |
| 10 | Ga0070680_100115905 | 3300005336 | Bacteria | 2233 |
| 11 | Ga0070680_100212999 | 3300005336 | Bacteria | 1630 |
| 12 | Ga0070682_100013796 | 3300005337 | Bacteria | 4659 |
| 13 | Ga0070682_100015285 | 3300005337 | Bacteria | 4445 |
| 14 | Ga0070682_100024483 | 3300005337 | Bacteria | 3593 |
| 15 | Ga0070682_100029174 | 3300005337 | Bacteria | 3320 |
| 16 | Ga0070682_100036730 | 3300005337 | Bacteria | 2996 |
| 17 | Ga0068868_100034278 | 3300005338 | Bacteria | 3918 |
| 18 | Ga0068868_100238440 | 3300005338 | Bacteria | 1527 |
| 19 | Ga0070660_100005923 | 3300005339 | Bacteria | 8454 |
| 20 | Ga0070660_100060376 | 3300005339 | Bacteria | 2943 |
| 21 | Ga0070660_100177538 | 3300005339 | Bacteria | 1722 |
| 22 | Ga0070689_100045899 | 3300005340 | Bacteria | 3366 |
| 23 | Ga0070691_10015848 | 3300005341 | Bacteria | 3465 |
| 24 | Ga0070691_10051621 | 3300005341 | Bacteria | 1964 |
| 25 | Ga0070661_100005675 | 3300005344 | Bacteria | 8596 |
| 26 | Ga0070668_100054366 | 3300005347 | Bacteria | 3088 |
| 27 | Ga0070668_100088205 | 3300005347 | Bacteria | 2442 |
| 28 | Ga0070669_100258523 | 3300005353 | Bacteria | 1389 |
| 29 | Ga0070688_100015520 | 3300005365 | Bacteria | 4337 |
| 30 | Ga0070659_100050496 | 3300005366 | Bacteria | 3269 |
| 31 | Ga0070659_100071877 | 3300005366 | Bacteria | 2752 |
| 32 | Ga0070659_100165228 | 3300005366 | Unclassified | 1811 |
| 33 | Ga0070667_100009302 | 3300005367 | Bacteria | 8145 |
| 34 | Ga0070667_100178778 | 3300005367 | Bacteria | 1876 |
| 35 | Ga0070709_10095217 | 3300005434 | Bacteria | 1972 |
| 36 | Ga0070714_100029254 | 3300005435 | Bacteria | 4580 |
| 37 | Ga0070714_100030412 | 3300005435 | Bacteria | 4494 |
| 38 | Ga0070714_100058112 | 3300005435 | Bacteria | 3313 |
| 39 | Ga0070714_100067633 | 3300005435 | Bacteria | 3081 |
| 40 | Ga0070714_100099389 | 3300005435 | Bacteria | 2561 |
| 41 | Ga0070714_100244341 | 3300005435 | Bacteria | 1658 |
| 42 | Ga0070713_100043207 | 3300005436 | Bacteria | 3683 |
| 43 | Ga0070713_100058191 | 3300005436 | Bacteria | 3223 |
| 44 | Ga0070713_100089869 | 3300005436 | Bacteria | 2639 |
| 45 | Ga0070713_100224591 | 3300005436 | Unclassified | 1705 |
| 46 | Ga0070710_10012734 | 3300005437 | Bacteria | 4186 |
| 47 | Ga0070701_10001955 | 3300005438 | Bacteria | 7806 |
| 48 | Ga0070711_100005352 | 3300005439 | Bacteria | 7672 |
| 49 | Ga0070711_100041981 | 3300005439 | Bacteria | 3090 |
| 50 | Ga0070711_100051343 | 3300005439 | Bacteria | 2831 |
| 51 | Ga0070705_100016734 | 3300005440 | Bacteria | 3815 |
| 52 | Ga0070705_100052306 | 3300005440 | Bacteria | 2385 |
| 53 | Ga0070705_100081776 | 3300005440 | Bacteria | 1985 |
| 54 | Ga0070705_100083922 | 3300005440 | Bacteria | 1964 |
| 55 | Ga0070705_100161429 | 3300005440 | Bacteria | 1499 |
| 56 | Ga0070700_100003711 | 3300005441 | Bacteria | 7892 |
| 57 | Ga0070700_100060336 | 3300005441 | Bacteria | 2390 |
| 58 | Ga0070700_100070126 | 3300005441 | Bacteria | 2234 |
| 59 | Ga0070694_100040078 | 3300005444 | Bacteria | 3121 |
| 60 | Ga0070694_100075706 | 3300005444 | Bacteria | 2328 |
| 61 | Ga0070708_100030358 | 3300005445 | Bacteria | 4672 |
| 62 | Ga0070708_100073080 | 3300005445 | Bacteria | 3091 |
| 63 | Ga0070678_100027211 | 3300005456 | Bacteria | 3881 |
| 64 | Ga0070678_100083046 | 3300005456 | Bacteria | 2434 |
| 65 | Ga0070678_100237318 | 3300005456 | Bacteria | 1523 |
| 66 | Ga0070678_100240063 | 3300005456 | Bacteria | 1515 |
| 67 | Ga0070662_100056188 | 3300005457 | Bacteria | 2857 |
| 68 | Ga0070681_10019656 | 3300005458 | Bacteria | 6764 |
| 69 | Ga0070681_10027044 | 3300005458 | Bacteria | 5768 |
| 70 | Ga0070681_10042356 | 3300005458 | Bacteria | 4563 |
| 71 | Ga0070681_10045320 | 3300005458 | Bacteria | 4400 |
| 72 | Ga0070681_10071810 | 3300005458 | Bacteria | 3426 |
| 73 | Ga0070681_10103021 | 3300005458 | Bacteria | 2799 |
| 74 | Ga0070681_10150198 | 3300005458 | Unclassified | 2256 |
| 75 | Ga0070681_10174749 | 3300005458 | Bacteria | 2069 |
| 76 | Ga0070681_10212509 | 3300005458 | Bacteria | 1850 |
| 77 | Ga0070681_10321332 | 3300005458 | Bacteria | 1457 |
| 78 | Ga0068867_100028094 | 3300005459 | Bacteria | 4048 |
| 79 | Ga0070706_100036466 | 3300005467 | Bacteria | 4541 |
| 80 | Ga0070706_100122830 | 3300005467 | Unclassified | 2421 |
| 81 | Ga0070706_100124960 | 3300005467 | Unclassified | 2398 |
| 82 | Ga0070706_100361788 | 3300005467 | Bacteria | 1352 |
| 83 | Ga0070707_100000736 | 3300005468 | Bacteria | 32520 |
| 84 | Ga0070707_100001917 | 3300005468 | Bacteria | 19935 |
| 85 | Ga0070707_100108476 | 3300005468 | Bacteria | 2693 |
| 86 | Ga0070707_100227414 | 3300005468 | Bacteria | 1817 |
| 87 | Ga0070707_100346107 | 3300005468 | Bacteria | 1444 |
| 88 | Ga0070698_100017893 | 3300005471 | Bacteria | 7466 |
| 89 | Ga0070698_100053947 | 3300005471 | Bacteria | 4083 |
| 90 | Ga0070698_100062959 | 3300005471 | Bacteria | 3741 |
| 91 | Ga0070698_100151900 | 3300005471 | Bacteria | 2263 |
| 92 | Ga0070698_100163311 | 3300005471 | Bacteria | 2170 |
| 93 | Ga0070698_100192258 | 3300005471 | Bacteria | 1978 |
| 94 | Ga0070699_100005711 | 3300005518 | Bacteria | 10897 |
| 95 | Ga0070699_100012784 | 3300005518 | Bacteria | 7236 |
| 96 | Ga0070699_100192617 | 3300005518 | Bacteria | 1812 |
| 97 | Ga0070679_100013238 | 3300005530 | Bacteria | 7895 |
| 98 | Ga0070679_100046291 | 3300005530 | Bacteria | 4335 |
| 99 | Ga0070679_100064484 | 3300005530 | Bacteria | 3651 |
| 100 | Ga0070679_100093351 | 3300005530 | Bacteria | 2997 |
| 101 | Ga0070679_100130555 | 3300005530 | Bacteria | 2494 |
| 102 | Ga0070679_100159956 | 3300005530 | Bacteria | 2227 |
| 103 | Ga0070684_100000304 | 3300005535 | Bacteria | 34144 |
| 104 | Ga0070684_100005611 | 3300005535 | Bacteria | 9644 |
| 105 | Ga0070684_100013149 | 3300005535 | Bacteria | 6661 |
| 106 | Ga0070684_100033850 | 3300005535 | Bacteria | 4365 |
| 107 | Ga0070684_100048627 | 3300005535 | Bacteria | 3679 |
| 108 | Ga0070697_100185522 | 3300005536 | Unclassified | 1764 |
| 109 | Ga0068853_100022302 | 3300005539 | Bacteria | 5287 |
| 110 | Ga0070686_100029186 | 3300005544 | Bacteria | 3353 |
| 111 | Ga0070695_100019884 | 3300005545 | Bacteria | 4095 |
| 112 | Ga0070696_100042589 | 3300005546 | Bacteria | 3138 |
| 113 | Ga0070696_100094204 | 3300005546 | Bacteria | 2137 |
| 114 | Ga0070696_100232270 | 3300005546 | Bacteria | 1388 |
| 115 | Ga0070693_100015911 | 3300005547 | Bacteria | 3882 |
| 116 | Ga0070693_100039488 | 3300005547 | Bacteria | 2644 |
| 117 | Ga0070665_100017345 | 3300005548 | Bacteria | 7227 |
| 118 | Ga0070665_100062268 | 3300005548 | Bacteria | 3741 |
| 119 | Ga0070704_100132297 | 3300005549 | Bacteria | 1935 |
| 120 | Ga0070704_100174758 | 3300005549 | Bacteria | 1712 |
| 121 | Ga0068855_100015558 | 3300005563 | Bacteria | 9158 |
| 122 | Ga0068855_100061321 | 3300005563 | Bacteria | 4394 |
| 123 | Ga0068855_100065248 | 3300005563 | Bacteria | 4245 |
| 124 | Ga0068855_100083393 | 3300005563 | Bacteria | 3702 |
| 125 | Ga0068855_100117266 | 3300005563 | Bacteria | 3050 |
| 126 | Ga0070664_100034719 | 3300005564 | Bacteria | 4231 |
| 127 | Ga0070664_100143570 | 3300005564 | Bacteria | 2104 |
| 128 | Ga0070664_100180277 | 3300005564 | Bacteria | 1877 |
| 129 | Ga0070664_100239925 | 3300005564 | Unclassified | 1627 |
| 130 | Ga0070664_100261620 | 3300005564 | Bacteria | 1557 |
| 131 | Ga0068857_100006535 | 3300005577 | Bacteria | 10005 |
| 132 | Ga0068857_100095260 | 3300005577 | Bacteria | 2667 |
| 133 | Ga0068856_100063236 | 3300005614 | Bacteria | 3656 |
| 134 | Ga0068856_100076900 | 3300005614 | Bacteria | 3307 |
| 135 | Ga0068856_100102573 | 3300005614 | Bacteria | 2854 |
| 136 | Ga0068856_100196648 | 3300005614 | Bacteria | 2030 |
| 137 | Ga0068856_100200382 | 3300005614 | Bacteria | 2010 |
| 138 | Ga0068856_100235155 | 3300005614 | Bacteria | 1848 |
| 139 | Ga0070702_100004559 | 3300005615 | Bacteria | 6341 |
| 140 | Ga0070702_100074984 | 3300005615 | Unclassified | 2009 |
| 141 | Ga0068852_100035447 | 3300005616 | Bacteria | 4162 |
| 142 | Ga0068864_100303951 | 3300005618 | Bacteria | 1494 |
| 143 | Ga0068864_100339051 | 3300005618 | Bacteria | 1416 |
| 144 | Ga0068866_10001213 | 3300005718 | Bacteria | 11206 |
| 145 | Ga0068861_100007901 | 3300005719 | Bacteria | 7319 |
| 146 | Ga0068861_100107071 | 3300005719 | Bacteria | 2234 |
| 147 | Ga0068861_100110309 | 3300005719 | Bacteria | 2203 |
| 148 | Ga0068863_100464763 | 3300005841 | Unclassified | 1243 |
| 149 | Ga0068862_100001367 | 3300005844 | Bacteria | 22660 |
| 150 | Ga0068862_100140681 | 3300005844 | Bacteria | 2141 |
| 151 | Ga0068862_100201484 | 3300005844 | Bacteria | 1795 |
| 152 | Ga0081455_10005820 | 3300005937 | Bacteria | 13416 |
| 153 | Ga0081455_10014238 | 3300005937 | Bacteria | 7805 |
| 154 | Ga0081455_10014350 | 3300005937 | Bacteria | 7773 |
| 155 | Ga0081455_10035655 | 3300005937 | Bacteria | 4441 |
| 156 | Ga0081538_10053605 | 3300005981 | Bacteria | 2396 |
| 157 | Ga0081540_1003071 | 3300005983 | Bacteria | 13377 |
| 158 | Ga0081540_1015602 | 3300005983 | Bacteria | 4802 |
| 159 | Ga0081539_10006606 | 3300005985 | Bacteria | 11012 |
| 160 | Ga0070717_10037914 | 3300006028 | Bacteria | 3915 |
| 161 | Ga0070717_10101499 | 3300006028 | Bacteria | 2443 |
| 162 | Ga0070717_10115892 | 3300006028 | Bacteria | 2290 |
| 163 | Ga0070717_10301524 | 3300006028 | Bacteria | 1424 |
| 164 | Ga0075365_10019759 | 3300006038 | Bacteria | 4165 |
| 165 | Ga0070715_10020079 | 3300006163 | Bacteria | 2571 |
| 166 | Ga0070715_10052854 | 3300006163 | Bacteria | 1754 |
| 167 | Ga0070712_100039286 | 3300006175 | Bacteria | 3238 |
| 168 | Ga0070712_100090282 | 3300006175 | Bacteria | 2243 |
| 169 | Ga0070712_100268046 | 3300006175 | Bacteria | 1371 |
| 170 | Ga0068871_100035915 | 3300006358 | Bacteria | 3941 |
| 171 | Ga0068871_100129862 | 3300006358 | Bacteria | 2135 |
| 172 | Ga0068871_100182559 | 3300006358 | Bacteria | 1804 |
| 173 | Ga0075428_100000381 | 3300006844 | Bacteria | 43984 |
| 174 | Ga0075431_100023773 | 3300006847 | Bacteria | 6273 |
| 175 | Ga0075431_100188313 | 3300006847 | Bacteria | 2115 |
| 176 | Ga0075433_10069829 | 3300006852 | Bacteria | 3086 |
| 177 | Ga0075433_10168459 | 3300006852 | Bacteria | 1949 |
| 178 | Ga0075433_10322230 | 3300006852 | Bacteria | 1367 |
| 179 | Ga0075434_100001557 | 3300006871 | Bacteria | 19447 |
| 180 | Ga0075434_100010132 | 3300006871 | Bacteria | 8828 |
| 181 | Ga0075434_100075961 | 3300006871 | Bacteria | 3354 |
| 182 | Ga0075434_100175550 | 3300006871 | Bacteria | 2162 |
| 183 | Ga0075434_100181318 | 3300006871 | Bacteria | 2126 |
| 184 | Ga0075429_100216747 | 3300006880 | Bacteria | 1677 |
| 185 | Ga0068865_100007982 | 3300006881 | Bacteria | 6535 |
| 186 | Ga0075436_100003007 | 3300006914 | Bacteria | 11549 |
| 187 | Ga0075436_100003937 | 3300006914 | Bacteria | 10181 |
| 188 | Ga0075436_100022390 | 3300006914 | Bacteria | 4340 |
| 189 | Ga0075436_100050943 | 3300006914 | Bacteria | 2857 |
| 190 | Ga0075435_100012038 | 3300007076 | Bacteria | 6391 |
| 191 | Ga0075435_100017412 | 3300007076 | Bacteria | 5441 |
| 192 | Ga0075435_100021362 | 3300007076 | Bacteria | 4977 |
| 193 | Ga0075435_100064189 | 3300007076 | Bacteria | 2983 |
| 194 | Ga0075435_100180082 | 3300007076 | Bacteria | 1786 |
| 195 | Ga0105240_10092787 | 3300009093 | Bacteria | 3685 |
| 196 | Ga0105240_10175155 | 3300009093 | Bacteria | 2536 |
| 197 | Ga0111539_10012314 | 3300009094 | Bacteria | 10718 |
| 198 | Ga0111539_10051846 | 3300009094 | Bacteria | 4885 |
| 199 | Ga0111539_10056650 | 3300009094 | Bacteria | 4657 |
| 200 | Ga0111539_10252067 | 3300009094 | Unclassified | 2055 |
| 201 | Ga0105245_10003086 | 3300009098 | Bacteria | 14908 |
| 202 | Ga0105245_10046270 | 3300009098 | Bacteria | 3888 |
| 203 | Ga0105245_10073970 | 3300009098 | Bacteria | 3100 |
| 204 | Ga0105245_10326822 | 3300009098 | Bacteria | 1512 |
| 205 | Ga0105247_10002698 | 3300009101 | Bacteria | 11915 |
| 206 | Ga0105247_10014196 | 3300009101 | Bacteria | 4779 |
| 207 | Ga0114129_10001661 | 3300009147 | Bacteria | 30289 |
| 208 | Ga0114129_10005673 | 3300009147 | Bacteria | 17670 |
| 209 | Ga0114129_10012739 | 3300009147 | Bacteria | 11971 |
| 210 | Ga0114129_10117688 | 3300009147 | Bacteria | 3661 |
| 211 | Ga0114129_10134627 | 3300009147 | Bacteria | 3391 |
| 212 | Ga0114129_10153050 | 3300009147 | Bacteria | 3156 |
| 213 | Ga0114129_10181523 | 3300009147 | Bacteria | 2863 |
| 214 | Ga0114129_10569990 | 3300009147 | Bacteria | 1470 |
| 215 | Ga0105243_10017876 | 3300009148 | Bacteria | 5364 |
| 216 | Ga0105243_10040745 | 3300009148 | Bacteria | 3629 |
| 217 | Ga0105243_10127544 | 3300009148 | Bacteria | 2154 |
| 218 | Ga0105243_10183473 | 3300009148 | Bacteria | 1822 |
| 219 | Ga0105243_10225101 | 3300009148 | Bacteria | 1660 |
| 220 | Ga0105241_10039315 | 3300009174 | Bacteria | 3568 |
| 221 | Ga0105242_10006738 | 3300009176 | Bacteria | 8859 |
| 222 | Ga0105242_10059277 | 3300009176 | Bacteria | 3140 |
| 223 | Ga0105248_10386638 | 3300009177 | Bacteria | 1575 |
| 224 | Ga0105237_10250757 | 3300009545 | Bacteria | 1772 |
| 225 | Ga0105238_10150945 | 3300009551 | Bacteria | 2299 |
| 226 | Ga0105238_10181417 | 3300009551 | Bacteria | 2082 |
| 227 | Ga0105238_10216597 | 3300009551 | Bacteria | 1891 |
| 228 | Ga0105249_10034961 | 3300009553 | Bacteria | 4556 |
| 229 | Ga0105239_10041625 | 3300010375 | Bacteria | 5034 |
| 230 | Ga0105239_10279800 | 3300010375 | Unclassified | 1878 |
| 231 | Ga0105246_10039168 | 3300011119 | Bacteria | 3191 |
| 232 | Ga0105246_10196366 | 3300011119 | Unclassified | 1565 |
| 233 | Ga0157373_10145747 | 3300013100 | Unclassified | 1665 |
| 234 | Ga0157371_10162431 | 3300013102 | Bacteria | 1595 |
| 235 | Ga0157370_10027005 | 3300013104 | Bacteria | 5663 |
| 236 | Ga0157370_10116274 | 3300013104 | Bacteria | 2499 |
| 237 | Ga0157369_10002618 | 3300013105 | Bacteria | 21517 |
| 238 | Ga0157369_10039852 | 3300013105 | Bacteria | 5132 |
| 239 | Ga0157369_10051221 | 3300013105 | Bacteria | 4468 |
| 240 | Ga0157369_10101401 | 3300013105 | Bacteria | 3067 |
| 241 | Ga0157369_10131514 | 3300013105 | Bacteria | 2651 |
| 242 | Ga0157374_10108469 | 3300013296 | Bacteria | 2668 |
| 243 | Ga0157378_10044141 | 3300013297 | Bacteria | 3958 |
| 244 | Ga0157378_10108371 | 3300013297 | Bacteria | 2543 |
| 245 | Ga0157378_10200593 | 3300013297 | Bacteria | 1887 |
| 246 | Ga0163162_10026922 | 3300013306 | Bacteria | 5686 |
| 247 | Ga0163162_10056437 | 3300013306 | Bacteria | 3955 |
| 248 | Ga0163162_10154367 | 3300013306 | Bacteria | 2415 |
| 249 | Ga0157372_10481927 | 3300013307 | Bacteria | 1446 |
| 250 | Ga0157375_10036207 | 3300013308 | Bacteria | 4719 |
| 251 | Ga0157375_10047453 | 3300013308 | Bacteria | 4195 |
| 252 | Ga0157380_10006605 | 3300014326 | Bacteria | 8181 |
| 253 | Ga0157380_10010760 | 3300014326 | Bacteria | 6592 |
| 254 | Ga0182008_10005743 | 3300014497 | Bacteria | 7025 |
| 255 | Ga0182008_10041945 | 3300014497 | Bacteria | 2281 |
| 256 | Ga0182008_10053067 | 3300014497 | Bacteria | 2008 |
| 257 | Ga0157377_10073642 | 3300014745 | Bacteria | 1980 |
| 258 | Ga0157379_10258274 | 3300014968 | Bacteria | 1583 |
| 259 | Ga0157376_10062443 | 3300014969 | Bacteria | 3134 |
| 260 | Ga0157376_10125268 | 3300014969 | Bacteria | 2284 |
| 261 | Ga0163161_10166119 | 3300017792 | Bacteria | 1685 |
| 262 | Ga0206356_10687371 | 3300020070 | Bacteria | 2795 |
| 263 | Ga0206356_11158095 | 3300020070 | Bacteria | 1283 |
| 264 | Ga0206356_11233245 | 3300020070 | Bacteria | 1369 |
| 265 | Ga0206356_11875873 | 3300020070 | Unclassified | 1893 |
| 266 | Ga0206354_10192413 | 3300020081 | Bacteria | 3483 |
| 267 | Ga0206354_10778318 | 3300020081 | Bacteria | 3765 |
| 268 | Ga0206354_10900364 | 3300020081 | Bacteria | 1794 |
| 269 | Ga0206353_10422956 | 3300020082 | Bacteria | 8342 |
| 270 | Ga0206353_11663111 | 3300020082 | Bacteria | 4091 |
| 271 | Ga0206353_11831078 | 3300020082 | Bacteria | 2926 |
| 272 | Ga0213871_10006336 | 3300021441 | Bacteria | 2500 |
| 273 | Ga0207692_10074254 | 3300025898 | Bacteria | 1801 |
| 274 | Ga0207642_10014554 | 3300025899 | Bacteria | 2905 |
| 275 | Ga0207710_10000179 | 3300025900 | Bacteria | 64100 |
| 276 | Ga0207688_10151160 | 3300025901 | Bacteria | 1371 |
| 277 | Ga0207647_10154597 | 3300025904 | Unclassified | 1340 |
| 278 | Ga0207699_10081352 | 3300025906 | Bacteria | 2009 |
| 279 | Ga0207645_10057178 | 3300025907 | Bacteria | 2490 |
| 280 | Ga0207705_10026437 | 3300025909 | Bacteria | 4139 |
| 281 | Ga0207705_10038063 | 3300025909 | Bacteria | 3443 |
| 282 | Ga0207705_10063948 | 3300025909 | Bacteria | 2659 |
| 283 | Ga0207684_10056353 | 3300025910 | Bacteria | 3334 |
| 284 | Ga0207684_10080852 | 3300025910 | Bacteria | 2765 |
| 285 | Ga0207684_10165453 | 3300025910 | Bacteria | 1905 |
| 286 | Ga0207684_10312577 | 3300025910 | Bacteria | 1354 |
| 287 | Ga0207684_10348716 | 3300025910 | Bacteria | 1274 |
| 288 | Ga0207654_10188351 | 3300025911 | Unclassified | 1351 |
| 289 | Ga0207707_10017134 | 3300025912 | Bacteria | 6312 |
| 290 | Ga0207707_10106547 | 3300025912 | Bacteria | 2450 |
| 291 | Ga0207707_10108903 | 3300025912 | Bacteria | 2422 |
| 292 | Ga0207707_10143050 | 3300025912 | Bacteria | 2091 |
| 293 | Ga0207693_10000319 | 3300025915 | Bacteria | 44749 |
| 294 | Ga0207693_10000945 | 3300025915 | Bacteria | 26054 |
| 295 | Ga0207693_10004123 | 3300025915 | Bacteria | 12338 |
| 296 | Ga0207693_10033836 | 3300025915 | Bacteria | 4032 |
| 297 | Ga0207693_10038611 | 3300025915 | Bacteria | 3759 |
| 298 | Ga0207693_10047648 | 3300025915 | Bacteria | 3367 |
| 299 | Ga0207693_10112782 | 3300025915 | Bacteria | 2133 |
| 300 | Ga0207693_10126291 | 3300025915 | Bacteria | 2010 |
| 301 | Ga0207693_10307813 | 3300025915 | Bacteria | 1241 |
| 302 | Ga0207663_10004268 | 3300025916 | Bacteria | 7094 |
| 303 | Ga0207663_10010470 | 3300025916 | Bacteria | 4938 |
| 304 | Ga0207663_10190443 | 3300025916 | Bacteria | 1472 |
| 305 | Ga0207660_10031455 | 3300025917 | Bacteria | 3655 |
| 306 | Ga0207660_10176254 | 3300025917 | Bacteria | 1658 |
| 307 | Ga0207662_10054435 | 3300025918 | Bacteria | 2386 |
| 308 | Ga0207657_10003731 | 3300025919 | Bacteria | 16188 |
| 309 | Ga0207657_10005756 | 3300025919 | Bacteria | 12928 |
| 310 | Ga0207657_10027056 | 3300025919 | Bacteria | 5258 |
| 311 | Ga0207657_10029230 | 3300025919 | Bacteria | 5019 |
| 312 | Ga0207657_10042806 | 3300025919 | Bacteria | 3992 |
| 313 | Ga0207649_10033516 | 3300025920 | Bacteria | 3069 |
| 314 | Ga0207652_10008054 | 3300025921 | Bacteria | 8458 |
| 315 | Ga0207652_10048618 | 3300025921 | Bacteria | 3626 |
| 316 | Ga0207652_10065363 | 3300025921 | Bacteria | 3150 |
| 317 | Ga0207652_10105455 | 3300025921 | Bacteria | 2494 |
| 318 | Ga0207652_10231005 | 3300025921 | Unclassified | 1667 |
| 319 | Ga0207646_10002421 | 3300025922 | Bacteria | 22033 |
| 320 | Ga0207646_10022827 | 3300025922 | Bacteria | 5754 |
| 321 | Ga0207694_10064076 | 3300025924 | Bacteria | 2864 |
| 322 | Ga0207659_10284173 | 3300025926 | Bacteria | 1354 |
| 323 | Ga0207687_10003599 | 3300025927 | Bacteria | 10432 |
| 324 | Ga0207687_10024282 | 3300025927 | Bacteria | 4048 |
| 325 | Ga0207687_10042776 | 3300025927 | Bacteria | 3119 |
| 326 | Ga0207687_10049497 | 3300025927 | Bacteria | 2922 |
| 327 | Ga0207687_10066707 | 3300025927 | Bacteria | 2558 |
| 328 | Ga0207687_10116444 | 3300025927 | Bacteria | 1992 |
| 329 | Ga0207687_10166619 | 3300025927 | Bacteria | 1696 |
| 330 | Ga0207687_10206638 | 3300025927 | Bacteria | 1538 |
| 331 | Ga0207700_10062381 | 3300025928 | Unclassified | 2831 |
| 332 | Ga0207700_10064336 | 3300025928 | Bacteria | 2793 |
| 333 | Ga0207700_10169436 | 3300025928 | Bacteria | 1821 |
| 334 | Ga0207664_10008572 | 3300025929 | Bacteria | 7143 |
| 335 | Ga0207664_10060285 | 3300025929 | Bacteria | 3024 |
| 336 | Ga0207664_10073207 | 3300025929 | Bacteria | 2764 |
| 337 | Ga0207664_10083264 | 3300025929 | Bacteria | 2608 |
| 338 | Ga0207664_10091349 | 3300025929 | Bacteria | 2497 |
| 339 | Ga0207664_10247239 | 3300025929 | Bacteria | 1555 |
| 340 | Ga0207664_10394379 | 3300025929 | Unclassified | 1230 |
| 341 | Ga0207690_10142744 | 3300025932 | Bacteria | 1766 |
| 342 | Ga0207706_10003832 | 3300025933 | Bacteria | 14329 |
| 343 | Ga0207706_10029343 | 3300025933 | Bacteria | 4910 |
| 344 | Ga0207706_10045280 | 3300025933 | Bacteria | 3899 |
| 345 | Ga0207706_10073803 | 3300025933 | Bacteria | 3000 |
| 346 | Ga0207686_10002316 | 3300025934 | Bacteria | 10426 |
| 347 | Ga0207709_10003771 | 3300025935 | Bacteria | 8904 |
| 348 | Ga0207709_10010998 | 3300025935 | Bacteria | 4988 |
| 349 | Ga0207709_10056466 | 3300025935 | Bacteria | 2430 |
| 350 | Ga0207670_10014593 | 3300025936 | Bacteria | 4670 |
| 351 | Ga0207704_10118584 | 3300025938 | Bacteria | 1805 |
| 352 | Ga0207665_10002255 | 3300025939 | Bacteria | 13013 |
| 353 | Ga0207665_10007220 | 3300025939 | Bacteria | 7352 |
| 354 | Ga0207665_10008529 | 3300025939 | Bacteria | 6747 |
| 355 | Ga0207665_10073671 | 3300025939 | Bacteria | 2336 |
| 356 | Ga0207691_10009218 | 3300025940 | Bacteria | 9472 |
| 357 | Ga0207691_10195473 | 3300025940 | Bacteria | 1763 |
| 358 | Ga0207711_10028596 | 3300025941 | Bacteria | 4693 |
| 359 | Ga0207661_10003070 | 3300025944 | Bacteria | 11557 |
| 360 | Ga0207661_10101276 | 3300025944 | Bacteria | 2419 |
| 361 | Ga0207661_10125684 | 3300025944 | Unclassified | 2190 |
| 362 | Ga0207679_10138480 | 3300025945 | Bacteria | 1964 |
| 363 | Ga0207679_10140877 | 3300025945 | Bacteria | 1949 |
| 364 | Ga0207667_10083906 | 3300025949 | Bacteria | 3298 |
| 365 | Ga0207667_10288750 | 3300025949 | Bacteria | 1676 |
| 366 | Ga0207651_10187263 | 3300025960 | Unclassified | 1648 |
| 367 | Ga0207712_10024209 | 3300025961 | Bacteria | 4018 |
| 368 | Ga0207668_10039579 | 3300025972 | Bacteria | 3175 |
| 369 | Ga0207668_10101007 | 3300025972 | Bacteria | 2143 |
| 370 | Ga0207668_10179823 | 3300025972 | Bacteria | 1667 |
| 371 | Ga0207658_10045246 | 3300025986 | Bacteria | 3208 |
| 372 | Ga0207708_10008089 | 3300026075 | Bacteria | 7794 |
| 373 | Ga0207708_10048525 | 3300026075 | Bacteria | 3232 |
| 374 | Ga0207708_10143876 | 3300026075 | Bacteria | 1873 |
| 375 | Ga0207702_10019118 | 3300026078 | Bacteria | 5669 |
| 376 | Ga0207702_10055641 | 3300026078 | Bacteria | 3356 |
| 377 | Ga0207702_10075448 | 3300026078 | Bacteria | 2913 |
| 378 | Ga0207702_10096587 | 3300026078 | Bacteria | 2599 |
| 379 | Ga0207702_10105669 | 3300026078 | Bacteria | 2494 |
| 380 | Ga0207702_10224622 | 3300026078 | Bacteria | 1751 |
| 381 | Ga0207641_10292795 | 3300026088 | Bacteria | 1535 |
| 382 | Ga0207648_10002132 | 3300026089 | Bacteria | 21520 |
| 383 | Ga0207648_10011231 | 3300026089 | Bacteria | 8445 |
| 384 | Ga0207676_10045001 | 3300026095 | Bacteria | 3408 |
| 385 | Ga0207674_10011029 | 3300026116 | Bacteria | 10164 |
| 386 | Ga0207674_10026840 | 3300026116 | Bacteria | 6109 |
| 387 | Ga0207675_100005440 | 3300026118 | Bacteria | 12206 |
| 388 | Ga0207675_100008915 | 3300026118 | Bacteria | 9412 |
| 389 | Ga0207675_100052680 | 3300026118 | Bacteria | 3797 |
| 390 | Ga0207675_100092869 | 3300026118 | Bacteria | 2838 |
| 391 | Ga0207675_100147604 | 3300026118 | Bacteria | 2237 |
| 392 | Ga0207683_10002939 | 3300026121 | Bacteria | 14868 |
| 393 | Ga0207683_10012321 | 3300026121 | Bacteria | 7298 |
| 394 | Ga0207683_10027994 | 3300026121 | Bacteria | 4872 |
| 395 | Ga0207683_10028451 | 3300026121 | Bacteria | 4832 |
| 396 | Ga0207683_10029373 | 3300026121 | Bacteria | 4760 |
| 397 | Ga0207683_10032077 | 3300026121 | Bacteria | 4562 |
| 398 | Ga0207683_10085471 | 3300026121 | Bacteria | 2804 |
| 399 | Ga0207683_10137693 | 3300026121 | Bacteria | 2198 |
| 400 | Ga0207698_10066827 | 3300026142 | Bacteria | 2832 |
| 401 | Ga0207698_10083164 | 3300026142 | Bacteria | 2590 |
| 402 | Ga0207428_10005252 | 3300027907 | Bacteria | 12103 |
| 403 | Ga0207428_10008826 | 3300027907 | Bacteria | 9088 |
| 404 | Ga0207428_10030367 | 3300027907 | Bacteria | 4468 |
| 405 | Ga0268265_10003678 | 3300028380 | Bacteria | 10943 |
| 406 | Ga0268265_10311239 | 3300028380 | Bacteria | 1422 |
| 407 | Ga0268264_10284109 | 3300028381 | Unclassified | 1551 |
| 408 | Ga0265337_1025219 | 3300028556 | Bacteria | 1811 |
| 409 | Ga0265326_10011074 | 3300028558 | Bacteria | 2667 |
| 410 | Ga0265319_1000592 | 3300028563 | Bacteria | 24262 |
| 411 | Ga0265319_1005217 | 3300028563 | Bacteria | 6270 |
| 412 | Ga0265318_10000219 | 3300028577 | Bacteria | 49788 |
| 413 | Ga0265318_10005482 | 3300028577 | Bacteria | 5954 |
| 414 | Ga0265318_10043101 | 3300028577 | Bacteria | 1711 |
| 415 | Ga0265322_10016444 | 3300028654 | Bacteria | 2135 |
| 416 | Ga0265338_10003307 | 3300028800 | Bacteria | 22846 |
| 417 | Ga0265338_10007029 | 3300028800 | Bacteria | 14125 |
| 418 | Ga0265338_10016091 | 3300028800 | Bacteria | 8162 |
| 419 | Ga0265338_10034817 | 3300028800 | Bacteria | 4855 |
| 420 | Ga0265338_10175213 | 3300028800 | Bacteria | 1640 |
| 421 | Ga0265330_10000479 | 3300031235 | Bacteria | 26766 |
| 422 | Ga0265328_10000790 | 3300031239 | Bacteria | 14638 |
| 423 | Ga0265320_10051332 | 3300031240 | Bacteria | 2001 |
| 424 | Ga0265320_10058686 | 3300031240 | Bacteria | 1841 |
| 425 | Ga0265325_10000443 | 3300031241 | Bacteria | 29809 |
| 426 | Ga0265329_10000472 | 3300031242 | Bacteria | 20927 |
| 427 | Ga0265340_10068279 | 3300031247 | Unclassified | 1688 |
| 428 | Ga0265339_10101055 | 3300031249 | Bacteria | 1501 |
| 429 | Ga0265331_10020343 | 3300031250 | Bacteria | 3410 |
| 430 | Ga0265327_10009052 | 3300031251 | Bacteria | 7275 |
| 431 | Ga0265316_10004053 | 3300031344 | Bacteria | 14658 |
| 432 | Ga0265316_10012119 | 3300031344 | Bacteria | 7742 |
| 433 | Ga0307408_100171924 | 3300031548 | Bacteria | 1731 |
| 434 | Ga0265313_10006992 | 3300031595 | Bacteria | 7824 |
| 435 | Ga0265314_10003422 | 3300031711 | Bacteria | 15353 |
| 436 | Ga0265314_10031419 | 3300031711 | Bacteria | 3919 |
| 437 | Ga0265342_10045680 | 3300031712 | Bacteria | 2635 |
| 438 | Ga0265342_10097936 | 3300031712 | Unclassified | 1674 |
| 439 | Ga0307406_10230486 | 3300031901 | Bacteria | 1383 |
| 440 | Ga0307409_100293301 | 3300031995 | Bacteria | 1509 |
| 441 | Ga0307416_100106261 | 3300032002 | Bacteria | 2460 |
| 442 | Ga0373938_0010324 | 3300034957 | Bacteria | 1714 |
| 443 | Ga0373952_0015557 | 3300035092 | Bacteria | 1537 |
| 444 | Ga0373939_0027186 | 3300035114 | Bacteria | 1618 |
| 445 | Ga0373941_0006820 | 3300035115 | Bacteria | 2768 |
| 446 | Ga0373941_0011420 | 3300035115 | Bacteria | 2295 |
| 447 | Ga0373945_0003511 | 3300035116 | Bacteria | 4939 |
| 448 | Ga0373960_0018728 | 3300035121 | Bacteria | 1810 |
| 449 | Ga0373943_0005293 | 3300035170 | Bacteria | 5802 |
| 450 | Ga0373943_0011525 | 3300035170 | Bacteria | 3979 |
| 451 | Ga0373943_0034514 | 3300035170 | Bacteria | 2413 |
| 452 | Ga0373943_0065060 | 3300035170 | Bacteria | 1832 |
| 453 | Ga0373946_0014769 | 3300035171 | Bacteria | 2950 |
| 454 | Ga0373955_0024397 | 3300035172 | Bacteria | 3093 |
| 455 | Ga0373961_0011677 | 3300035241 | Bacteria | 2183 |
| 456 | Ga0373962_0003254 | 3300035242 | Bacteria | 3906 |
| 457 | Ga0373931_0006393 | 3300035691 | Bacteria | 5503 |
| 458 | Ga0373935_0072020 | 3300035692 | Bacteria | 2231 |
| 459 | Ga0373927_0045554 | 3300035695 | Unclassified | 2837 |
| 460 | Ga0373927_0158836 | 3300035695 | Bacteria | 1481 |
| 461 | Ga0373947_0000237 | 3300035725 | Bacteria | 31058 |
| 462 | Ga0373937_0000548 | 3300036401 | Bacteria | 33475 |
| 463 | Ga0373937_0025305 | 3300036401 | Bacteria | 5358 |
| 464 | Ga0373937_0338739 | 3300036401 | Bacteria | 1424 |
| 465 | Ga0373925_0002356 | 3300037068 | Bacteria | 15161 |
| 466 | Ga0373925_0055357 | 3300037068 | Bacteria | 2969 |
| 467 | Ga0373925_0093770 | 3300037068 | Bacteria | 2298 |
| 468 | Ga0373925_0107961 | 3300037068 | Bacteria | 2147 |
| 469 | Ga0395899_0010815 | 3300037312 | Bacteria | 6996 |
| 470 | Ga0395899_0012610 | 3300037312 | Bacteria | 6480 |
| 471 | Ga0395899_0016341 | 3300037312 | Bacteria | 5656 |
| 472 | Ga0395899_0026219 | 3300037312 | Bacteria | 4398 |
| 473 | Ga0395899_0030436 | 3300037312 | Bacteria | 4060 |
| 474 | Ga0395899_0046995 | 3300037312 | Bacteria | 3214 |
| 475 | Ga0395899_0058758 | 3300037312 | Bacteria | 2836 |
| 476 | Ga0395899_0073691 | 3300037312 | Bacteria | 2496 |
| 477 | Ga0395899_0075024 | 3300037312 | Bacteria | 2470 |
| 478 | Ga0395899_0076944 | 3300037312 | Bacteria | 2435 |
| 479 | Ga0395899_0114276 | 3300037312 | Bacteria | 1938 |
| 480 | Ga0395899_0123955 | 3300037312 | Bacteria | 1848 |
| 481 | Ga0395900_0000838 | 3300037418 | Bacteria | 40475 |
| 482 | Ga0395900_0003636 | 3300037418 | Bacteria | 16572 |
| 483 | Ga0395900_0003913 | 3300037418 | Bacteria | 15910 |
| 484 | Ga0395900_0006681 | 3300037418 | Bacteria | 11985 |
| 485 | Ga0395900_0008263 | 3300037418 | Bacteria | 10716 |
| 486 | Ga0395900_0013052 | 3300037418 | Bacteria | 8492 |
| 487 | Ga0395900_0050121 | 3300037418 | Bacteria | 4301 |
| 488 | Ga0395900_0070002 | 3300037418 | Bacteria | 3607 |
| 489 | Ga0395900_0093511 | 3300037418 | Bacteria | 3088 |
| 490 | Ga0395900_0106472 | 3300037418 | Bacteria | 2880 |
| 491 | Ga0395900_0112371 | 3300037418 | Bacteria | 2797 |
| 492 | Ga0395900_0143369 | 3300037418 | Bacteria | 2445 |
| 493 | Ga0395900_0196645 | 3300037418 | Unclassified | 2042 |
| 494 | Ga0395900_0227670 | 3300037418 | Bacteria | 1877 |
| 495 | Ga0395900_0248532 | 3300037418 | Bacteria | 1781 |
| 496 | Ga0395898_0001212 | 3300037466 | Bacteria | 38943 |
| 497 | Ga0395898_0003410 | 3300037466 | Bacteria | 17802 |
| 498 | Ga0395898_0007007 | 3300037466 | Bacteria | 11978 |
| 499 | Ga0395898_0007049 | 3300037466 | Bacteria | 11941 |
| 500 | Ga0395898_0007790 | 3300037466 | Bacteria | 11368 |
| 501 | Ga0395898_0011394 | 3300037466 | Bacteria | 9234 |
| 502 | Ga0395898_0015434 | 3300037466 | Bacteria | 7832 |
| 503 | Ga0395898_0024102 | 3300037466 | Bacteria | 6142 |
| 504 | Ga0395898_0031435 | 3300037466 | Bacteria | 5304 |
| 505 | Ga0395898_0033701 | 3300037466 | Bacteria | 5108 |
| 506 | Ga0395898_0039393 | 3300037466 | Bacteria | 4677 |
| 507 | Ga0395898_0057873 | 3300037466 | Bacteria | 3775 |
| 508 | Ga0395898_0058510 | 3300037466 | Bacteria | 3751 |
| 509 | Ga0395898_0097804 | 3300037466 | Bacteria | 2818 |
| 510 | Ga0395898_0116142 | 3300037466 | Bacteria | 2564 |
| 511 | Ga0395898_0127735 | 3300037466 | Bacteria | 2435 |
| 512 | Ga0395898_0157977 | 3300037466 | Bacteria | 2168 |
| 513 | Ga0395898_0171389 | 3300037466 | Bacteria | 2075 |
| 514 | Ga0395898_0346758 | 3300037466 | Bacteria | 1416 |
| 515 | Ga0395898_0481221 | 3300037466 | Bacteria | 1181 |
| 516 | Ga0395898_0600040 | 3300037466 | Unclassified | 1044 |
| 517 | Ga0395905_0001601 | 3300037471 | Bacteria | 26910 |
| 518 | Ga0395905_0001928 | 3300037471 | Bacteria | 23814 |
| 519 | Ga0395905_0004549 | 3300037471 | Bacteria | 14360 |
| 520 | Ga0395905_0010973 | 3300037471 | Bacteria | 8769 |
| 521 | Ga0395905_0011189 | 3300037471 | Bacteria | 8676 |
| 522 | Ga0395905_0012746 | 3300037471 | Bacteria | 8086 |
| 523 | Ga0395905_0019921 | 3300037471 | Bacteria | 6357 |
| 524 | Ga0395905_0026059 | 3300037471 | Bacteria | 5513 |
| 525 | Ga0395905_0105086 | 3300037471 | Bacteria | 2651 |
| 526 | Ga0395905_0122043 | 3300037471 | Bacteria | 2450 |
| 527 | Ga0395905_0126128 | 3300037471 | Bacteria | 2407 |
| 528 | Ga0395901_0000858 | 3300038443 | Bacteria | 33469 |
| 529 | Ga0395901_0001826 | 3300038443 | Bacteria | 21982 |
| 530 | Ga0395901_0003205 | 3300038443 | Bacteria | 16466 |
| 531 | Ga0395901_0003231 | 3300038443 | Bacteria | 16388 |
| 532 | Ga0395901_0003420 | 3300038443 | Bacteria | 15996 |
| 533 | Ga0395901_0006476 | 3300038443 | Bacteria | 11854 |
| 534 | Ga0395901_0010878 | 3300038443 | Bacteria | 9221 |
| 535 | Ga0395901_0013196 | 3300038443 | Bacteria | 8390 |
| 536 | Ga0395901_0024220 | 3300038443 | Bacteria | 6228 |
| 537 | Ga0395901_0033692 | 3300038443 | Bacteria | 5288 |
| 538 | Ga0395901_0037382 | 3300038443 | Bacteria | 5021 |
| 539 | Ga0395901_0041928 | 3300038443 | Bacteria | 4744 |
| 540 | Ga0395901_0055287 | 3300038443 | Bacteria | 4128 |
| 541 | Ga0395901_0064877 | 3300038443 | Bacteria | 3801 |
| 542 | Ga0395901_0076162 | 3300038443 | Bacteria | 3500 |
| 543 | Ga0395901_0080971 | 3300038443 | Bacteria | 3391 |
| 544 | Ga0395901_0117180 | 3300038443 | Bacteria | 2798 |
| 545 | Ga0395901_0138446 | 3300038443 | Bacteria | 2558 |
| 546 | Ga0395901_0146551 | 3300038443 | Bacteria | 2481 |
| 547 | Ga0395901_0157899 | 3300038443 | Bacteria | 2382 |
| 548 | Ga0395901_0161945 | 3300038443 | Bacteria | 2350 |
| 549 | Ga0395901_0241094 | 3300038443 | Unclassified | 1886 |
| 550 | Ga0395901_0244308 | 3300038443 | Bacteria | 1871 |
| 551 | Ga0395901_0306200 | 3300038443 | Unclassified | 1646 |
| 552 | Ga0395901_0320598 | 3300038443 | Bacteria | 1603 |
| 553 | Ga0436365_1070781 | 3300039437 | Bacteria | 2419 |
| 554 | Ga0436360_0887170 | 3300039438 | Bacteria | 4748 |
| 555 | Ga0451789_0528223 | 3300041443 | Unclassified | 1836 |
| 556 | Ga0451789_0919425 | 3300041443 | Bacteria | 1404 |
| 557 | Ga0451800_1267821 | 3300041459 | Bacteria | 2221 |
| 558 | Ga0451835_0383021 | 3300041492 | Bacteria | 3443 |
| 559 | Ga0451839_0194646 | 3300041496 | Bacteria | 2270 |
| 560 | Ga0451849_0045844 | 3300041505 | Bacteria | 4176 |
| 561 | Ga0451851_0849119 | 3300041507 | Bacteria | 2791 |
| 562 | Ga0451853_3599974 | 3300041512 | Bacteria | 2150 |
| 563 | Ga0439464_0036941 | 3300042439 | Bacteria | 1384 |
| 564 | Ga0466965_0004578 | 3300044683 | Bacteria | 6158 |
| 565 | Ga0466965_0085556 | 3300044683 | Bacteria | 1598 |
| 566 | Ga0466966_0020499 | 3300044684 | Bacteria | 4346 |
| 567 | Ga0466966_0038817 | 3300044684 | Bacteria | 3066 |
| 568 | Ga0466961_0002675 | 3300044693 | Bacteria | 11056 |
| 569 | Ga0466961_0004260 | 3300044693 | Bacteria | 8954 |
| 570 | Ga0466961_0083012 | 3300044693 | Bacteria | 2026 |
| 571 | Ga0466961_0099484 | 3300044693 | Bacteria | 1833 |
| 572 | Ga0466963_0000261 | 3300044694 | Bacteria | 23150 |
| 573 | Ga0466963_0000768 | 3300044694 | Bacteria | 15875 |
| 574 | Ga0466963_0002376 | 3300044694 | Bacteria | 10515 |
| 575 | Ga0466963_0002868 | 3300044694 | Bacteria | 9735 |
| 576 | Ga0466963_0004245 | 3300044694 | Bacteria | 8313 |
| 577 | Ga0466963_0011880 | 3300044694 | Bacteria | 5315 |
| 578 | Ga0466963_0024908 | 3300044694 | Bacteria | 3811 |
| 579 | Ga0466963_0035060 | 3300044694 | Bacteria | 3267 |
| 580 | Ga0466963_0044167 | 3300044694 | Bacteria | 2933 |
| 581 | Ga0466963_0076363 | 3300044694 | Unclassified | 2262 |
| 582 | Ga0466963_0081131 | 3300044694 | Bacteria | 2196 |
| 583 | Ga0466963_0083860 | 3300044694 | Bacteria | 2161 |
| 584 | Ga0466964_0000352 | 3300044706 | Bacteria | 13785 |
| 585 | Ga0466964_0004673 | 3300044706 | Bacteria | 5062 |
| 586 | Ga0466964_0008804 | 3300044706 | Bacteria | 3794 |
| 587 | Ga0466964_0017735 | 3300044706 | Bacteria | 2726 |
| 588 | Ga0466964_0026000 | 3300044706 | Bacteria | 2289 |
| 589 | Ga0466964_0030830 | 3300044706 | Bacteria | 2124 |
| 590 | Ga0466964_0063959 | 3300044706 | Bacteria | 1538 |
| 591 | Ga0466968_0003161 | 3300044735 | Bacteria | 6077 |
| 592 | Ga0466968_0008909 | 3300044735 | Bacteria | 3852 |
| 593 | Ga0466968_0031417 | 3300044735 | Bacteria | 2203 |
| 594 | Ga0466968_0041575 | 3300044735 | Bacteria | 1941 |
| 595 | Ga0466970_0014312 | 3300044765 | Bacteria | 4071 |
| 596 | Ga0466970_0160736 | 3300044765 | Bacteria | 1242 |
| 597 | Ga0466957_0006127 | 3300044842 | Bacteria | 6787 |
| 598 | Ga0466957_0030739 | 3300044842 | Bacteria | 3207 |
| 599 | Ga0466960_0003012 | 3300044901 | Bacteria | 6433 |
| 600 | Ga0466959_0025227 | 3300045049 | Bacteria | 4404 |
| 601 | Ga0466959_0025914 | 3300045049 | Bacteria | 4348 |
| 602 | Ga0451576_0022984 | 3300045051 | Bacteria | 6757 |
| 603 | Ga0466958_0000988 | 3300045836 | Bacteria | 12856 |
| 604 | Ga0466958_0002635 | 3300045836 | Bacteria | 9070 |
| 605 | Ga0466958_0031646 | 3300045836 | Unclassified | 3145 |
| 606 | Ga0466958_0121919 | 3300045836 | Bacteria | 1633 |
| 607 | Ga0466967_0002587 | 3300045976 | Bacteria | 11369 |
| 608 | Ga0466967_0013294 | 3300045976 | Bacteria | 6353 |
| 609 | Ga0466967_0013473 | 3300045976 | Bacteria | 6321 |
| 610 | Ga0466967_0015101 | 3300045976 | Bacteria | 6044 |
| 611 | Ga0466967_0021409 | 3300045976 | Bacteria | 5250 |
| 612 | Ga0466967_0022717 | 3300045976 | Bacteria | 5126 |
| 613 | Ga0466967_0027600 | 3300045976 | Bacteria | 4724 |
| 614 | Ga0466967_0031057 | 3300045976 | Bacteria | 4492 |
| 615 | Ga0466967_0031978 | 3300045976 | Bacteria | 4438 |
| 616 | Ga0466967_0038321 | 3300045976 | Bacteria | 4110 |
| 617 | Ga0466967_0053417 | 3300045976 | Bacteria | 3551 |
| 618 | Ga0466967_0054362 | 3300045976 | Bacteria | 3523 |
| 619 | Ga0466967_0055137 | 3300045976 | Bacteria | 3501 |
| 620 | Ga0466967_0074837 | 3300045976 | Bacteria | 3042 |
| 621 | Ga0466967_0111660 | 3300045976 | Bacteria | 2512 |
| 622 | Ga0466967_0122613 | 3300045976 | Bacteria | 2404 |
| 623 | Ga0466967_0141492 | 3300045976 | Bacteria | 2241 |
| 624 | Ga0466967_0187418 | 3300045976 | Bacteria | 1954 |
| 625 | Ga0466967_0226508 | 3300045976 | Bacteria | 1779 |
| 626 | Ga0466967_0242022 | 3300045976 | Bacteria | 1721 |
| 627 | Ga0466967_0440315 | 3300045976 | Unclassified | 1272 |
| 628 | Ga0495592_0000100 | 3300046454 | Bacteria | 76535 |
| 629 | Ga0495592_0060169 | 3300046454 | Bacteria | 2794 |
| 630 | Ga0495603_0001231 | 3300046455 | Bacteria | 14938 |
| 631 | Ga0495603_0013603 | 3300046455 | Bacteria | 4923 |
| 632 | Ga0495603_0014127 | 3300046455 | Bacteria | 4831 |
| 633 | Ga0495603_0041622 | 3300046455 | Bacteria | 2746 |
| 634 | Ga0495603_0047923 | 3300046455 | Bacteria | 2544 |
| 635 | Ga0495603_0104510 | 3300046455 | Bacteria | 1653 |
| 636 | Ga0495629_0002746 | 3300046459 | Bacteria | 13466 |
| 637 | Ga0495629_0030475 | 3300046459 | Bacteria | 3824 |
| 638 | Ga0495641_0002482 | 3300046461 | Bacteria | 14526 |
| 639 | Ga0495641_0004633 | 3300046461 | Bacteria | 9613 |
| 640 | Ga0495641_0043455 | 3300046461 | Bacteria | 2078 |
| 641 | Ga0495641_0055610 | 3300046461 | Bacteria | 1796 |
| 642 | Ga0495641_0056804 | 3300046461 | Bacteria | 1773 |
| 643 | Ga0495641_0057609 | 3300046461 | Bacteria | 1760 |
| 644 | Ga0495641_0064745 | 3300046461 | Bacteria | 1646 |
| 645 | Ga0495651_0000008 | 3300046462 | Bacteria | 156989 |
| 646 | Ga0495651_0035623 | 3300046462 | Bacteria | 3874 |
| 647 | Ga0495651_0042861 | 3300046462 | Bacteria | 3512 |
| 648 | Ga0495651_0056623 | 3300046462 | Bacteria | 3011 |
| 649 | Ga0495653_0032335 | 3300046463 | Bacteria | 4155 |
| 650 | Ga0495653_0035380 | 3300046463 | Bacteria | 3941 |
| 651 | Ga0495653_0047434 | 3300046463 | Bacteria | 3322 |
| 652 | Ga0495653_0170490 | 3300046463 | Bacteria | 1502 |
| 653 | Ga0495582_0001422 | 3300046473 | Bacteria | 13508 |
| 654 | Ga0495582_0014295 | 3300046473 | Bacteria | 4366 |
| 655 | Ga0495582_0016729 | 3300046473 | Bacteria | 4016 |
| 656 | Ga0495582_0044924 | 3300046473 | Bacteria | 2433 |
| 657 | Ga0495582_0100123 | 3300046473 | Bacteria | 1622 |
| 658 | Ga0495582_0130800 | 3300046473 | Unclassified | 1418 |
| 659 | Ga0495582_0172744 | 3300046473 | Unclassified | 1230 |
| 660 | Ga0495605_0019449 | 3300046474 | Bacteria | 3627 |
| 661 | Ga0495605_0019926 | 3300046474 | Bacteria | 3571 |
| 662 | Ga0495639_0001181 | 3300046475 | Bacteria | 11798 |
| 663 | Ga0495639_0004850 | 3300046475 | Bacteria | 5769 |
| 664 | Ga0495639_0047663 | 3300046475 | Bacteria | 1942 |
| 665 | Ga0495639_0066254 | 3300046475 | Unclassified | 1662 |
| 666 | Ga0495662_0003046 | 3300046476 | Bacteria | 8451 |
| 667 | Ga0495662_0037839 | 3300046476 | Bacteria | 2331 |
| 668 | Ga0495664_0027095 | 3300046477 | Bacteria | 3341 |
| 669 | Ga0495584_0010544 | 3300046491 | Bacteria | 4747 |
| 670 | Ga0495584_0072938 | 3300046491 | Bacteria | 1725 |
| 671 | Ga0495585_0131686 | 3300046492 | Unclassified | 1316 |
| 672 | Ga0495594_0001036 | 3300046499 | Bacteria | 14468 |
| 673 | Ga0495596_0071510 | 3300046500 | Unclassified | 1347 |
| 674 | Ga0495596_0073991 | 3300046500 | Unclassified | 1323 |
| 675 | Ga0495607_0088451 | 3300046501 | Bacteria | 1684 |
| 676 | Ga0495608_0002626 | 3300046511 | Bacteria | 12905 |
| 677 | Ga0495608_0011259 | 3300046511 | Bacteria | 6227 |
| 678 | Ga0495608_0039772 | 3300046511 | Bacteria | 3151 |
| 679 | Ga0495608_0115164 | 3300046511 | Bacteria | 1726 |
| 680 | Ga0495618_0006703 | 3300046514 | Bacteria | 6977 |
| 681 | Ga0495618_0032144 | 3300046514 | Bacteria | 3287 |
| 682 | Ga0495618_0117810 | 3300046514 | Unclassified | 1700 |
| 683 | Ga0495628_0000105 | 3300046516 | Bacteria | 68159 |
| 684 | Ga0495628_0001154 | 3300046516 | Bacteria | 24083 |
| 685 | Ga0495628_0005946 | 3300046516 | Bacteria | 10677 |
| 686 | Ga0495628_0028966 | 3300046516 | Bacteria | 4494 |
| 687 | Ga0495628_0172847 | 3300046516 | Bacteria | 1638 |
| 688 | Ga0495630_0003323 | 3300046517 | Bacteria | 11203 |
| 689 | Ga0495630_0014105 | 3300046517 | Bacteria | 5815 |
| 690 | Ga0495630_0024498 | 3300046517 | Bacteria | 4460 |
| 691 | Ga0495630_0031468 | 3300046517 | Bacteria | 3951 |
| 692 | Ga0495630_0143569 | 3300046517 | Bacteria | 1815 |
| 693 | Ga0495630_0155911 | 3300046517 | Bacteria | 1738 |
| 694 | Ga0495631_0071338 | 3300046518 | Bacteria | 1501 |
| 695 | Ga0495644_0004305 | 3300046523 | Bacteria | 5592 |
| 696 | Ga0495644_0032726 | 3300046523 | Unclassified | 1965 |
| 697 | Ga0495663_0011150 | 3300046525 | Bacteria | 2501 |
| 698 | Ga0495666_0099635 | 3300046526 | Bacteria | 1369 |
| 699 | Ga0495652_0000588 | 3300046529 | Bacteria | 42490 |
| 700 | Ga0495652_0007715 | 3300046529 | Bacteria | 9909 |
| 701 | Ga0495652_0077392 | 3300046529 | Bacteria | 2757 |
| 702 | Ga0495652_0124915 | 3300046529 | Bacteria | 2046 |
| 703 | Ga0495652_0124966 | 3300046529 | Bacteria | 2045 |
| 704 | Ga0495665_0002651 | 3300046531 | Bacteria | 9656 |
| 705 | Ga0495665_0020951 | 3300046531 | Bacteria | 3513 |
| 706 | Ga0495665_0036519 | 3300046531 | Bacteria | 2623 |
| 707 | Ga0495640_0012819 | 3300046533 | Bacteria | 6396 |
| 708 | Ga0495640_0026363 | 3300046533 | Bacteria | 4201 |
| 709 | Ga0495586_0057494 | 3300046535 | Bacteria | 2110 |
| 710 | Ga0495586_0070615 | 3300046535 | Bacteria | 1907 |
| 711 | Ga0495587_0000048 | 3300046536 | Bacteria | 105358 |
| 712 | Ga0495587_0019872 | 3300046536 | Bacteria | 4151 |
| 713 | Ga0495609_0014755 | 3300046538 | Bacteria | 3668 |
| 714 | Ga0495609_0037234 | 3300046538 | Bacteria | 2195 |
| 715 | Ga0495609_0064070 | 3300046538 | Bacteria | 1622 |
| 716 | Ga0495645_0000029 | 3300046543 | Bacteria | 113119 |
| 717 | Ga0495645_0018139 | 3300046543 | Bacteria | 5051 |
| 718 | Ga0495645_0057702 | 3300046543 | Bacteria | 2817 |
| 719 | Ga0495667_0005882 | 3300046559 | Bacteria | 8306 |
| 720 | Ga0495667_0016319 | 3300046559 | Bacteria | 5018 |
| 721 | Ga0495667_0037446 | 3300046559 | Bacteria | 3233 |
| 722 | Ga0495667_0048893 | 3300046559 | Bacteria | 2792 |
| 723 | Ga0495667_0081797 | 3300046559 | Bacteria | 2099 |
| 724 | Ga0495656_0017608 | 3300046615 | Bacteria | 2729 |
| 725 | Ga0495656_0058104 | 3300046615 | Bacteria | 1677 |
| 726 | Ga0495656_0096626 | 3300046615 | Bacteria | 1360 |
| 727 | Ga0495656_0103930 | 3300046615 | Bacteria | 1318 |
| 728 | Ga0495656_0113038 | 3300046615 | Bacteria | 1273 |
| 729 | Ga0495634_0021634 | 3300046642 | Bacteria | 4543 |
| 730 | Ga0495634_0029224 | 3300046642 | Bacteria | 3817 |
| 731 | Ga0495634_0048784 | 3300046642 | Bacteria | 2849 |
| 732 | Ga0495634_0071929 | 3300046642 | Bacteria | 2275 |
| 733 | Ga0495611_0123291 | 3300046648 | Bacteria | 1208 |
| 734 | Ga0495635_0047792 | 3300046663 | Bacteria | 2950 |
| 735 | Ga0495635_0074004 | 3300046663 | Bacteria | 2333 |
| 736 | Ga0495635_0105734 | 3300046663 | Unclassified | 1923 |
| 737 | Ga0495635_0126439 | 3300046663 | Bacteria | 1743 |
| 738 | Ga0495659_0042609 | 3300046664 | Bacteria | 1625 |
| 739 | Ga0495588_0000812 | 3300046674 | Bacteria | 13938 |
| 740 | Ga0495588_0041339 | 3300046674 | Bacteria | 2354 |
| 741 | Ga0495588_0056635 | 3300046674 | Bacteria | 2024 |
| 742 | Ga0495588_0063506 | 3300046674 | Bacteria | 1915 |
| 743 | Ga0495588_0122311 | 3300046674 | Bacteria | 1372 |
| 744 | Ga0495657_0015166 | 3300046675 | Bacteria | 5645 |
| 745 | Ga0495657_0033676 | 3300046675 | Bacteria | 3565 |
| 746 | Ga0495657_0046320 | 3300046675 | Bacteria | 2945 |
| 747 | Ga0495657_0107380 | 3300046675 | Bacteria | 1771 |
| 748 | Ga0495599_0000110 | 3300046678 | Bacteria | 55240 |
| 749 | Ga0495599_0000519 | 3300046678 | Bacteria | 22125 |
| 750 | Ga0495599_0011820 | 3300046678 | Bacteria | 5368 |
| 751 | Ga0495599_0093113 | 3300046678 | Bacteria | 1880 |
| 752 | Ga0495599_0177620 | 3300046678 | Bacteria | 1313 |
| 753 | Ga0495623_0005997 | 3300046679 | Bacteria | 7905 |
| 754 | Ga0495623_0033141 | 3300046679 | Bacteria | 3316 |
| 755 | Ga0495646_0005674 | 3300046680 | Bacteria | 7904 |
| 756 | Ga0495646_0009733 | 3300046680 | Bacteria | 6104 |
| 757 | Ga0495646_0022232 | 3300046680 | Bacteria | 4001 |
| 758 | Ga0495646_0094316 | 3300046680 | Bacteria | 1723 |
| 759 | Ga0495647_0013829 | 3300046681 | Bacteria | 2803 |
| 760 | Ga0495647_0041893 | 3300046681 | Bacteria | 1746 |
| 761 | Ga0495658_0000794 | 3300046683 | Bacteria | 17003 |
| 762 | Ga0495658_0017927 | 3300046683 | Bacteria | 3670 |
| 763 | Ga0495658_0069108 | 3300046683 | Bacteria | 2047 |
| 764 | Ga0495658_0117328 | 3300046683 | Bacteria | 1606 |
| 765 | Ga0495669_0015201 | 3300046684 | Bacteria | 3295 |
| 766 | Ga0495613_0014803 | 3300046689 | Bacteria | 5789 |
| 767 | Ga0495613_0048055 | 3300046689 | Bacteria | 3151 |
| 768 | Ga0495613_0117332 | 3300046689 | Bacteria | 1914 |
| 769 | Ga0495613_0169103 | 3300046689 | Bacteria | 1552 |
| 770 | Ga0495624_0010504 | 3300046690 | Bacteria | 6383 |
| 771 | Ga0495624_0013790 | 3300046690 | Bacteria | 5504 |
| 772 | Ga0495624_0019028 | 3300046690 | Bacteria | 4587 |
| 773 | Ga0495624_0031523 | 3300046690 | Bacteria | 3444 |
| 774 | Ga0495624_0087499 | 3300046690 | Bacteria | 1924 |
| 775 | Ga0495589_0008261 | 3300046794 | Bacteria | 5436 |
| 776 | Ga0495581_0000542 | 3300047315 | Bacteria | 19446 |
| 777 | Ga0495581_0002109 | 3300047315 | Bacteria | 11206 |
| 778 | Ga0495581_0017160 | 3300047315 | Bacteria | 4207 |
| 779 | Ga0495581_0037888 | 3300047315 | Bacteria | 2790 |
| 780 | Ga0495581_0088403 | 3300047315 | Unclassified | 1796 |
| 781 | Ga0495604_0000238 | 3300047317 | Bacteria | 49191 |
| 782 | Ga0495604_0060369 | 3300047317 | Bacteria | 2904 |
| 783 | Ga0495604_0089930 | 3300047317 | Bacteria | 2281 |
| 784 | Ga0495604_0098303 | 3300047317 | Bacteria | 2157 |
| 785 | Ga0495674_0000010 | 3300047319 | Bacteria | 285794 |
| 786 | Ga0495674_0004125 | 3300047319 | Bacteria | 14022 |
| 787 | Ga0495674_0128255 | 3300047319 | Bacteria | 2138 |
| 788 | Ga0495674_0161788 | 3300047319 | Bacteria | 1872 |
| 789 | Ga0495674_0192849 | 3300047319 | Bacteria | 1692 |
| 790 | Ga0495674_0224870 | 3300047319 | Bacteria | 1550 |
| 791 | Ga0495676_0000583 | 3300047321 | Bacteria | 30065 |
| 792 | Ga0495676_0006975 | 3300047321 | Bacteria | 10367 |
| 793 | Ga0495676_0037005 | 3300047321 | Bacteria | 4068 |
| 794 | Ga0495676_0039278 | 3300047321 | Bacteria | 3922 |
| 795 | Ga0495676_0138506 | 3300047321 | Bacteria | 1746 |
| 796 | Ga0495676_0243398 | 3300047321 | Unclassified | 1230 |
| 797 | Ga0495680_0008735 | 3300047322 | Bacteria | 9180 |
| 798 | Ga0495680_0009703 | 3300047322 | Bacteria | 8640 |
| 799 | Ga0495680_0013633 | 3300047322 | Bacteria | 7081 |
| 800 | Ga0495680_0015897 | 3300047322 | Bacteria | 6478 |
| 801 | Ga0495680_0036403 | 3300047322 | Bacteria | 3951 |
| 802 | Ga0495680_0045794 | 3300047322 | Bacteria | 3452 |
| 803 | Ga0495680_0071934 | 3300047322 | Bacteria | 2631 |
| 804 | Ga0495675_0000262 | 3300047444 | Bacteria | 38243 |
| 805 | Ga0495675_0040368 | 3300047444 | Bacteria | 2974 |
| 806 | Ga0495675_0059149 | 3300047444 | Bacteria | 2430 |
| 807 | Ga0495685_006549 | 3300047447 | Bacteria | 3819 |
| 808 | Ga0495684_0025947 | 3300047471 | Bacteria | 4503 |
| 809 | Ga0495684_0049834 | 3300047471 | Bacteria | 3199 |
| 810 | Ga0495684_0104422 | 3300047471 | Bacteria | 2141 |
| 811 | Ga0495684_0136233 | 3300047471 | Unclassified | 1842 |
| 812 | Ga0495684_0140403 | 3300047471 | Bacteria | 1811 |
| 813 | Ga0495593_0003361 | 3300047673 | Bacteria | 9583 |
| 814 | Ga0495593_0034402 | 3300047673 | Bacteria | 2756 |
| 815 | Ga0495602_0010209 | 3300048088 | Bacteria | 9746 |
| 816 | Ga0495602_0011469 | 3300048088 | Bacteria | 9161 |
| 817 | Ga0495602_0113494 | 3300048088 | Bacteria | 2196 |
| 818 | Ga0495614_0010208 | 3300048089 | Bacteria | 4142 |
| 819 | Ga0495614_0025966 | 3300048089 | Bacteria | 2524 |
| 820 | Ga0496100_0106876 | 3300048903 | Bacteria | 1938 |
| 821 | Ga0496100_0194447 | 3300048903 | Bacteria | 1475 |
| 822 | Ga0496100_0266603 | 3300048903 | Bacteria | 1272 |
| 823 | Ga0496101_0026233 | 3300048904 | Bacteria | 4050 |
| 824 | Ga0496101_0028279 | 3300048904 | Bacteria | 3913 |
| 825 | Ga0496101_0065408 | 3300048904 | Bacteria | 2650 |
| 826 | Ga0496101_0091491 | 3300048904 | Bacteria | 2264 |
| 827 | Ga0496101_0119174 | 3300048904 | Bacteria | 1994 |
| 828 | Ga0496101_0153046 | 3300048904 | Bacteria | 1765 |
| 829 | Ga0496101_0163244 | 3300048904 | Bacteria | 1710 |
| 830 | Ga0496102_0005140 | 3300048905 | Bacteria | 11098 |
| 831 | Ga0496102_0023351 | 3300048905 | Bacteria | 5492 |
| 832 | Ga0496102_0070584 | 3300048905 | Bacteria | 3207 |
| 833 | Ga0496103_0009187 | 3300048906 | Bacteria | 5854 |
| 834 | Ga0496103_0031627 | 3300048906 | Bacteria | 3226 |
| 835 | Ga0496103_0041804 | 3300048906 | Bacteria | 2819 |
| 836 | Ga0496103_0087976 | 3300048906 | Bacteria | 1959 |
| 837 | Ga0496104_0000015 | 3300048907 | Bacteria | 374530 |
| 838 | Ga0496104_0000133 | 3300048907 | Bacteria | 69099 |
| 839 | Ga0496104_0000699 | 3300048907 | Bacteria | 28859 |
| 840 | Ga0496104_0001337 | 3300048907 | Bacteria | 21325 |
| 841 | Ga0496104_0003803 | 3300048907 | Bacteria | 13056 |
| 842 | Ga0496104_0004726 | 3300048907 | Bacteria | 11856 |
| 843 | Ga0496104_0005710 | 3300048907 | Bacteria | 10887 |
| 844 | Ga0496104_0012539 | 3300048907 | Bacteria | 7625 |
| 845 | Ga0496104_0018592 | 3300048907 | Bacteria | 6342 |
| 846 | Ga0496104_0058648 | 3300048907 | Bacteria | 3644 |
| 847 | Ga0496104_0062778 | 3300048907 | Bacteria | 3523 |
| 848 | Ga0496104_0093560 | 3300048907 | Bacteria | 2875 |
| 849 | Ga0496105_0000004 | 3300048908 | Bacteria | 475798 |
| 850 | Ga0496105_0000148 | 3300048908 | Bacteria | 46239 |
| 851 | Ga0496105_0000595 | 3300048908 | Bacteria | 24079 |
| 852 | Ga0496105_0003041 | 3300048908 | Bacteria | 12333 |
| 853 | Ga0496105_0005142 | 3300048908 | Bacteria | 9921 |
| 854 | Ga0496105_0020909 | 3300048908 | Bacteria | 5292 |
| 855 | Ga0496105_0027281 | 3300048908 | Bacteria | 4663 |
| 856 | Ga0496105_0031958 | 3300048908 | Bacteria | 4316 |
| 857 | Ga0496105_0084535 | 3300048908 | Bacteria | 2621 |
| 858 | Ga0496106_0006351 | 3300048909 | Bacteria | 8756 |
| 859 | Ga0496106_0016234 | 3300048909 | Bacteria | 5508 |
| 860 | Ga0496106_0026150 | 3300048909 | Bacteria | 4343 |
| 861 | Ga0496106_0070837 | 3300048909 | Bacteria | 2663 |
| 862 | Ga0496106_0113253 | 3300048909 | Bacteria | 2114 |
| 863 | Ga0496106_0160270 | 3300048909 | Bacteria | 1779 |
| 864 | Ga0496107_0004496 | 3300048910 | Bacteria | 9458 |
| 865 | Ga0496107_0017662 | 3300048910 | Bacteria | 5018 |
| 866 | Ga0496107_0059618 | 3300048910 | Bacteria | 2762 |
| 867 | Ga0496107_0066587 | 3300048910 | Bacteria | 2612 |
| 868 | Ga0496108_0000272 | 3300048911 | Bacteria | 44414 |
| 869 | Ga0496108_0012780 | 3300048911 | Bacteria | 6836 |
| 870 | Ga0496108_0037741 | 3300048911 | Bacteria | 4025 |
| 871 | Ga0496108_0067233 | 3300048911 | Bacteria | 3022 |
| 872 | Ga0496108_0096255 | 3300048911 | Bacteria | 2521 |
| 873 | Ga0496108_0104882 | 3300048911 | Bacteria | 2413 |
| 874 | Ga0496108_0121102 | 3300048911 | Bacteria | 2244 |
| 875 | Ga0496109_0000578 | 3300048912 | Bacteria | 30715 |
| 876 | Ga0496109_0000993 | 3300048912 | Bacteria | 23393 |
| 877 | Ga0496109_0001933 | 3300048912 | Bacteria | 17222 |
| 878 | Ga0496109_0022810 | 3300048912 | Bacteria | 5546 |
| 879 | Ga0496109_0024331 | 3300048912 | Bacteria | 5383 |
| 880 | Ga0496109_0039781 | 3300048912 | Bacteria | 4257 |
| 881 | Ga0496109_0057043 | 3300048912 | Bacteria | 3563 |
| 882 | Ga0496109_0093185 | 3300048912 | Bacteria | 2787 |
| 883 | Ga0496109_0198673 | 3300048912 | Bacteria | 1885 |
| 884 | Ga0496109_0346906 | 3300048912 | Unclassified | 1402 |
| 885 | Ga0496110_0000746 | 3300048913 | Bacteria | 22474 |
| 886 | Ga0496110_0002158 | 3300048913 | Bacteria | 14684 |
| 887 | Ga0496110_0011829 | 3300048913 | Bacteria | 7165 |
| 888 | Ga0496110_0056199 | 3300048913 | Bacteria | 3463 |
| 889 | Ga0496110_0076452 | 3300048913 | Bacteria | 2977 |
| 890 | Ga0496110_0111152 | 3300048913 | Bacteria | 2463 |
| 891 | Ga0496110_0174667 | 3300048913 | Unclassified | 1950 |
| 892 | Ga0496110_0211495 | 3300048913 | Unclassified | 1763 |
| 893 | Ga0496110_0392667 | 3300048913 | Bacteria | 1265 |
| 894 | Ga0496111_0000499 | 3300048914 | Bacteria | 20270 |
| 895 | Ga0496111_0016234 | 3300048914 | Bacteria | 5130 |
| 896 | Ga0496111_0027056 | 3300048914 | Bacteria | 4054 |
| 897 | Ga0496111_0033102 | 3300048914 | Bacteria | 3686 |
| 898 | Ga0496111_0058869 | 3300048914 | Bacteria | 2782 |
| 899 | Ga0496111_0062583 | 3300048914 | Bacteria | 2699 |
| 900 | Ga0496111_0161895 | 3300048914 | Bacteria | 1662 |
| 901 | Ga0496112_0001182 | 3300048915 | Bacteria | 19571 |
| 902 | Ga0496112_0020408 | 3300048915 | Bacteria | 6281 |
| 903 | Ga0496112_0021074 | 3300048915 | Bacteria | 6191 |
| 904 | Ga0496112_0028772 | 3300048915 | Bacteria | 5368 |
| 905 | Ga0496112_0060665 | 3300048915 | Bacteria | 3727 |
| 906 | Ga0496112_0096105 | 3300048915 | Bacteria | 2933 |
| 907 | Ga0496112_0137566 | 3300048915 | Bacteria | 2412 |
| 908 | Ga0496112_0161566 | 3300048915 | Bacteria | 2207 |
| 909 | Ga0496112_0264118 | 3300048915 | Bacteria | 1670 |
| 910 | Ga0496112_0488156 | 3300048915 | Bacteria | 1168 |
| 911 | Ga0496113_0000040 | 3300048916 | Bacteria | 55517 |
| 912 | Ga0496113_0004976 | 3300048916 | Bacteria | 8237 |
| 913 | Ga0496113_0029360 | 3300048916 | Bacteria | 3970 |
| 914 | Ga0496113_0037313 | 3300048916 | Bacteria | 3565 |
| 915 | Ga0496113_0047236 | 3300048916 | Bacteria | 3199 |
| 916 | Ga0496113_0118181 | 3300048916 | Bacteria | 2070 |
| 917 | Ga0496113_0178938 | 3300048916 | Bacteria | 1681 |
| 918 | Ga0496113_0219786 | 3300048916 | Bacteria | 1514 |
| 919 | Ga0496114_0003196 | 3300048917 | Bacteria | 12564 |
| 920 | Ga0496114_0003379 | 3300048917 | Bacteria | 12253 |
| 921 | Ga0496114_0030568 | 3300048917 | Bacteria | 4432 |
| 922 | Ga0496114_0039640 | 3300048917 | Bacteria | 3898 |
| 923 | Ga0496114_0071680 | 3300048917 | Bacteria | 2912 |
| 924 | Ga0496114_0072002 | 3300048917 | Bacteria | 2906 |
| 925 | Ga0496114_0132058 | 3300048917 | Bacteria | 2157 |
| 926 | Ga0496114_0174442 | 3300048917 | Unclassified | 1875 |
| 927 | Ga0496114_0251776 | 3300048917 | Unclassified | 1554 |
| 928 | Ga0496115_0017242 | 3300048918 | Bacteria | 5514 |
| 929 | Ga0496115_0057656 | 3300048918 | Bacteria | 3124 |
| 930 | Ga0496115_0069990 | 3300048918 | Bacteria | 2843 |
| 931 | Ga0496115_0070347 | 3300048918 | Bacteria | 2836 |
| 932 | Ga0496115_0183991 | 3300048918 | Bacteria | 1726 |
| 933 | Ga0496119_0019718 | 3300048922 | Bacteria | 4950 |
| 934 | Ga0501031_0027314 | 3300049568 | Bacteria | 3721 |
| 935 | Ga0501039_0016924 | 3300049575 | Bacteria | 5588 |
| 936 | Ga0501040_0022023 | 3300049576 | Bacteria | 4262 |
| 937 | Ga0501040_0155730 | 3300049576 | Bacteria | 1613 |
| 938 | Ga0501041_0164474 | 3300049577 | Bacteria | 1387 |
| 939 | Ga0501043_0009300 | 3300049579 | Bacteria | 7720 |
| 940 | Ga0501046_0110657 | 3300049580 | Bacteria | 2098 |
| 941 | Ga0501067_0003396 | 3300049583 | Bacteria | 8761 |
| 942 | Ga0501067_0016859 | 3300049583 | Bacteria | 4034 |
| 943 | Ga0501067_0087822 | 3300049583 | Bacteria | 1725 |
| 944 | Ga0501067_0096979 | 3300049583 | Unclassified | 1637 |
| 945 | Ga0501068_0001181 | 3300049584 | Bacteria | 13899 |
| 946 | Ga0501069_0002399 | 3300049585 | Bacteria | 9513 |
| 947 | Ga0501069_0016467 | 3300049585 | Bacteria | 3973 |
| 948 | Ga0501069_0016640 | 3300049585 | Bacteria | 3952 |
| 949 | Ga0501069_0022584 | 3300049585 | Bacteria | 3424 |
| 950 | Ga0501069_0027636 | 3300049585 | Bacteria | 3109 |
| 951 | Ga0501070_0008509 | 3300049586 | Bacteria | 8672 |
| 952 | Ga0501070_0010395 | 3300049586 | Bacteria | 7867 |
| 953 | Ga0501070_0014204 | 3300049586 | Bacteria | 6700 |
| 954 | Ga0501070_0089951 | 3300049586 | Bacteria | 2541 |
| 955 | Ga0501071_0018729 | 3300049587 | Bacteria | 4800 |
| 956 | Ga0501071_0127219 | 3300049587 | Bacteria | 1891 |
| 957 | Ga0501072_0083731 | 3300049588 | Bacteria | 2528 |
| 958 | Ga0501072_0150155 | 3300049588 | Bacteria | 1858 |
| 959 | Ga0501074_0017874 | 3300049590 | Bacteria | 5152 |
| 960 | Ga0501076_0011754 | 3300049592 | Bacteria | 6535 |
| 961 | Ga0501077_0043666 | 3300049593 | Bacteria | 2848 |
| 962 | Ga0501079_0021128 | 3300049741 | Bacteria | 4976 |
| 963 | Ga0501081_0004576 | 3300049743 | Bacteria | 8880 |
| 964 | Ga0501083_0025552 | 3300049744 | Bacteria | 4089 |
| 965 | Ga0501045_0010111 | 3300049824 | Bacteria | 6603 |
| 966 | Ga0501045_0093128 | 3300049824 | Bacteria | 2228 |
| 967 | nmdc:mga05p37_148675_c1 | 3300050507 | Bacteria | 2867 |
| 968 | nmdc:mga05p37_1648_c1 | 3300050507 | Bacteria | 25906 |
| 969 | nmdc:mga05p37_4144_c2 | 3300050507 | Bacteria | 16203 |
| 970 | nmdc:mga05p37_45059_c1 | 3300050507 | Bacteria | 5426 |
| 971 | nmdc:mga05p37_53795_c1 | 3300050507 | Bacteria | 4952 |
| 972 | nmdc:mga09592_135586_c1 | 3300050508 | Bacteria | 2120 |
| 973 | nmdc:mga09592_195461_c1 | 3300050508 | Bacteria | 1751 |
| 974 | nmdc:mga0qj67_65425_c1 | 3300050509 | Bacteria | 2894 |
| 975 | nmdc:mga06r32_11086_c1 | 3300050510 | Bacteria | 8114 |
| 976 | nmdc:mga08y16_141052_c1 | 3300050511 | Unclassified | 2505 |
| 977 | nmdc:mga08y16_19969_c1 | 3300050511 | Bacteria | 7070 |
| 978 | nmdc:mga08y16_284641_c1 | 3300050511 | Bacteria | 1705 |
| 979 | nmdc:mga0n895_13560_c1 | 3300050512 | Bacteria | 7362 |
| 980 | nmdc:mga0n895_144310_c1 | 3300050512 | Bacteria | 2410 |
| 981 | nmdc:mga0n895_217996_c1 | 3300050512 | Bacteria | 1938 |
| 982 | nmdc:mga0n895_29458_c1 | 3300050512 | Bacteria | 5237 |
| 983 | nmdc:mga0rr50_12711_c1 | 3300050513 | Bacteria | 5453 |
| 984 | nmdc:mga0rr50_13489_c1 | 3300050513 | Bacteria | 5322 |
| 985 | nmdc:mga0rr50_38904_c1 | 3300050513 | Bacteria | 3446 |
| 986 | nmdc:mga0rr50_55552_c1 | 3300050513 | Bacteria | 2955 |
| 987 | nmdc:mga0rr50_78467_c1 | 3300050513 | Bacteria | 2541 |
| 988 | nmdc:mga08x19_2647_c1 | 3300050514 | Bacteria | 10831 |
| 989 | nmdc:mga0a205_120264_c1 | 3300050515 | Bacteria | 2526 |
| 990 | nmdc:mga0a205_247804_c1 | 3300050515 | Bacteria | 1661 |
| 991 | nmdc:mga0a205_252300_c1 | 3300050515 | Bacteria | 1643 |
| 992 | nmdc:mga0a205_55410_c1 | 3300050515 | Bacteria | 3830 |
| 993 | nmdc:mga0a205_68871_c1 | 3300050515 | Bacteria | 3418 |
| 994 | nmdc:mga0a205_89899_c1 | 3300050515 | Bacteria | 2968 |
| 995 | nmdc:mga0a205_9936_c1 | 3300050515 | Bacteria | 8729 |
| 996 | Ga0495601_0007612 | 3300053077 | Bacteria | 6360 |
| 997 | Ga0495601_0007870 | 3300053077 | Bacteria | 6276 |
| 998 | Ga0495601_0039693 | 3300053077 | Bacteria | 2948 |
| 999 | Ga0495601_0041154 | 3300053077 | Bacteria | 2896 |
| 1000 | Ga0495601_0108271 | 3300053077 | Bacteria | 1798 |
| 1001 | Ga0495601_0140940 | 3300053077 | Bacteria | 1572 |
| 1002 | Ga0495612_0012979 | 3300053078 | Bacteria | 3356 |
| 1003 | Ga0495612_0021217 | 3300053078 | Unclassified | 2606 |
| 1004 | Ga0495612_0021410 | 3300053078 | Bacteria | 2594 |
| 1005 | Ga0495595_0004929 | 3300053084 | Bacteria | 5384 |
| 1006 | Ga0495595_0022765 | 3300053084 | Bacteria | 2753 |
| 1007 | Ga0495595_0026387 | 3300053084 | Bacteria | 2581 |
| 1008 | Ga0495619_0000507 | 3300053085 | Bacteria | 25923 |
| 1009 | Ga0495619_0001017 | 3300053085 | Bacteria | 18372 |
| 1010 | Ga0495619_0002571 | 3300053085 | Bacteria | 11864 |
| 1011 | Ga0495619_0007865 | 3300053085 | Bacteria | 6745 |
| 1012 | Ga0495619_0012980 | 3300053085 | Bacteria | 5249 |
| 1013 | Ga0495619_0034749 | 3300053085 | Bacteria | 3277 |
| 1014 | Ga0500566_0045228 | 3300053094 | Bacteria | 2535 |
| 1015 | Ga0501084_0151623 | 3300054114 | Unclassified | 1954 |
| 1016 | Ga0501084_0222004 | 3300054114 | Bacteria | 1594 |
| 1017 | Ga0466962_0004473 | 3300061719 | Bacteria | 6699 |
| 1018 | Ga0466962_0021951 | 3300061719 | Bacteria | 3065 |
| 1019 | Ga0530510_0030809 | 3300061734 | Bacteria | 3854 |
| 1020 | Ga0530510_0113514 | 3300061734 | Bacteria | 1986 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013306 | Ga0163162_10026922 | Ga0163162_100269225 | 292 |
| 2 | 3300047444 | Ga0495675_0040368 | Ga0495675_0040368_1016_1936 | 305 |
| 3 | 3300025904 | Ga0207647_10154597 | Ga0207647_101545971 | 310 |
| 4 | 3300037466 | Ga0395898_0600040 | Ga0395898_0600040_15_968 | 315 |
| 5 | 3300009098 | Ga0105245_10003086 | Ga0105245_1000308610 | 323 |
| 6 | 3300048917 | Ga0496114_0174442 | Ga0496114_0174442_322_1323 | 323 |
| 7 | 3300025927 | Ga0207687_10166619 | Ga0207687_101666192 | 333 |
| 8 | 3300025906 | Ga0207699_10081352 | Ga0207699_100813523 | 336 |
| 9 | 3300020070 | Ga0206356_11233245 | Ga0206356_112332451 | 338 |
| 10 | 3300025910 | Ga0207684_10312577 | Ga0207684_103125771 | 338 |
| 11 | 3300046615 | Ga0495656_0113038 | Ga0495656_0113038_228_1253 | 338 |
| 12 | 3300048903 | Ga0496100_0266603 | Ga0496100_0266603_237_1259 | 338 |
| 13 | 3300038443 | Ga0395901_0241094 | Ga0395901_0241094_164_1297 | 339 |
| 14 | 3300048908 | Ga0496105_0027281 | Ga0496105_0027281_2764_3795 | 340 |
| 15 | 3300061734 | Ga0530510_0113514 | Ga0530510_0113514_287_1327 | 343 |
| 16 | 3300005327 | Ga0070658_10010832 | Ga0070658_100108328 | 344 |
| 17 | 3300005339 | Ga0070660_100005923 | Ga0070660_1000059234 | 344 |
| 18 | 3300013100 | Ga0157373_10145747 | Ga0157373_101457472 | 344 |
| 19 | 3300046475 | Ga0495639_0066254 | Ga0495639_0066254_585_1631 | 345 |
| 20 | 3300048913 | Ga0496110_0392667 | Ga0496110_0392667_141_1190 | 345 |
| 21 | 3300049583 | Ga0501067_0016859 | Ga0501067_0016859_935_2047 | 345 |
| 22 | 3300049585 | Ga0501069_0022584 | Ga0501069_0022584_1092_2204 | 345 |
| 23 | 3300049586 | Ga0501070_0089951 | Ga0501070_0089951_700_1812 | 345 |
| 24 | 3300061734 | Ga0530510_0030809 | Ga0530510_0030809_1331_2443 | 345 |
| 25 | 3300005436 | Ga0070713_100089869 | Ga0070713_1000898692 | 346 |
| 26 | 3300006028 | Ga0070717_10037914 | Ga0070717_100379143 | 346 |
| 27 | 3300025928 | Ga0207700_10169436 | Ga0207700_101694362 | 346 |
| 28 | 3300025929 | Ga0207664_10083264 | Ga0207664_100832641 | 346 |
| 29 | 3300005564 | Ga0070664_100239925 | Ga0070664_1002399252 | 350 |
| 30 | 3300005981 | Ga0081538_10053605 | Ga0081538_100536053 | 350 |
| 31 | 3300005456 | Ga0070678_100027211 | Ga0070678_1000272113 | 353 |
| 32 | 3300026121 | Ga0207683_10012321 | Ga0207683_100123216 | 353 |
| 33 | 3300028563 | Ga0265319_1000592 | Ga0265319_100059212 | 353 |
| 34 | 3300028577 | Ga0265318_10005482 | Ga0265318_100054824 | 353 |
| 35 | 3300028800 | Ga0265338_10007029 | Ga0265338_1000702910 | 353 |
| 36 | 3300031240 | Ga0265320_10051332 | Ga0265320_100513323 | 353 |
| 37 | 3300031344 | Ga0265316_10012119 | Ga0265316_100121197 | 353 |
| 38 | 3300031712 | Ga0265342_10045680 | Ga0265342_100456803 | 353 |
| 39 | 3300005436 | Ga0070713_100058191 | Ga0070713_1000581912 | 355 |
| 40 | 3300005458 | Ga0070681_10103021 | Ga0070681_101030213 | 355 |
| 41 | 3300005535 | Ga0070684_100033850 | Ga0070684_1000338502 | 355 |
| 42 | 3300005564 | Ga0070664_100180277 | Ga0070664_1001802772 | 355 |
| 43 | 3300025945 | Ga0207679_10138480 | Ga0207679_101384802 | 355 |
| 44 | 3300044694 | Ga0466963_0004245 | Ga0466963_0004245_4284_5366 | 355 |
| 45 | 3300044694 | Ga0466963_0011880 | Ga0466963_0011880_1901_2983 | 355 |
| 46 | 3300044694 | Ga0466963_0081131 | Ga0466963_0081131_529_1611 | 355 |
| 47 | 3300044706 | Ga0466964_0017735 | Ga0466964_0017735_392_1474 | 355 |
| 48 | 3300044765 | Ga0466970_0160736 | Ga0466970_0160736_36_1118 | 355 |
| 49 | 3300045836 | Ga0466958_0000988 | Ga0466958_0000988_9921_11003 | 355 |
| 50 | 3300045976 | Ga0466967_0031978 | Ga0466967_0031978_457_1539 | 355 |
| 51 | 3300046455 | Ga0495603_0014127 | Ga0495603_0014127_745_1827 | 355 |
| 52 | 3300046473 | Ga0495582_0044924 | Ga0495582_0044924_106_1188 | 355 |
| 53 | 3300046664 | Ga0495659_0042609 | Ga0495659_0042609_222_1310 | 355 |
| 54 | 3300046683 | Ga0495658_0069108 | Ga0495658_0069108_292_1374 | 355 |
| 55 | 3300047322 | Ga0495680_0036403 | Ga0495680_0036403_344_1453 | 355 |
| 56 | 3300053077 | Ga0495601_0108271 | Ga0495601_0108271_300_1409 | 355 |
| 57 | 3300005347 | Ga0070668_100088205 | Ga0070668_1000882052 | 356 |
| 58 | 3300005367 | Ga0070667_100009302 | Ga0070667_1000093024 | 356 |
| 59 | 3300005435 | Ga0070714_100058112 | Ga0070714_1000581122 | 356 |
| 60 | 3300005435 | Ga0070714_100244341 | Ga0070714_1002443412 | 356 |
| 61 | 3300005436 | Ga0070713_100043207 | Ga0070713_1000432071 | 356 |
| 62 | 3300005844 | Ga0068862_100001367 | Ga0068862_10000136715 | 356 |
| 63 | 3300006028 | Ga0070717_10301524 | Ga0070717_103015242 | 356 |
| 64 | 3300009553 | Ga0105249_10034961 | Ga0105249_100349612 | 356 |
| 65 | 3300025915 | Ga0207693_10047648 | Ga0207693_100476484 | 356 |
| 66 | 3300025928 | Ga0207700_10064336 | Ga0207700_100643364 | 356 |
| 67 | 3300025929 | Ga0207664_10073207 | Ga0207664_100732072 | 356 |
| 68 | 3300025961 | Ga0207712_10024209 | Ga0207712_100242092 | 356 |
| 69 | 3300025972 | Ga0207668_10101007 | Ga0207668_101010072 | 356 |
| 70 | 3300028380 | Ga0268265_10003678 | Ga0268265_100036784 | 356 |
| 71 | 3300028556 | Ga0265337_1025219 | Ga0265337_10252192 | 356 |
| 72 | 3300028577 | Ga0265318_10043101 | Ga0265318_100431012 | 356 |
| 73 | 3300028800 | Ga0265338_10034817 | Ga0265338_100348174 | 356 |
| 74 | 3300031250 | Ga0265331_10020343 | Ga0265331_100203435 | 356 |
| 75 | 3300031711 | Ga0265314_10031419 | Ga0265314_100314193 | 356 |
| 76 | 3300038443 | Ga0395901_0146551 | Ga0395901_0146551_729_1835 | 356 |
| 77 | 3300044683 | Ga0466965_0004578 | Ga0466965_0004578_1449_2534 | 356 |
| 78 | 3300044694 | Ga0466963_0035060 | Ga0466963_0035060_389_1474 | 356 |
| 79 | 3300044735 | Ga0466968_0031417 | Ga0466968_0031417_773_1858 | 356 |
| 80 | 3300045976 | Ga0466967_0054362 | Ga0466967_0054362_1809_2891 | 356 |
| 81 | 3300045976 | Ga0466967_0111660 | Ga0466967_0111660_249_1334 | 356 |
| 82 | 3300050511 | nmdc:mga08y16_141052_c1 | nmdc:mga08y16_141052_c1_1413_2492 | 356 |
| 83 | 3300005937 | Ga0081455_10005820 | Ga0081455_100058204 | 357 |
| 84 | 3300037418 | Ga0395900_0227670 | Ga0395900_0227670_417_1562 | 357 |
| 85 | 3300046511 | Ga0495608_0002626 | Ga0495608_0002626_6191_7309 | 357 |
| 86 | 3300044693 | Ga0466961_0004260 | Ga0466961_0004260_834_1925 | 358 |
| 87 | 3300005614 | Ga0068856_100076900 | Ga0068856_1000769002 | 359 |
| 88 | 3300044694 | Ga0466963_0002868 | Ga0466963_0002868_2727_3845 | 359 |
| 89 | 3300048912 | Ga0496109_0346906 | Ga0496109_0346906_121_1206 | 359 |
| 90 | 3300048913 | Ga0496110_0174667 | Ga0496110_0174667_344_1462 | 359 |
| 91 | 3300048913 | Ga0496110_0211495 | Ga0496110_0211495_248_1333 | 359 |
| 92 | 3300048915 | Ga0496112_0028772 | Ga0496112_0028772_3733_4818 | 359 |
| 93 | 3300049583 | Ga0501067_0087822 | Ga0501067_0087822_198_1283 | 359 |
| 94 | 3300049585 | Ga0501069_0016640 | Ga0501069_0016640_1733_2818 | 359 |
| 95 | 3300046516 | Ga0495628_0001154 | Ga0495628_0001154_2894_4003 | 360 |
| 96 | 3300048914 | Ga0496111_0161895 | Ga0496111_0161895_149_1237 | 360 |
| 97 | 3300048917 | Ga0496114_0132058 | Ga0496114_0132058_429_1517 | 360 |
| 98 | 3300005367 | Ga0070667_100178778 | Ga0070667_1001787782 | 361 |
| 99 | 3300025986 | Ga0207658_10045246 | Ga0207658_100452463 | 361 |
| 100 | 3300037312 | Ga0395899_0016341 | Ga0395899_0016341_1966_3069 | 362 |
| 101 | 3300005336 | Ga0070680_100115905 | Ga0070680_1001159052 | 363 |
| 102 | 3300005366 | Ga0070659_100071877 | Ga0070659_1000718772 | 363 |
| 103 | 3300005434 | Ga0070709_10095217 | Ga0070709_100952172 | 363 |
| 104 | 3300005435 | Ga0070714_100029254 | Ga0070714_1000292545 | 363 |
| 105 | 3300005435 | Ga0070714_100099389 | Ga0070714_1000993893 | 363 |
| 106 | 3300005437 | Ga0070710_10012734 | Ga0070710_100127345 | 363 |
| 107 | 3300005439 | Ga0070711_100051343 | Ga0070711_1000513433 | 363 |
| 108 | 3300005458 | Ga0070681_10045320 | Ga0070681_100453204 | 363 |
| 109 | 3300005458 | Ga0070681_10212509 | Ga0070681_102125092 | 363 |
| 110 | 3300005467 | Ga0070706_100122830 | Ga0070706_1001228302 | 363 |
| 111 | 3300005471 | Ga0070698_100192258 | Ga0070698_1001922582 | 363 |
| 112 | 3300005530 | Ga0070679_100064484 | Ga0070679_1000644843 | 363 |
| 113 | 3300005530 | Ga0070679_100159956 | Ga0070679_1001599563 | 363 |
| 114 | 3300005546 | Ga0070696_100232270 | Ga0070696_1002322701 | 363 |
| 115 | 3300005563 | Ga0068855_100083393 | Ga0068855_1000833932 | 363 |
| 116 | 3300005564 | Ga0070664_100143570 | Ga0070664_1001435702 | 363 |
| 117 | 3300005614 | Ga0068856_100196648 | Ga0068856_1001966482 | 363 |
| 118 | 3300005614 | Ga0068856_100235155 | Ga0068856_1002351552 | 363 |
| 119 | 3300005937 | Ga0081455_10035655 | Ga0081455_100356555 | 363 |
| 120 | 3300006028 | Ga0070717_10101499 | Ga0070717_101014992 | 363 |
| 121 | 3300006175 | Ga0070712_100090282 | Ga0070712_1000902822 | 363 |
| 122 | 3300006871 | Ga0075434_100181318 | Ga0075434_1001813183 | 363 |
| 123 | 3300009094 | Ga0111539_10051846 | Ga0111539_100518465 | 363 |
| 124 | 3300009551 | Ga0105238_10150945 | Ga0105238_101509452 | 363 |
| 125 | 3300013105 | Ga0157369_10039852 | Ga0157369_100398525 | 363 |
| 126 | 3300014497 | Ga0182008_10005743 | Ga0182008_100057438 | 363 |
| 127 | 3300025909 | Ga0207705_10063948 | Ga0207705_100639483 | 363 |
| 128 | 3300025915 | Ga0207693_10000945 | Ga0207693_1000094523 | 363 |
| 129 | 3300025915 | Ga0207693_10112782 | Ga0207693_101127822 | 363 |
| 130 | 3300025919 | Ga0207657_10003731 | Ga0207657_1000373110 | 363 |
| 131 | 3300025922 | Ga0207646_10002421 | Ga0207646_1000242110 | 363 |
| 132 | 3300025924 | Ga0207694_10064076 | Ga0207694_100640762 | 363 |
| 133 | 3300025927 | Ga0207687_10066707 | Ga0207687_100667073 | 363 |
| 134 | 3300025929 | Ga0207664_10060285 | Ga0207664_100602853 | 363 |
| 135 | 3300025929 | Ga0207664_10247239 | Ga0207664_102472391 | 363 |
| 136 | 3300025929 | Ga0207664_10394379 | Ga0207664_103943791 | 363 |
| 137 | 3300026078 | Ga0207702_10075448 | Ga0207702_100754482 | 363 |
| 138 | 3300031995 | Ga0307409_100293301 | Ga0307409_1002933012 | 363 |
| 139 | 3300032002 | Ga0307416_100106261 | Ga0307416_1001062613 | 363 |
| 140 | 3300035170 | Ga0373943_0011525 | Ga0373943_0011525_178_1284 | 363 |
| 141 | 3300035692 | Ga0373935_0072020 | Ga0373935_0072020_529_1635 | 363 |
| 142 | 3300035695 | Ga0373927_0158836 | Ga0373927_0158836_307_1413 | 363 |
| 143 | 3300036401 | Ga0373937_0000548 | Ga0373937_0000548_18303_19409 | 363 |
| 144 | 3300036401 | Ga0373937_0025305 | Ga0373937_0025305_2859_3965 | 363 |
| 145 | 3300036401 | Ga0373937_0338739 | Ga0373937_0338739_235_1344 | 363 |
| 146 | 3300037068 | Ga0373925_0055357 | Ga0373925_0055357_1328_2434 | 363 |
| 147 | 3300037312 | Ga0395899_0073691 | Ga0395899_0073691_665_1771 | 363 |
| 148 | 3300037418 | Ga0395900_0006681 | Ga0395900_0006681_9332_10438 | 363 |
| 149 | 3300037466 | Ga0395898_0011394 | Ga0395898_0011394_1488_2594 | 363 |
| 150 | 3300038443 | Ga0395901_0117180 | Ga0395901_0117180_883_1989 | 363 |
| 151 | 3300038443 | Ga0395901_0161945 | Ga0395901_0161945_624_1727 | 363 |
| 152 | 3300044683 | Ga0466965_0085556 | Ga0466965_0085556_389_1495 | 363 |
| 153 | 3300044684 | Ga0466966_0020499 | Ga0466966_0020499_51_1157 | 363 |
| 154 | 3300044693 | Ga0466961_0002675 | Ga0466961_0002675_6665_7771 | 363 |
| 155 | 3300044693 | Ga0466961_0083012 | Ga0466961_0083012_815_1921 | 363 |
| 156 | 3300044694 | Ga0466963_0000261 | Ga0466963_0000261_14411_15517 | 363 |
| 157 | 3300044694 | Ga0466963_0002376 | Ga0466963_0002376_1559_2665 | 363 |
| 158 | 3300044694 | Ga0466963_0024908 | Ga0466963_0024908_1005_2111 | 363 |
| 159 | 3300044694 | Ga0466963_0044167 | Ga0466963_0044167_1058_2164 | 363 |
| 160 | 3300044694 | Ga0466963_0076363 | Ga0466963_0076363_599_1705 | 363 |
| 161 | 3300044694 | Ga0466963_0083860 | Ga0466963_0083860_771_1877 | 363 |
| 162 | 3300044706 | Ga0466964_0008804 | Ga0466964_0008804_2643_3749 | 363 |
| 163 | 3300044706 | Ga0466964_0026000 | Ga0466964_0026000_215_1321 | 363 |
| 164 | 3300044706 | Ga0466964_0063959 | Ga0466964_0063959_304_1410 | 363 |
| 165 | 3300044735 | Ga0466968_0003161 | Ga0466968_0003161_2482_3588 | 363 |
| 166 | 3300044735 | Ga0466968_0008909 | Ga0466968_0008909_1751_2857 | 363 |
| 167 | 3300044765 | Ga0466970_0014312 | Ga0466970_0014312_1486_2592 | 363 |
| 168 | 3300044842 | Ga0466957_0006127 | Ga0466957_0006127_3132_4238 | 363 |
| 169 | 3300044842 | Ga0466957_0030739 | Ga0466957_0030739_1116_2222 | 363 |
| 170 | 3300045049 | Ga0466959_0025227 | Ga0466959_0025227_2935_4041 | 363 |
| 171 | 3300045836 | Ga0466958_0031646 | Ga0466958_0031646_778_1884 | 363 |
| 172 | 3300045836 | Ga0466958_0121919 | Ga0466958_0121919_391_1497 | 363 |
| 173 | 3300045976 | Ga0466967_0002587 | Ga0466967_0002587_6135_7241 | 363 |
| 174 | 3300045976 | Ga0466967_0013294 | Ga0466967_0013294_290_1396 | 363 |
| 175 | 3300045976 | Ga0466967_0013473 | Ga0466967_0013473_4917_6023 | 363 |
| 176 | 3300045976 | Ga0466967_0015101 | Ga0466967_0015101_3828_4934 | 363 |
| 177 | 3300045976 | Ga0466967_0027600 | Ga0466967_0027600_1213_2319 | 363 |
| 178 | 3300045976 | Ga0466967_0031057 | Ga0466967_0031057_2303_3409 | 363 |
| 179 | 3300045976 | Ga0466967_0122613 | Ga0466967_0122613_640_1746 | 363 |
| 180 | 3300045976 | Ga0466967_0141492 | Ga0466967_0141492_158_1318 | 363 |
| 181 | 3300045976 | Ga0466967_0187418 | Ga0466967_0187418_441_1550 | 363 |
| 182 | 3300045976 | Ga0466967_0226508 | Ga0466967_0226508_32_1141 | 363 |
| 183 | 3300045976 | Ga0466967_0242022 | Ga0466967_0242022_169_1275 | 363 |
| 184 | 3300045976 | Ga0466967_0440315 | Ga0466967_0440315_53_1159 | 363 |
| 185 | 3300046454 | Ga0495592_0000100 | Ga0495592_0000100_4618_5724 | 363 |
| 186 | 3300046454 | Ga0495592_0060169 | Ga0495592_0060169_203_1309 | 363 |
| 187 | 3300046455 | Ga0495603_0104510 | Ga0495603_0104510_90_1196 | 363 |
| 188 | 3300046459 | Ga0495629_0030475 | Ga0495629_0030475_1639_2745 | 363 |
| 189 | 3300046461 | Ga0495641_0055610 | Ga0495641_0055610_405_1511 | 363 |
| 190 | 3300046461 | Ga0495641_0056804 | Ga0495641_0056804_490_1596 | 363 |
| 191 | 3300046461 | Ga0495641_0064745 | Ga0495641_0064745_306_1412 | 363 |
| 192 | 3300046462 | Ga0495651_0000008 | Ga0495651_0000008_125925_127031 | 363 |
| 193 | 3300046462 | Ga0495651_0042861 | Ga0495651_0042861_886_1992 | 363 |
| 194 | 3300046462 | Ga0495651_0056623 | Ga0495651_0056623_1595_2701 | 363 |
| 195 | 3300046463 | Ga0495653_0035380 | Ga0495653_0035380_777_1883 | 363 |
| 196 | 3300046473 | Ga0495582_0100123 | Ga0495582_0100123_161_1267 | 363 |
| 197 | 3300046473 | Ga0495582_0172744 | Ga0495582_0172744_74_1180 | 363 |
| 198 | 3300046474 | Ga0495605_0019449 | Ga0495605_0019449_2305_3411 | 363 |
| 199 | 3300046475 | Ga0495639_0004850 | Ga0495639_0004850_4090_5196 | 363 |
| 200 | 3300046501 | Ga0495607_0088451 | Ga0495607_0088451_464_1570 | 363 |
| 201 | 3300046511 | Ga0495608_0011259 | Ga0495608_0011259_399_1505 | 363 |
| 202 | 3300046511 | Ga0495608_0039772 | Ga0495608_0039772_765_1871 | 363 |
| 203 | 3300046514 | Ga0495618_0006703 | Ga0495618_0006703_1618_2724 | 363 |
| 204 | 3300046514 | Ga0495618_0117810 | Ga0495618_0117810_538_1644 | 363 |
| 205 | 3300046516 | Ga0495628_0000105 | Ga0495628_0000105_30313_31419 | 363 |
| 206 | 3300046516 | Ga0495628_0005946 | Ga0495628_0005946_2147_3253 | 363 |
| 207 | 3300046516 | Ga0495628_0028966 | Ga0495628_0028966_2208_3314 | 363 |
| 208 | 3300046516 | Ga0495628_0172847 | Ga0495628_0172847_114_1223 | 363 |
| 209 | 3300046517 | Ga0495630_0014105 | Ga0495630_0014105_4636_5742 | 363 |
| 210 | 3300046523 | Ga0495644_0004305 | Ga0495644_0004305_2575_3681 | 363 |
| 211 | 3300046529 | Ga0495652_0000588 | Ga0495652_0000588_4644_5750 | 363 |
| 212 | 3300046529 | Ga0495652_0007715 | Ga0495652_0007715_6650_7756 | 363 |
| 213 | 3300046529 | Ga0495652_0077392 | Ga0495652_0077392_101_1207 | 363 |
| 214 | 3300046529 | Ga0495652_0124966 | Ga0495652_0124966_500_1606 | 363 |
| 215 | 3300046531 | Ga0495665_0020951 | Ga0495665_0020951_1559_2665 | 363 |
| 216 | 3300046533 | Ga0495640_0012819 | Ga0495640_0012819_74_1180 | 363 |
| 217 | 3300046533 | Ga0495640_0026363 | Ga0495640_0026363_1463_2569 | 363 |
| 218 | 3300046535 | Ga0495586_0057494 | Ga0495586_0057494_814_1920 | 363 |
| 219 | 3300046536 | Ga0495587_0000048 | Ga0495587_0000048_33313_34419 | 363 |
| 220 | 3300046536 | Ga0495587_0019872 | Ga0495587_0019872_744_1850 | 363 |
| 221 | 3300046543 | Ga0495645_0000029 | Ga0495645_0000029_78701_79807 | 363 |
| 222 | 3300046543 | Ga0495645_0018139 | Ga0495645_0018139_3475_4581 | 363 |
| 223 | 3300046559 | Ga0495667_0005882 | Ga0495667_0005882_3846_4952 | 363 |
| 224 | 3300046615 | Ga0495656_0096626 | Ga0495656_0096626_132_1235 | 363 |
| 225 | 3300046642 | Ga0495634_0048784 | Ga0495634_0048784_623_1729 | 363 |
| 226 | 3300046642 | Ga0495634_0071929 | Ga0495634_0071929_984_2090 | 363 |
| 227 | 3300046648 | Ga0495611_0123291 | Ga0495611_0123291_80_1186 | 363 |
| 228 | 3300046663 | Ga0495635_0047792 | Ga0495635_0047792_1524_2630 | 363 |
| 229 | 3300046674 | Ga0495588_0063506 | Ga0495588_0063506_26_1132 | 363 |
| 230 | 3300046675 | Ga0495657_0015166 | Ga0495657_0015166_1678_2784 | 363 |
| 231 | 3300046675 | Ga0495657_0046320 | Ga0495657_0046320_1625_2731 | 363 |
| 232 | 3300046675 | Ga0495657_0107380 | Ga0495657_0107380_490_1596 | 363 |
| 233 | 3300046678 | Ga0495599_0000110 | Ga0495599_0000110_33312_34418 | 363 |
| 234 | 3300046678 | Ga0495599_0000519 | Ga0495599_0000519_17673_18779 | 363 |
| 235 | 3300046678 | Ga0495599_0011820 | Ga0495599_0011820_3604_4710 | 363 |
| 236 | 3300046678 | Ga0495599_0177620 | Ga0495599_0177620_65_1171 | 363 |
| 237 | 3300046679 | Ga0495623_0005997 | Ga0495623_0005997_4505_5611 | 363 |
| 238 | 3300046679 | Ga0495623_0033141 | Ga0495623_0033141_2028_3134 | 363 |
| 239 | 3300046680 | Ga0495646_0005674 | Ga0495646_0005674_4636_5742 | 363 |
| 240 | 3300046680 | Ga0495646_0009733 | Ga0495646_0009733_2009_3115 | 363 |
| 241 | 3300046680 | Ga0495646_0022232 | Ga0495646_0022232_1103_2209 | 363 |
| 242 | 3300046680 | Ga0495646_0094316 | Ga0495646_0094316_567_1673 | 363 |
| 243 | 3300046681 | Ga0495647_0013829 | Ga0495647_0013829_78_1184 | 363 |
| 244 | 3300046683 | Ga0495658_0017927 | Ga0495658_0017927_2514_3620 | 363 |
| 245 | 3300046683 | Ga0495658_0117328 | Ga0495658_0117328_472_1578 | 363 |
| 246 | 3300046689 | Ga0495613_0048055 | Ga0495613_0048055_1641_2747 | 363 |
| 247 | 3300046689 | Ga0495613_0117332 | Ga0495613_0117332_586_1695 | 363 |
| 248 | 3300046689 | Ga0495613_0169103 | Ga0495613_0169103_226_1332 | 363 |
| 249 | 3300046690 | Ga0495624_0010504 | Ga0495624_0010504_687_1793 | 363 |
| 250 | 3300046690 | Ga0495624_0019028 | Ga0495624_0019028_1782_2888 | 363 |
| 251 | 3300046690 | Ga0495624_0031523 | Ga0495624_0031523_1812_2918 | 363 |
| 252 | 3300046794 | Ga0495589_0008261 | Ga0495589_0008261_2457_3563 | 363 |
| 253 | 3300047315 | Ga0495581_0088403 | Ga0495581_0088403_51_1157 | 363 |
| 254 | 3300047317 | Ga0495604_0000238 | Ga0495604_0000238_4505_5611 | 363 |
| 255 | 3300047317 | Ga0495604_0089930 | Ga0495604_0089930_756_1862 | 363 |
| 256 | 3300047319 | Ga0495674_0128255 | Ga0495674_0128255_62_1168 | 363 |
| 257 | 3300047319 | Ga0495674_0161788 | Ga0495674_0161788_74_1180 | 363 |
| 258 | 3300047319 | Ga0495674_0224870 | Ga0495674_0224870_346_1452 | 363 |
| 259 | 3300047321 | Ga0495676_0039278 | Ga0495676_0039278_2531_3637 | 363 |
| 260 | 3300047321 | Ga0495676_0243398 | Ga0495676_0243398_74_1180 | 363 |
| 261 | 3300047322 | Ga0495680_0008735 | Ga0495680_0008735_7161_8267 | 363 |
| 262 | 3300047322 | Ga0495680_0013633 | Ga0495680_0013633_4950_6056 | 363 |
| 263 | 3300047322 | Ga0495680_0071934 | Ga0495680_0071934_1211_2317 | 363 |
| 264 | 3300047444 | Ga0495675_0000262 | Ga0495675_0000262_4516_5622 | 363 |
| 265 | 3300047471 | Ga0495684_0049834 | Ga0495684_0049834_2028_3134 | 363 |
| 266 | 3300047471 | Ga0495684_0104422 | Ga0495684_0104422_420_1526 | 363 |
| 267 | 3300047471 | Ga0495684_0136233 | Ga0495684_0136233_66_1172 | 363 |
| 268 | 3300047471 | Ga0495684_0140403 | Ga0495684_0140403_378_1484 | 363 |
| 269 | 3300047673 | Ga0495593_0003361 | Ga0495593_0003361_1056_2162 | 363 |
| 270 | 3300048088 | Ga0495602_0010209 | Ga0495602_0010209_4529_5635 | 363 |
| 271 | 3300048088 | Ga0495602_0011469 | Ga0495602_0011469_2149_3255 | 363 |
| 272 | 3300048089 | Ga0495614_0025966 | Ga0495614_0025966_1251_2357 | 363 |
| 273 | 3300048904 | Ga0496101_0119174 | Ga0496101_0119174_174_1280 | 363 |
| 274 | 3300048904 | Ga0496101_0153046 | Ga0496101_0153046_378_1484 | 363 |
| 275 | 3300048907 | Ga0496104_0004726 | Ga0496104_0004726_9492_10598 | 363 |
| 276 | 3300048907 | Ga0496104_0062778 | Ga0496104_0062778_343_1449 | 363 |
| 277 | 3300048908 | Ga0496105_0005142 | Ga0496105_0005142_6416_7522 | 363 |
| 278 | 3300048909 | Ga0496106_0160270 | Ga0496106_0160270_445_1551 | 363 |
| 279 | 3300048910 | Ga0496107_0066587 | Ga0496107_0066587_403_1512 | 363 |
| 280 | 3300048911 | Ga0496108_0096255 | Ga0496108_0096255_361_1467 | 363 |
| 281 | 3300048912 | Ga0496109_0000993 | Ga0496109_0000993_2919_4025 | 363 |
| 282 | 3300048916 | Ga0496113_0037313 | Ga0496113_0037313_37_1143 | 363 |
| 283 | 3300048917 | Ga0496114_0071680 | Ga0496114_0071680_1407_2513 | 363 |
| 284 | 3300048918 | Ga0496115_0069990 | Ga0496115_0069990_442_1548 | 363 |
| 285 | 3300048918 | Ga0496115_0183991 | Ga0496115_0183991_573_1679 | 363 |
| 286 | 3300049575 | Ga0501039_0016924 | Ga0501039_0016924_4350_5468 | 363 |
| 287 | 3300049576 | Ga0501040_0155730 | Ga0501040_0155730_466_1584 | 363 |
| 288 | 3300049577 | Ga0501041_0164474 | Ga0501041_0164474_29_1147 | 363 |
| 289 | 3300049579 | Ga0501043_0009300 | Ga0501043_0009300_4200_5318 | 363 |
| 290 | 3300049580 | Ga0501046_0110657 | Ga0501046_0110657_515_1633 | 363 |
| 291 | 3300049583 | Ga0501067_0096979 | Ga0501067_0096979_343_1449 | 363 |
| 292 | 3300049585 | Ga0501069_0016467 | Ga0501069_0016467_1620_2726 | 363 |
| 293 | 3300049586 | Ga0501070_0008509 | Ga0501070_0008509_808_1926 | 363 |
| 294 | 3300049586 | Ga0501070_0010395 | Ga0501070_0010395_6374_7483 | 363 |
| 295 | 3300049587 | Ga0501071_0127219 | Ga0501071_0127219_30_1148 | 363 |
| 296 | 3300049590 | Ga0501074_0017874 | Ga0501074_0017874_1340_2449 | 363 |
| 297 | 3300049592 | Ga0501076_0011754 | Ga0501076_0011754_5177_6295 | 363 |
| 298 | 3300049593 | Ga0501077_0043666 | Ga0501077_0043666_234_1352 | 363 |
| 299 | 3300049741 | Ga0501079_0021128 | Ga0501079_0021128_1489_2607 | 363 |
| 300 | 3300049824 | Ga0501045_0093128 | Ga0501045_0093128_1066_2184 | 363 |
| 301 | 3300050512 | nmdc:mga0n895_144310_c1 | nmdc:mga0n895_144310_c1_745_1851 | 363 |
| 302 | 3300053077 | Ga0495601_0007870 | Ga0495601_0007870_4157_5263 | 363 |
| 303 | 3300053077 | Ga0495601_0039693 | Ga0495601_0039693_308_1414 | 363 |
| 304 | 3300053077 | Ga0495601_0140940 | Ga0495601_0140940_378_1484 | 363 |
| 305 | 3300053078 | Ga0495612_0012979 | Ga0495612_0012979_1681_2787 | 363 |
| 306 | 3300053078 | Ga0495612_0021217 | Ga0495612_0021217_487_1593 | 363 |
| 307 | 3300053078 | Ga0495612_0021410 | Ga0495612_0021410_874_1980 | 363 |
| 308 | 3300053084 | Ga0495595_0004929 | Ga0495595_0004929_3954_5060 | 363 |
| 309 | 3300053084 | Ga0495595_0026387 | Ga0495595_0026387_1306_2412 | 363 |
| 310 | 3300053085 | Ga0495619_0012980 | Ga0495619_0012980_3712_4818 | 363 |
| 311 | 3300053085 | Ga0495619_0034749 | Ga0495619_0034749_813_1919 | 363 |
| 312 | 3300053094 | Ga0500566_0045228 | Ga0500566_0045228_256_1362 | 363 |
| 313 | 3300054114 | Ga0501084_0222004 | Ga0501084_0222004_364_1482 | 363 |
| 314 | 3300061719 | Ga0466962_0004473 | Ga0466962_0004473_3270_4376 | 363 |
| 315 | 3300061719 | Ga0466962_0021951 | Ga0466962_0021951_1223_2329 | 363 |
| 316 | 3300005327 | Ga0070658_10001917 | Ga0070658_1000191713 | 364 |
| 317 | 3300005327 | Ga0070658_10009008 | Ga0070658_100090087 | 364 |
| 318 | 3300005336 | Ga0070680_100212999 | Ga0070680_1002129992 | 364 |
| 319 | 3300005337 | Ga0070682_100013796 | Ga0070682_1000137965 | 364 |
| 320 | 3300005344 | Ga0070661_100005675 | Ga0070661_1000056752 | 364 |
| 321 | 3300005436 | Ga0070713_100224591 | Ga0070713_1002245912 | 364 |
| 322 | 3300005456 | Ga0070678_100083046 | Ga0070678_1000830462 | 364 |
| 323 | 3300005458 | Ga0070681_10019656 | Ga0070681_100196564 | 364 |
| 324 | 3300005458 | Ga0070681_10042356 | Ga0070681_100423563 | 364 |
| 325 | 3300005471 | Ga0070698_100163311 | Ga0070698_1001633112 | 364 |
| 326 | 3300005530 | Ga0070679_100013238 | Ga0070679_1000132382 | 364 |
| 327 | 3300005535 | Ga0070684_100000304 | Ga0070684_1000003043 | 364 |
| 328 | 3300005563 | Ga0068855_100015558 | Ga0068855_1000155582 | 364 |
| 329 | 3300005564 | Ga0070664_100261620 | Ga0070664_1002616202 | 364 |
| 330 | 3300005614 | Ga0068856_100063236 | Ga0068856_1000632362 | 364 |
| 331 | 3300006358 | Ga0068871_100182559 | Ga0068871_1001825592 | 364 |
| 332 | 3300006871 | Ga0075434_100001557 | Ga0075434_10000155712 | 364 |
| 333 | 3300007076 | Ga0075435_100017412 | Ga0075435_1000174126 | 364 |
| 334 | 3300009093 | Ga0105240_10092787 | Ga0105240_100927875 | 364 |
| 335 | 3300009093 | Ga0105240_10175155 | Ga0105240_101751552 | 364 |
| 336 | 3300009098 | Ga0105245_10046270 | Ga0105245_100462702 | 364 |
| 337 | 3300013104 | Ga0157370_10027005 | Ga0157370_100270056 | 364 |
| 338 | 3300013105 | Ga0157369_10051221 | Ga0157369_100512213 | 364 |
| 339 | 3300013105 | Ga0157369_10101401 | Ga0157369_101014013 | 364 |
| 340 | 3300013105 | Ga0157369_10131514 | Ga0157369_101315143 | 364 |
| 341 | 3300020070 | Ga0206356_10687371 | Ga0206356_106873712 | 364 |
| 342 | 3300020070 | Ga0206356_11875873 | Ga0206356_118758733 | 364 |
| 343 | 3300020081 | Ga0206354_10778318 | Ga0206354_107783185 | 364 |
| 344 | 3300020082 | Ga0206353_11663111 | Ga0206353_116631113 | 364 |
| 345 | 3300025909 | Ga0207705_10026437 | Ga0207705_100264372 | 364 |
| 346 | 3300025917 | Ga0207660_10176254 | Ga0207660_101762542 | 364 |
| 347 | 3300025919 | Ga0207657_10042806 | Ga0207657_100428065 | 364 |
| 348 | 3300025920 | Ga0207649_10033516 | Ga0207649_100335162 | 364 |
| 349 | 3300025921 | Ga0207652_10008054 | Ga0207652_100080542 | 364 |
| 350 | 3300025927 | Ga0207687_10003599 | Ga0207687_100035993 | 364 |
| 351 | 3300025927 | Ga0207687_10042776 | Ga0207687_100427763 | 364 |
| 352 | 3300025929 | Ga0207664_10008572 | Ga0207664_100085727 | 364 |
| 353 | 3300025935 | Ga0207709_10056466 | Ga0207709_100564662 | 364 |
| 354 | 3300025949 | Ga0207667_10083906 | Ga0207667_100839065 | 364 |
| 355 | 3300026078 | Ga0207702_10055641 | Ga0207702_100556412 | 364 |
| 356 | 3300026078 | Ga0207702_10224622 | Ga0207702_102246222 | 364 |
| 357 | 3300026121 | Ga0207683_10027994 | Ga0207683_100279945 | 364 |
| 358 | 3300026142 | Ga0207698_10083164 | Ga0207698_100831643 | 364 |
| 359 | 3300037418 | Ga0395900_0248532 | Ga0395900_0248532_585_1685 | 364 |
| 360 | 3300037466 | Ga0395898_0157977 | Ga0395898_0157977_492_1604 | 364 |
| 361 | 3300037466 | Ga0395898_0481221 | Ga0395898_0481221_64_1164 | 364 |
| 362 | 3300038443 | Ga0395901_0033692 | Ga0395901_0033692_3163_4275 | 364 |
| 363 | 3300038443 | Ga0395901_0076162 | Ga0395901_0076162_1802_2911 | 364 |
| 364 | 3300039437 | Ga0436365_1070781 | Ga0436365_1070781_1089_2195 | 364 |
| 365 | 3300044693 | Ga0466961_0099484 | Ga0466961_0099484_388_1503 | 364 |
| 366 | 3300044694 | Ga0466963_0000768 | Ga0466963_0000768_5245_6354 | 364 |
| 367 | 3300045836 | Ga0466958_0002635 | Ga0466958_0002635_5552_6661 | 364 |
| 368 | 3300045976 | Ga0466967_0038321 | Ga0466967_0038321_589_1707 | 364 |
| 369 | 3300045976 | Ga0466967_0053417 | Ga0466967_0053417_138_1253 | 364 |
| 370 | 3300045976 | Ga0466967_0055137 | Ga0466967_0055137_1239_2348 | 364 |
| 371 | 3300045976 | Ga0466967_0074837 | Ga0466967_0074837_1687_2802 | 364 |
| 372 | 3300046455 | Ga0495603_0047923 | Ga0495603_0047923_64_1191 | 364 |
| 373 | 3300046475 | Ga0495639_0047663 | Ga0495639_0047663_43_1170 | 364 |
| 374 | 3300046511 | Ga0495608_0115164 | Ga0495608_0115164_346_1455 | 364 |
| 375 | 3300046615 | Ga0495656_0058104 | Ga0495656_0058104_344_1450 | 364 |
| 376 | 3300046674 | Ga0495588_0041339 | Ga0495588_0041339_255_1382 | 364 |
| 377 | 3300046678 | Ga0495599_0093113 | Ga0495599_0093113_18_1130 | 364 |
| 378 | 3300047317 | Ga0495604_0098303 | Ga0495604_0098303_640_1749 | 364 |
| 379 | 3300048904 | Ga0496101_0026233 | Ga0496101_0026233_135_1241 | 364 |
| 380 | 3300048905 | Ga0496102_0005140 | Ga0496102_0005140_6277_7383 | 364 |
| 381 | 3300048906 | Ga0496103_0009187 | Ga0496103_0009187_3721_4827 | 364 |
| 382 | 3300048907 | Ga0496104_0000699 | Ga0496104_0000699_26051_27157 | 364 |
| 383 | 3300048907 | Ga0496104_0003803 | Ga0496104_0003803_10931_12037 | 364 |
| 384 | 3300048908 | Ga0496105_0000148 | Ga0496105_0000148_44320_45426 | 364 |
| 385 | 3300048909 | Ga0496106_0016234 | Ga0496106_0016234_2943_4058 | 364 |
| 386 | 3300048910 | Ga0496107_0017662 | Ga0496107_0017662_3194_4309 | 364 |
| 387 | 3300048910 | Ga0496107_0059618 | Ga0496107_0059618_915_2021 | 364 |
| 388 | 3300048911 | Ga0496108_0037741 | Ga0496108_0037741_952_2058 | 364 |
| 389 | 3300048912 | Ga0496109_0000578 | Ga0496109_0000578_7796_8902 | 364 |
| 390 | 3300048912 | Ga0496109_0198673 | Ga0496109_0198673_49_1155 | 364 |
| 391 | 3300048913 | Ga0496110_0002158 | Ga0496110_0002158_12551_13657 | 364 |
| 392 | 3300048914 | Ga0496111_0016234 | Ga0496111_0016234_3165_4271 | 364 |
| 393 | 3300048914 | Ga0496111_0027056 | Ga0496111_0027056_19_1125 | 364 |
| 394 | 3300048914 | Ga0496111_0062583 | Ga0496111_0062583_1029_2135 | 364 |
| 395 | 3300048915 | Ga0496112_0161566 | Ga0496112_0161566_801_1907 | 364 |
| 396 | 3300048916 | Ga0496113_0178938 | Ga0496113_0178938_489_1595 | 364 |
| 397 | 3300048916 | Ga0496113_0219786 | Ga0496113_0219786_133_1248 | 364 |
| 398 | 3300048917 | Ga0496114_0003196 | Ga0496114_0003196_6396_7502 | 364 |
| 399 | 3300048917 | Ga0496114_0003379 | Ga0496114_0003379_6044_7150 | 364 |
| 400 | 3300048917 | Ga0496114_0072002 | Ga0496114_0072002_1096_2202 | 364 |
| 401 | 3300049588 | Ga0501072_0083731 | Ga0501072_0083731_643_1755 | 364 |
| 402 | 3300049744 | Ga0501083_0025552 | Ga0501083_0025552_1811_2923 | 364 |
| 403 | 3300050512 | nmdc:mga0n895_29458_c1 | nmdc:mga0n895_29458_c1_3833_4957 | 364 |
| 404 | 3300050513 | nmdc:mga0rr50_12711_c1 | nmdc:mga0rr50_12711_c1_3673_4797 | 364 |
| 405 | 3300050515 | nmdc:mga0a205_9936_c1 | nmdc:mga0a205_9936_c1_5689_6813 | 364 |
| 406 | 3300054114 | Ga0501084_0151623 | Ga0501084_0151623_479_1591 | 364 |
| 407 | 3300005329 | Ga0070683_100122099 | Ga0070683_1001220993 | 365 |
| 408 | 3300005337 | Ga0070682_100015285 | Ga0070682_1000152853 | 365 |
| 409 | 3300005366 | Ga0070659_100050496 | Ga0070659_1000504962 | 365 |
| 410 | 3300005458 | Ga0070681_10027044 | Ga0070681_100270443 | 365 |
| 411 | 3300005458 | Ga0070681_10071810 | Ga0070681_100718105 | 365 |
| 412 | 3300005458 | Ga0070681_10321332 | Ga0070681_103213321 | 365 |
| 413 | 3300005468 | Ga0070707_100108476 | Ga0070707_1001084761 | 365 |
| 414 | 3300005530 | Ga0070679_100093351 | Ga0070679_1000933512 | 365 |
| 415 | 3300005530 | Ga0070679_100130555 | Ga0070679_1001305553 | 365 |
| 416 | 3300005535 | Ga0070684_100005611 | Ga0070684_1000056115 | 365 |
| 417 | 3300005563 | Ga0068855_100117266 | Ga0068855_1001172662 | 365 |
| 418 | 3300006844 | Ga0075428_100000381 | Ga0075428_1000003812 | 365 |
| 419 | 3300006847 | Ga0075431_100188313 | Ga0075431_1001883131 | 365 |
| 420 | 3300006880 | Ga0075429_100216747 | Ga0075429_1002167472 | 365 |
| 421 | 3300009147 | Ga0114129_10001661 | Ga0114129_1000166129 | 365 |
| 422 | 3300009147 | Ga0114129_10134627 | Ga0114129_101346273 | 365 |
| 423 | 3300014497 | Ga0182008_10053067 | Ga0182008_100530671 | 365 |
| 424 | 3300020070 | Ga0206356_11158095 | Ga0206356_111580951 | 365 |
| 425 | 3300020081 | Ga0206354_10192413 | Ga0206354_101924135 | 365 |
| 426 | 3300020081 | Ga0206354_10900364 | Ga0206354_109003641 | 365 |
| 427 | 3300020082 | Ga0206353_10422956 | Ga0206353_104229565 | 365 |
| 428 | 3300020082 | Ga0206353_11831078 | Ga0206353_118310782 | 365 |
| 429 | 3300021441 | Ga0213871_10006336 | Ga0213871_100063362 | 365 |
| 430 | 3300025909 | Ga0207705_10038063 | Ga0207705_100380633 | 365 |
| 431 | 3300025912 | Ga0207707_10017134 | Ga0207707_100171347 | 365 |
| 432 | 3300025912 | Ga0207707_10106547 | Ga0207707_101065472 | 365 |
| 433 | 3300025917 | Ga0207660_10031455 | Ga0207660_100314552 | 365 |
| 434 | 3300025918 | Ga0207662_10054435 | Ga0207662_100544352 | 365 |
| 435 | 3300025919 | Ga0207657_10005756 | Ga0207657_100057567 | 365 |
| 436 | 3300025919 | Ga0207657_10027056 | Ga0207657_100270567 | 365 |
| 437 | 3300025921 | Ga0207652_10048618 | Ga0207652_100486183 | 365 |
| 438 | 3300025921 | Ga0207652_10065363 | Ga0207652_100653632 | 365 |
| 439 | 3300025921 | Ga0207652_10105455 | Ga0207652_101054552 | 365 |
| 440 | 3300025932 | Ga0207690_10142744 | Ga0207690_101427442 | 365 |
| 441 | 3300025944 | Ga0207661_10003070 | Ga0207661_1000307017 | 365 |
| 442 | 3300025944 | Ga0207661_10125684 | Ga0207661_101256842 | 365 |
| 443 | 3300025949 | Ga0207667_10288750 | Ga0207667_102887502 | 365 |
| 444 | 3300026118 | Ga0207675_100147604 | Ga0207675_1001476041 | 365 |
| 445 | 3300028558 | Ga0265326_10011074 | Ga0265326_100110742 | 365 |
| 446 | 3300028563 | Ga0265319_1005217 | Ga0265319_10052172 | 365 |
| 447 | 3300028577 | Ga0265318_10000219 | Ga0265318_1000021913 | 365 |
| 448 | 3300028654 | Ga0265322_10016444 | Ga0265322_100164443 | 365 |
| 449 | 3300028800 | Ga0265338_10003307 | Ga0265338_1000330711 | 365 |
| 450 | 3300028800 | Ga0265338_10016091 | Ga0265338_100160916 | 365 |
| 451 | 3300028800 | Ga0265338_10175213 | Ga0265338_101752132 | 365 |
| 452 | 3300031235 | Ga0265330_10000479 | Ga0265330_1000047911 | 365 |
| 453 | 3300031239 | Ga0265328_10000790 | Ga0265328_100007905 | 365 |
| 454 | 3300031240 | Ga0265320_10058686 | Ga0265320_100586862 | 365 |
| 455 | 3300031241 | Ga0265325_10000443 | Ga0265325_1000044316 | 365 |
| 456 | 3300031242 | Ga0265329_10000472 | Ga0265329_100004729 | 365 |
| 457 | 3300031247 | Ga0265340_10068279 | Ga0265340_100682792 | 365 |
| 458 | 3300031249 | Ga0265339_10101055 | Ga0265339_101010552 | 365 |
| 459 | 3300031251 | Ga0265327_10009052 | Ga0265327_100090526 | 365 |
| 460 | 3300031344 | Ga0265316_10004053 | Ga0265316_100040532 | 365 |
| 461 | 3300031595 | Ga0265313_10006992 | Ga0265313_100069927 | 365 |
| 462 | 3300031711 | Ga0265314_10003422 | Ga0265314_100034228 | 365 |
| 463 | 3300031712 | Ga0265342_10097936 | Ga0265342_100979362 | 365 |
| 464 | 3300035172 | Ga0373955_0024397 | Ga0373955_0024397_1570_2688 | 365 |
| 465 | 3300037312 | Ga0395899_0012610 | Ga0395899_0012610_3305_4432 | 365 |
| 466 | 3300037418 | Ga0395900_0050121 | Ga0395900_0050121_3120_4232 | 365 |
| 467 | 3300037418 | Ga0395900_0093511 | Ga0395900_0093511_1912_3039 | 365 |
| 468 | 3300037466 | Ga0395898_0127735 | Ga0395898_0127735_722_1840 | 365 |
| 469 | 3300037471 | Ga0395905_0012746 | Ga0395905_0012746_483_1601 | 365 |
| 470 | 3300038443 | Ga0395901_0010878 | Ga0395901_0010878_6472_7599 | 365 |
| 471 | 3300038443 | Ga0395901_0041928 | Ga0395901_0041928_52_1164 | 365 |
| 472 | 3300038443 | Ga0395901_0064877 | Ga0395901_0064877_2501_3619 | 365 |
| 473 | 3300039438 | Ga0436360_0887170 | Ga0436360_0887170_1935_3047 | 365 |
| 474 | 3300044684 | Ga0466966_0038817 | Ga0466966_0038817_800_1912 | 365 |
| 475 | 3300044706 | Ga0466964_0030830 | Ga0466964_0030830_301_1419 | 365 |
| 476 | 3300045049 | Ga0466959_0025914 | Ga0466959_0025914_1672_2784 | 365 |
| 477 | 3300045976 | Ga0466967_0021409 | Ga0466967_0021409_3928_5046 | 365 |
| 478 | 3300046462 | Ga0495651_0035623 | Ga0495651_0035623_1746_2864 | 365 |
| 479 | 3300046463 | Ga0495653_0032335 | Ga0495653_0032335_514_1632 | 365 |
| 480 | 3300046463 | Ga0495653_0047434 | Ga0495653_0047434_970_2088 | 365 |
| 481 | 3300046473 | Ga0495582_0130800 | Ga0495582_0130800_80_1201 | 365 |
| 482 | 3300046517 | Ga0495630_0143569 | Ga0495630_0143569_428_1546 | 365 |
| 483 | 3300046559 | Ga0495667_0016319 | Ga0495667_0016319_3551_4669 | 365 |
| 484 | 3300046559 | Ga0495667_0081797 | Ga0495667_0081797_624_1742 | 365 |
| 485 | 3300046615 | Ga0495656_0103930 | Ga0495656_0103930_13_1119 | 365 |
| 486 | 3300046642 | Ga0495634_0029224 | Ga0495634_0029224_1723_2841 | 365 |
| 487 | 3300046663 | Ga0495635_0105734 | Ga0495635_0105734_369_1487 | 365 |
| 488 | 3300046663 | Ga0495635_0126439 | Ga0495635_0126439_246_1364 | 365 |
| 489 | 3300046675 | Ga0495657_0033676 | Ga0495657_0033676_1306_2424 | 365 |
| 490 | 3300047317 | Ga0495604_0060369 | Ga0495604_0060369_1641_2759 | 365 |
| 491 | 3300047322 | Ga0495680_0045794 | Ga0495680_0045794_202_1320 | 365 |
| 492 | 3300047444 | Ga0495675_0059149 | Ga0495675_0059149_947_2065 | 365 |
| 493 | 3300048907 | Ga0496104_0093560 | Ga0496104_0093560_1696_2817 | 365 |
| 494 | 3300048915 | Ga0496112_0020408 | Ga0496112_0020408_1311_2429 | 365 |
| 495 | 3300050507 | nmdc:mga05p37_1648_c1 | nmdc:mga05p37_1648_c1_2326_3438 | 365 |
| 496 | 3300050508 | nmdc:mga09592_195461_c1 | nmdc:mga09592_195461_c1_412_1524 | 365 |
| 497 | 3300053084 | Ga0495595_0022765 | Ga0495595_0022765_1219_2337 | 365 |
| 498 | 3300053085 | Ga0495619_0007865 | Ga0495619_0007865_3693_4811 | 365 |
| 499 | 3300005330 | Ga0070690_100021377 | Ga0070690_1000213774 | 366 |
| 500 | 3300005334 | Ga0068869_100102301 | Ga0068869_1001023012 | 366 |
| 501 | 3300005336 | Ga0070680_100079285 | Ga0070680_1000792852 | 366 |
| 502 | 3300005337 | Ga0070682_100024483 | Ga0070682_1000244832 | 366 |
| 503 | 3300005338 | Ga0068868_100238440 | Ga0068868_1002384402 | 366 |
| 504 | 3300005339 | Ga0070660_100060376 | Ga0070660_1000603762 | 366 |
| 505 | 3300005339 | Ga0070660_100177538 | Ga0070660_1001775382 | 366 |
| 506 | 3300005340 | Ga0070689_100045899 | Ga0070689_1000458992 | 366 |
| 507 | 3300005341 | Ga0070691_10051621 | Ga0070691_100516212 | 366 |
| 508 | 3300005347 | Ga0070668_100054366 | Ga0070668_1000543662 | 366 |
| 509 | 3300005353 | Ga0070669_100258523 | Ga0070669_1002585231 | 366 |
| 510 | 3300005365 | Ga0070688_100015520 | Ga0070688_1000155201 | 366 |
| 511 | 3300005366 | Ga0070659_100165228 | Ga0070659_1001652282 | 366 |
| 512 | 3300005438 | Ga0070701_10001955 | Ga0070701_100019554 | 366 |
| 513 | 3300005440 | Ga0070705_100052306 | Ga0070705_1000523061 | 366 |
| 514 | 3300005441 | Ga0070700_100003711 | Ga0070700_1000037117 | 366 |
| 515 | 3300005445 | Ga0070708_100030358 | Ga0070708_1000303582 | 366 |
| 516 | 3300005456 | Ga0070678_100240063 | Ga0070678_1002400631 | 366 |
| 517 | 3300005457 | Ga0070662_100056188 | Ga0070662_1000561883 | 366 |
| 518 | 3300005459 | Ga0068867_100028094 | Ga0068867_1000280943 | 366 |
| 519 | 3300005467 | Ga0070706_100361788 | Ga0070706_1003617881 | 366 |
| 520 | 3300005468 | Ga0070707_100000736 | Ga0070707_10000073629 | 366 |
| 521 | 3300005468 | Ga0070707_100346107 | Ga0070707_1003461072 | 366 |
| 522 | 3300005471 | Ga0070698_100017893 | Ga0070698_1000178934 | 366 |
| 523 | 3300005471 | Ga0070698_100053947 | Ga0070698_1000539474 | 366 |
| 524 | 3300005518 | Ga0070699_100005711 | Ga0070699_1000057114 | 366 |
| 525 | 3300005518 | Ga0070699_100012784 | Ga0070699_1000127842 | 366 |
| 526 | 3300005539 | Ga0068853_100022302 | Ga0068853_1000223023 | 366 |
| 527 | 3300005548 | Ga0070665_100017345 | Ga0070665_1000173457 | 366 |
| 528 | 3300005548 | Ga0070665_100062268 | Ga0070665_1000622683 | 366 |
| 529 | 3300005614 | Ga0068856_100102573 | Ga0068856_1001025732 | 366 |
| 530 | 3300005615 | Ga0070702_100004559 | Ga0070702_1000045596 | 366 |
| 531 | 3300005616 | Ga0068852_100035447 | Ga0068852_1000354472 | 366 |
| 532 | 3300005618 | Ga0068864_100303951 | Ga0068864_1003039512 | 366 |
| 533 | 3300005718 | Ga0068866_10001213 | Ga0068866_100012139 | 366 |
| 534 | 3300005719 | Ga0068861_100107071 | Ga0068861_1001070712 | 366 |
| 535 | 3300005719 | Ga0068861_100110309 | Ga0068861_1001103092 | 366 |
| 536 | 3300005841 | Ga0068863_100464763 | Ga0068863_1004647631 | 366 |
| 537 | 3300005844 | Ga0068862_100140681 | Ga0068862_1001406812 | 366 |
| 538 | 3300005844 | Ga0068862_100201484 | Ga0068862_1002014842 | 366 |
| 539 | 3300006038 | Ga0075365_10019759 | Ga0075365_100197596 | 366 |
| 540 | 3300006175 | Ga0070712_100039286 | Ga0070712_1000392862 | 366 |
| 541 | 3300006175 | Ga0070712_100268046 | Ga0070712_1002680462 | 366 |
| 542 | 3300006358 | Ga0068871_100035915 | Ga0068871_1000359155 | 366 |
| 543 | 3300006847 | Ga0075431_100023773 | Ga0075431_1000237736 | 366 |
| 544 | 3300006852 | Ga0075433_10069829 | Ga0075433_100698294 | 366 |
| 545 | 3300006852 | Ga0075433_10168459 | Ga0075433_101684592 | 366 |
| 546 | 3300006871 | Ga0075434_100175550 | Ga0075434_1001755502 | 366 |
| 547 | 3300006881 | Ga0068865_100007982 | Ga0068865_1000079825 | 366 |
| 548 | 3300006914 | Ga0075436_100050943 | Ga0075436_1000509433 | 366 |
| 549 | 3300007076 | Ga0075435_100021362 | Ga0075435_1000213624 | 366 |
| 550 | 3300009094 | Ga0111539_10012314 | Ga0111539_100123149 | 366 |
| 551 | 3300009094 | Ga0111539_10056650 | Ga0111539_100566502 | 366 |
| 552 | 3300009101 | Ga0105247_10014196 | Ga0105247_100141965 | 366 |
| 553 | 3300009147 | Ga0114129_10012739 | Ga0114129_100127399 | 366 |
| 554 | 3300009147 | Ga0114129_10153050 | Ga0114129_101530503 | 366 |
| 555 | 3300009177 | Ga0105248_10386638 | Ga0105248_103866382 | 366 |
| 556 | 3300009551 | Ga0105238_10181417 | Ga0105238_101814172 | 366 |
| 557 | 3300011119 | Ga0105246_10196366 | Ga0105246_101963662 | 366 |
| 558 | 3300013296 | Ga0157374_10108469 | Ga0157374_101084692 | 366 |
| 559 | 3300013308 | Ga0157375_10047453 | Ga0157375_100474535 | 366 |
| 560 | 3300014326 | Ga0157380_10010760 | Ga0157380_100107603 | 366 |
| 561 | 3300014745 | Ga0157377_10073642 | Ga0157377_100736422 | 366 |
| 562 | 3300014968 | Ga0157379_10258274 | Ga0157379_102582742 | 366 |
| 563 | 3300014969 | Ga0157376_10062443 | Ga0157376_100624433 | 366 |
| 564 | 3300017792 | Ga0163161_10166119 | Ga0163161_101661192 | 366 |
| 565 | 3300025898 | Ga0207692_10074254 | Ga0207692_100742542 | 366 |
| 566 | 3300025899 | Ga0207642_10014554 | Ga0207642_100145543 | 366 |
| 567 | 3300025907 | Ga0207645_10057178 | Ga0207645_100571781 | 366 |
| 568 | 3300025910 | Ga0207684_10080852 | Ga0207684_100808523 | 366 |
| 569 | 3300025910 | Ga0207684_10348716 | Ga0207684_103487162 | 366 |
| 570 | 3300025912 | Ga0207707_10143050 | Ga0207707_101430502 | 366 |
| 571 | 3300025915 | Ga0207693_10033836 | Ga0207693_100338364 | 366 |
| 572 | 3300025915 | Ga0207693_10307813 | Ga0207693_103078131 | 366 |
| 573 | 3300025919 | Ga0207657_10029230 | Ga0207657_100292302 | 366 |
| 574 | 3300025922 | Ga0207646_10022827 | Ga0207646_100228276 | 366 |
| 575 | 3300025927 | Ga0207687_10024282 | Ga0207687_100242823 | 366 |
| 576 | 3300025927 | Ga0207687_10206638 | Ga0207687_102066382 | 366 |
| 577 | 3300025933 | Ga0207706_10045280 | Ga0207706_100452802 | 366 |
| 578 | 3300025935 | Ga0207709_10003771 | Ga0207709_100037713 | 366 |
| 579 | 3300025936 | Ga0207670_10014593 | Ga0207670_100145935 | 366 |
| 580 | 3300025938 | Ga0207704_10118584 | Ga0207704_101185842 | 366 |
| 581 | 3300025939 | Ga0207665_10073671 | Ga0207665_100736712 | 366 |
| 582 | 3300025941 | Ga0207711_10028596 | Ga0207711_100285962 | 366 |
| 583 | 3300025960 | Ga0207651_10187263 | Ga0207651_101872632 | 366 |
| 584 | 3300025972 | Ga0207668_10039579 | Ga0207668_100395792 | 366 |
| 585 | 3300026075 | Ga0207708_10008089 | Ga0207708_100080898 | 366 |
| 586 | 3300026078 | Ga0207702_10096587 | Ga0207702_100965873 | 366 |
| 587 | 3300026089 | Ga0207648_10011231 | Ga0207648_100112319 | 366 |
| 588 | 3300026118 | Ga0207675_100008915 | Ga0207675_1000089153 | 366 |
| 589 | 3300026121 | Ga0207683_10002939 | Ga0207683_1000293912 | 366 |
| 590 | 3300027907 | Ga0207428_10008826 | Ga0207428_1000882610 | 366 |
| 591 | 3300027907 | Ga0207428_10030367 | Ga0207428_100303673 | 366 |
| 592 | 3300028381 | Ga0268264_10284109 | Ga0268264_102841091 | 366 |
| 593 | 3300031548 | Ga0307408_100171924 | Ga0307408_1001719242 | 366 |
| 594 | 3300035115 | Ga0373941_0006820 | Ga0373941_0006820_1122_2264 | 366 |
| 595 | 3300035241 | Ga0373961_0011677 | Ga0373961_0011677_370_1512 | 366 |
| 596 | 3300037312 | Ga0395899_0026219 | Ga0395899_0026219_3168_4286 | 366 |
| 597 | 3300037312 | Ga0395899_0058758 | Ga0395899_0058758_267_1388 | 366 |
| 598 | 3300037312 | Ga0395899_0075024 | Ga0395899_0075024_594_1715 | 366 |
| 599 | 3300037418 | Ga0395900_0003913 | Ga0395900_0003913_7816_8934 | 366 |
| 600 | 3300037418 | Ga0395900_0143369 | Ga0395900_0143369_162_1280 | 366 |
| 601 | 3300037418 | Ga0395900_0196645 | Ga0395900_0196645_122_1243 | 366 |
| 602 | 3300037466 | Ga0395898_0003410 | Ga0395898_0003410_15388_16506 | 366 |
| 603 | 3300037466 | Ga0395898_0007790 | Ga0395898_0007790_1987_3108 | 366 |
| 604 | 3300037466 | Ga0395898_0024102 | Ga0395898_0024102_3700_4821 | 366 |
| 605 | 3300037466 | Ga0395898_0057873 | Ga0395898_0057873_1369_2490 | 366 |
| 606 | 3300037466 | Ga0395898_0058510 | Ga0395898_0058510_1094_2215 | 366 |
| 607 | 3300037466 | Ga0395898_0171389 | Ga0395898_0171389_776_1897 | 366 |
| 608 | 3300037471 | Ga0395905_0001601 | Ga0395905_0001601_17446_18564 | 366 |
| 609 | 3300037471 | Ga0395905_0010973 | Ga0395905_0010973_408_1529 | 366 |
| 610 | 3300037471 | Ga0395905_0019921 | Ga0395905_0019921_1305_2426 | 366 |
| 611 | 3300037471 | Ga0395905_0122043 | Ga0395905_0122043_71_1189 | 366 |
| 612 | 3300038443 | Ga0395901_0000858 | Ga0395901_0000858_13239_14360 | 366 |
| 613 | 3300038443 | Ga0395901_0001826 | Ga0395901_0001826_2291_3412 | 366 |
| 614 | 3300038443 | Ga0395901_0003205 | Ga0395901_0003205_8672_9790 | 366 |
| 615 | 3300038443 | Ga0395901_0013196 | Ga0395901_0013196_4446_5567 | 366 |
| 616 | 3300038443 | Ga0395901_0024220 | Ga0395901_0024220_3992_5110 | 366 |
| 617 | 3300038443 | Ga0395901_0138446 | Ga0395901_0138446_86_1207 | 366 |
| 618 | 3300038443 | Ga0395901_0157899 | Ga0395901_0157899_987_2105 | 366 |
| 619 | 3300041443 | Ga0451789_0919425 | Ga0451789_0919425_192_1310 | 366 |
| 620 | 3300046461 | Ga0495641_0043455 | Ga0495641_0043455_645_1763 | 366 |
| 621 | 3300046473 | Ga0495582_0016729 | Ga0495582_0016729_1877_2995 | 366 |
| 622 | 3300046474 | Ga0495605_0019926 | Ga0495605_0019926_1369_2487 | 366 |
| 623 | 3300046476 | Ga0495662_0037839 | Ga0495662_0037839_520_1638 | 366 |
| 624 | 3300046477 | Ga0495664_0027095 | Ga0495664_0027095_2014_3138 | 366 |
| 625 | 3300046491 | Ga0495584_0072938 | Ga0495584_0072938_216_1334 | 366 |
| 626 | 3300046492 | Ga0495585_0131686 | Ga0495585_0131686_31_1149 | 366 |
| 627 | 3300046500 | Ga0495596_0071510 | Ga0495596_0071510_95_1213 | 366 |
| 628 | 3300046514 | Ga0495618_0032144 | Ga0495618_0032144_99_1223 | 366 |
| 629 | 3300046518 | Ga0495631_0071338 | Ga0495631_0071338_266_1384 | 366 |
| 630 | 3300046531 | Ga0495665_0036519 | Ga0495665_0036519_819_1937 | 366 |
| 631 | 3300046538 | Ga0495609_0037234 | Ga0495609_0037234_788_1906 | 366 |
| 632 | 3300046559 | Ga0495667_0037446 | Ga0495667_0037446_363_1487 | 366 |
| 633 | 3300046615 | Ga0495656_0017608 | Ga0495656_0017608_531_1649 | 366 |
| 634 | 3300046642 | Ga0495634_0021634 | Ga0495634_0021634_1373_2497 | 366 |
| 635 | 3300046690 | Ga0495624_0087499 | Ga0495624_0087499_638_1756 | 366 |
| 636 | 3300047315 | Ga0495581_0002109 | Ga0495581_0002109_6234_7352 | 366 |
| 637 | 3300047319 | Ga0495674_0004125 | Ga0495674_0004125_9576_10700 | 366 |
| 638 | 3300047322 | Ga0495680_0009703 | Ga0495680_0009703_4050_5174 | 366 |
| 639 | 3300047447 | Ga0495685_006549 | Ga0495685_006549_2507_3625 | 366 |
| 640 | 3300048903 | Ga0496100_0194447 | Ga0496100_0194447_178_1320 | 366 |
| 641 | 3300048904 | Ga0496101_0091491 | Ga0496101_0091491_677_1795 | 366 |
| 642 | 3300048906 | Ga0496103_0031627 | Ga0496103_0031627_2018_3136 | 366 |
| 643 | 3300048906 | Ga0496103_0087976 | Ga0496103_0087976_801_1919 | 366 |
| 644 | 3300048907 | Ga0496104_0058648 | Ga0496104_0058648_625_1743 | 366 |
| 645 | 3300048908 | Ga0496105_0020909 | Ga0496105_0020909_2217_3335 | 366 |
| 646 | 3300048909 | Ga0496106_0006351 | Ga0496106_0006351_633_1751 | 366 |
| 647 | 3300048911 | Ga0496108_0104882 | Ga0496108_0104882_609_1727 | 366 |
| 648 | 3300048911 | Ga0496108_0121102 | Ga0496108_0121102_1114_2232 | 366 |
| 649 | 3300048912 | Ga0496109_0022810 | Ga0496109_0022810_2061_3179 | 366 |
| 650 | 3300048912 | Ga0496109_0057043 | Ga0496109_0057043_575_1693 | 366 |
| 651 | 3300048915 | Ga0496112_0060665 | Ga0496112_0060665_1154_2272 | 366 |
| 652 | 3300048915 | Ga0496112_0488156 | Ga0496112_0488156_36_1154 | 366 |
| 653 | 3300048916 | Ga0496113_0029360 | Ga0496113_0029360_2074_3216 | 366 |
| 654 | 3300048916 | Ga0496113_0047236 | Ga0496113_0047236_744_1862 | 366 |
| 655 | 3300048916 | Ga0496113_0118181 | Ga0496113_0118181_556_1674 | 366 |
| 656 | 3300048917 | Ga0496114_0251776 | Ga0496114_0251776_421_1539 | 366 |
| 657 | 3300048918 | Ga0496115_0017242 | Ga0496115_0017242_2244_3362 | 366 |
| 658 | 3300048918 | Ga0496115_0057656 | Ga0496115_0057656_96_1214 | 366 |
| 659 | 3300050507 | nmdc:mga05p37_53795_c1 | nmdc:mga05p37_53795_c1_1394_2512 | 366 |
| 660 | 3300050510 | nmdc:mga06r32_11086_c1 | nmdc:mga06r32_11086_c1_5853_6971 | 366 |
| 661 | 3300050511 | nmdc:mga08y16_19969_c1 | nmdc:mga08y16_19969_c1_1086_2204 | 366 |
| 662 | 3300050511 | nmdc:mga08y16_284641_c1 | nmdc:mga08y16_284641_c1_480_1622 | 366 |
| 663 | 3300050513 | nmdc:mga0rr50_13489_c1 | nmdc:mga0rr50_13489_c1_2972_4090 | 366 |
| 664 | 3300050515 | nmdc:mga0a205_247804_c1 | nmdc:mga0a205_247804_c1_225_1349 | 366 |
| 665 | 3300050515 | nmdc:mga0a205_55410_c1 | nmdc:mga0a205_55410_c1_1937_3055 | 366 |
| 666 | 3300005329 | Ga0070683_100166019 | Ga0070683_1001660192 | 367 |
| 667 | 3300005337 | Ga0070682_100029174 | Ga0070682_1000291742 | 367 |
| 668 | 3300005337 | Ga0070682_100036730 | Ga0070682_1000367302 | 367 |
| 669 | 3300005338 | Ga0068868_100034278 | Ga0068868_1000342782 | 367 |
| 670 | 3300005341 | Ga0070691_10015848 | Ga0070691_100158483 | 367 |
| 671 | 3300005435 | Ga0070714_100030412 | Ga0070714_1000304123 | 367 |
| 672 | 3300005439 | Ga0070711_100005352 | Ga0070711_1000053524 | 367 |
| 673 | 3300005439 | Ga0070711_100041981 | Ga0070711_1000419811 | 367 |
| 674 | 3300005440 | Ga0070705_100016734 | Ga0070705_1000167343 | 367 |
| 675 | 3300005440 | Ga0070705_100081776 | Ga0070705_1000817762 | 367 |
| 676 | 3300005440 | Ga0070705_100083922 | Ga0070705_1000839222 | 367 |
| 677 | 3300005440 | Ga0070705_100161429 | Ga0070705_1001614292 | 367 |
| 678 | 3300005441 | Ga0070700_100060336 | Ga0070700_1000603361 | 367 |
| 679 | 3300005441 | Ga0070700_100070126 | Ga0070700_1000701262 | 367 |
| 680 | 3300005444 | Ga0070694_100040078 | Ga0070694_1000400783 | 367 |
| 681 | 3300005444 | Ga0070694_100075706 | Ga0070694_1000757062 | 367 |
| 682 | 3300005445 | Ga0070708_100073080 | Ga0070708_1000730802 | 367 |
| 683 | 3300005456 | Ga0070678_100237318 | Ga0070678_1002373182 | 367 |
| 684 | 3300005458 | Ga0070681_10174749 | Ga0070681_101747491 | 367 |
| 685 | 3300005468 | Ga0070707_100227414 | Ga0070707_1002274142 | 367 |
| 686 | 3300005530 | Ga0070679_100046291 | Ga0070679_1000462912 | 367 |
| 687 | 3300005535 | Ga0070684_100013149 | Ga0070684_1000131492 | 367 |
| 688 | 3300005535 | Ga0070684_100048627 | Ga0070684_1000486272 | 367 |
| 689 | 3300005544 | Ga0070686_100029186 | Ga0070686_1000291863 | 367 |
| 690 | 3300005545 | Ga0070695_100019884 | Ga0070695_1000198844 | 367 |
| 691 | 3300005546 | Ga0070696_100042589 | Ga0070696_1000425892 | 367 |
| 692 | 3300005546 | Ga0070696_100094204 | Ga0070696_1000942042 | 367 |
| 693 | 3300005547 | Ga0070693_100015911 | Ga0070693_1000159112 | 367 |
| 694 | 3300005547 | Ga0070693_100039488 | Ga0070693_1000394882 | 367 |
| 695 | 3300005549 | Ga0070704_100132297 | Ga0070704_1001322972 | 367 |
| 696 | 3300005549 | Ga0070704_100174758 | Ga0070704_1001747582 | 367 |
| 697 | 3300005563 | Ga0068855_100065248 | Ga0068855_1000652483 | 367 |
| 698 | 3300005564 | Ga0070664_100034719 | Ga0070664_1000347192 | 367 |
| 699 | 3300005577 | Ga0068857_100006535 | Ga0068857_1000065352 | 367 |
| 700 | 3300005577 | Ga0068857_100095260 | Ga0068857_1000952603 | 367 |
| 701 | 3300005614 | Ga0068856_100200382 | Ga0068856_1002003823 | 367 |
| 702 | 3300005615 | Ga0070702_100074984 | Ga0070702_1000749842 | 367 |
| 703 | 3300005983 | Ga0081540_1015602 | Ga0081540_10156024 | 367 |
| 704 | 3300006028 | Ga0070717_10115892 | Ga0070717_101158922 | 367 |
| 705 | 3300006163 | Ga0070715_10020079 | Ga0070715_100200792 | 367 |
| 706 | 3300006163 | Ga0070715_10052854 | Ga0070715_100528541 | 367 |
| 707 | 3300006358 | Ga0068871_100129862 | Ga0068871_1001298622 | 367 |
| 708 | 3300006852 | Ga0075433_10322230 | Ga0075433_103222302 | 367 |
| 709 | 3300006871 | Ga0075434_100010132 | Ga0075434_1000101327 | 367 |
| 710 | 3300006871 | Ga0075434_100075961 | Ga0075434_1000759612 | 367 |
| 711 | 3300006914 | Ga0075436_100003007 | Ga0075436_1000030072 | 367 |
| 712 | 3300006914 | Ga0075436_100003937 | Ga0075436_1000039374 | 367 |
| 713 | 3300007076 | Ga0075435_100012038 | Ga0075435_1000120387 | 367 |
| 714 | 3300007076 | Ga0075435_100064189 | Ga0075435_1000641891 | 367 |
| 715 | 3300007076 | Ga0075435_100180082 | Ga0075435_1001800822 | 367 |
| 716 | 3300009098 | Ga0105245_10326822 | Ga0105245_103268222 | 367 |
| 717 | 3300009147 | Ga0114129_10005673 | Ga0114129_100056737 | 367 |
| 718 | 3300009147 | Ga0114129_10181523 | Ga0114129_101815231 | 367 |
| 719 | 3300009147 | Ga0114129_10569990 | Ga0114129_105699902 | 367 |
| 720 | 3300009148 | Ga0105243_10017876 | Ga0105243_100178766 | 367 |
| 721 | 3300009148 | Ga0105243_10040745 | Ga0105243_100407452 | 367 |
| 722 | 3300009148 | Ga0105243_10127544 | Ga0105243_101275442 | 367 |
| 723 | 3300009148 | Ga0105243_10183473 | Ga0105243_101834732 | 367 |
| 724 | 3300009174 | Ga0105241_10039315 | Ga0105241_100393153 | 367 |
| 725 | 3300009176 | Ga0105242_10059277 | Ga0105242_100592771 | 367 |
| 726 | 3300009545 | Ga0105237_10250757 | Ga0105237_102507571 | 367 |
| 727 | 3300009551 | Ga0105238_10216597 | Ga0105238_102165972 | 367 |
| 728 | 3300011119 | Ga0105246_10039168 | Ga0105246_100391682 | 367 |
| 729 | 3300013297 | Ga0157378_10108371 | Ga0157378_101083712 | 367 |
| 730 | 3300013297 | Ga0157378_10200593 | Ga0157378_102005933 | 367 |
| 731 | 3300013306 | Ga0163162_10154367 | Ga0163162_101543673 | 367 |
| 732 | 3300013308 | Ga0157375_10036207 | Ga0157375_100362074 | 367 |
| 733 | 3300014326 | Ga0157380_10006605 | Ga0157380_100066053 | 367 |
| 734 | 3300014497 | Ga0182008_10041945 | Ga0182008_100419453 | 367 |
| 735 | 3300014969 | Ga0157376_10125268 | Ga0157376_101252682 | 367 |
| 736 | 3300025901 | Ga0207688_10151160 | Ga0207688_101511602 | 367 |
| 737 | 3300025910 | Ga0207684_10165453 | Ga0207684_101654532 | 367 |
| 738 | 3300025911 | Ga0207654_10188351 | Ga0207654_101883511 | 367 |
| 739 | 3300025912 | Ga0207707_10108903 | Ga0207707_101089033 | 367 |
| 740 | 3300025915 | Ga0207693_10000319 | Ga0207693_1000031934 | 367 |
| 741 | 3300025915 | Ga0207693_10004123 | Ga0207693_100041232 | 367 |
| 742 | 3300025915 | Ga0207693_10038611 | Ga0207693_100386113 | 367 |
| 743 | 3300025916 | Ga0207663_10004268 | Ga0207663_100042682 | 367 |
| 744 | 3300025916 | Ga0207663_10010470 | Ga0207663_100104705 | 367 |
| 745 | 3300025916 | Ga0207663_10190443 | Ga0207663_101904432 | 367 |
| 746 | 3300025921 | Ga0207652_10231005 | Ga0207652_102310052 | 367 |
| 747 | 3300025926 | Ga0207659_10284173 | Ga0207659_102841732 | 367 |
| 748 | 3300025927 | Ga0207687_10049497 | Ga0207687_100494973 | 367 |
| 749 | 3300025927 | Ga0207687_10116444 | Ga0207687_101164442 | 367 |
| 750 | 3300025928 | Ga0207700_10062381 | Ga0207700_100623812 | 367 |
| 751 | 3300025929 | Ga0207664_10091349 | Ga0207664_100913492 | 367 |
| 752 | 3300025933 | Ga0207706_10003832 | Ga0207706_1000383215 | 367 |
| 753 | 3300025933 | Ga0207706_10029343 | Ga0207706_100293434 | 367 |
| 754 | 3300025935 | Ga0207709_10010998 | Ga0207709_100109983 | 367 |
| 755 | 3300025939 | Ga0207665_10002255 | Ga0207665_100022553 | 367 |
| 756 | 3300025939 | Ga0207665_10007220 | Ga0207665_100072202 | 367 |
| 757 | 3300025939 | Ga0207665_10008529 | Ga0207665_100085296 | 367 |
| 758 | 3300025940 | Ga0207691_10009218 | Ga0207691_100092181 | 367 |
| 759 | 3300025944 | Ga0207661_10101276 | Ga0207661_101012762 | 367 |
| 760 | 3300025945 | Ga0207679_10140877 | Ga0207679_101408772 | 367 |
| 761 | 3300026075 | Ga0207708_10048525 | Ga0207708_100485252 | 367 |
| 762 | 3300026078 | Ga0207702_10019118 | Ga0207702_100191184 | 367 |
| 763 | 3300026078 | Ga0207702_10105669 | Ga0207702_101056692 | 367 |
| 764 | 3300026088 | Ga0207641_10292795 | Ga0207641_102927952 | 367 |
| 765 | 3300026089 | Ga0207648_10002132 | Ga0207648_1000213222 | 367 |
| 766 | 3300026095 | Ga0207676_10045001 | Ga0207676_100450013 | 367 |
| 767 | 3300026116 | Ga0207674_10011029 | Ga0207674_1001102910 | 367 |
| 768 | 3300026116 | Ga0207674_10026840 | Ga0207674_100268402 | 367 |
| 769 | 3300026118 | Ga0207675_100005440 | Ga0207675_1000054402 | 367 |
| 770 | 3300026118 | Ga0207675_100052680 | Ga0207675_1000526802 | 367 |
| 771 | 3300026121 | Ga0207683_10028451 | Ga0207683_100284517 | 367 |
| 772 | 3300026121 | Ga0207683_10029373 | Ga0207683_100293732 | 367 |
| 773 | 3300026121 | Ga0207683_10032077 | Ga0207683_100320773 | 367 |
| 774 | 3300026121 | Ga0207683_10085471 | Ga0207683_100854713 | 367 |
| 775 | 3300026121 | Ga0207683_10137693 | Ga0207683_101376932 | 367 |
| 776 | 3300026142 | Ga0207698_10066827 | Ga0207698_100668272 | 367 |
| 777 | 3300028380 | Ga0268265_10311239 | Ga0268265_103112391 | 367 |
| 778 | 3300031901 | Ga0307406_10230486 | Ga0307406_102304862 | 367 |
| 779 | 3300034957 | Ga0373938_0010324 | Ga0373938_0010324_192_1316 | 367 |
| 780 | 3300035092 | Ga0373952_0015557 | Ga0373952_0015557_149_1273 | 367 |
| 781 | 3300035114 | Ga0373939_0027186 | Ga0373939_0027186_295_1419 | 367 |
| 782 | 3300035115 | Ga0373941_0011420 | Ga0373941_0011420_1058_2182 | 367 |
| 783 | 3300035121 | Ga0373960_0018728 | Ga0373960_0018728_517_1641 | 367 |
| 784 | 3300035170 | Ga0373943_0065060 | Ga0373943_0065060_665_1801 | 367 |
| 785 | 3300035242 | Ga0373962_0003254 | Ga0373962_0003254_421_1545 | 367 |
| 786 | 3300035691 | Ga0373931_0006393 | Ga0373931_0006393_1305_2429 | 367 |
| 787 | 3300037068 | Ga0373925_0107961 | Ga0373925_0107961_656_1792 | 367 |
| 788 | 3300037312 | Ga0395899_0030436 | Ga0395899_0030436_267_1391 | 367 |
| 789 | 3300037312 | Ga0395899_0046995 | Ga0395899_0046995_1401_2525 | 367 |
| 790 | 3300037312 | Ga0395899_0076944 | Ga0395899_0076944_356_1480 | 367 |
| 791 | 3300037312 | Ga0395899_0114276 | Ga0395899_0114276_587_1723 | 367 |
| 792 | 3300037312 | Ga0395899_0123955 | Ga0395899_0123955_606_1730 | 367 |
| 793 | 3300037418 | Ga0395900_0000838 | Ga0395900_0000838_30449_31699 | 367 |
| 794 | 3300037418 | Ga0395900_0003636 | Ga0395900_0003636_1846_2982 | 367 |
| 795 | 3300037418 | Ga0395900_0013052 | Ga0395900_0013052_356_1480 | 367 |
| 796 | 3300037418 | Ga0395900_0106472 | Ga0395900_0106472_261_1385 | 367 |
| 797 | 3300037418 | Ga0395900_0112371 | Ga0395900_0112371_1504_2628 | 367 |
| 798 | 3300037466 | Ga0395898_0001212 | Ga0395898_0001212_18503_19753 | 367 |
| 799 | 3300037466 | Ga0395898_0007007 | Ga0395898_0007007_9157_10281 | 367 |
| 800 | 3300037466 | Ga0395898_0015434 | Ga0395898_0015434_1858_2982 | 367 |
| 801 | 3300037466 | Ga0395898_0031435 | Ga0395898_0031435_1904_3028 | 367 |
| 802 | 3300037466 | Ga0395898_0039393 | Ga0395898_0039393_3288_4412 | 367 |
| 803 | 3300037466 | Ga0395898_0097804 | Ga0395898_0097804_1211_2347 | 367 |
| 804 | 3300037466 | Ga0395898_0116142 | Ga0395898_0116142_1151_2275 | 367 |
| 805 | 3300037471 | Ga0395905_0001928 | Ga0395905_0001928_13392_14642 | 367 |
| 806 | 3300037471 | Ga0395905_0011189 | Ga0395905_0011189_6554_7678 | 367 |
| 807 | 3300037471 | Ga0395905_0026059 | Ga0395905_0026059_4162_5298 | 367 |
| 808 | 3300037471 | Ga0395905_0105086 | Ga0395905_0105086_1308_2432 | 367 |
| 809 | 3300037471 | Ga0395905_0126128 | Ga0395905_0126128_1115_2239 | 367 |
| 810 | 3300038443 | Ga0395901_0003231 | Ga0395901_0003231_9939_11189 | 367 |
| 811 | 3300038443 | Ga0395901_0003420 | Ga0395901_0003420_10699_11835 | 367 |
| 812 | 3300038443 | Ga0395901_0037382 | Ga0395901_0037382_3418_4545 | 367 |
| 813 | 3300038443 | Ga0395901_0055287 | Ga0395901_0055287_1982_3109 | 367 |
| 814 | 3300038443 | Ga0395901_0080971 | Ga0395901_0080971_1936_3060 | 367 |
| 815 | 3300038443 | Ga0395901_0244308 | Ga0395901_0244308_460_1584 | 367 |
| 816 | 3300038443 | Ga0395901_0320598 | Ga0395901_0320598_23_1147 | 367 |
| 817 | 3300041443 | Ga0451789_0528223 | Ga0451789_0528223_289_1413 | 367 |
| 818 | 3300041459 | Ga0451800_1267821 | Ga0451800_1267821_454_1578 | 367 |
| 819 | 3300041492 | Ga0451835_0383021 | Ga0451835_0383021_595_1719 | 367 |
| 820 | 3300041496 | Ga0451839_0194646 | Ga0451839_0194646_470_1594 | 367 |
| 821 | 3300041505 | Ga0451849_0045844 | Ga0451849_0045844_483_1607 | 367 |
| 822 | 3300041507 | Ga0451851_0849119 | Ga0451851_0849119_596_1720 | 367 |
| 823 | 3300044706 | Ga0466964_0000352 | Ga0466964_0000352_7907_9031 | 367 |
| 824 | 3300044735 | Ga0466968_0041575 | Ga0466968_0041575_669_1787 | 367 |
| 825 | 3300044901 | Ga0466960_0003012 | Ga0466960_0003012_3004_4128 | 367 |
| 826 | 3300045051 | Ga0451576_0022984 | Ga0451576_0022984_151_1290 | 367 |
| 827 | 3300046455 | Ga0495603_0001231 | Ga0495603_0001231_12893_14029 | 367 |
| 828 | 3300046455 | Ga0495603_0013603 | Ga0495603_0013603_454_1578 | 367 |
| 829 | 3300046455 | Ga0495603_0041622 | Ga0495603_0041622_1480_2616 | 367 |
| 830 | 3300046461 | Ga0495641_0002482 | Ga0495641_0002482_11375_12511 | 367 |
| 831 | 3300046461 | Ga0495641_0057609 | Ga0495641_0057609_169_1293 | 367 |
| 832 | 3300046473 | Ga0495582_0014295 | Ga0495582_0014295_624_1748 | 367 |
| 833 | 3300046491 | Ga0495584_0010544 | Ga0495584_0010544_828_1952 | 367 |
| 834 | 3300046499 | Ga0495594_0001036 | Ga0495594_0001036_10823_11959 | 367 |
| 835 | 3300046500 | Ga0495596_0073991 | Ga0495596_0073991_39_1175 | 367 |
| 836 | 3300046517 | Ga0495630_0003323 | Ga0495630_0003323_3825_4931 | 367 |
| 837 | 3300046517 | Ga0495630_0031468 | Ga0495630_0031468_1220_2344 | 367 |
| 838 | 3300046523 | Ga0495644_0032726 | Ga0495644_0032726_809_1933 | 367 |
| 839 | 3300046525 | Ga0495663_0011150 | Ga0495663_0011150_1172_2296 | 367 |
| 840 | 3300046535 | Ga0495586_0070615 | Ga0495586_0070615_618_1742 | 367 |
| 841 | 3300046538 | Ga0495609_0014755 | Ga0495609_0014755_2515_3639 | 367 |
| 842 | 3300046538 | Ga0495609_0064070 | Ga0495609_0064070_250_1374 | 367 |
| 843 | 3300046674 | Ga0495588_0000812 | Ga0495588_0000812_2320_3456 | 367 |
| 844 | 3300046674 | Ga0495588_0056635 | Ga0495588_0056635_218_1342 | 367 |
| 845 | 3300046674 | Ga0495588_0122311 | Ga0495588_0122311_93_1217 | 367 |
| 846 | 3300046681 | Ga0495647_0041893 | Ga0495647_0041893_388_1512 | 367 |
| 847 | 3300046684 | Ga0495669_0015201 | Ga0495669_0015201_491_1615 | 367 |
| 848 | 3300047315 | Ga0495581_0017160 | Ga0495581_0017160_1249_2373 | 367 |
| 849 | 3300047315 | Ga0495581_0037888 | Ga0495581_0037888_738_1874 | 367 |
| 850 | 3300047319 | Ga0495674_0000010 | Ga0495674_0000010_15383_16507 | 367 |
| 851 | 3300047321 | Ga0495676_0006975 | Ga0495676_0006975_9188_10324 | 367 |
| 852 | 3300047321 | Ga0495676_0138506 | Ga0495676_0138506_33_1157 | 367 |
| 853 | 3300048903 | Ga0496100_0106876 | Ga0496100_0106876_303_1427 | 367 |
| 854 | 3300048904 | Ga0496101_0028279 | Ga0496101_0028279_1109_2242 | 367 |
| 855 | 3300048904 | Ga0496101_0065408 | Ga0496101_0065408_732_1868 | 367 |
| 856 | 3300048904 | Ga0496101_0163244 | Ga0496101_0163244_560_1684 | 367 |
| 857 | 3300048905 | Ga0496102_0023351 | Ga0496102_0023351_4332_5456 | 367 |
| 858 | 3300048905 | Ga0496102_0070584 | Ga0496102_0070584_918_2054 | 367 |
| 859 | 3300048906 | Ga0496103_0041804 | Ga0496103_0041804_1515_2651 | 367 |
| 860 | 3300048907 | Ga0496104_0001337 | Ga0496104_0001337_1622_2803 | 367 |
| 861 | 3300048907 | Ga0496104_0005710 | Ga0496104_0005710_8612_9745 | 367 |
| 862 | 3300048907 | Ga0496104_0012539 | Ga0496104_0012539_6399_7523 | 367 |
| 863 | 3300048907 | Ga0496104_0018592 | Ga0496104_0018592_4417_5553 | 367 |
| 864 | 3300048908 | Ga0496105_0003041 | Ga0496105_0003041_3784_4965 | 367 |
| 865 | 3300048908 | Ga0496105_0031958 | Ga0496105_0031958_2601_3734 | 367 |
| 866 | 3300048908 | Ga0496105_0084535 | Ga0496105_0084535_16_1140 | 367 |
| 867 | 3300048909 | Ga0496106_0026150 | Ga0496106_0026150_2595_3764 | 367 |
| 868 | 3300048909 | Ga0496106_0070837 | Ga0496106_0070837_361_1494 | 367 |
| 869 | 3300048909 | Ga0496106_0113253 | Ga0496106_0113253_237_1373 | 367 |
| 870 | 3300048910 | Ga0496107_0004496 | Ga0496107_0004496_1355_2488 | 367 |
| 871 | 3300048911 | Ga0496108_0000272 | Ga0496108_0000272_32629_33810 | 367 |
| 872 | 3300048911 | Ga0496108_0012780 | Ga0496108_0012780_326_1450 | 367 |
| 873 | 3300048911 | Ga0496108_0067233 | Ga0496108_0067233_853_1986 | 367 |
| 874 | 3300048912 | Ga0496109_0001933 | Ga0496109_0001933_7355_8536 | 367 |
| 875 | 3300048912 | Ga0496109_0039781 | Ga0496109_0039781_627_1751 | 367 |
| 876 | 3300048912 | Ga0496109_0093185 | Ga0496109_0093185_584_1708 | 367 |
| 877 | 3300048913 | Ga0496110_0000746 | Ga0496110_0000746_6218_7399 | 367 |
| 878 | 3300048913 | Ga0496110_0011829 | Ga0496110_0011829_5065_6198 | 367 |
| 879 | 3300048913 | Ga0496110_0056199 | Ga0496110_0056199_2175_3299 | 367 |
| 880 | 3300048913 | Ga0496110_0076452 | Ga0496110_0076452_301_1437 | 367 |
| 881 | 3300048914 | Ga0496111_0000499 | Ga0496111_0000499_8368_9549 | 367 |
| 882 | 3300048914 | Ga0496111_0033102 | Ga0496111_0033102_1316_2440 | 367 |
| 883 | 3300048914 | Ga0496111_0058869 | Ga0496111_0058869_1171_2295 | 367 |
| 884 | 3300048915 | Ga0496112_0001182 | Ga0496112_0001182_8446_9627 | 367 |
| 885 | 3300048915 | Ga0496112_0021074 | Ga0496112_0021074_4893_6026 | 367 |
| 886 | 3300048915 | Ga0496112_0096105 | Ga0496112_0096105_854_1978 | 367 |
| 887 | 3300048915 | Ga0496112_0137566 | Ga0496112_0137566_169_1305 | 367 |
| 888 | 3300048916 | Ga0496113_0000040 | Ga0496113_0000040_42573_43754 | 367 |
| 889 | 3300048916 | Ga0496113_0004976 | Ga0496113_0004976_682_1815 | 367 |
| 890 | 3300048917 | Ga0496114_0030568 | Ga0496114_0030568_1141_2322 | 367 |
| 891 | 3300048917 | Ga0496114_0039640 | Ga0496114_0039640_2599_3723 | 367 |
| 892 | 3300048918 | Ga0496115_0070347 | Ga0496115_0070347_1610_2734 | 367 |
| 893 | 3300049576 | Ga0501040_0022023 | Ga0501040_0022023_1795_2925 | 367 |
| 894 | 3300049588 | Ga0501072_0150155 | Ga0501072_0150155_41_1171 | 367 |
| 895 | 3300050507 | nmdc:mga05p37_148675_c1 | nmdc:mga05p37_148675_c1_1604_2728 | 367 |
| 896 | 3300050507 | nmdc:mga05p37_4144_c2 | nmdc:mga05p37_4144_c2_14907_16031 | 367 |
| 897 | 3300050507 | nmdc:mga05p37_45059_c1 | nmdc:mga05p37_45059_c1_17_1141 | 367 |
| 898 | 3300050509 | nmdc:mga0qj67_65425_c1 | nmdc:mga0qj67_65425_c1_1298_2422 | 367 |
| 899 | 3300050512 | nmdc:mga0n895_217996_c1 | nmdc:mga0n895_217996_c1_571_1695 | 367 |
| 900 | 3300050513 | nmdc:mga0rr50_55552_c1 | nmdc:mga0rr50_55552_c1_823_1947 | 367 |
| 901 | 3300050513 | nmdc:mga0rr50_78467_c1 | nmdc:mga0rr50_78467_c1_1324_2529 | 367 |
| 902 | 3300050514 | nmdc:mga08x19_2647_c1 | nmdc:mga08x19_2647_c1_8631_9755 | 367 |
| 903 | 3300050515 | nmdc:mga0a205_120264_c1 | nmdc:mga0a205_120264_c1_1283_2407 | 367 |
| 904 | 3300050515 | nmdc:mga0a205_252300_c1 | nmdc:mga0a205_252300_c1_381_1586 | 367 |
| 905 | 3300050515 | nmdc:mga0a205_89899_c1 | nmdc:mga0a205_89899_c1_346_1470 | 367 |
| 906 | 3300053077 | Ga0495601_0007612 | Ga0495601_0007612_346_1452 | 367 |
| 907 | 3300053085 | Ga0495619_0000507 | Ga0495619_0000507_1042_2148 | 367 |
| 908 | 3300053085 | Ga0495619_0001017 | Ga0495619_0001017_11575_12678 | 367 |
| 909 | 3300005468 | Ga0070707_100001917 | Ga0070707_10000191716 | 368 |
| 910 | 3300005471 | Ga0070698_100062959 | Ga0070698_1000629593 | 368 |
| 911 | 3300005983 | Ga0081540_1003071 | Ga0081540_10030718 | 368 |
| 912 | 3300005985 | Ga0081539_10006606 | Ga0081539_100066063 | 368 |
| 913 | 3300026075 | Ga0207708_10143876 | Ga0207708_101438762 | 368 |
| 914 | 3300037466 | Ga0395898_0033701 | Ga0395898_0033701_2409_3545 | 368 |
| 915 | 3300038443 | Ga0395901_0306200 | Ga0395901_0306200_426_1598 | 368 |
| 916 | 3300048913 | Ga0496110_0111152 | Ga0496110_0111152_322_1464 | 368 |
| 917 | 3300048915 | Ga0496112_0264118 | Ga0496112_0264118_274_1410 | 368 |
| 918 | 3300049568 | Ga0501031_0027314 | Ga0501031_0027314_366_1505 | 368 |
| 919 | 3300049585 | Ga0501069_0027636 | Ga0501069_0027636_121_1260 | 368 |
| 920 | 3300049586 | Ga0501070_0014204 | Ga0501070_0014204_1105_2244 | 368 |
| 921 | 3300049743 | Ga0501081_0004576 | Ga0501081_0004576_7505_8644 | 368 |
| 922 | 3300049824 | Ga0501045_0010111 | Ga0501045_0010111_4279_5418 | 368 |
| 923 | 3300005435 | Ga0070714_100067633 | Ga0070714_1000676333 | 369 |
| 924 | 3300005458 | Ga0070681_10150198 | Ga0070681_101501982 | 369 |
| 925 | 3300005467 | Ga0070706_100124960 | Ga0070706_1001249602 | 369 |
| 926 | 3300005536 | Ga0070697_100185522 | Ga0070697_1001855222 | 369 |
| 927 | 3300005937 | Ga0081455_10014238 | Ga0081455_100142386 | 369 |
| 928 | 3300013102 | Ga0157371_10162431 | Ga0157371_101624312 | 369 |
| 929 | 3300013104 | Ga0157370_10116274 | Ga0157370_101162743 | 369 |
| 930 | 3300013105 | Ga0157369_10002618 | Ga0157369_1000261811 | 369 |
| 931 | 3300013297 | Ga0157378_10044141 | Ga0157378_100441413 | 369 |
| 932 | 3300025915 | Ga0207693_10126291 | Ga0207693_101262912 | 369 |
| 933 | 3300025940 | Ga0207691_10195473 | Ga0207691_101954732 | 369 |
| 934 | 3300035116 | Ga0373945_0003511 | Ga0373945_0003511_163_1287 | 369 |
| 935 | 3300035170 | Ga0373943_0034514 | Ga0373943_0034514_1080_2204 | 369 |
| 936 | 3300035171 | Ga0373946_0014769 | Ga0373946_0014769_1135_2259 | 369 |
| 937 | 3300035725 | Ga0373947_0000237 | Ga0373947_0000237_20668_21792 | 369 |
| 938 | 3300037068 | Ga0373925_0002356 | Ga0373925_0002356_12527_13651 | 369 |
| 939 | 3300041512 | Ga0451853_3599974 | Ga0451853_3599974_637_1779 | 369 |
| 940 | 3300044706 | Ga0466964_0004673 | Ga0466964_0004673_1187_2329 | 369 |
| 941 | 3300046459 | Ga0495629_0002746 | Ga0495629_0002746_1411_2535 | 369 |
| 942 | 3300046461 | Ga0495641_0004633 | Ga0495641_0004633_6714_7838 | 369 |
| 943 | 3300046463 | Ga0495653_0170490 | Ga0495653_0170490_22_1146 | 369 |
| 944 | 3300046473 | Ga0495582_0001422 | Ga0495582_0001422_1733_2857 | 369 |
| 945 | 3300046475 | Ga0495639_0001181 | Ga0495639_0001181_8880_10004 | 369 |
| 946 | 3300046476 | Ga0495662_0003046 | Ga0495662_0003046_1862_2986 | 369 |
| 947 | 3300046517 | Ga0495630_0024498 | Ga0495630_0024498_3106_4230 | 369 |
| 948 | 3300046526 | Ga0495666_0099635 | Ga0495666_0099635_230_1354 | 369 |
| 949 | 3300046531 | Ga0495665_0002651 | Ga0495665_0002651_4364_5488 | 369 |
| 950 | 3300046559 | Ga0495667_0048893 | Ga0495667_0048893_358_1482 | 369 |
| 951 | 3300046663 | Ga0495635_0074004 | Ga0495635_0074004_252_1376 | 369 |
| 952 | 3300046683 | Ga0495658_0000794 | Ga0495658_0000794_4371_5495 | 369 |
| 953 | 3300046689 | Ga0495613_0014803 | Ga0495613_0014803_2119_3243 | 369 |
| 954 | 3300046690 | Ga0495624_0013790 | Ga0495624_0013790_2468_3592 | 369 |
| 955 | 3300047315 | Ga0495581_0000542 | Ga0495581_0000542_2807_3931 | 369 |
| 956 | 3300047319 | Ga0495674_0192849 | Ga0495674_0192849_179_1303 | 369 |
| 957 | 3300047321 | Ga0495676_0000583 | Ga0495676_0000583_19226_20350 | 369 |
| 958 | 3300047322 | Ga0495680_0015897 | Ga0495680_0015897_4072_5196 | 369 |
| 959 | 3300047471 | Ga0495684_0025947 | Ga0495684_0025947_645_1769 | 369 |
| 960 | 3300047673 | Ga0495593_0034402 | Ga0495593_0034402_62_1186 | 369 |
| 961 | 3300048089 | Ga0495614_0010208 | Ga0495614_0010208_1544_2668 | 369 |
| 962 | 3300048912 | Ga0496109_0024331 | Ga0496109_0024331_1198_2349 | 369 |
| 963 | 3300049583 | Ga0501067_0003396 | Ga0501067_0003396_6938_8092 | 369 |
| 964 | 3300049584 | Ga0501068_0001181 | Ga0501068_0001181_4320_5474 | 369 |
| 965 | 3300049585 | Ga0501069_0002399 | Ga0501069_0002399_4044_5198 | 369 |
| 966 | 3300049587 | Ga0501071_0018729 | Ga0501071_0018729_556_1710 | 369 |
| 967 | 3300053085 | Ga0495619_0002571 | Ga0495619_0002571_3652_4776 | 369 |
| 968 | 3300005467 | Ga0070706_100036466 | Ga0070706_1000364664 | 370 |
| 969 | 3300005471 | Ga0070698_100151900 | Ga0070698_1001519002 | 370 |
| 970 | 3300005518 | Ga0070699_100192617 | Ga0070699_1001926172 | 370 |
| 971 | 3300005563 | Ga0068855_100061321 | Ga0068855_1000613213 | 370 |
| 972 | 3300005618 | Ga0068864_100339051 | Ga0068864_1003390512 | 370 |
| 973 | 3300005719 | Ga0068861_100007901 | Ga0068861_1000079011 | 370 |
| 974 | 3300005937 | Ga0081455_10014350 | Ga0081455_100143506 | 370 |
| 975 | 3300006914 | Ga0075436_100022390 | Ga0075436_1000223904 | 370 |
| 976 | 3300009094 | Ga0111539_10252067 | Ga0111539_102520672 | 370 |
| 977 | 3300009098 | Ga0105245_10073970 | Ga0105245_100739703 | 370 |
| 978 | 3300009147 | Ga0114129_10117688 | Ga0114129_101176882 | 370 |
| 979 | 3300009148 | Ga0105243_10225101 | Ga0105243_102251011 | 370 |
| 980 | 3300010375 | Ga0105239_10041625 | Ga0105239_100416255 | 370 |
| 981 | 3300010375 | Ga0105239_10279800 | Ga0105239_102798002 | 370 |
| 982 | 3300013306 | Ga0163162_10056437 | Ga0163162_100564374 | 370 |
| 983 | 3300013307 | Ga0157372_10481927 | Ga0157372_104819271 | 370 |
| 984 | 3300025910 | Ga0207684_10056353 | Ga0207684_100563532 | 370 |
| 985 | 3300025933 | Ga0207706_10073803 | Ga0207706_100738032 | 370 |
| 986 | 3300025972 | Ga0207668_10179823 | Ga0207668_101798232 | 370 |
| 987 | 3300026118 | Ga0207675_100092869 | Ga0207675_1000928693 | 370 |
| 988 | 3300027907 | Ga0207428_10005252 | Ga0207428_1000525212 | 370 |
| 989 | 3300035170 | Ga0373943_0005293 | Ga0373943_0005293_4263_5411 | 370 |
| 990 | 3300035695 | Ga0373927_0045554 | Ga0373927_0045554_106_1254 | 370 |
| 991 | 3300037068 | Ga0373925_0093770 | Ga0373925_0093770_145_1293 | 370 |
| 992 | 3300037312 | Ga0395899_0010815 | Ga0395899_0010815_3416_4567 | 370 |
| 993 | 3300037418 | Ga0395900_0008263 | Ga0395900_0008263_8481_9632 | 370 |
| 994 | 3300037466 | Ga0395898_0007049 | Ga0395898_0007049_9502_10653 | 370 |
| 995 | 3300037471 | Ga0395905_0004549 | Ga0395905_0004549_9989_11140 | 370 |
| 996 | 3300038443 | Ga0395901_0006476 | Ga0395901_0006476_7770_8921 | 370 |
| 997 | 3300042439 | Ga0439464_0036941 | Ga0439464_0036941_190_1335 | 370 |
| 998 | 3300045976 | Ga0466967_0022717 | Ga0466967_0022717_1335_2486 | 370 |
| 999 | 3300046517 | Ga0495630_0155911 | Ga0495630_0155911_469_1617 | 370 |
| 1000 | 3300047321 | Ga0495676_0037005 | Ga0495676_0037005_905_2053 | 370 |
| 1001 | 3300050508 | nmdc:mga09592_135586_c1 | nmdc:mga09592_135586_c1_194_1339 | 370 |
| 1002 | 3300050512 | nmdc:mga0n895_13560_c1 | nmdc:mga0n895_13560_c1_2020_3165 | 370 |
| 1003 | 3300050513 | nmdc:mga0rr50_38904_c1 | nmdc:mga0rr50_38904_c1_2258_3403 | 370 |
| 1004 | 3300050515 | nmdc:mga0a205_68871_c1 | nmdc:mga0a205_68871_c1_2262_3407 | 370 |
| 1005 | 3300046529 | Ga0495652_0124915 | Ga0495652_0124915_487_1611 | 371 |
| 1006 | 3300048088 | Ga0495602_0113494 | Ga0495602_0113494_61_1179 | 371 |
| 1007 | 3300048907 | Ga0496104_0000133 | Ga0496104_0000133_45391_46515 | 371 |
| 1008 | 3300048908 | Ga0496105_0000595 | Ga0496105_0000595_18696_19820 | 371 |
| 1009 | 3300053077 | Ga0495601_0041154 | Ga0495601_0041154_1385_2509 | 371 |
| 1010 | 3300037418 | Ga0395900_0070002 | Ga0395900_0070002_683_1840 | 372 |
| 1011 | 3300037466 | Ga0395898_0346758 | Ga0395898_0346758_246_1403 | 372 |
| 1012 | 3300001979 | JGI24740J21852_10001919 | JGI24740J21852_100019195 | 374 |
| 1013 | 3300009101 | Ga0105247_10002698 | Ga0105247_100026982 | 374 |
| 1014 | 3300009176 | Ga0105242_10006738 | Ga0105242_100067386 | 374 |
| 1015 | 3300025900 | Ga0207710_10000179 | Ga0207710_1000017992 | 374 |
| 1016 | 3300025934 | Ga0207686_10002316 | Ga0207686_100023166 | 374 |
| 1017 | 3300046543 | Ga0495645_0057702 | Ga0495645_0057702_1609_2736 | 374 |
| 1018 | 3300048907 | Ga0496104_0000015 | Ga0496104_0000015_174434_175567 | 374 |
| 1019 | 3300048908 | Ga0496105_0000004 | Ga0496105_0000004_300232_301365 | 374 |
| 1020 | 3300048922 | Ga0496119_0019718 | Ga0496119_0019718_1530_2663 | 374 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3rza-assembly1.cif.gz_B | crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. aureus mu50 at 2.10 a resolution | 0.9269 | 3 | 367 |
| 3rza-assembly1.cif.gz_B | crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. aureus mu50 at 2.10 a resolution | 0.9057 | 3 | 367 |
| 3gb0-assembly1.cif.gz_A-2 | crystal structure of aminopeptidase pept (np_980509.1) from bacillus cereus atcc 10987 at 2.04 a resolution | 0.8748 | 3 | 363 |
| 3gb0-assembly1.cif.gz_A-2 | crystal structure of aminopeptidase pept (np_980509.1) from bacillus cereus atcc 10987 at 2.04 a resolution | 0.8468 | 3 | 363 |
| 1fno-assembly1.cif.gz_A-2 | peptidase t (tripeptidase) | 0.8278 | 1 | 367 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3gb0A02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9545 | 174 | 281 | 3.30.70.360 |
| 3gb0A01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9426 | 3 | 363 | 3.40.630.10 |
| 3gb0A02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9202 | 174 | 281 | 3.30.70.360 |
| 3gb0A01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9032 | 3 | 363 | 3.40.630.10 |
| 3io1B02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8801 | 174 | 281 | 3.30.70.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0TJG2-F1-model_v4 | Peptidase dimerization domain-containing protein | 0.9825 | 151 | 367 |
|
| AF-A0A1F5BLI0-F1-model_v4 | Peptidase M20 dimerisation domain-containing protein | 0.9753 | 3 | 362 |
GO:0004177
GO:0046872 |
| AF-A0A7W0APW2-F1-model_v4 | M20/M25/M40 family metallo-hydrolase | 0.9679 | 52 | 371 |
GO:0006508
GO:0008237 |
| AF-A0A7W7MJ24-F1-model_v4 | Tripeptide aminopeptidase (EC 3.4.11.4) | 0.9666 | 3 | 365 |
GO:0045148
GO:0046872 |
| AF-A0A0T6A5U6-F1-model_v4 | Peptidase T-like protein | 0.966 | 3 | 367 |
GO:0004177
GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar