F488371

General Info

Members Datasets Scaffolds Average Seq Length
1020 338 1020 372

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0000838|Ga0395900_0000838_30449_31699
Length 416
Sequence LALRTLQLSLSLTQFPVVLAELFRRRAGSSPRCQDRLVQRPGWAPDALSLFVELAALPSPSGEERAVADRVLDYLRALGLEVDEDDTGARIGSTMGNLLCRLEPRGNGDGAPLFFCAHLDTVPPEGPIEPVVGEDGIVRNGAGTILGADDKSAVAAMLEAAARLVEDGRPHAGVELLFTPKEEVGLVGAAAFDENRLAARLGYVYDHAGPVGEVIVGAPYQQKLDVHFRGRAAHAGMYPEEGRSAIAAAARAIADLRLGRLDEETSANVGRIEGGTARNVIPEHCRLAAEARSHDERKLADLVQEMLDTVTFAASLAECEVETQVAPASRGYRFRRDAEAVELAASALARVGREPSFVLSGGGADANVFNERGLQCVNLANGMTDIHTPDERIAVDDLEAMVDVTLALVDEAARRA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
160 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
161 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
162 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
163 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
166 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
167 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
168 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
169 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
170 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
171 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
172 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
183 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
186 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
187 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
192 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
206 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
207 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
208 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
209 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
210 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
211 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
212 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
213 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
214 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
219 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
220 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
221 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
222 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
228 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
233 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
234 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
237 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
238 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
239 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
240 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
241 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
242 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
243 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
244 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
248 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
249 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
250 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
251 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
252 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
253 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
256 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
258 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
259 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
260 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
261 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
262 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
263 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
264 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
265 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
266 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
267 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
268 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
269 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
270 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
271 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
272 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
273 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
274 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
275 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
276 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
279 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
280 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
281 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
282 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
283 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
284 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
285 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
286 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
293 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
294 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
295 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
296 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
297 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
298 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
299 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
300 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
301 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
302 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
303 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
310 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
311 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
312 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
313 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
314 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
315 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
316 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
317 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
318 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
319 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
320 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
321 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
322 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
323 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
324 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
325 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
328 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
329 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
330 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
331 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
332 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
333 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
334 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
335 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
336 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
337 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
338 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.98
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 11.37
Rhizosphere 87.75
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001919 3300001979 Bacteria 9526
2 Ga0070658_10001917 3300005327 Bacteria 17524
3 Ga0070658_10009008 3300005327 Bacteria 8024
4 Ga0070658_10010832 3300005327 Bacteria 7310
5 Ga0070683_100122099 3300005329 Bacteria 2461
6 Ga0070683_100166019 3300005329 Bacteria 2095
7 Ga0070690_100021377 3300005330 Bacteria 3950
8 Ga0068869_100102301 3300005334 Bacteria 2168
9 Ga0070680_100079285 3300005336 Bacteria 2706
10 Ga0070680_100115905 3300005336 Bacteria 2233
11 Ga0070680_100212999 3300005336 Bacteria 1630
12 Ga0070682_100013796 3300005337 Bacteria 4659
13 Ga0070682_100015285 3300005337 Bacteria 4445
14 Ga0070682_100024483 3300005337 Bacteria 3593
15 Ga0070682_100029174 3300005337 Bacteria 3320
16 Ga0070682_100036730 3300005337 Bacteria 2996
17 Ga0068868_100034278 3300005338 Bacteria 3918
18 Ga0068868_100238440 3300005338 Bacteria 1527
19 Ga0070660_100005923 3300005339 Bacteria 8454
20 Ga0070660_100060376 3300005339 Bacteria 2943
21 Ga0070660_100177538 3300005339 Bacteria 1722
22 Ga0070689_100045899 3300005340 Bacteria 3366
23 Ga0070691_10015848 3300005341 Bacteria 3465
24 Ga0070691_10051621 3300005341 Bacteria 1964
25 Ga0070661_100005675 3300005344 Bacteria 8596
26 Ga0070668_100054366 3300005347 Bacteria 3088
27 Ga0070668_100088205 3300005347 Bacteria 2442
28 Ga0070669_100258523 3300005353 Bacteria 1389
29 Ga0070688_100015520 3300005365 Bacteria 4337
30 Ga0070659_100050496 3300005366 Bacteria 3269
31 Ga0070659_100071877 3300005366 Bacteria 2752
32 Ga0070659_100165228 3300005366 Unclassified 1811
33 Ga0070667_100009302 3300005367 Bacteria 8145
34 Ga0070667_100178778 3300005367 Bacteria 1876
35 Ga0070709_10095217 3300005434 Bacteria 1972
36 Ga0070714_100029254 3300005435 Bacteria 4580
37 Ga0070714_100030412 3300005435 Bacteria 4494
38 Ga0070714_100058112 3300005435 Bacteria 3313
39 Ga0070714_100067633 3300005435 Bacteria 3081
40 Ga0070714_100099389 3300005435 Bacteria 2561
41 Ga0070714_100244341 3300005435 Bacteria 1658
42 Ga0070713_100043207 3300005436 Bacteria 3683
43 Ga0070713_100058191 3300005436 Bacteria 3223
44 Ga0070713_100089869 3300005436 Bacteria 2639
45 Ga0070713_100224591 3300005436 Unclassified 1705
46 Ga0070710_10012734 3300005437 Bacteria 4186
47 Ga0070701_10001955 3300005438 Bacteria 7806
48 Ga0070711_100005352 3300005439 Bacteria 7672
49 Ga0070711_100041981 3300005439 Bacteria 3090
50 Ga0070711_100051343 3300005439 Bacteria 2831
51 Ga0070705_100016734 3300005440 Bacteria 3815
52 Ga0070705_100052306 3300005440 Bacteria 2385
53 Ga0070705_100081776 3300005440 Bacteria 1985
54 Ga0070705_100083922 3300005440 Bacteria 1964
55 Ga0070705_100161429 3300005440 Bacteria 1499
56 Ga0070700_100003711 3300005441 Bacteria 7892
57 Ga0070700_100060336 3300005441 Bacteria 2390
58 Ga0070700_100070126 3300005441 Bacteria 2234
59 Ga0070694_100040078 3300005444 Bacteria 3121
60 Ga0070694_100075706 3300005444 Bacteria 2328
61 Ga0070708_100030358 3300005445 Bacteria 4672
62 Ga0070708_100073080 3300005445 Bacteria 3091
63 Ga0070678_100027211 3300005456 Bacteria 3881
64 Ga0070678_100083046 3300005456 Bacteria 2434
65 Ga0070678_100237318 3300005456 Bacteria 1523
66 Ga0070678_100240063 3300005456 Bacteria 1515
67 Ga0070662_100056188 3300005457 Bacteria 2857
68 Ga0070681_10019656 3300005458 Bacteria 6764
69 Ga0070681_10027044 3300005458 Bacteria 5768
70 Ga0070681_10042356 3300005458 Bacteria 4563
71 Ga0070681_10045320 3300005458 Bacteria 4400
72 Ga0070681_10071810 3300005458 Bacteria 3426
73 Ga0070681_10103021 3300005458 Bacteria 2799
74 Ga0070681_10150198 3300005458 Unclassified 2256
75 Ga0070681_10174749 3300005458 Bacteria 2069
76 Ga0070681_10212509 3300005458 Bacteria 1850
77 Ga0070681_10321332 3300005458 Bacteria 1457
78 Ga0068867_100028094 3300005459 Bacteria 4048
79 Ga0070706_100036466 3300005467 Bacteria 4541
80 Ga0070706_100122830 3300005467 Unclassified 2421
81 Ga0070706_100124960 3300005467 Unclassified 2398
82 Ga0070706_100361788 3300005467 Bacteria 1352
83 Ga0070707_100000736 3300005468 Bacteria 32520
84 Ga0070707_100001917 3300005468 Bacteria 19935
85 Ga0070707_100108476 3300005468 Bacteria 2693
86 Ga0070707_100227414 3300005468 Bacteria 1817
87 Ga0070707_100346107 3300005468 Bacteria 1444
88 Ga0070698_100017893 3300005471 Bacteria 7466
89 Ga0070698_100053947 3300005471 Bacteria 4083
90 Ga0070698_100062959 3300005471 Bacteria 3741
91 Ga0070698_100151900 3300005471 Bacteria 2263
92 Ga0070698_100163311 3300005471 Bacteria 2170
93 Ga0070698_100192258 3300005471 Bacteria 1978
94 Ga0070699_100005711 3300005518 Bacteria 10897
95 Ga0070699_100012784 3300005518 Bacteria 7236
96 Ga0070699_100192617 3300005518 Bacteria 1812
97 Ga0070679_100013238 3300005530 Bacteria 7895
98 Ga0070679_100046291 3300005530 Bacteria 4335
99 Ga0070679_100064484 3300005530 Bacteria 3651
100 Ga0070679_100093351 3300005530 Bacteria 2997
101 Ga0070679_100130555 3300005530 Bacteria 2494
102 Ga0070679_100159956 3300005530 Bacteria 2227
103 Ga0070684_100000304 3300005535 Bacteria 34144
104 Ga0070684_100005611 3300005535 Bacteria 9644
105 Ga0070684_100013149 3300005535 Bacteria 6661
106 Ga0070684_100033850 3300005535 Bacteria 4365
107 Ga0070684_100048627 3300005535 Bacteria 3679
108 Ga0070697_100185522 3300005536 Unclassified 1764
109 Ga0068853_100022302 3300005539 Bacteria 5287
110 Ga0070686_100029186 3300005544 Bacteria 3353
111 Ga0070695_100019884 3300005545 Bacteria 4095
112 Ga0070696_100042589 3300005546 Bacteria 3138
113 Ga0070696_100094204 3300005546 Bacteria 2137
114 Ga0070696_100232270 3300005546 Bacteria 1388
115 Ga0070693_100015911 3300005547 Bacteria 3882
116 Ga0070693_100039488 3300005547 Bacteria 2644
117 Ga0070665_100017345 3300005548 Bacteria 7227
118 Ga0070665_100062268 3300005548 Bacteria 3741
119 Ga0070704_100132297 3300005549 Bacteria 1935
120 Ga0070704_100174758 3300005549 Bacteria 1712
121 Ga0068855_100015558 3300005563 Bacteria 9158
122 Ga0068855_100061321 3300005563 Bacteria 4394
123 Ga0068855_100065248 3300005563 Bacteria 4245
124 Ga0068855_100083393 3300005563 Bacteria 3702
125 Ga0068855_100117266 3300005563 Bacteria 3050
126 Ga0070664_100034719 3300005564 Bacteria 4231
127 Ga0070664_100143570 3300005564 Bacteria 2104
128 Ga0070664_100180277 3300005564 Bacteria 1877
129 Ga0070664_100239925 3300005564 Unclassified 1627
130 Ga0070664_100261620 3300005564 Bacteria 1557
131 Ga0068857_100006535 3300005577 Bacteria 10005
132 Ga0068857_100095260 3300005577 Bacteria 2667
133 Ga0068856_100063236 3300005614 Bacteria 3656
134 Ga0068856_100076900 3300005614 Bacteria 3307
135 Ga0068856_100102573 3300005614 Bacteria 2854
136 Ga0068856_100196648 3300005614 Bacteria 2030
137 Ga0068856_100200382 3300005614 Bacteria 2010
138 Ga0068856_100235155 3300005614 Bacteria 1848
139 Ga0070702_100004559 3300005615 Bacteria 6341
140 Ga0070702_100074984 3300005615 Unclassified 2009
141 Ga0068852_100035447 3300005616 Bacteria 4162
142 Ga0068864_100303951 3300005618 Bacteria 1494
143 Ga0068864_100339051 3300005618 Bacteria 1416
144 Ga0068866_10001213 3300005718 Bacteria 11206
145 Ga0068861_100007901 3300005719 Bacteria 7319
146 Ga0068861_100107071 3300005719 Bacteria 2234
147 Ga0068861_100110309 3300005719 Bacteria 2203
148 Ga0068863_100464763 3300005841 Unclassified 1243
149 Ga0068862_100001367 3300005844 Bacteria 22660
150 Ga0068862_100140681 3300005844 Bacteria 2141
151 Ga0068862_100201484 3300005844 Bacteria 1795
152 Ga0081455_10005820 3300005937 Bacteria 13416
153 Ga0081455_10014238 3300005937 Bacteria 7805
154 Ga0081455_10014350 3300005937 Bacteria 7773
155 Ga0081455_10035655 3300005937 Bacteria 4441
156 Ga0081538_10053605 3300005981 Bacteria 2396
157 Ga0081540_1003071 3300005983 Bacteria 13377
158 Ga0081540_1015602 3300005983 Bacteria 4802
159 Ga0081539_10006606 3300005985 Bacteria 11012
160 Ga0070717_10037914 3300006028 Bacteria 3915
161 Ga0070717_10101499 3300006028 Bacteria 2443
162 Ga0070717_10115892 3300006028 Bacteria 2290
163 Ga0070717_10301524 3300006028 Bacteria 1424
164 Ga0075365_10019759 3300006038 Bacteria 4165
165 Ga0070715_10020079 3300006163 Bacteria 2571
166 Ga0070715_10052854 3300006163 Bacteria 1754
167 Ga0070712_100039286 3300006175 Bacteria 3238
168 Ga0070712_100090282 3300006175 Bacteria 2243
169 Ga0070712_100268046 3300006175 Bacteria 1371
170 Ga0068871_100035915 3300006358 Bacteria 3941
171 Ga0068871_100129862 3300006358 Bacteria 2135
172 Ga0068871_100182559 3300006358 Bacteria 1804
173 Ga0075428_100000381 3300006844 Bacteria 43984
174 Ga0075431_100023773 3300006847 Bacteria 6273
175 Ga0075431_100188313 3300006847 Bacteria 2115
176 Ga0075433_10069829 3300006852 Bacteria 3086
177 Ga0075433_10168459 3300006852 Bacteria 1949
178 Ga0075433_10322230 3300006852 Bacteria 1367
179 Ga0075434_100001557 3300006871 Bacteria 19447
180 Ga0075434_100010132 3300006871 Bacteria 8828
181 Ga0075434_100075961 3300006871 Bacteria 3354
182 Ga0075434_100175550 3300006871 Bacteria 2162
183 Ga0075434_100181318 3300006871 Bacteria 2126
184 Ga0075429_100216747 3300006880 Bacteria 1677
185 Ga0068865_100007982 3300006881 Bacteria 6535
186 Ga0075436_100003007 3300006914 Bacteria 11549
187 Ga0075436_100003937 3300006914 Bacteria 10181
188 Ga0075436_100022390 3300006914 Bacteria 4340
189 Ga0075436_100050943 3300006914 Bacteria 2857
190 Ga0075435_100012038 3300007076 Bacteria 6391
191 Ga0075435_100017412 3300007076 Bacteria 5441
192 Ga0075435_100021362 3300007076 Bacteria 4977
193 Ga0075435_100064189 3300007076 Bacteria 2983
194 Ga0075435_100180082 3300007076 Bacteria 1786
195 Ga0105240_10092787 3300009093 Bacteria 3685
196 Ga0105240_10175155 3300009093 Bacteria 2536
197 Ga0111539_10012314 3300009094 Bacteria 10718
198 Ga0111539_10051846 3300009094 Bacteria 4885
199 Ga0111539_10056650 3300009094 Bacteria 4657
200 Ga0111539_10252067 3300009094 Unclassified 2055
201 Ga0105245_10003086 3300009098 Bacteria 14908
202 Ga0105245_10046270 3300009098 Bacteria 3888
203 Ga0105245_10073970 3300009098 Bacteria 3100
204 Ga0105245_10326822 3300009098 Bacteria 1512
205 Ga0105247_10002698 3300009101 Bacteria 11915
206 Ga0105247_10014196 3300009101 Bacteria 4779
207 Ga0114129_10001661 3300009147 Bacteria 30289
208 Ga0114129_10005673 3300009147 Bacteria 17670
209 Ga0114129_10012739 3300009147 Bacteria 11971
210 Ga0114129_10117688 3300009147 Bacteria 3661
211 Ga0114129_10134627 3300009147 Bacteria 3391
212 Ga0114129_10153050 3300009147 Bacteria 3156
213 Ga0114129_10181523 3300009147 Bacteria 2863
214 Ga0114129_10569990 3300009147 Bacteria 1470
215 Ga0105243_10017876 3300009148 Bacteria 5364
216 Ga0105243_10040745 3300009148 Bacteria 3629
217 Ga0105243_10127544 3300009148 Bacteria 2154
218 Ga0105243_10183473 3300009148 Bacteria 1822
219 Ga0105243_10225101 3300009148 Bacteria 1660
220 Ga0105241_10039315 3300009174 Bacteria 3568
221 Ga0105242_10006738 3300009176 Bacteria 8859
222 Ga0105242_10059277 3300009176 Bacteria 3140
223 Ga0105248_10386638 3300009177 Bacteria 1575
224 Ga0105237_10250757 3300009545 Bacteria 1772
225 Ga0105238_10150945 3300009551 Bacteria 2299
226 Ga0105238_10181417 3300009551 Bacteria 2082
227 Ga0105238_10216597 3300009551 Bacteria 1891
228 Ga0105249_10034961 3300009553 Bacteria 4556
229 Ga0105239_10041625 3300010375 Bacteria 5034
230 Ga0105239_10279800 3300010375 Unclassified 1878
231 Ga0105246_10039168 3300011119 Bacteria 3191
232 Ga0105246_10196366 3300011119 Unclassified 1565
233 Ga0157373_10145747 3300013100 Unclassified 1665
234 Ga0157371_10162431 3300013102 Bacteria 1595
235 Ga0157370_10027005 3300013104 Bacteria 5663
236 Ga0157370_10116274 3300013104 Bacteria 2499
237 Ga0157369_10002618 3300013105 Bacteria 21517
238 Ga0157369_10039852 3300013105 Bacteria 5132
239 Ga0157369_10051221 3300013105 Bacteria 4468
240 Ga0157369_10101401 3300013105 Bacteria 3067
241 Ga0157369_10131514 3300013105 Bacteria 2651
242 Ga0157374_10108469 3300013296 Bacteria 2668
243 Ga0157378_10044141 3300013297 Bacteria 3958
244 Ga0157378_10108371 3300013297 Bacteria 2543
245 Ga0157378_10200593 3300013297 Bacteria 1887
246 Ga0163162_10026922 3300013306 Bacteria 5686
247 Ga0163162_10056437 3300013306 Bacteria 3955
248 Ga0163162_10154367 3300013306 Bacteria 2415
249 Ga0157372_10481927 3300013307 Bacteria 1446
250 Ga0157375_10036207 3300013308 Bacteria 4719
251 Ga0157375_10047453 3300013308 Bacteria 4195
252 Ga0157380_10006605 3300014326 Bacteria 8181
253 Ga0157380_10010760 3300014326 Bacteria 6592
254 Ga0182008_10005743 3300014497 Bacteria 7025
255 Ga0182008_10041945 3300014497 Bacteria 2281
256 Ga0182008_10053067 3300014497 Bacteria 2008
257 Ga0157377_10073642 3300014745 Bacteria 1980
258 Ga0157379_10258274 3300014968 Bacteria 1583
259 Ga0157376_10062443 3300014969 Bacteria 3134
260 Ga0157376_10125268 3300014969 Bacteria 2284
261 Ga0163161_10166119 3300017792 Bacteria 1685
262 Ga0206356_10687371 3300020070 Bacteria 2795
263 Ga0206356_11158095 3300020070 Bacteria 1283
264 Ga0206356_11233245 3300020070 Bacteria 1369
265 Ga0206356_11875873 3300020070 Unclassified 1893
266 Ga0206354_10192413 3300020081 Bacteria 3483
267 Ga0206354_10778318 3300020081 Bacteria 3765
268 Ga0206354_10900364 3300020081 Bacteria 1794
269 Ga0206353_10422956 3300020082 Bacteria 8342
270 Ga0206353_11663111 3300020082 Bacteria 4091
271 Ga0206353_11831078 3300020082 Bacteria 2926
272 Ga0213871_10006336 3300021441 Bacteria 2500
273 Ga0207692_10074254 3300025898 Bacteria 1801
274 Ga0207642_10014554 3300025899 Bacteria 2905
275 Ga0207710_10000179 3300025900 Bacteria 64100
276 Ga0207688_10151160 3300025901 Bacteria 1371
277 Ga0207647_10154597 3300025904 Unclassified 1340
278 Ga0207699_10081352 3300025906 Bacteria 2009
279 Ga0207645_10057178 3300025907 Bacteria 2490
280 Ga0207705_10026437 3300025909 Bacteria 4139
281 Ga0207705_10038063 3300025909 Bacteria 3443
282 Ga0207705_10063948 3300025909 Bacteria 2659
283 Ga0207684_10056353 3300025910 Bacteria 3334
284 Ga0207684_10080852 3300025910 Bacteria 2765
285 Ga0207684_10165453 3300025910 Bacteria 1905
286 Ga0207684_10312577 3300025910 Bacteria 1354
287 Ga0207684_10348716 3300025910 Bacteria 1274
288 Ga0207654_10188351 3300025911 Unclassified 1351
289 Ga0207707_10017134 3300025912 Bacteria 6312
290 Ga0207707_10106547 3300025912 Bacteria 2450
291 Ga0207707_10108903 3300025912 Bacteria 2422
292 Ga0207707_10143050 3300025912 Bacteria 2091
293 Ga0207693_10000319 3300025915 Bacteria 44749
294 Ga0207693_10000945 3300025915 Bacteria 26054
295 Ga0207693_10004123 3300025915 Bacteria 12338
296 Ga0207693_10033836 3300025915 Bacteria 4032
297 Ga0207693_10038611 3300025915 Bacteria 3759
298 Ga0207693_10047648 3300025915 Bacteria 3367
299 Ga0207693_10112782 3300025915 Bacteria 2133
300 Ga0207693_10126291 3300025915 Bacteria 2010
301 Ga0207693_10307813 3300025915 Bacteria 1241
302 Ga0207663_10004268 3300025916 Bacteria 7094
303 Ga0207663_10010470 3300025916 Bacteria 4938
304 Ga0207663_10190443 3300025916 Bacteria 1472
305 Ga0207660_10031455 3300025917 Bacteria 3655
306 Ga0207660_10176254 3300025917 Bacteria 1658
307 Ga0207662_10054435 3300025918 Bacteria 2386
308 Ga0207657_10003731 3300025919 Bacteria 16188
309 Ga0207657_10005756 3300025919 Bacteria 12928
310 Ga0207657_10027056 3300025919 Bacteria 5258
311 Ga0207657_10029230 3300025919 Bacteria 5019
312 Ga0207657_10042806 3300025919 Bacteria 3992
313 Ga0207649_10033516 3300025920 Bacteria 3069
314 Ga0207652_10008054 3300025921 Bacteria 8458
315 Ga0207652_10048618 3300025921 Bacteria 3626
316 Ga0207652_10065363 3300025921 Bacteria 3150
317 Ga0207652_10105455 3300025921 Bacteria 2494
318 Ga0207652_10231005 3300025921 Unclassified 1667
319 Ga0207646_10002421 3300025922 Bacteria 22033
320 Ga0207646_10022827 3300025922 Bacteria 5754
321 Ga0207694_10064076 3300025924 Bacteria 2864
322 Ga0207659_10284173 3300025926 Bacteria 1354
323 Ga0207687_10003599 3300025927 Bacteria 10432
324 Ga0207687_10024282 3300025927 Bacteria 4048
325 Ga0207687_10042776 3300025927 Bacteria 3119
326 Ga0207687_10049497 3300025927 Bacteria 2922
327 Ga0207687_10066707 3300025927 Bacteria 2558
328 Ga0207687_10116444 3300025927 Bacteria 1992
329 Ga0207687_10166619 3300025927 Bacteria 1696
330 Ga0207687_10206638 3300025927 Bacteria 1538
331 Ga0207700_10062381 3300025928 Unclassified 2831
332 Ga0207700_10064336 3300025928 Bacteria 2793
333 Ga0207700_10169436 3300025928 Bacteria 1821
334 Ga0207664_10008572 3300025929 Bacteria 7143
335 Ga0207664_10060285 3300025929 Bacteria 3024
336 Ga0207664_10073207 3300025929 Bacteria 2764
337 Ga0207664_10083264 3300025929 Bacteria 2608
338 Ga0207664_10091349 3300025929 Bacteria 2497
339 Ga0207664_10247239 3300025929 Bacteria 1555
340 Ga0207664_10394379 3300025929 Unclassified 1230
341 Ga0207690_10142744 3300025932 Bacteria 1766
342 Ga0207706_10003832 3300025933 Bacteria 14329
343 Ga0207706_10029343 3300025933 Bacteria 4910
344 Ga0207706_10045280 3300025933 Bacteria 3899
345 Ga0207706_10073803 3300025933 Bacteria 3000
346 Ga0207686_10002316 3300025934 Bacteria 10426
347 Ga0207709_10003771 3300025935 Bacteria 8904
348 Ga0207709_10010998 3300025935 Bacteria 4988
349 Ga0207709_10056466 3300025935 Bacteria 2430
350 Ga0207670_10014593 3300025936 Bacteria 4670
351 Ga0207704_10118584 3300025938 Bacteria 1805
352 Ga0207665_10002255 3300025939 Bacteria 13013
353 Ga0207665_10007220 3300025939 Bacteria 7352
354 Ga0207665_10008529 3300025939 Bacteria 6747
355 Ga0207665_10073671 3300025939 Bacteria 2336
356 Ga0207691_10009218 3300025940 Bacteria 9472
357 Ga0207691_10195473 3300025940 Bacteria 1763
358 Ga0207711_10028596 3300025941 Bacteria 4693
359 Ga0207661_10003070 3300025944 Bacteria 11557
360 Ga0207661_10101276 3300025944 Bacteria 2419
361 Ga0207661_10125684 3300025944 Unclassified 2190
362 Ga0207679_10138480 3300025945 Bacteria 1964
363 Ga0207679_10140877 3300025945 Bacteria 1949
364 Ga0207667_10083906 3300025949 Bacteria 3298
365 Ga0207667_10288750 3300025949 Bacteria 1676
366 Ga0207651_10187263 3300025960 Unclassified 1648
367 Ga0207712_10024209 3300025961 Bacteria 4018
368 Ga0207668_10039579 3300025972 Bacteria 3175
369 Ga0207668_10101007 3300025972 Bacteria 2143
370 Ga0207668_10179823 3300025972 Bacteria 1667
371 Ga0207658_10045246 3300025986 Bacteria 3208
372 Ga0207708_10008089 3300026075 Bacteria 7794
373 Ga0207708_10048525 3300026075 Bacteria 3232
374 Ga0207708_10143876 3300026075 Bacteria 1873
375 Ga0207702_10019118 3300026078 Bacteria 5669
376 Ga0207702_10055641 3300026078 Bacteria 3356
377 Ga0207702_10075448 3300026078 Bacteria 2913
378 Ga0207702_10096587 3300026078 Bacteria 2599
379 Ga0207702_10105669 3300026078 Bacteria 2494
380 Ga0207702_10224622 3300026078 Bacteria 1751
381 Ga0207641_10292795 3300026088 Bacteria 1535
382 Ga0207648_10002132 3300026089 Bacteria 21520
383 Ga0207648_10011231 3300026089 Bacteria 8445
384 Ga0207676_10045001 3300026095 Bacteria 3408
385 Ga0207674_10011029 3300026116 Bacteria 10164
386 Ga0207674_10026840 3300026116 Bacteria 6109
387 Ga0207675_100005440 3300026118 Bacteria 12206
388 Ga0207675_100008915 3300026118 Bacteria 9412
389 Ga0207675_100052680 3300026118 Bacteria 3797
390 Ga0207675_100092869 3300026118 Bacteria 2838
391 Ga0207675_100147604 3300026118 Bacteria 2237
392 Ga0207683_10002939 3300026121 Bacteria 14868
393 Ga0207683_10012321 3300026121 Bacteria 7298
394 Ga0207683_10027994 3300026121 Bacteria 4872
395 Ga0207683_10028451 3300026121 Bacteria 4832
396 Ga0207683_10029373 3300026121 Bacteria 4760
397 Ga0207683_10032077 3300026121 Bacteria 4562
398 Ga0207683_10085471 3300026121 Bacteria 2804
399 Ga0207683_10137693 3300026121 Bacteria 2198
400 Ga0207698_10066827 3300026142 Bacteria 2832
401 Ga0207698_10083164 3300026142 Bacteria 2590
402 Ga0207428_10005252 3300027907 Bacteria 12103
403 Ga0207428_10008826 3300027907 Bacteria 9088
404 Ga0207428_10030367 3300027907 Bacteria 4468
405 Ga0268265_10003678 3300028380 Bacteria 10943
406 Ga0268265_10311239 3300028380 Bacteria 1422
407 Ga0268264_10284109 3300028381 Unclassified 1551
408 Ga0265337_1025219 3300028556 Bacteria 1811
409 Ga0265326_10011074 3300028558 Bacteria 2667
410 Ga0265319_1000592 3300028563 Bacteria 24262
411 Ga0265319_1005217 3300028563 Bacteria 6270
412 Ga0265318_10000219 3300028577 Bacteria 49788
413 Ga0265318_10005482 3300028577 Bacteria 5954
414 Ga0265318_10043101 3300028577 Bacteria 1711
415 Ga0265322_10016444 3300028654 Bacteria 2135
416 Ga0265338_10003307 3300028800 Bacteria 22846
417 Ga0265338_10007029 3300028800 Bacteria 14125
418 Ga0265338_10016091 3300028800 Bacteria 8162
419 Ga0265338_10034817 3300028800 Bacteria 4855
420 Ga0265338_10175213 3300028800 Bacteria 1640
421 Ga0265330_10000479 3300031235 Bacteria 26766
422 Ga0265328_10000790 3300031239 Bacteria 14638
423 Ga0265320_10051332 3300031240 Bacteria 2001
424 Ga0265320_10058686 3300031240 Bacteria 1841
425 Ga0265325_10000443 3300031241 Bacteria 29809
426 Ga0265329_10000472 3300031242 Bacteria 20927
427 Ga0265340_10068279 3300031247 Unclassified 1688
428 Ga0265339_10101055 3300031249 Bacteria 1501
429 Ga0265331_10020343 3300031250 Bacteria 3410
430 Ga0265327_10009052 3300031251 Bacteria 7275
431 Ga0265316_10004053 3300031344 Bacteria 14658
432 Ga0265316_10012119 3300031344 Bacteria 7742
433 Ga0307408_100171924 3300031548 Bacteria 1731
434 Ga0265313_10006992 3300031595 Bacteria 7824
435 Ga0265314_10003422 3300031711 Bacteria 15353
436 Ga0265314_10031419 3300031711 Bacteria 3919
437 Ga0265342_10045680 3300031712 Bacteria 2635
438 Ga0265342_10097936 3300031712 Unclassified 1674
439 Ga0307406_10230486 3300031901 Bacteria 1383
440 Ga0307409_100293301 3300031995 Bacteria 1509
441 Ga0307416_100106261 3300032002 Bacteria 2460
442 Ga0373938_0010324 3300034957 Bacteria 1714
443 Ga0373952_0015557 3300035092 Bacteria 1537
444 Ga0373939_0027186 3300035114 Bacteria 1618
445 Ga0373941_0006820 3300035115 Bacteria 2768
446 Ga0373941_0011420 3300035115 Bacteria 2295
447 Ga0373945_0003511 3300035116 Bacteria 4939
448 Ga0373960_0018728 3300035121 Bacteria 1810
449 Ga0373943_0005293 3300035170 Bacteria 5802
450 Ga0373943_0011525 3300035170 Bacteria 3979
451 Ga0373943_0034514 3300035170 Bacteria 2413
452 Ga0373943_0065060 3300035170 Bacteria 1832
453 Ga0373946_0014769 3300035171 Bacteria 2950
454 Ga0373955_0024397 3300035172 Bacteria 3093
455 Ga0373961_0011677 3300035241 Bacteria 2183
456 Ga0373962_0003254 3300035242 Bacteria 3906
457 Ga0373931_0006393 3300035691 Bacteria 5503
458 Ga0373935_0072020 3300035692 Bacteria 2231
459 Ga0373927_0045554 3300035695 Unclassified 2837
460 Ga0373927_0158836 3300035695 Bacteria 1481
461 Ga0373947_0000237 3300035725 Bacteria 31058
462 Ga0373937_0000548 3300036401 Bacteria 33475
463 Ga0373937_0025305 3300036401 Bacteria 5358
464 Ga0373937_0338739 3300036401 Bacteria 1424
465 Ga0373925_0002356 3300037068 Bacteria 15161
466 Ga0373925_0055357 3300037068 Bacteria 2969
467 Ga0373925_0093770 3300037068 Bacteria 2298
468 Ga0373925_0107961 3300037068 Bacteria 2147
469 Ga0395899_0010815 3300037312 Bacteria 6996
470 Ga0395899_0012610 3300037312 Bacteria 6480
471 Ga0395899_0016341 3300037312 Bacteria 5656
472 Ga0395899_0026219 3300037312 Bacteria 4398
473 Ga0395899_0030436 3300037312 Bacteria 4060
474 Ga0395899_0046995 3300037312 Bacteria 3214
475 Ga0395899_0058758 3300037312 Bacteria 2836
476 Ga0395899_0073691 3300037312 Bacteria 2496
477 Ga0395899_0075024 3300037312 Bacteria 2470
478 Ga0395899_0076944 3300037312 Bacteria 2435
479 Ga0395899_0114276 3300037312 Bacteria 1938
480 Ga0395899_0123955 3300037312 Bacteria 1848
481 Ga0395900_0000838 3300037418 Bacteria 40475
482 Ga0395900_0003636 3300037418 Bacteria 16572
483 Ga0395900_0003913 3300037418 Bacteria 15910
484 Ga0395900_0006681 3300037418 Bacteria 11985
485 Ga0395900_0008263 3300037418 Bacteria 10716
486 Ga0395900_0013052 3300037418 Bacteria 8492
487 Ga0395900_0050121 3300037418 Bacteria 4301
488 Ga0395900_0070002 3300037418 Bacteria 3607
489 Ga0395900_0093511 3300037418 Bacteria 3088
490 Ga0395900_0106472 3300037418 Bacteria 2880
491 Ga0395900_0112371 3300037418 Bacteria 2797
492 Ga0395900_0143369 3300037418 Bacteria 2445
493 Ga0395900_0196645 3300037418 Unclassified 2042
494 Ga0395900_0227670 3300037418 Bacteria 1877
495 Ga0395900_0248532 3300037418 Bacteria 1781
496 Ga0395898_0001212 3300037466 Bacteria 38943
497 Ga0395898_0003410 3300037466 Bacteria 17802
498 Ga0395898_0007007 3300037466 Bacteria 11978
499 Ga0395898_0007049 3300037466 Bacteria 11941
500 Ga0395898_0007790 3300037466 Bacteria 11368
501 Ga0395898_0011394 3300037466 Bacteria 9234
502 Ga0395898_0015434 3300037466 Bacteria 7832
503 Ga0395898_0024102 3300037466 Bacteria 6142
504 Ga0395898_0031435 3300037466 Bacteria 5304
505 Ga0395898_0033701 3300037466 Bacteria 5108
506 Ga0395898_0039393 3300037466 Bacteria 4677
507 Ga0395898_0057873 3300037466 Bacteria 3775
508 Ga0395898_0058510 3300037466 Bacteria 3751
509 Ga0395898_0097804 3300037466 Bacteria 2818
510 Ga0395898_0116142 3300037466 Bacteria 2564
511 Ga0395898_0127735 3300037466 Bacteria 2435
512 Ga0395898_0157977 3300037466 Bacteria 2168
513 Ga0395898_0171389 3300037466 Bacteria 2075
514 Ga0395898_0346758 3300037466 Bacteria 1416
515 Ga0395898_0481221 3300037466 Bacteria 1181
516 Ga0395898_0600040 3300037466 Unclassified 1044
517 Ga0395905_0001601 3300037471 Bacteria 26910
518 Ga0395905_0001928 3300037471 Bacteria 23814
519 Ga0395905_0004549 3300037471 Bacteria 14360
520 Ga0395905_0010973 3300037471 Bacteria 8769
521 Ga0395905_0011189 3300037471 Bacteria 8676
522 Ga0395905_0012746 3300037471 Bacteria 8086
523 Ga0395905_0019921 3300037471 Bacteria 6357
524 Ga0395905_0026059 3300037471 Bacteria 5513
525 Ga0395905_0105086 3300037471 Bacteria 2651
526 Ga0395905_0122043 3300037471 Bacteria 2450
527 Ga0395905_0126128 3300037471 Bacteria 2407
528 Ga0395901_0000858 3300038443 Bacteria 33469
529 Ga0395901_0001826 3300038443 Bacteria 21982
530 Ga0395901_0003205 3300038443 Bacteria 16466
531 Ga0395901_0003231 3300038443 Bacteria 16388
532 Ga0395901_0003420 3300038443 Bacteria 15996
533 Ga0395901_0006476 3300038443 Bacteria 11854
534 Ga0395901_0010878 3300038443 Bacteria 9221
535 Ga0395901_0013196 3300038443 Bacteria 8390
536 Ga0395901_0024220 3300038443 Bacteria 6228
537 Ga0395901_0033692 3300038443 Bacteria 5288
538 Ga0395901_0037382 3300038443 Bacteria 5021
539 Ga0395901_0041928 3300038443 Bacteria 4744
540 Ga0395901_0055287 3300038443 Bacteria 4128
541 Ga0395901_0064877 3300038443 Bacteria 3801
542 Ga0395901_0076162 3300038443 Bacteria 3500
543 Ga0395901_0080971 3300038443 Bacteria 3391
544 Ga0395901_0117180 3300038443 Bacteria 2798
545 Ga0395901_0138446 3300038443 Bacteria 2558
546 Ga0395901_0146551 3300038443 Bacteria 2481
547 Ga0395901_0157899 3300038443 Bacteria 2382
548 Ga0395901_0161945 3300038443 Bacteria 2350
549 Ga0395901_0241094 3300038443 Unclassified 1886
550 Ga0395901_0244308 3300038443 Bacteria 1871
551 Ga0395901_0306200 3300038443 Unclassified 1646
552 Ga0395901_0320598 3300038443 Bacteria 1603
553 Ga0436365_1070781 3300039437 Bacteria 2419
554 Ga0436360_0887170 3300039438 Bacteria 4748
555 Ga0451789_0528223 3300041443 Unclassified 1836
556 Ga0451789_0919425 3300041443 Bacteria 1404
557 Ga0451800_1267821 3300041459 Bacteria 2221
558 Ga0451835_0383021 3300041492 Bacteria 3443
559 Ga0451839_0194646 3300041496 Bacteria 2270
560 Ga0451849_0045844 3300041505 Bacteria 4176
561 Ga0451851_0849119 3300041507 Bacteria 2791
562 Ga0451853_3599974 3300041512 Bacteria 2150
563 Ga0439464_0036941 3300042439 Bacteria 1384
564 Ga0466965_0004578 3300044683 Bacteria 6158
565 Ga0466965_0085556 3300044683 Bacteria 1598
566 Ga0466966_0020499 3300044684 Bacteria 4346
567 Ga0466966_0038817 3300044684 Bacteria 3066
568 Ga0466961_0002675 3300044693 Bacteria 11056
569 Ga0466961_0004260 3300044693 Bacteria 8954
570 Ga0466961_0083012 3300044693 Bacteria 2026
571 Ga0466961_0099484 3300044693 Bacteria 1833
572 Ga0466963_0000261 3300044694 Bacteria 23150
573 Ga0466963_0000768 3300044694 Bacteria 15875
574 Ga0466963_0002376 3300044694 Bacteria 10515
575 Ga0466963_0002868 3300044694 Bacteria 9735
576 Ga0466963_0004245 3300044694 Bacteria 8313
577 Ga0466963_0011880 3300044694 Bacteria 5315
578 Ga0466963_0024908 3300044694 Bacteria 3811
579 Ga0466963_0035060 3300044694 Bacteria 3267
580 Ga0466963_0044167 3300044694 Bacteria 2933
581 Ga0466963_0076363 3300044694 Unclassified 2262
582 Ga0466963_0081131 3300044694 Bacteria 2196
583 Ga0466963_0083860 3300044694 Bacteria 2161
584 Ga0466964_0000352 3300044706 Bacteria 13785
585 Ga0466964_0004673 3300044706 Bacteria 5062
586 Ga0466964_0008804 3300044706 Bacteria 3794
587 Ga0466964_0017735 3300044706 Bacteria 2726
588 Ga0466964_0026000 3300044706 Bacteria 2289
589 Ga0466964_0030830 3300044706 Bacteria 2124
590 Ga0466964_0063959 3300044706 Bacteria 1538
591 Ga0466968_0003161 3300044735 Bacteria 6077
592 Ga0466968_0008909 3300044735 Bacteria 3852
593 Ga0466968_0031417 3300044735 Bacteria 2203
594 Ga0466968_0041575 3300044735 Bacteria 1941
595 Ga0466970_0014312 3300044765 Bacteria 4071
596 Ga0466970_0160736 3300044765 Bacteria 1242
597 Ga0466957_0006127 3300044842 Bacteria 6787
598 Ga0466957_0030739 3300044842 Bacteria 3207
599 Ga0466960_0003012 3300044901 Bacteria 6433
600 Ga0466959_0025227 3300045049 Bacteria 4404
601 Ga0466959_0025914 3300045049 Bacteria 4348
602 Ga0451576_0022984 3300045051 Bacteria 6757
603 Ga0466958_0000988 3300045836 Bacteria 12856
604 Ga0466958_0002635 3300045836 Bacteria 9070
605 Ga0466958_0031646 3300045836 Unclassified 3145
606 Ga0466958_0121919 3300045836 Bacteria 1633
607 Ga0466967_0002587 3300045976 Bacteria 11369
608 Ga0466967_0013294 3300045976 Bacteria 6353
609 Ga0466967_0013473 3300045976 Bacteria 6321
610 Ga0466967_0015101 3300045976 Bacteria 6044
611 Ga0466967_0021409 3300045976 Bacteria 5250
612 Ga0466967_0022717 3300045976 Bacteria 5126
613 Ga0466967_0027600 3300045976 Bacteria 4724
614 Ga0466967_0031057 3300045976 Bacteria 4492
615 Ga0466967_0031978 3300045976 Bacteria 4438
616 Ga0466967_0038321 3300045976 Bacteria 4110
617 Ga0466967_0053417 3300045976 Bacteria 3551
618 Ga0466967_0054362 3300045976 Bacteria 3523
619 Ga0466967_0055137 3300045976 Bacteria 3501
620 Ga0466967_0074837 3300045976 Bacteria 3042
621 Ga0466967_0111660 3300045976 Bacteria 2512
622 Ga0466967_0122613 3300045976 Bacteria 2404
623 Ga0466967_0141492 3300045976 Bacteria 2241
624 Ga0466967_0187418 3300045976 Bacteria 1954
625 Ga0466967_0226508 3300045976 Bacteria 1779
626 Ga0466967_0242022 3300045976 Bacteria 1721
627 Ga0466967_0440315 3300045976 Unclassified 1272
628 Ga0495592_0000100 3300046454 Bacteria 76535
629 Ga0495592_0060169 3300046454 Bacteria 2794
630 Ga0495603_0001231 3300046455 Bacteria 14938
631 Ga0495603_0013603 3300046455 Bacteria 4923
632 Ga0495603_0014127 3300046455 Bacteria 4831
633 Ga0495603_0041622 3300046455 Bacteria 2746
634 Ga0495603_0047923 3300046455 Bacteria 2544
635 Ga0495603_0104510 3300046455 Bacteria 1653
636 Ga0495629_0002746 3300046459 Bacteria 13466
637 Ga0495629_0030475 3300046459 Bacteria 3824
638 Ga0495641_0002482 3300046461 Bacteria 14526
639 Ga0495641_0004633 3300046461 Bacteria 9613
640 Ga0495641_0043455 3300046461 Bacteria 2078
641 Ga0495641_0055610 3300046461 Bacteria 1796
642 Ga0495641_0056804 3300046461 Bacteria 1773
643 Ga0495641_0057609 3300046461 Bacteria 1760
644 Ga0495641_0064745 3300046461 Bacteria 1646
645 Ga0495651_0000008 3300046462 Bacteria 156989
646 Ga0495651_0035623 3300046462 Bacteria 3874
647 Ga0495651_0042861 3300046462 Bacteria 3512
648 Ga0495651_0056623 3300046462 Bacteria 3011
649 Ga0495653_0032335 3300046463 Bacteria 4155
650 Ga0495653_0035380 3300046463 Bacteria 3941
651 Ga0495653_0047434 3300046463 Bacteria 3322
652 Ga0495653_0170490 3300046463 Bacteria 1502
653 Ga0495582_0001422 3300046473 Bacteria 13508
654 Ga0495582_0014295 3300046473 Bacteria 4366
655 Ga0495582_0016729 3300046473 Bacteria 4016
656 Ga0495582_0044924 3300046473 Bacteria 2433
657 Ga0495582_0100123 3300046473 Bacteria 1622
658 Ga0495582_0130800 3300046473 Unclassified 1418
659 Ga0495582_0172744 3300046473 Unclassified 1230
660 Ga0495605_0019449 3300046474 Bacteria 3627
661 Ga0495605_0019926 3300046474 Bacteria 3571
662 Ga0495639_0001181 3300046475 Bacteria 11798
663 Ga0495639_0004850 3300046475 Bacteria 5769
664 Ga0495639_0047663 3300046475 Bacteria 1942
665 Ga0495639_0066254 3300046475 Unclassified 1662
666 Ga0495662_0003046 3300046476 Bacteria 8451
667 Ga0495662_0037839 3300046476 Bacteria 2331
668 Ga0495664_0027095 3300046477 Bacteria 3341
669 Ga0495584_0010544 3300046491 Bacteria 4747
670 Ga0495584_0072938 3300046491 Bacteria 1725
671 Ga0495585_0131686 3300046492 Unclassified 1316
672 Ga0495594_0001036 3300046499 Bacteria 14468
673 Ga0495596_0071510 3300046500 Unclassified 1347
674 Ga0495596_0073991 3300046500 Unclassified 1323
675 Ga0495607_0088451 3300046501 Bacteria 1684
676 Ga0495608_0002626 3300046511 Bacteria 12905
677 Ga0495608_0011259 3300046511 Bacteria 6227
678 Ga0495608_0039772 3300046511 Bacteria 3151
679 Ga0495608_0115164 3300046511 Bacteria 1726
680 Ga0495618_0006703 3300046514 Bacteria 6977
681 Ga0495618_0032144 3300046514 Bacteria 3287
682 Ga0495618_0117810 3300046514 Unclassified 1700
683 Ga0495628_0000105 3300046516 Bacteria 68159
684 Ga0495628_0001154 3300046516 Bacteria 24083
685 Ga0495628_0005946 3300046516 Bacteria 10677
686 Ga0495628_0028966 3300046516 Bacteria 4494
687 Ga0495628_0172847 3300046516 Bacteria 1638
688 Ga0495630_0003323 3300046517 Bacteria 11203
689 Ga0495630_0014105 3300046517 Bacteria 5815
690 Ga0495630_0024498 3300046517 Bacteria 4460
691 Ga0495630_0031468 3300046517 Bacteria 3951
692 Ga0495630_0143569 3300046517 Bacteria 1815
693 Ga0495630_0155911 3300046517 Bacteria 1738
694 Ga0495631_0071338 3300046518 Bacteria 1501
695 Ga0495644_0004305 3300046523 Bacteria 5592
696 Ga0495644_0032726 3300046523 Unclassified 1965
697 Ga0495663_0011150 3300046525 Bacteria 2501
698 Ga0495666_0099635 3300046526 Bacteria 1369
699 Ga0495652_0000588 3300046529 Bacteria 42490
700 Ga0495652_0007715 3300046529 Bacteria 9909
701 Ga0495652_0077392 3300046529 Bacteria 2757
702 Ga0495652_0124915 3300046529 Bacteria 2046
703 Ga0495652_0124966 3300046529 Bacteria 2045
704 Ga0495665_0002651 3300046531 Bacteria 9656
705 Ga0495665_0020951 3300046531 Bacteria 3513
706 Ga0495665_0036519 3300046531 Bacteria 2623
707 Ga0495640_0012819 3300046533 Bacteria 6396
708 Ga0495640_0026363 3300046533 Bacteria 4201
709 Ga0495586_0057494 3300046535 Bacteria 2110
710 Ga0495586_0070615 3300046535 Bacteria 1907
711 Ga0495587_0000048 3300046536 Bacteria 105358
712 Ga0495587_0019872 3300046536 Bacteria 4151
713 Ga0495609_0014755 3300046538 Bacteria 3668
714 Ga0495609_0037234 3300046538 Bacteria 2195
715 Ga0495609_0064070 3300046538 Bacteria 1622
716 Ga0495645_0000029 3300046543 Bacteria 113119
717 Ga0495645_0018139 3300046543 Bacteria 5051
718 Ga0495645_0057702 3300046543 Bacteria 2817
719 Ga0495667_0005882 3300046559 Bacteria 8306
720 Ga0495667_0016319 3300046559 Bacteria 5018
721 Ga0495667_0037446 3300046559 Bacteria 3233
722 Ga0495667_0048893 3300046559 Bacteria 2792
723 Ga0495667_0081797 3300046559 Bacteria 2099
724 Ga0495656_0017608 3300046615 Bacteria 2729
725 Ga0495656_0058104 3300046615 Bacteria 1677
726 Ga0495656_0096626 3300046615 Bacteria 1360
727 Ga0495656_0103930 3300046615 Bacteria 1318
728 Ga0495656_0113038 3300046615 Bacteria 1273
729 Ga0495634_0021634 3300046642 Bacteria 4543
730 Ga0495634_0029224 3300046642 Bacteria 3817
731 Ga0495634_0048784 3300046642 Bacteria 2849
732 Ga0495634_0071929 3300046642 Bacteria 2275
733 Ga0495611_0123291 3300046648 Bacteria 1208
734 Ga0495635_0047792 3300046663 Bacteria 2950
735 Ga0495635_0074004 3300046663 Bacteria 2333
736 Ga0495635_0105734 3300046663 Unclassified 1923
737 Ga0495635_0126439 3300046663 Bacteria 1743
738 Ga0495659_0042609 3300046664 Bacteria 1625
739 Ga0495588_0000812 3300046674 Bacteria 13938
740 Ga0495588_0041339 3300046674 Bacteria 2354
741 Ga0495588_0056635 3300046674 Bacteria 2024
742 Ga0495588_0063506 3300046674 Bacteria 1915
743 Ga0495588_0122311 3300046674 Bacteria 1372
744 Ga0495657_0015166 3300046675 Bacteria 5645
745 Ga0495657_0033676 3300046675 Bacteria 3565
746 Ga0495657_0046320 3300046675 Bacteria 2945
747 Ga0495657_0107380 3300046675 Bacteria 1771
748 Ga0495599_0000110 3300046678 Bacteria 55240
749 Ga0495599_0000519 3300046678 Bacteria 22125
750 Ga0495599_0011820 3300046678 Bacteria 5368
751 Ga0495599_0093113 3300046678 Bacteria 1880
752 Ga0495599_0177620 3300046678 Bacteria 1313
753 Ga0495623_0005997 3300046679 Bacteria 7905
754 Ga0495623_0033141 3300046679 Bacteria 3316
755 Ga0495646_0005674 3300046680 Bacteria 7904
756 Ga0495646_0009733 3300046680 Bacteria 6104
757 Ga0495646_0022232 3300046680 Bacteria 4001
758 Ga0495646_0094316 3300046680 Bacteria 1723
759 Ga0495647_0013829 3300046681 Bacteria 2803
760 Ga0495647_0041893 3300046681 Bacteria 1746
761 Ga0495658_0000794 3300046683 Bacteria 17003
762 Ga0495658_0017927 3300046683 Bacteria 3670
763 Ga0495658_0069108 3300046683 Bacteria 2047
764 Ga0495658_0117328 3300046683 Bacteria 1606
765 Ga0495669_0015201 3300046684 Bacteria 3295
766 Ga0495613_0014803 3300046689 Bacteria 5789
767 Ga0495613_0048055 3300046689 Bacteria 3151
768 Ga0495613_0117332 3300046689 Bacteria 1914
769 Ga0495613_0169103 3300046689 Bacteria 1552
770 Ga0495624_0010504 3300046690 Bacteria 6383
771 Ga0495624_0013790 3300046690 Bacteria 5504
772 Ga0495624_0019028 3300046690 Bacteria 4587
773 Ga0495624_0031523 3300046690 Bacteria 3444
774 Ga0495624_0087499 3300046690 Bacteria 1924
775 Ga0495589_0008261 3300046794 Bacteria 5436
776 Ga0495581_0000542 3300047315 Bacteria 19446
777 Ga0495581_0002109 3300047315 Bacteria 11206
778 Ga0495581_0017160 3300047315 Bacteria 4207
779 Ga0495581_0037888 3300047315 Bacteria 2790
780 Ga0495581_0088403 3300047315 Unclassified 1796
781 Ga0495604_0000238 3300047317 Bacteria 49191
782 Ga0495604_0060369 3300047317 Bacteria 2904
783 Ga0495604_0089930 3300047317 Bacteria 2281
784 Ga0495604_0098303 3300047317 Bacteria 2157
785 Ga0495674_0000010 3300047319 Bacteria 285794
786 Ga0495674_0004125 3300047319 Bacteria 14022
787 Ga0495674_0128255 3300047319 Bacteria 2138
788 Ga0495674_0161788 3300047319 Bacteria 1872
789 Ga0495674_0192849 3300047319 Bacteria 1692
790 Ga0495674_0224870 3300047319 Bacteria 1550
791 Ga0495676_0000583 3300047321 Bacteria 30065
792 Ga0495676_0006975 3300047321 Bacteria 10367
793 Ga0495676_0037005 3300047321 Bacteria 4068
794 Ga0495676_0039278 3300047321 Bacteria 3922
795 Ga0495676_0138506 3300047321 Bacteria 1746
796 Ga0495676_0243398 3300047321 Unclassified 1230
797 Ga0495680_0008735 3300047322 Bacteria 9180
798 Ga0495680_0009703 3300047322 Bacteria 8640
799 Ga0495680_0013633 3300047322 Bacteria 7081
800 Ga0495680_0015897 3300047322 Bacteria 6478
801 Ga0495680_0036403 3300047322 Bacteria 3951
802 Ga0495680_0045794 3300047322 Bacteria 3452
803 Ga0495680_0071934 3300047322 Bacteria 2631
804 Ga0495675_0000262 3300047444 Bacteria 38243
805 Ga0495675_0040368 3300047444 Bacteria 2974
806 Ga0495675_0059149 3300047444 Bacteria 2430
807 Ga0495685_006549 3300047447 Bacteria 3819
808 Ga0495684_0025947 3300047471 Bacteria 4503
809 Ga0495684_0049834 3300047471 Bacteria 3199
810 Ga0495684_0104422 3300047471 Bacteria 2141
811 Ga0495684_0136233 3300047471 Unclassified 1842
812 Ga0495684_0140403 3300047471 Bacteria 1811
813 Ga0495593_0003361 3300047673 Bacteria 9583
814 Ga0495593_0034402 3300047673 Bacteria 2756
815 Ga0495602_0010209 3300048088 Bacteria 9746
816 Ga0495602_0011469 3300048088 Bacteria 9161
817 Ga0495602_0113494 3300048088 Bacteria 2196
818 Ga0495614_0010208 3300048089 Bacteria 4142
819 Ga0495614_0025966 3300048089 Bacteria 2524
820 Ga0496100_0106876 3300048903 Bacteria 1938
821 Ga0496100_0194447 3300048903 Bacteria 1475
822 Ga0496100_0266603 3300048903 Bacteria 1272
823 Ga0496101_0026233 3300048904 Bacteria 4050
824 Ga0496101_0028279 3300048904 Bacteria 3913
825 Ga0496101_0065408 3300048904 Bacteria 2650
826 Ga0496101_0091491 3300048904 Bacteria 2264
827 Ga0496101_0119174 3300048904 Bacteria 1994
828 Ga0496101_0153046 3300048904 Bacteria 1765
829 Ga0496101_0163244 3300048904 Bacteria 1710
830 Ga0496102_0005140 3300048905 Bacteria 11098
831 Ga0496102_0023351 3300048905 Bacteria 5492
832 Ga0496102_0070584 3300048905 Bacteria 3207
833 Ga0496103_0009187 3300048906 Bacteria 5854
834 Ga0496103_0031627 3300048906 Bacteria 3226
835 Ga0496103_0041804 3300048906 Bacteria 2819
836 Ga0496103_0087976 3300048906 Bacteria 1959
837 Ga0496104_0000015 3300048907 Bacteria 374530
838 Ga0496104_0000133 3300048907 Bacteria 69099
839 Ga0496104_0000699 3300048907 Bacteria 28859
840 Ga0496104_0001337 3300048907 Bacteria 21325
841 Ga0496104_0003803 3300048907 Bacteria 13056
842 Ga0496104_0004726 3300048907 Bacteria 11856
843 Ga0496104_0005710 3300048907 Bacteria 10887
844 Ga0496104_0012539 3300048907 Bacteria 7625
845 Ga0496104_0018592 3300048907 Bacteria 6342
846 Ga0496104_0058648 3300048907 Bacteria 3644
847 Ga0496104_0062778 3300048907 Bacteria 3523
848 Ga0496104_0093560 3300048907 Bacteria 2875
849 Ga0496105_0000004 3300048908 Bacteria 475798
850 Ga0496105_0000148 3300048908 Bacteria 46239
851 Ga0496105_0000595 3300048908 Bacteria 24079
852 Ga0496105_0003041 3300048908 Bacteria 12333
853 Ga0496105_0005142 3300048908 Bacteria 9921
854 Ga0496105_0020909 3300048908 Bacteria 5292
855 Ga0496105_0027281 3300048908 Bacteria 4663
856 Ga0496105_0031958 3300048908 Bacteria 4316
857 Ga0496105_0084535 3300048908 Bacteria 2621
858 Ga0496106_0006351 3300048909 Bacteria 8756
859 Ga0496106_0016234 3300048909 Bacteria 5508
860 Ga0496106_0026150 3300048909 Bacteria 4343
861 Ga0496106_0070837 3300048909 Bacteria 2663
862 Ga0496106_0113253 3300048909 Bacteria 2114
863 Ga0496106_0160270 3300048909 Bacteria 1779
864 Ga0496107_0004496 3300048910 Bacteria 9458
865 Ga0496107_0017662 3300048910 Bacteria 5018
866 Ga0496107_0059618 3300048910 Bacteria 2762
867 Ga0496107_0066587 3300048910 Bacteria 2612
868 Ga0496108_0000272 3300048911 Bacteria 44414
869 Ga0496108_0012780 3300048911 Bacteria 6836
870 Ga0496108_0037741 3300048911 Bacteria 4025
871 Ga0496108_0067233 3300048911 Bacteria 3022
872 Ga0496108_0096255 3300048911 Bacteria 2521
873 Ga0496108_0104882 3300048911 Bacteria 2413
874 Ga0496108_0121102 3300048911 Bacteria 2244
875 Ga0496109_0000578 3300048912 Bacteria 30715
876 Ga0496109_0000993 3300048912 Bacteria 23393
877 Ga0496109_0001933 3300048912 Bacteria 17222
878 Ga0496109_0022810 3300048912 Bacteria 5546
879 Ga0496109_0024331 3300048912 Bacteria 5383
880 Ga0496109_0039781 3300048912 Bacteria 4257
881 Ga0496109_0057043 3300048912 Bacteria 3563
882 Ga0496109_0093185 3300048912 Bacteria 2787
883 Ga0496109_0198673 3300048912 Bacteria 1885
884 Ga0496109_0346906 3300048912 Unclassified 1402
885 Ga0496110_0000746 3300048913 Bacteria 22474
886 Ga0496110_0002158 3300048913 Bacteria 14684
887 Ga0496110_0011829 3300048913 Bacteria 7165
888 Ga0496110_0056199 3300048913 Bacteria 3463
889 Ga0496110_0076452 3300048913 Bacteria 2977
890 Ga0496110_0111152 3300048913 Bacteria 2463
891 Ga0496110_0174667 3300048913 Unclassified 1950
892 Ga0496110_0211495 3300048913 Unclassified 1763
893 Ga0496110_0392667 3300048913 Bacteria 1265
894 Ga0496111_0000499 3300048914 Bacteria 20270
895 Ga0496111_0016234 3300048914 Bacteria 5130
896 Ga0496111_0027056 3300048914 Bacteria 4054
897 Ga0496111_0033102 3300048914 Bacteria 3686
898 Ga0496111_0058869 3300048914 Bacteria 2782
899 Ga0496111_0062583 3300048914 Bacteria 2699
900 Ga0496111_0161895 3300048914 Bacteria 1662
901 Ga0496112_0001182 3300048915 Bacteria 19571
902 Ga0496112_0020408 3300048915 Bacteria 6281
903 Ga0496112_0021074 3300048915 Bacteria 6191
904 Ga0496112_0028772 3300048915 Bacteria 5368
905 Ga0496112_0060665 3300048915 Bacteria 3727
906 Ga0496112_0096105 3300048915 Bacteria 2933
907 Ga0496112_0137566 3300048915 Bacteria 2412
908 Ga0496112_0161566 3300048915 Bacteria 2207
909 Ga0496112_0264118 3300048915 Bacteria 1670
910 Ga0496112_0488156 3300048915 Bacteria 1168
911 Ga0496113_0000040 3300048916 Bacteria 55517
912 Ga0496113_0004976 3300048916 Bacteria 8237
913 Ga0496113_0029360 3300048916 Bacteria 3970
914 Ga0496113_0037313 3300048916 Bacteria 3565
915 Ga0496113_0047236 3300048916 Bacteria 3199
916 Ga0496113_0118181 3300048916 Bacteria 2070
917 Ga0496113_0178938 3300048916 Bacteria 1681
918 Ga0496113_0219786 3300048916 Bacteria 1514
919 Ga0496114_0003196 3300048917 Bacteria 12564
920 Ga0496114_0003379 3300048917 Bacteria 12253
921 Ga0496114_0030568 3300048917 Bacteria 4432
922 Ga0496114_0039640 3300048917 Bacteria 3898
923 Ga0496114_0071680 3300048917 Bacteria 2912
924 Ga0496114_0072002 3300048917 Bacteria 2906
925 Ga0496114_0132058 3300048917 Bacteria 2157
926 Ga0496114_0174442 3300048917 Unclassified 1875
927 Ga0496114_0251776 3300048917 Unclassified 1554
928 Ga0496115_0017242 3300048918 Bacteria 5514
929 Ga0496115_0057656 3300048918 Bacteria 3124
930 Ga0496115_0069990 3300048918 Bacteria 2843
931 Ga0496115_0070347 3300048918 Bacteria 2836
932 Ga0496115_0183991 3300048918 Bacteria 1726
933 Ga0496119_0019718 3300048922 Bacteria 4950
934 Ga0501031_0027314 3300049568 Bacteria 3721
935 Ga0501039_0016924 3300049575 Bacteria 5588
936 Ga0501040_0022023 3300049576 Bacteria 4262
937 Ga0501040_0155730 3300049576 Bacteria 1613
938 Ga0501041_0164474 3300049577 Bacteria 1387
939 Ga0501043_0009300 3300049579 Bacteria 7720
940 Ga0501046_0110657 3300049580 Bacteria 2098
941 Ga0501067_0003396 3300049583 Bacteria 8761
942 Ga0501067_0016859 3300049583 Bacteria 4034
943 Ga0501067_0087822 3300049583 Bacteria 1725
944 Ga0501067_0096979 3300049583 Unclassified 1637
945 Ga0501068_0001181 3300049584 Bacteria 13899
946 Ga0501069_0002399 3300049585 Bacteria 9513
947 Ga0501069_0016467 3300049585 Bacteria 3973
948 Ga0501069_0016640 3300049585 Bacteria 3952
949 Ga0501069_0022584 3300049585 Bacteria 3424
950 Ga0501069_0027636 3300049585 Bacteria 3109
951 Ga0501070_0008509 3300049586 Bacteria 8672
952 Ga0501070_0010395 3300049586 Bacteria 7867
953 Ga0501070_0014204 3300049586 Bacteria 6700
954 Ga0501070_0089951 3300049586 Bacteria 2541
955 Ga0501071_0018729 3300049587 Bacteria 4800
956 Ga0501071_0127219 3300049587 Bacteria 1891
957 Ga0501072_0083731 3300049588 Bacteria 2528
958 Ga0501072_0150155 3300049588 Bacteria 1858
959 Ga0501074_0017874 3300049590 Bacteria 5152
960 Ga0501076_0011754 3300049592 Bacteria 6535
961 Ga0501077_0043666 3300049593 Bacteria 2848
962 Ga0501079_0021128 3300049741 Bacteria 4976
963 Ga0501081_0004576 3300049743 Bacteria 8880
964 Ga0501083_0025552 3300049744 Bacteria 4089
965 Ga0501045_0010111 3300049824 Bacteria 6603
966 Ga0501045_0093128 3300049824 Bacteria 2228
967 nmdc:mga05p37_148675_c1 3300050507 Bacteria 2867
968 nmdc:mga05p37_1648_c1 3300050507 Bacteria 25906
969 nmdc:mga05p37_4144_c2 3300050507 Bacteria 16203
970 nmdc:mga05p37_45059_c1 3300050507 Bacteria 5426
971 nmdc:mga05p37_53795_c1 3300050507 Bacteria 4952
972 nmdc:mga09592_135586_c1 3300050508 Bacteria 2120
973 nmdc:mga09592_195461_c1 3300050508 Bacteria 1751
974 nmdc:mga0qj67_65425_c1 3300050509 Bacteria 2894
975 nmdc:mga06r32_11086_c1 3300050510 Bacteria 8114
976 nmdc:mga08y16_141052_c1 3300050511 Unclassified 2505
977 nmdc:mga08y16_19969_c1 3300050511 Bacteria 7070
978 nmdc:mga08y16_284641_c1 3300050511 Bacteria 1705
979 nmdc:mga0n895_13560_c1 3300050512 Bacteria 7362
980 nmdc:mga0n895_144310_c1 3300050512 Bacteria 2410
981 nmdc:mga0n895_217996_c1 3300050512 Bacteria 1938
982 nmdc:mga0n895_29458_c1 3300050512 Bacteria 5237
983 nmdc:mga0rr50_12711_c1 3300050513 Bacteria 5453
984 nmdc:mga0rr50_13489_c1 3300050513 Bacteria 5322
985 nmdc:mga0rr50_38904_c1 3300050513 Bacteria 3446
986 nmdc:mga0rr50_55552_c1 3300050513 Bacteria 2955
987 nmdc:mga0rr50_78467_c1 3300050513 Bacteria 2541
988 nmdc:mga08x19_2647_c1 3300050514 Bacteria 10831
989 nmdc:mga0a205_120264_c1 3300050515 Bacteria 2526
990 nmdc:mga0a205_247804_c1 3300050515 Bacteria 1661
991 nmdc:mga0a205_252300_c1 3300050515 Bacteria 1643
992 nmdc:mga0a205_55410_c1 3300050515 Bacteria 3830
993 nmdc:mga0a205_68871_c1 3300050515 Bacteria 3418
994 nmdc:mga0a205_89899_c1 3300050515 Bacteria 2968
995 nmdc:mga0a205_9936_c1 3300050515 Bacteria 8729
996 Ga0495601_0007612 3300053077 Bacteria 6360
997 Ga0495601_0007870 3300053077 Bacteria 6276
998 Ga0495601_0039693 3300053077 Bacteria 2948
999 Ga0495601_0041154 3300053077 Bacteria 2896
1000 Ga0495601_0108271 3300053077 Bacteria 1798
1001 Ga0495601_0140940 3300053077 Bacteria 1572
1002 Ga0495612_0012979 3300053078 Bacteria 3356
1003 Ga0495612_0021217 3300053078 Unclassified 2606
1004 Ga0495612_0021410 3300053078 Bacteria 2594
1005 Ga0495595_0004929 3300053084 Bacteria 5384
1006 Ga0495595_0022765 3300053084 Bacteria 2753
1007 Ga0495595_0026387 3300053084 Bacteria 2581
1008 Ga0495619_0000507 3300053085 Bacteria 25923
1009 Ga0495619_0001017 3300053085 Bacteria 18372
1010 Ga0495619_0002571 3300053085 Bacteria 11864
1011 Ga0495619_0007865 3300053085 Bacteria 6745
1012 Ga0495619_0012980 3300053085 Bacteria 5249
1013 Ga0495619_0034749 3300053085 Bacteria 3277
1014 Ga0500566_0045228 3300053094 Bacteria 2535
1015 Ga0501084_0151623 3300054114 Unclassified 1954
1016 Ga0501084_0222004 3300054114 Bacteria 1594
1017 Ga0466962_0004473 3300061719 Bacteria 6699
1018 Ga0466962_0021951 3300061719 Bacteria 3065
1019 Ga0530510_0030809 3300061734 Bacteria 3854
1020 Ga0530510_0113514 3300061734 Bacteria 1986

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_10026922 Ga0163162_100269225 292
2 3300047444 Ga0495675_0040368 Ga0495675_0040368_1016_1936 305
3 3300025904 Ga0207647_10154597 Ga0207647_101545971 310
4 3300037466 Ga0395898_0600040 Ga0395898_0600040_15_968 315
5 3300009098 Ga0105245_10003086 Ga0105245_1000308610 323
6 3300048917 Ga0496114_0174442 Ga0496114_0174442_322_1323 323
7 3300025927 Ga0207687_10166619 Ga0207687_101666192 333
8 3300025906 Ga0207699_10081352 Ga0207699_100813523 336
9 3300020070 Ga0206356_11233245 Ga0206356_112332451 338
10 3300025910 Ga0207684_10312577 Ga0207684_103125771 338
11 3300046615 Ga0495656_0113038 Ga0495656_0113038_228_1253 338
12 3300048903 Ga0496100_0266603 Ga0496100_0266603_237_1259 338
13 3300038443 Ga0395901_0241094 Ga0395901_0241094_164_1297 339
14 3300048908 Ga0496105_0027281 Ga0496105_0027281_2764_3795 340
15 3300061734 Ga0530510_0113514 Ga0530510_0113514_287_1327 343
16 3300005327 Ga0070658_10010832 Ga0070658_100108328 344
17 3300005339 Ga0070660_100005923 Ga0070660_1000059234 344
18 3300013100 Ga0157373_10145747 Ga0157373_101457472 344
19 3300046475 Ga0495639_0066254 Ga0495639_0066254_585_1631 345
20 3300048913 Ga0496110_0392667 Ga0496110_0392667_141_1190 345
21 3300049583 Ga0501067_0016859 Ga0501067_0016859_935_2047 345
22 3300049585 Ga0501069_0022584 Ga0501069_0022584_1092_2204 345
23 3300049586 Ga0501070_0089951 Ga0501070_0089951_700_1812 345
24 3300061734 Ga0530510_0030809 Ga0530510_0030809_1331_2443 345
25 3300005436 Ga0070713_100089869 Ga0070713_1000898692 346
26 3300006028 Ga0070717_10037914 Ga0070717_100379143 346
27 3300025928 Ga0207700_10169436 Ga0207700_101694362 346
28 3300025929 Ga0207664_10083264 Ga0207664_100832641 346
29 3300005564 Ga0070664_100239925 Ga0070664_1002399252 350
30 3300005981 Ga0081538_10053605 Ga0081538_100536053 350
31 3300005456 Ga0070678_100027211 Ga0070678_1000272113 353
32 3300026121 Ga0207683_10012321 Ga0207683_100123216 353
33 3300028563 Ga0265319_1000592 Ga0265319_100059212 353
34 3300028577 Ga0265318_10005482 Ga0265318_100054824 353
35 3300028800 Ga0265338_10007029 Ga0265338_1000702910 353
36 3300031240 Ga0265320_10051332 Ga0265320_100513323 353
37 3300031344 Ga0265316_10012119 Ga0265316_100121197 353
38 3300031712 Ga0265342_10045680 Ga0265342_100456803 353
39 3300005436 Ga0070713_100058191 Ga0070713_1000581912 355
40 3300005458 Ga0070681_10103021 Ga0070681_101030213 355
41 3300005535 Ga0070684_100033850 Ga0070684_1000338502 355
42 3300005564 Ga0070664_100180277 Ga0070664_1001802772 355
43 3300025945 Ga0207679_10138480 Ga0207679_101384802 355
44 3300044694 Ga0466963_0004245 Ga0466963_0004245_4284_5366 355
45 3300044694 Ga0466963_0011880 Ga0466963_0011880_1901_2983 355
46 3300044694 Ga0466963_0081131 Ga0466963_0081131_529_1611 355
47 3300044706 Ga0466964_0017735 Ga0466964_0017735_392_1474 355
48 3300044765 Ga0466970_0160736 Ga0466970_0160736_36_1118 355
49 3300045836 Ga0466958_0000988 Ga0466958_0000988_9921_11003 355
50 3300045976 Ga0466967_0031978 Ga0466967_0031978_457_1539 355
51 3300046455 Ga0495603_0014127 Ga0495603_0014127_745_1827 355
52 3300046473 Ga0495582_0044924 Ga0495582_0044924_106_1188 355
53 3300046664 Ga0495659_0042609 Ga0495659_0042609_222_1310 355
54 3300046683 Ga0495658_0069108 Ga0495658_0069108_292_1374 355
55 3300047322 Ga0495680_0036403 Ga0495680_0036403_344_1453 355
56 3300053077 Ga0495601_0108271 Ga0495601_0108271_300_1409 355
57 3300005347 Ga0070668_100088205 Ga0070668_1000882052 356
58 3300005367 Ga0070667_100009302 Ga0070667_1000093024 356
59 3300005435 Ga0070714_100058112 Ga0070714_1000581122 356
60 3300005435 Ga0070714_100244341 Ga0070714_1002443412 356
61 3300005436 Ga0070713_100043207 Ga0070713_1000432071 356
62 3300005844 Ga0068862_100001367 Ga0068862_10000136715 356
63 3300006028 Ga0070717_10301524 Ga0070717_103015242 356
64 3300009553 Ga0105249_10034961 Ga0105249_100349612 356
65 3300025915 Ga0207693_10047648 Ga0207693_100476484 356
66 3300025928 Ga0207700_10064336 Ga0207700_100643364 356
67 3300025929 Ga0207664_10073207 Ga0207664_100732072 356
68 3300025961 Ga0207712_10024209 Ga0207712_100242092 356
69 3300025972 Ga0207668_10101007 Ga0207668_101010072 356
70 3300028380 Ga0268265_10003678 Ga0268265_100036784 356
71 3300028556 Ga0265337_1025219 Ga0265337_10252192 356
72 3300028577 Ga0265318_10043101 Ga0265318_100431012 356
73 3300028800 Ga0265338_10034817 Ga0265338_100348174 356
74 3300031250 Ga0265331_10020343 Ga0265331_100203435 356
75 3300031711 Ga0265314_10031419 Ga0265314_100314193 356
76 3300038443 Ga0395901_0146551 Ga0395901_0146551_729_1835 356
77 3300044683 Ga0466965_0004578 Ga0466965_0004578_1449_2534 356
78 3300044694 Ga0466963_0035060 Ga0466963_0035060_389_1474 356
79 3300044735 Ga0466968_0031417 Ga0466968_0031417_773_1858 356
80 3300045976 Ga0466967_0054362 Ga0466967_0054362_1809_2891 356
81 3300045976 Ga0466967_0111660 Ga0466967_0111660_249_1334 356
82 3300050511 nmdc:mga08y16_141052_c1 nmdc:mga08y16_141052_c1_1413_2492 356
83 3300005937 Ga0081455_10005820 Ga0081455_100058204 357
84 3300037418 Ga0395900_0227670 Ga0395900_0227670_417_1562 357
85 3300046511 Ga0495608_0002626 Ga0495608_0002626_6191_7309 357
86 3300044693 Ga0466961_0004260 Ga0466961_0004260_834_1925 358
87 3300005614 Ga0068856_100076900 Ga0068856_1000769002 359
88 3300044694 Ga0466963_0002868 Ga0466963_0002868_2727_3845 359
89 3300048912 Ga0496109_0346906 Ga0496109_0346906_121_1206 359
90 3300048913 Ga0496110_0174667 Ga0496110_0174667_344_1462 359
91 3300048913 Ga0496110_0211495 Ga0496110_0211495_248_1333 359
92 3300048915 Ga0496112_0028772 Ga0496112_0028772_3733_4818 359
93 3300049583 Ga0501067_0087822 Ga0501067_0087822_198_1283 359
94 3300049585 Ga0501069_0016640 Ga0501069_0016640_1733_2818 359
95 3300046516 Ga0495628_0001154 Ga0495628_0001154_2894_4003 360
96 3300048914 Ga0496111_0161895 Ga0496111_0161895_149_1237 360
97 3300048917 Ga0496114_0132058 Ga0496114_0132058_429_1517 360
98 3300005367 Ga0070667_100178778 Ga0070667_1001787782 361
99 3300025986 Ga0207658_10045246 Ga0207658_100452463 361
100 3300037312 Ga0395899_0016341 Ga0395899_0016341_1966_3069 362
101 3300005336 Ga0070680_100115905 Ga0070680_1001159052 363
102 3300005366 Ga0070659_100071877 Ga0070659_1000718772 363
103 3300005434 Ga0070709_10095217 Ga0070709_100952172 363
104 3300005435 Ga0070714_100029254 Ga0070714_1000292545 363
105 3300005435 Ga0070714_100099389 Ga0070714_1000993893 363
106 3300005437 Ga0070710_10012734 Ga0070710_100127345 363
107 3300005439 Ga0070711_100051343 Ga0070711_1000513433 363
108 3300005458 Ga0070681_10045320 Ga0070681_100453204 363
109 3300005458 Ga0070681_10212509 Ga0070681_102125092 363
110 3300005467 Ga0070706_100122830 Ga0070706_1001228302 363
111 3300005471 Ga0070698_100192258 Ga0070698_1001922582 363
112 3300005530 Ga0070679_100064484 Ga0070679_1000644843 363
113 3300005530 Ga0070679_100159956 Ga0070679_1001599563 363
114 3300005546 Ga0070696_100232270 Ga0070696_1002322701 363
115 3300005563 Ga0068855_100083393 Ga0068855_1000833932 363
116 3300005564 Ga0070664_100143570 Ga0070664_1001435702 363
117 3300005614 Ga0068856_100196648 Ga0068856_1001966482 363
118 3300005614 Ga0068856_100235155 Ga0068856_1002351552 363
119 3300005937 Ga0081455_10035655 Ga0081455_100356555 363
120 3300006028 Ga0070717_10101499 Ga0070717_101014992 363
121 3300006175 Ga0070712_100090282 Ga0070712_1000902822 363
122 3300006871 Ga0075434_100181318 Ga0075434_1001813183 363
123 3300009094 Ga0111539_10051846 Ga0111539_100518465 363
124 3300009551 Ga0105238_10150945 Ga0105238_101509452 363
125 3300013105 Ga0157369_10039852 Ga0157369_100398525 363
126 3300014497 Ga0182008_10005743 Ga0182008_100057438 363
127 3300025909 Ga0207705_10063948 Ga0207705_100639483 363
128 3300025915 Ga0207693_10000945 Ga0207693_1000094523 363
129 3300025915 Ga0207693_10112782 Ga0207693_101127822 363
130 3300025919 Ga0207657_10003731 Ga0207657_1000373110 363
131 3300025922 Ga0207646_10002421 Ga0207646_1000242110 363
132 3300025924 Ga0207694_10064076 Ga0207694_100640762 363
133 3300025927 Ga0207687_10066707 Ga0207687_100667073 363
134 3300025929 Ga0207664_10060285 Ga0207664_100602853 363
135 3300025929 Ga0207664_10247239 Ga0207664_102472391 363
136 3300025929 Ga0207664_10394379 Ga0207664_103943791 363
137 3300026078 Ga0207702_10075448 Ga0207702_100754482 363
138 3300031995 Ga0307409_100293301 Ga0307409_1002933012 363
139 3300032002 Ga0307416_100106261 Ga0307416_1001062613 363
140 3300035170 Ga0373943_0011525 Ga0373943_0011525_178_1284 363
141 3300035692 Ga0373935_0072020 Ga0373935_0072020_529_1635 363
142 3300035695 Ga0373927_0158836 Ga0373927_0158836_307_1413 363
143 3300036401 Ga0373937_0000548 Ga0373937_0000548_18303_19409 363
144 3300036401 Ga0373937_0025305 Ga0373937_0025305_2859_3965 363
145 3300036401 Ga0373937_0338739 Ga0373937_0338739_235_1344 363
146 3300037068 Ga0373925_0055357 Ga0373925_0055357_1328_2434 363
147 3300037312 Ga0395899_0073691 Ga0395899_0073691_665_1771 363
148 3300037418 Ga0395900_0006681 Ga0395900_0006681_9332_10438 363
149 3300037466 Ga0395898_0011394 Ga0395898_0011394_1488_2594 363
150 3300038443 Ga0395901_0117180 Ga0395901_0117180_883_1989 363
151 3300038443 Ga0395901_0161945 Ga0395901_0161945_624_1727 363
152 3300044683 Ga0466965_0085556 Ga0466965_0085556_389_1495 363
153 3300044684 Ga0466966_0020499 Ga0466966_0020499_51_1157 363
154 3300044693 Ga0466961_0002675 Ga0466961_0002675_6665_7771 363
155 3300044693 Ga0466961_0083012 Ga0466961_0083012_815_1921 363
156 3300044694 Ga0466963_0000261 Ga0466963_0000261_14411_15517 363
157 3300044694 Ga0466963_0002376 Ga0466963_0002376_1559_2665 363
158 3300044694 Ga0466963_0024908 Ga0466963_0024908_1005_2111 363
159 3300044694 Ga0466963_0044167 Ga0466963_0044167_1058_2164 363
160 3300044694 Ga0466963_0076363 Ga0466963_0076363_599_1705 363
161 3300044694 Ga0466963_0083860 Ga0466963_0083860_771_1877 363
162 3300044706 Ga0466964_0008804 Ga0466964_0008804_2643_3749 363
163 3300044706 Ga0466964_0026000 Ga0466964_0026000_215_1321 363
164 3300044706 Ga0466964_0063959 Ga0466964_0063959_304_1410 363
165 3300044735 Ga0466968_0003161 Ga0466968_0003161_2482_3588 363
166 3300044735 Ga0466968_0008909 Ga0466968_0008909_1751_2857 363
167 3300044765 Ga0466970_0014312 Ga0466970_0014312_1486_2592 363
168 3300044842 Ga0466957_0006127 Ga0466957_0006127_3132_4238 363
169 3300044842 Ga0466957_0030739 Ga0466957_0030739_1116_2222 363
170 3300045049 Ga0466959_0025227 Ga0466959_0025227_2935_4041 363
171 3300045836 Ga0466958_0031646 Ga0466958_0031646_778_1884 363
172 3300045836 Ga0466958_0121919 Ga0466958_0121919_391_1497 363
173 3300045976 Ga0466967_0002587 Ga0466967_0002587_6135_7241 363
174 3300045976 Ga0466967_0013294 Ga0466967_0013294_290_1396 363
175 3300045976 Ga0466967_0013473 Ga0466967_0013473_4917_6023 363
176 3300045976 Ga0466967_0015101 Ga0466967_0015101_3828_4934 363
177 3300045976 Ga0466967_0027600 Ga0466967_0027600_1213_2319 363
178 3300045976 Ga0466967_0031057 Ga0466967_0031057_2303_3409 363
179 3300045976 Ga0466967_0122613 Ga0466967_0122613_640_1746 363
180 3300045976 Ga0466967_0141492 Ga0466967_0141492_158_1318 363
181 3300045976 Ga0466967_0187418 Ga0466967_0187418_441_1550 363
182 3300045976 Ga0466967_0226508 Ga0466967_0226508_32_1141 363
183 3300045976 Ga0466967_0242022 Ga0466967_0242022_169_1275 363
184 3300045976 Ga0466967_0440315 Ga0466967_0440315_53_1159 363
185 3300046454 Ga0495592_0000100 Ga0495592_0000100_4618_5724 363
186 3300046454 Ga0495592_0060169 Ga0495592_0060169_203_1309 363
187 3300046455 Ga0495603_0104510 Ga0495603_0104510_90_1196 363
188 3300046459 Ga0495629_0030475 Ga0495629_0030475_1639_2745 363
189 3300046461 Ga0495641_0055610 Ga0495641_0055610_405_1511 363
190 3300046461 Ga0495641_0056804 Ga0495641_0056804_490_1596 363
191 3300046461 Ga0495641_0064745 Ga0495641_0064745_306_1412 363
192 3300046462 Ga0495651_0000008 Ga0495651_0000008_125925_127031 363
193 3300046462 Ga0495651_0042861 Ga0495651_0042861_886_1992 363
194 3300046462 Ga0495651_0056623 Ga0495651_0056623_1595_2701 363
195 3300046463 Ga0495653_0035380 Ga0495653_0035380_777_1883 363
196 3300046473 Ga0495582_0100123 Ga0495582_0100123_161_1267 363
197 3300046473 Ga0495582_0172744 Ga0495582_0172744_74_1180 363
198 3300046474 Ga0495605_0019449 Ga0495605_0019449_2305_3411 363
199 3300046475 Ga0495639_0004850 Ga0495639_0004850_4090_5196 363
200 3300046501 Ga0495607_0088451 Ga0495607_0088451_464_1570 363
201 3300046511 Ga0495608_0011259 Ga0495608_0011259_399_1505 363
202 3300046511 Ga0495608_0039772 Ga0495608_0039772_765_1871 363
203 3300046514 Ga0495618_0006703 Ga0495618_0006703_1618_2724 363
204 3300046514 Ga0495618_0117810 Ga0495618_0117810_538_1644 363
205 3300046516 Ga0495628_0000105 Ga0495628_0000105_30313_31419 363
206 3300046516 Ga0495628_0005946 Ga0495628_0005946_2147_3253 363
207 3300046516 Ga0495628_0028966 Ga0495628_0028966_2208_3314 363
208 3300046516 Ga0495628_0172847 Ga0495628_0172847_114_1223 363
209 3300046517 Ga0495630_0014105 Ga0495630_0014105_4636_5742 363
210 3300046523 Ga0495644_0004305 Ga0495644_0004305_2575_3681 363
211 3300046529 Ga0495652_0000588 Ga0495652_0000588_4644_5750 363
212 3300046529 Ga0495652_0007715 Ga0495652_0007715_6650_7756 363
213 3300046529 Ga0495652_0077392 Ga0495652_0077392_101_1207 363
214 3300046529 Ga0495652_0124966 Ga0495652_0124966_500_1606 363
215 3300046531 Ga0495665_0020951 Ga0495665_0020951_1559_2665 363
216 3300046533 Ga0495640_0012819 Ga0495640_0012819_74_1180 363
217 3300046533 Ga0495640_0026363 Ga0495640_0026363_1463_2569 363
218 3300046535 Ga0495586_0057494 Ga0495586_0057494_814_1920 363
219 3300046536 Ga0495587_0000048 Ga0495587_0000048_33313_34419 363
220 3300046536 Ga0495587_0019872 Ga0495587_0019872_744_1850 363
221 3300046543 Ga0495645_0000029 Ga0495645_0000029_78701_79807 363
222 3300046543 Ga0495645_0018139 Ga0495645_0018139_3475_4581 363
223 3300046559 Ga0495667_0005882 Ga0495667_0005882_3846_4952 363
224 3300046615 Ga0495656_0096626 Ga0495656_0096626_132_1235 363
225 3300046642 Ga0495634_0048784 Ga0495634_0048784_623_1729 363
226 3300046642 Ga0495634_0071929 Ga0495634_0071929_984_2090 363
227 3300046648 Ga0495611_0123291 Ga0495611_0123291_80_1186 363
228 3300046663 Ga0495635_0047792 Ga0495635_0047792_1524_2630 363
229 3300046674 Ga0495588_0063506 Ga0495588_0063506_26_1132 363
230 3300046675 Ga0495657_0015166 Ga0495657_0015166_1678_2784 363
231 3300046675 Ga0495657_0046320 Ga0495657_0046320_1625_2731 363
232 3300046675 Ga0495657_0107380 Ga0495657_0107380_490_1596 363
233 3300046678 Ga0495599_0000110 Ga0495599_0000110_33312_34418 363
234 3300046678 Ga0495599_0000519 Ga0495599_0000519_17673_18779 363
235 3300046678 Ga0495599_0011820 Ga0495599_0011820_3604_4710 363
236 3300046678 Ga0495599_0177620 Ga0495599_0177620_65_1171 363
237 3300046679 Ga0495623_0005997 Ga0495623_0005997_4505_5611 363
238 3300046679 Ga0495623_0033141 Ga0495623_0033141_2028_3134 363
239 3300046680 Ga0495646_0005674 Ga0495646_0005674_4636_5742 363
240 3300046680 Ga0495646_0009733 Ga0495646_0009733_2009_3115 363
241 3300046680 Ga0495646_0022232 Ga0495646_0022232_1103_2209 363
242 3300046680 Ga0495646_0094316 Ga0495646_0094316_567_1673 363
243 3300046681 Ga0495647_0013829 Ga0495647_0013829_78_1184 363
244 3300046683 Ga0495658_0017927 Ga0495658_0017927_2514_3620 363
245 3300046683 Ga0495658_0117328 Ga0495658_0117328_472_1578 363
246 3300046689 Ga0495613_0048055 Ga0495613_0048055_1641_2747 363
247 3300046689 Ga0495613_0117332 Ga0495613_0117332_586_1695 363
248 3300046689 Ga0495613_0169103 Ga0495613_0169103_226_1332 363
249 3300046690 Ga0495624_0010504 Ga0495624_0010504_687_1793 363
250 3300046690 Ga0495624_0019028 Ga0495624_0019028_1782_2888 363
251 3300046690 Ga0495624_0031523 Ga0495624_0031523_1812_2918 363
252 3300046794 Ga0495589_0008261 Ga0495589_0008261_2457_3563 363
253 3300047315 Ga0495581_0088403 Ga0495581_0088403_51_1157 363
254 3300047317 Ga0495604_0000238 Ga0495604_0000238_4505_5611 363
255 3300047317 Ga0495604_0089930 Ga0495604_0089930_756_1862 363
256 3300047319 Ga0495674_0128255 Ga0495674_0128255_62_1168 363
257 3300047319 Ga0495674_0161788 Ga0495674_0161788_74_1180 363
258 3300047319 Ga0495674_0224870 Ga0495674_0224870_346_1452 363
259 3300047321 Ga0495676_0039278 Ga0495676_0039278_2531_3637 363
260 3300047321 Ga0495676_0243398 Ga0495676_0243398_74_1180 363
261 3300047322 Ga0495680_0008735 Ga0495680_0008735_7161_8267 363
262 3300047322 Ga0495680_0013633 Ga0495680_0013633_4950_6056 363
263 3300047322 Ga0495680_0071934 Ga0495680_0071934_1211_2317 363
264 3300047444 Ga0495675_0000262 Ga0495675_0000262_4516_5622 363
265 3300047471 Ga0495684_0049834 Ga0495684_0049834_2028_3134 363
266 3300047471 Ga0495684_0104422 Ga0495684_0104422_420_1526 363
267 3300047471 Ga0495684_0136233 Ga0495684_0136233_66_1172 363
268 3300047471 Ga0495684_0140403 Ga0495684_0140403_378_1484 363
269 3300047673 Ga0495593_0003361 Ga0495593_0003361_1056_2162 363
270 3300048088 Ga0495602_0010209 Ga0495602_0010209_4529_5635 363
271 3300048088 Ga0495602_0011469 Ga0495602_0011469_2149_3255 363
272 3300048089 Ga0495614_0025966 Ga0495614_0025966_1251_2357 363
273 3300048904 Ga0496101_0119174 Ga0496101_0119174_174_1280 363
274 3300048904 Ga0496101_0153046 Ga0496101_0153046_378_1484 363
275 3300048907 Ga0496104_0004726 Ga0496104_0004726_9492_10598 363
276 3300048907 Ga0496104_0062778 Ga0496104_0062778_343_1449 363
277 3300048908 Ga0496105_0005142 Ga0496105_0005142_6416_7522 363
278 3300048909 Ga0496106_0160270 Ga0496106_0160270_445_1551 363
279 3300048910 Ga0496107_0066587 Ga0496107_0066587_403_1512 363
280 3300048911 Ga0496108_0096255 Ga0496108_0096255_361_1467 363
281 3300048912 Ga0496109_0000993 Ga0496109_0000993_2919_4025 363
282 3300048916 Ga0496113_0037313 Ga0496113_0037313_37_1143 363
283 3300048917 Ga0496114_0071680 Ga0496114_0071680_1407_2513 363
284 3300048918 Ga0496115_0069990 Ga0496115_0069990_442_1548 363
285 3300048918 Ga0496115_0183991 Ga0496115_0183991_573_1679 363
286 3300049575 Ga0501039_0016924 Ga0501039_0016924_4350_5468 363
287 3300049576 Ga0501040_0155730 Ga0501040_0155730_466_1584 363
288 3300049577 Ga0501041_0164474 Ga0501041_0164474_29_1147 363
289 3300049579 Ga0501043_0009300 Ga0501043_0009300_4200_5318 363
290 3300049580 Ga0501046_0110657 Ga0501046_0110657_515_1633 363
291 3300049583 Ga0501067_0096979 Ga0501067_0096979_343_1449 363
292 3300049585 Ga0501069_0016467 Ga0501069_0016467_1620_2726 363
293 3300049586 Ga0501070_0008509 Ga0501070_0008509_808_1926 363
294 3300049586 Ga0501070_0010395 Ga0501070_0010395_6374_7483 363
295 3300049587 Ga0501071_0127219 Ga0501071_0127219_30_1148 363
296 3300049590 Ga0501074_0017874 Ga0501074_0017874_1340_2449 363
297 3300049592 Ga0501076_0011754 Ga0501076_0011754_5177_6295 363
298 3300049593 Ga0501077_0043666 Ga0501077_0043666_234_1352 363
299 3300049741 Ga0501079_0021128 Ga0501079_0021128_1489_2607 363
300 3300049824 Ga0501045_0093128 Ga0501045_0093128_1066_2184 363
301 3300050512 nmdc:mga0n895_144310_c1 nmdc:mga0n895_144310_c1_745_1851 363
302 3300053077 Ga0495601_0007870 Ga0495601_0007870_4157_5263 363
303 3300053077 Ga0495601_0039693 Ga0495601_0039693_308_1414 363
304 3300053077 Ga0495601_0140940 Ga0495601_0140940_378_1484 363
305 3300053078 Ga0495612_0012979 Ga0495612_0012979_1681_2787 363
306 3300053078 Ga0495612_0021217 Ga0495612_0021217_487_1593 363
307 3300053078 Ga0495612_0021410 Ga0495612_0021410_874_1980 363
308 3300053084 Ga0495595_0004929 Ga0495595_0004929_3954_5060 363
309 3300053084 Ga0495595_0026387 Ga0495595_0026387_1306_2412 363
310 3300053085 Ga0495619_0012980 Ga0495619_0012980_3712_4818 363
311 3300053085 Ga0495619_0034749 Ga0495619_0034749_813_1919 363
312 3300053094 Ga0500566_0045228 Ga0500566_0045228_256_1362 363
313 3300054114 Ga0501084_0222004 Ga0501084_0222004_364_1482 363
314 3300061719 Ga0466962_0004473 Ga0466962_0004473_3270_4376 363
315 3300061719 Ga0466962_0021951 Ga0466962_0021951_1223_2329 363
316 3300005327 Ga0070658_10001917 Ga0070658_1000191713 364
317 3300005327 Ga0070658_10009008 Ga0070658_100090087 364
318 3300005336 Ga0070680_100212999 Ga0070680_1002129992 364
319 3300005337 Ga0070682_100013796 Ga0070682_1000137965 364
320 3300005344 Ga0070661_100005675 Ga0070661_1000056752 364
321 3300005436 Ga0070713_100224591 Ga0070713_1002245912 364
322 3300005456 Ga0070678_100083046 Ga0070678_1000830462 364
323 3300005458 Ga0070681_10019656 Ga0070681_100196564 364
324 3300005458 Ga0070681_10042356 Ga0070681_100423563 364
325 3300005471 Ga0070698_100163311 Ga0070698_1001633112 364
326 3300005530 Ga0070679_100013238 Ga0070679_1000132382 364
327 3300005535 Ga0070684_100000304 Ga0070684_1000003043 364
328 3300005563 Ga0068855_100015558 Ga0068855_1000155582 364
329 3300005564 Ga0070664_100261620 Ga0070664_1002616202 364
330 3300005614 Ga0068856_100063236 Ga0068856_1000632362 364
331 3300006358 Ga0068871_100182559 Ga0068871_1001825592 364
332 3300006871 Ga0075434_100001557 Ga0075434_10000155712 364
333 3300007076 Ga0075435_100017412 Ga0075435_1000174126 364
334 3300009093 Ga0105240_10092787 Ga0105240_100927875 364
335 3300009093 Ga0105240_10175155 Ga0105240_101751552 364
336 3300009098 Ga0105245_10046270 Ga0105245_100462702 364
337 3300013104 Ga0157370_10027005 Ga0157370_100270056 364
338 3300013105 Ga0157369_10051221 Ga0157369_100512213 364
339 3300013105 Ga0157369_10101401 Ga0157369_101014013 364
340 3300013105 Ga0157369_10131514 Ga0157369_101315143 364
341 3300020070 Ga0206356_10687371 Ga0206356_106873712 364
342 3300020070 Ga0206356_11875873 Ga0206356_118758733 364
343 3300020081 Ga0206354_10778318 Ga0206354_107783185 364
344 3300020082 Ga0206353_11663111 Ga0206353_116631113 364
345 3300025909 Ga0207705_10026437 Ga0207705_100264372 364
346 3300025917 Ga0207660_10176254 Ga0207660_101762542 364
347 3300025919 Ga0207657_10042806 Ga0207657_100428065 364
348 3300025920 Ga0207649_10033516 Ga0207649_100335162 364
349 3300025921 Ga0207652_10008054 Ga0207652_100080542 364
350 3300025927 Ga0207687_10003599 Ga0207687_100035993 364
351 3300025927 Ga0207687_10042776 Ga0207687_100427763 364
352 3300025929 Ga0207664_10008572 Ga0207664_100085727 364
353 3300025935 Ga0207709_10056466 Ga0207709_100564662 364
354 3300025949 Ga0207667_10083906 Ga0207667_100839065 364
355 3300026078 Ga0207702_10055641 Ga0207702_100556412 364
356 3300026078 Ga0207702_10224622 Ga0207702_102246222 364
357 3300026121 Ga0207683_10027994 Ga0207683_100279945 364
358 3300026142 Ga0207698_10083164 Ga0207698_100831643 364
359 3300037418 Ga0395900_0248532 Ga0395900_0248532_585_1685 364
360 3300037466 Ga0395898_0157977 Ga0395898_0157977_492_1604 364
361 3300037466 Ga0395898_0481221 Ga0395898_0481221_64_1164 364
362 3300038443 Ga0395901_0033692 Ga0395901_0033692_3163_4275 364
363 3300038443 Ga0395901_0076162 Ga0395901_0076162_1802_2911 364
364 3300039437 Ga0436365_1070781 Ga0436365_1070781_1089_2195 364
365 3300044693 Ga0466961_0099484 Ga0466961_0099484_388_1503 364
366 3300044694 Ga0466963_0000768 Ga0466963_0000768_5245_6354 364
367 3300045836 Ga0466958_0002635 Ga0466958_0002635_5552_6661 364
368 3300045976 Ga0466967_0038321 Ga0466967_0038321_589_1707 364
369 3300045976 Ga0466967_0053417 Ga0466967_0053417_138_1253 364
370 3300045976 Ga0466967_0055137 Ga0466967_0055137_1239_2348 364
371 3300045976 Ga0466967_0074837 Ga0466967_0074837_1687_2802 364
372 3300046455 Ga0495603_0047923 Ga0495603_0047923_64_1191 364
373 3300046475 Ga0495639_0047663 Ga0495639_0047663_43_1170 364
374 3300046511 Ga0495608_0115164 Ga0495608_0115164_346_1455 364
375 3300046615 Ga0495656_0058104 Ga0495656_0058104_344_1450 364
376 3300046674 Ga0495588_0041339 Ga0495588_0041339_255_1382 364
377 3300046678 Ga0495599_0093113 Ga0495599_0093113_18_1130 364
378 3300047317 Ga0495604_0098303 Ga0495604_0098303_640_1749 364
379 3300048904 Ga0496101_0026233 Ga0496101_0026233_135_1241 364
380 3300048905 Ga0496102_0005140 Ga0496102_0005140_6277_7383 364
381 3300048906 Ga0496103_0009187 Ga0496103_0009187_3721_4827 364
382 3300048907 Ga0496104_0000699 Ga0496104_0000699_26051_27157 364
383 3300048907 Ga0496104_0003803 Ga0496104_0003803_10931_12037 364
384 3300048908 Ga0496105_0000148 Ga0496105_0000148_44320_45426 364
385 3300048909 Ga0496106_0016234 Ga0496106_0016234_2943_4058 364
386 3300048910 Ga0496107_0017662 Ga0496107_0017662_3194_4309 364
387 3300048910 Ga0496107_0059618 Ga0496107_0059618_915_2021 364
388 3300048911 Ga0496108_0037741 Ga0496108_0037741_952_2058 364
389 3300048912 Ga0496109_0000578 Ga0496109_0000578_7796_8902 364
390 3300048912 Ga0496109_0198673 Ga0496109_0198673_49_1155 364
391 3300048913 Ga0496110_0002158 Ga0496110_0002158_12551_13657 364
392 3300048914 Ga0496111_0016234 Ga0496111_0016234_3165_4271 364
393 3300048914 Ga0496111_0027056 Ga0496111_0027056_19_1125 364
394 3300048914 Ga0496111_0062583 Ga0496111_0062583_1029_2135 364
395 3300048915 Ga0496112_0161566 Ga0496112_0161566_801_1907 364
396 3300048916 Ga0496113_0178938 Ga0496113_0178938_489_1595 364
397 3300048916 Ga0496113_0219786 Ga0496113_0219786_133_1248 364
398 3300048917 Ga0496114_0003196 Ga0496114_0003196_6396_7502 364
399 3300048917 Ga0496114_0003379 Ga0496114_0003379_6044_7150 364
400 3300048917 Ga0496114_0072002 Ga0496114_0072002_1096_2202 364
401 3300049588 Ga0501072_0083731 Ga0501072_0083731_643_1755 364
402 3300049744 Ga0501083_0025552 Ga0501083_0025552_1811_2923 364
403 3300050512 nmdc:mga0n895_29458_c1 nmdc:mga0n895_29458_c1_3833_4957 364
404 3300050513 nmdc:mga0rr50_12711_c1 nmdc:mga0rr50_12711_c1_3673_4797 364
405 3300050515 nmdc:mga0a205_9936_c1 nmdc:mga0a205_9936_c1_5689_6813 364
406 3300054114 Ga0501084_0151623 Ga0501084_0151623_479_1591 364
407 3300005329 Ga0070683_100122099 Ga0070683_1001220993 365
408 3300005337 Ga0070682_100015285 Ga0070682_1000152853 365
409 3300005366 Ga0070659_100050496 Ga0070659_1000504962 365
410 3300005458 Ga0070681_10027044 Ga0070681_100270443 365
411 3300005458 Ga0070681_10071810 Ga0070681_100718105 365
412 3300005458 Ga0070681_10321332 Ga0070681_103213321 365
413 3300005468 Ga0070707_100108476 Ga0070707_1001084761 365
414 3300005530 Ga0070679_100093351 Ga0070679_1000933512 365
415 3300005530 Ga0070679_100130555 Ga0070679_1001305553 365
416 3300005535 Ga0070684_100005611 Ga0070684_1000056115 365
417 3300005563 Ga0068855_100117266 Ga0068855_1001172662 365
418 3300006844 Ga0075428_100000381 Ga0075428_1000003812 365
419 3300006847 Ga0075431_100188313 Ga0075431_1001883131 365
420 3300006880 Ga0075429_100216747 Ga0075429_1002167472 365
421 3300009147 Ga0114129_10001661 Ga0114129_1000166129 365
422 3300009147 Ga0114129_10134627 Ga0114129_101346273 365
423 3300014497 Ga0182008_10053067 Ga0182008_100530671 365
424 3300020070 Ga0206356_11158095 Ga0206356_111580951 365
425 3300020081 Ga0206354_10192413 Ga0206354_101924135 365
426 3300020081 Ga0206354_10900364 Ga0206354_109003641 365
427 3300020082 Ga0206353_10422956 Ga0206353_104229565 365
428 3300020082 Ga0206353_11831078 Ga0206353_118310782 365
429 3300021441 Ga0213871_10006336 Ga0213871_100063362 365
430 3300025909 Ga0207705_10038063 Ga0207705_100380633 365
431 3300025912 Ga0207707_10017134 Ga0207707_100171347 365
432 3300025912 Ga0207707_10106547 Ga0207707_101065472 365
433 3300025917 Ga0207660_10031455 Ga0207660_100314552 365
434 3300025918 Ga0207662_10054435 Ga0207662_100544352 365
435 3300025919 Ga0207657_10005756 Ga0207657_100057567 365
436 3300025919 Ga0207657_10027056 Ga0207657_100270567 365
437 3300025921 Ga0207652_10048618 Ga0207652_100486183 365
438 3300025921 Ga0207652_10065363 Ga0207652_100653632 365
439 3300025921 Ga0207652_10105455 Ga0207652_101054552 365
440 3300025932 Ga0207690_10142744 Ga0207690_101427442 365
441 3300025944 Ga0207661_10003070 Ga0207661_1000307017 365
442 3300025944 Ga0207661_10125684 Ga0207661_101256842 365
443 3300025949 Ga0207667_10288750 Ga0207667_102887502 365
444 3300026118 Ga0207675_100147604 Ga0207675_1001476041 365
445 3300028558 Ga0265326_10011074 Ga0265326_100110742 365
446 3300028563 Ga0265319_1005217 Ga0265319_10052172 365
447 3300028577 Ga0265318_10000219 Ga0265318_1000021913 365
448 3300028654 Ga0265322_10016444 Ga0265322_100164443 365
449 3300028800 Ga0265338_10003307 Ga0265338_1000330711 365
450 3300028800 Ga0265338_10016091 Ga0265338_100160916 365
451 3300028800 Ga0265338_10175213 Ga0265338_101752132 365
452 3300031235 Ga0265330_10000479 Ga0265330_1000047911 365
453 3300031239 Ga0265328_10000790 Ga0265328_100007905 365
454 3300031240 Ga0265320_10058686 Ga0265320_100586862 365
455 3300031241 Ga0265325_10000443 Ga0265325_1000044316 365
456 3300031242 Ga0265329_10000472 Ga0265329_100004729 365
457 3300031247 Ga0265340_10068279 Ga0265340_100682792 365
458 3300031249 Ga0265339_10101055 Ga0265339_101010552 365
459 3300031251 Ga0265327_10009052 Ga0265327_100090526 365
460 3300031344 Ga0265316_10004053 Ga0265316_100040532 365
461 3300031595 Ga0265313_10006992 Ga0265313_100069927 365
462 3300031711 Ga0265314_10003422 Ga0265314_100034228 365
463 3300031712 Ga0265342_10097936 Ga0265342_100979362 365
464 3300035172 Ga0373955_0024397 Ga0373955_0024397_1570_2688 365
465 3300037312 Ga0395899_0012610 Ga0395899_0012610_3305_4432 365
466 3300037418 Ga0395900_0050121 Ga0395900_0050121_3120_4232 365
467 3300037418 Ga0395900_0093511 Ga0395900_0093511_1912_3039 365
468 3300037466 Ga0395898_0127735 Ga0395898_0127735_722_1840 365
469 3300037471 Ga0395905_0012746 Ga0395905_0012746_483_1601 365
470 3300038443 Ga0395901_0010878 Ga0395901_0010878_6472_7599 365
471 3300038443 Ga0395901_0041928 Ga0395901_0041928_52_1164 365
472 3300038443 Ga0395901_0064877 Ga0395901_0064877_2501_3619 365
473 3300039438 Ga0436360_0887170 Ga0436360_0887170_1935_3047 365
474 3300044684 Ga0466966_0038817 Ga0466966_0038817_800_1912 365
475 3300044706 Ga0466964_0030830 Ga0466964_0030830_301_1419 365
476 3300045049 Ga0466959_0025914 Ga0466959_0025914_1672_2784 365
477 3300045976 Ga0466967_0021409 Ga0466967_0021409_3928_5046 365
478 3300046462 Ga0495651_0035623 Ga0495651_0035623_1746_2864 365
479 3300046463 Ga0495653_0032335 Ga0495653_0032335_514_1632 365
480 3300046463 Ga0495653_0047434 Ga0495653_0047434_970_2088 365
481 3300046473 Ga0495582_0130800 Ga0495582_0130800_80_1201 365
482 3300046517 Ga0495630_0143569 Ga0495630_0143569_428_1546 365
483 3300046559 Ga0495667_0016319 Ga0495667_0016319_3551_4669 365
484 3300046559 Ga0495667_0081797 Ga0495667_0081797_624_1742 365
485 3300046615 Ga0495656_0103930 Ga0495656_0103930_13_1119 365
486 3300046642 Ga0495634_0029224 Ga0495634_0029224_1723_2841 365
487 3300046663 Ga0495635_0105734 Ga0495635_0105734_369_1487 365
488 3300046663 Ga0495635_0126439 Ga0495635_0126439_246_1364 365
489 3300046675 Ga0495657_0033676 Ga0495657_0033676_1306_2424 365
490 3300047317 Ga0495604_0060369 Ga0495604_0060369_1641_2759 365
491 3300047322 Ga0495680_0045794 Ga0495680_0045794_202_1320 365
492 3300047444 Ga0495675_0059149 Ga0495675_0059149_947_2065 365
493 3300048907 Ga0496104_0093560 Ga0496104_0093560_1696_2817 365
494 3300048915 Ga0496112_0020408 Ga0496112_0020408_1311_2429 365
495 3300050507 nmdc:mga05p37_1648_c1 nmdc:mga05p37_1648_c1_2326_3438 365
496 3300050508 nmdc:mga09592_195461_c1 nmdc:mga09592_195461_c1_412_1524 365
497 3300053084 Ga0495595_0022765 Ga0495595_0022765_1219_2337 365
498 3300053085 Ga0495619_0007865 Ga0495619_0007865_3693_4811 365
499 3300005330 Ga0070690_100021377 Ga0070690_1000213774 366
500 3300005334 Ga0068869_100102301 Ga0068869_1001023012 366
501 3300005336 Ga0070680_100079285 Ga0070680_1000792852 366
502 3300005337 Ga0070682_100024483 Ga0070682_1000244832 366
503 3300005338 Ga0068868_100238440 Ga0068868_1002384402 366
504 3300005339 Ga0070660_100060376 Ga0070660_1000603762 366
505 3300005339 Ga0070660_100177538 Ga0070660_1001775382 366
506 3300005340 Ga0070689_100045899 Ga0070689_1000458992 366
507 3300005341 Ga0070691_10051621 Ga0070691_100516212 366
508 3300005347 Ga0070668_100054366 Ga0070668_1000543662 366
509 3300005353 Ga0070669_100258523 Ga0070669_1002585231 366
510 3300005365 Ga0070688_100015520 Ga0070688_1000155201 366
511 3300005366 Ga0070659_100165228 Ga0070659_1001652282 366
512 3300005438 Ga0070701_10001955 Ga0070701_100019554 366
513 3300005440 Ga0070705_100052306 Ga0070705_1000523061 366
514 3300005441 Ga0070700_100003711 Ga0070700_1000037117 366
515 3300005445 Ga0070708_100030358 Ga0070708_1000303582 366
516 3300005456 Ga0070678_100240063 Ga0070678_1002400631 366
517 3300005457 Ga0070662_100056188 Ga0070662_1000561883 366
518 3300005459 Ga0068867_100028094 Ga0068867_1000280943 366
519 3300005467 Ga0070706_100361788 Ga0070706_1003617881 366
520 3300005468 Ga0070707_100000736 Ga0070707_10000073629 366
521 3300005468 Ga0070707_100346107 Ga0070707_1003461072 366
522 3300005471 Ga0070698_100017893 Ga0070698_1000178934 366
523 3300005471 Ga0070698_100053947 Ga0070698_1000539474 366
524 3300005518 Ga0070699_100005711 Ga0070699_1000057114 366
525 3300005518 Ga0070699_100012784 Ga0070699_1000127842 366
526 3300005539 Ga0068853_100022302 Ga0068853_1000223023 366
527 3300005548 Ga0070665_100017345 Ga0070665_1000173457 366
528 3300005548 Ga0070665_100062268 Ga0070665_1000622683 366
529 3300005614 Ga0068856_100102573 Ga0068856_1001025732 366
530 3300005615 Ga0070702_100004559 Ga0070702_1000045596 366
531 3300005616 Ga0068852_100035447 Ga0068852_1000354472 366
532 3300005618 Ga0068864_100303951 Ga0068864_1003039512 366
533 3300005718 Ga0068866_10001213 Ga0068866_100012139 366
534 3300005719 Ga0068861_100107071 Ga0068861_1001070712 366
535 3300005719 Ga0068861_100110309 Ga0068861_1001103092 366
536 3300005841 Ga0068863_100464763 Ga0068863_1004647631 366
537 3300005844 Ga0068862_100140681 Ga0068862_1001406812 366
538 3300005844 Ga0068862_100201484 Ga0068862_1002014842 366
539 3300006038 Ga0075365_10019759 Ga0075365_100197596 366
540 3300006175 Ga0070712_100039286 Ga0070712_1000392862 366
541 3300006175 Ga0070712_100268046 Ga0070712_1002680462 366
542 3300006358 Ga0068871_100035915 Ga0068871_1000359155 366
543 3300006847 Ga0075431_100023773 Ga0075431_1000237736 366
544 3300006852 Ga0075433_10069829 Ga0075433_100698294 366
545 3300006852 Ga0075433_10168459 Ga0075433_101684592 366
546 3300006871 Ga0075434_100175550 Ga0075434_1001755502 366
547 3300006881 Ga0068865_100007982 Ga0068865_1000079825 366
548 3300006914 Ga0075436_100050943 Ga0075436_1000509433 366
549 3300007076 Ga0075435_100021362 Ga0075435_1000213624 366
550 3300009094 Ga0111539_10012314 Ga0111539_100123149 366
551 3300009094 Ga0111539_10056650 Ga0111539_100566502 366
552 3300009101 Ga0105247_10014196 Ga0105247_100141965 366
553 3300009147 Ga0114129_10012739 Ga0114129_100127399 366
554 3300009147 Ga0114129_10153050 Ga0114129_101530503 366
555 3300009177 Ga0105248_10386638 Ga0105248_103866382 366
556 3300009551 Ga0105238_10181417 Ga0105238_101814172 366
557 3300011119 Ga0105246_10196366 Ga0105246_101963662 366
558 3300013296 Ga0157374_10108469 Ga0157374_101084692 366
559 3300013308 Ga0157375_10047453 Ga0157375_100474535 366
560 3300014326 Ga0157380_10010760 Ga0157380_100107603 366
561 3300014745 Ga0157377_10073642 Ga0157377_100736422 366
562 3300014968 Ga0157379_10258274 Ga0157379_102582742 366
563 3300014969 Ga0157376_10062443 Ga0157376_100624433 366
564 3300017792 Ga0163161_10166119 Ga0163161_101661192 366
565 3300025898 Ga0207692_10074254 Ga0207692_100742542 366
566 3300025899 Ga0207642_10014554 Ga0207642_100145543 366
567 3300025907 Ga0207645_10057178 Ga0207645_100571781 366
568 3300025910 Ga0207684_10080852 Ga0207684_100808523 366
569 3300025910 Ga0207684_10348716 Ga0207684_103487162 366
570 3300025912 Ga0207707_10143050 Ga0207707_101430502 366
571 3300025915 Ga0207693_10033836 Ga0207693_100338364 366
572 3300025915 Ga0207693_10307813 Ga0207693_103078131 366
573 3300025919 Ga0207657_10029230 Ga0207657_100292302 366
574 3300025922 Ga0207646_10022827 Ga0207646_100228276 366
575 3300025927 Ga0207687_10024282 Ga0207687_100242823 366
576 3300025927 Ga0207687_10206638 Ga0207687_102066382 366
577 3300025933 Ga0207706_10045280 Ga0207706_100452802 366
578 3300025935 Ga0207709_10003771 Ga0207709_100037713 366
579 3300025936 Ga0207670_10014593 Ga0207670_100145935 366
580 3300025938 Ga0207704_10118584 Ga0207704_101185842 366
581 3300025939 Ga0207665_10073671 Ga0207665_100736712 366
582 3300025941 Ga0207711_10028596 Ga0207711_100285962 366
583 3300025960 Ga0207651_10187263 Ga0207651_101872632 366
584 3300025972 Ga0207668_10039579 Ga0207668_100395792 366
585 3300026075 Ga0207708_10008089 Ga0207708_100080898 366
586 3300026078 Ga0207702_10096587 Ga0207702_100965873 366
587 3300026089 Ga0207648_10011231 Ga0207648_100112319 366
588 3300026118 Ga0207675_100008915 Ga0207675_1000089153 366
589 3300026121 Ga0207683_10002939 Ga0207683_1000293912 366
590 3300027907 Ga0207428_10008826 Ga0207428_1000882610 366
591 3300027907 Ga0207428_10030367 Ga0207428_100303673 366
592 3300028381 Ga0268264_10284109 Ga0268264_102841091 366
593 3300031548 Ga0307408_100171924 Ga0307408_1001719242 366
594 3300035115 Ga0373941_0006820 Ga0373941_0006820_1122_2264 366
595 3300035241 Ga0373961_0011677 Ga0373961_0011677_370_1512 366
596 3300037312 Ga0395899_0026219 Ga0395899_0026219_3168_4286 366
597 3300037312 Ga0395899_0058758 Ga0395899_0058758_267_1388 366
598 3300037312 Ga0395899_0075024 Ga0395899_0075024_594_1715 366
599 3300037418 Ga0395900_0003913 Ga0395900_0003913_7816_8934 366
600 3300037418 Ga0395900_0143369 Ga0395900_0143369_162_1280 366
601 3300037418 Ga0395900_0196645 Ga0395900_0196645_122_1243 366
602 3300037466 Ga0395898_0003410 Ga0395898_0003410_15388_16506 366
603 3300037466 Ga0395898_0007790 Ga0395898_0007790_1987_3108 366
604 3300037466 Ga0395898_0024102 Ga0395898_0024102_3700_4821 366
605 3300037466 Ga0395898_0057873 Ga0395898_0057873_1369_2490 366
606 3300037466 Ga0395898_0058510 Ga0395898_0058510_1094_2215 366
607 3300037466 Ga0395898_0171389 Ga0395898_0171389_776_1897 366
608 3300037471 Ga0395905_0001601 Ga0395905_0001601_17446_18564 366
609 3300037471 Ga0395905_0010973 Ga0395905_0010973_408_1529 366
610 3300037471 Ga0395905_0019921 Ga0395905_0019921_1305_2426 366
611 3300037471 Ga0395905_0122043 Ga0395905_0122043_71_1189 366
612 3300038443 Ga0395901_0000858 Ga0395901_0000858_13239_14360 366
613 3300038443 Ga0395901_0001826 Ga0395901_0001826_2291_3412 366
614 3300038443 Ga0395901_0003205 Ga0395901_0003205_8672_9790 366
615 3300038443 Ga0395901_0013196 Ga0395901_0013196_4446_5567 366
616 3300038443 Ga0395901_0024220 Ga0395901_0024220_3992_5110 366
617 3300038443 Ga0395901_0138446 Ga0395901_0138446_86_1207 366
618 3300038443 Ga0395901_0157899 Ga0395901_0157899_987_2105 366
619 3300041443 Ga0451789_0919425 Ga0451789_0919425_192_1310 366
620 3300046461 Ga0495641_0043455 Ga0495641_0043455_645_1763 366
621 3300046473 Ga0495582_0016729 Ga0495582_0016729_1877_2995 366
622 3300046474 Ga0495605_0019926 Ga0495605_0019926_1369_2487 366
623 3300046476 Ga0495662_0037839 Ga0495662_0037839_520_1638 366
624 3300046477 Ga0495664_0027095 Ga0495664_0027095_2014_3138 366
625 3300046491 Ga0495584_0072938 Ga0495584_0072938_216_1334 366
626 3300046492 Ga0495585_0131686 Ga0495585_0131686_31_1149 366
627 3300046500 Ga0495596_0071510 Ga0495596_0071510_95_1213 366
628 3300046514 Ga0495618_0032144 Ga0495618_0032144_99_1223 366
629 3300046518 Ga0495631_0071338 Ga0495631_0071338_266_1384 366
630 3300046531 Ga0495665_0036519 Ga0495665_0036519_819_1937 366
631 3300046538 Ga0495609_0037234 Ga0495609_0037234_788_1906 366
632 3300046559 Ga0495667_0037446 Ga0495667_0037446_363_1487 366
633 3300046615 Ga0495656_0017608 Ga0495656_0017608_531_1649 366
634 3300046642 Ga0495634_0021634 Ga0495634_0021634_1373_2497 366
635 3300046690 Ga0495624_0087499 Ga0495624_0087499_638_1756 366
636 3300047315 Ga0495581_0002109 Ga0495581_0002109_6234_7352 366
637 3300047319 Ga0495674_0004125 Ga0495674_0004125_9576_10700 366
638 3300047322 Ga0495680_0009703 Ga0495680_0009703_4050_5174 366
639 3300047447 Ga0495685_006549 Ga0495685_006549_2507_3625 366
640 3300048903 Ga0496100_0194447 Ga0496100_0194447_178_1320 366
641 3300048904 Ga0496101_0091491 Ga0496101_0091491_677_1795 366
642 3300048906 Ga0496103_0031627 Ga0496103_0031627_2018_3136 366
643 3300048906 Ga0496103_0087976 Ga0496103_0087976_801_1919 366
644 3300048907 Ga0496104_0058648 Ga0496104_0058648_625_1743 366
645 3300048908 Ga0496105_0020909 Ga0496105_0020909_2217_3335 366
646 3300048909 Ga0496106_0006351 Ga0496106_0006351_633_1751 366
647 3300048911 Ga0496108_0104882 Ga0496108_0104882_609_1727 366
648 3300048911 Ga0496108_0121102 Ga0496108_0121102_1114_2232 366
649 3300048912 Ga0496109_0022810 Ga0496109_0022810_2061_3179 366
650 3300048912 Ga0496109_0057043 Ga0496109_0057043_575_1693 366
651 3300048915 Ga0496112_0060665 Ga0496112_0060665_1154_2272 366
652 3300048915 Ga0496112_0488156 Ga0496112_0488156_36_1154 366
653 3300048916 Ga0496113_0029360 Ga0496113_0029360_2074_3216 366
654 3300048916 Ga0496113_0047236 Ga0496113_0047236_744_1862 366
655 3300048916 Ga0496113_0118181 Ga0496113_0118181_556_1674 366
656 3300048917 Ga0496114_0251776 Ga0496114_0251776_421_1539 366
657 3300048918 Ga0496115_0017242 Ga0496115_0017242_2244_3362 366
658 3300048918 Ga0496115_0057656 Ga0496115_0057656_96_1214 366
659 3300050507 nmdc:mga05p37_53795_c1 nmdc:mga05p37_53795_c1_1394_2512 366
660 3300050510 nmdc:mga06r32_11086_c1 nmdc:mga06r32_11086_c1_5853_6971 366
661 3300050511 nmdc:mga08y16_19969_c1 nmdc:mga08y16_19969_c1_1086_2204 366
662 3300050511 nmdc:mga08y16_284641_c1 nmdc:mga08y16_284641_c1_480_1622 366
663 3300050513 nmdc:mga0rr50_13489_c1 nmdc:mga0rr50_13489_c1_2972_4090 366
664 3300050515 nmdc:mga0a205_247804_c1 nmdc:mga0a205_247804_c1_225_1349 366
665 3300050515 nmdc:mga0a205_55410_c1 nmdc:mga0a205_55410_c1_1937_3055 366
666 3300005329 Ga0070683_100166019 Ga0070683_1001660192 367
667 3300005337 Ga0070682_100029174 Ga0070682_1000291742 367
668 3300005337 Ga0070682_100036730 Ga0070682_1000367302 367
669 3300005338 Ga0068868_100034278 Ga0068868_1000342782 367
670 3300005341 Ga0070691_10015848 Ga0070691_100158483 367
671 3300005435 Ga0070714_100030412 Ga0070714_1000304123 367
672 3300005439 Ga0070711_100005352 Ga0070711_1000053524 367
673 3300005439 Ga0070711_100041981 Ga0070711_1000419811 367
674 3300005440 Ga0070705_100016734 Ga0070705_1000167343 367
675 3300005440 Ga0070705_100081776 Ga0070705_1000817762 367
676 3300005440 Ga0070705_100083922 Ga0070705_1000839222 367
677 3300005440 Ga0070705_100161429 Ga0070705_1001614292 367
678 3300005441 Ga0070700_100060336 Ga0070700_1000603361 367
679 3300005441 Ga0070700_100070126 Ga0070700_1000701262 367
680 3300005444 Ga0070694_100040078 Ga0070694_1000400783 367
681 3300005444 Ga0070694_100075706 Ga0070694_1000757062 367
682 3300005445 Ga0070708_100073080 Ga0070708_1000730802 367
683 3300005456 Ga0070678_100237318 Ga0070678_1002373182 367
684 3300005458 Ga0070681_10174749 Ga0070681_101747491 367
685 3300005468 Ga0070707_100227414 Ga0070707_1002274142 367
686 3300005530 Ga0070679_100046291 Ga0070679_1000462912 367
687 3300005535 Ga0070684_100013149 Ga0070684_1000131492 367
688 3300005535 Ga0070684_100048627 Ga0070684_1000486272 367
689 3300005544 Ga0070686_100029186 Ga0070686_1000291863 367
690 3300005545 Ga0070695_100019884 Ga0070695_1000198844 367
691 3300005546 Ga0070696_100042589 Ga0070696_1000425892 367
692 3300005546 Ga0070696_100094204 Ga0070696_1000942042 367
693 3300005547 Ga0070693_100015911 Ga0070693_1000159112 367
694 3300005547 Ga0070693_100039488 Ga0070693_1000394882 367
695 3300005549 Ga0070704_100132297 Ga0070704_1001322972 367
696 3300005549 Ga0070704_100174758 Ga0070704_1001747582 367
697 3300005563 Ga0068855_100065248 Ga0068855_1000652483 367
698 3300005564 Ga0070664_100034719 Ga0070664_1000347192 367
699 3300005577 Ga0068857_100006535 Ga0068857_1000065352 367
700 3300005577 Ga0068857_100095260 Ga0068857_1000952603 367
701 3300005614 Ga0068856_100200382 Ga0068856_1002003823 367
702 3300005615 Ga0070702_100074984 Ga0070702_1000749842 367
703 3300005983 Ga0081540_1015602 Ga0081540_10156024 367
704 3300006028 Ga0070717_10115892 Ga0070717_101158922 367
705 3300006163 Ga0070715_10020079 Ga0070715_100200792 367
706 3300006163 Ga0070715_10052854 Ga0070715_100528541 367
707 3300006358 Ga0068871_100129862 Ga0068871_1001298622 367
708 3300006852 Ga0075433_10322230 Ga0075433_103222302 367
709 3300006871 Ga0075434_100010132 Ga0075434_1000101327 367
710 3300006871 Ga0075434_100075961 Ga0075434_1000759612 367
711 3300006914 Ga0075436_100003007 Ga0075436_1000030072 367
712 3300006914 Ga0075436_100003937 Ga0075436_1000039374 367
713 3300007076 Ga0075435_100012038 Ga0075435_1000120387 367
714 3300007076 Ga0075435_100064189 Ga0075435_1000641891 367
715 3300007076 Ga0075435_100180082 Ga0075435_1001800822 367
716 3300009098 Ga0105245_10326822 Ga0105245_103268222 367
717 3300009147 Ga0114129_10005673 Ga0114129_100056737 367
718 3300009147 Ga0114129_10181523 Ga0114129_101815231 367
719 3300009147 Ga0114129_10569990 Ga0114129_105699902 367
720 3300009148 Ga0105243_10017876 Ga0105243_100178766 367
721 3300009148 Ga0105243_10040745 Ga0105243_100407452 367
722 3300009148 Ga0105243_10127544 Ga0105243_101275442 367
723 3300009148 Ga0105243_10183473 Ga0105243_101834732 367
724 3300009174 Ga0105241_10039315 Ga0105241_100393153 367
725 3300009176 Ga0105242_10059277 Ga0105242_100592771 367
726 3300009545 Ga0105237_10250757 Ga0105237_102507571 367
727 3300009551 Ga0105238_10216597 Ga0105238_102165972 367
728 3300011119 Ga0105246_10039168 Ga0105246_100391682 367
729 3300013297 Ga0157378_10108371 Ga0157378_101083712 367
730 3300013297 Ga0157378_10200593 Ga0157378_102005933 367
731 3300013306 Ga0163162_10154367 Ga0163162_101543673 367
732 3300013308 Ga0157375_10036207 Ga0157375_100362074 367
733 3300014326 Ga0157380_10006605 Ga0157380_100066053 367
734 3300014497 Ga0182008_10041945 Ga0182008_100419453 367
735 3300014969 Ga0157376_10125268 Ga0157376_101252682 367
736 3300025901 Ga0207688_10151160 Ga0207688_101511602 367
737 3300025910 Ga0207684_10165453 Ga0207684_101654532 367
738 3300025911 Ga0207654_10188351 Ga0207654_101883511 367
739 3300025912 Ga0207707_10108903 Ga0207707_101089033 367
740 3300025915 Ga0207693_10000319 Ga0207693_1000031934 367
741 3300025915 Ga0207693_10004123 Ga0207693_100041232 367
742 3300025915 Ga0207693_10038611 Ga0207693_100386113 367
743 3300025916 Ga0207663_10004268 Ga0207663_100042682 367
744 3300025916 Ga0207663_10010470 Ga0207663_100104705 367
745 3300025916 Ga0207663_10190443 Ga0207663_101904432 367
746 3300025921 Ga0207652_10231005 Ga0207652_102310052 367
747 3300025926 Ga0207659_10284173 Ga0207659_102841732 367
748 3300025927 Ga0207687_10049497 Ga0207687_100494973 367
749 3300025927 Ga0207687_10116444 Ga0207687_101164442 367
750 3300025928 Ga0207700_10062381 Ga0207700_100623812 367
751 3300025929 Ga0207664_10091349 Ga0207664_100913492 367
752 3300025933 Ga0207706_10003832 Ga0207706_1000383215 367
753 3300025933 Ga0207706_10029343 Ga0207706_100293434 367
754 3300025935 Ga0207709_10010998 Ga0207709_100109983 367
755 3300025939 Ga0207665_10002255 Ga0207665_100022553 367
756 3300025939 Ga0207665_10007220 Ga0207665_100072202 367
757 3300025939 Ga0207665_10008529 Ga0207665_100085296 367
758 3300025940 Ga0207691_10009218 Ga0207691_100092181 367
759 3300025944 Ga0207661_10101276 Ga0207661_101012762 367
760 3300025945 Ga0207679_10140877 Ga0207679_101408772 367
761 3300026075 Ga0207708_10048525 Ga0207708_100485252 367
762 3300026078 Ga0207702_10019118 Ga0207702_100191184 367
763 3300026078 Ga0207702_10105669 Ga0207702_101056692 367
764 3300026088 Ga0207641_10292795 Ga0207641_102927952 367
765 3300026089 Ga0207648_10002132 Ga0207648_1000213222 367
766 3300026095 Ga0207676_10045001 Ga0207676_100450013 367
767 3300026116 Ga0207674_10011029 Ga0207674_1001102910 367
768 3300026116 Ga0207674_10026840 Ga0207674_100268402 367
769 3300026118 Ga0207675_100005440 Ga0207675_1000054402 367
770 3300026118 Ga0207675_100052680 Ga0207675_1000526802 367
771 3300026121 Ga0207683_10028451 Ga0207683_100284517 367
772 3300026121 Ga0207683_10029373 Ga0207683_100293732 367
773 3300026121 Ga0207683_10032077 Ga0207683_100320773 367
774 3300026121 Ga0207683_10085471 Ga0207683_100854713 367
775 3300026121 Ga0207683_10137693 Ga0207683_101376932 367
776 3300026142 Ga0207698_10066827 Ga0207698_100668272 367
777 3300028380 Ga0268265_10311239 Ga0268265_103112391 367
778 3300031901 Ga0307406_10230486 Ga0307406_102304862 367
779 3300034957 Ga0373938_0010324 Ga0373938_0010324_192_1316 367
780 3300035092 Ga0373952_0015557 Ga0373952_0015557_149_1273 367
781 3300035114 Ga0373939_0027186 Ga0373939_0027186_295_1419 367
782 3300035115 Ga0373941_0011420 Ga0373941_0011420_1058_2182 367
783 3300035121 Ga0373960_0018728 Ga0373960_0018728_517_1641 367
784 3300035170 Ga0373943_0065060 Ga0373943_0065060_665_1801 367
785 3300035242 Ga0373962_0003254 Ga0373962_0003254_421_1545 367
786 3300035691 Ga0373931_0006393 Ga0373931_0006393_1305_2429 367
787 3300037068 Ga0373925_0107961 Ga0373925_0107961_656_1792 367
788 3300037312 Ga0395899_0030436 Ga0395899_0030436_267_1391 367
789 3300037312 Ga0395899_0046995 Ga0395899_0046995_1401_2525 367
790 3300037312 Ga0395899_0076944 Ga0395899_0076944_356_1480 367
791 3300037312 Ga0395899_0114276 Ga0395899_0114276_587_1723 367
792 3300037312 Ga0395899_0123955 Ga0395899_0123955_606_1730 367
793 3300037418 Ga0395900_0000838 Ga0395900_0000838_30449_31699 367
794 3300037418 Ga0395900_0003636 Ga0395900_0003636_1846_2982 367
795 3300037418 Ga0395900_0013052 Ga0395900_0013052_356_1480 367
796 3300037418 Ga0395900_0106472 Ga0395900_0106472_261_1385 367
797 3300037418 Ga0395900_0112371 Ga0395900_0112371_1504_2628 367
798 3300037466 Ga0395898_0001212 Ga0395898_0001212_18503_19753 367
799 3300037466 Ga0395898_0007007 Ga0395898_0007007_9157_10281 367
800 3300037466 Ga0395898_0015434 Ga0395898_0015434_1858_2982 367
801 3300037466 Ga0395898_0031435 Ga0395898_0031435_1904_3028 367
802 3300037466 Ga0395898_0039393 Ga0395898_0039393_3288_4412 367
803 3300037466 Ga0395898_0097804 Ga0395898_0097804_1211_2347 367
804 3300037466 Ga0395898_0116142 Ga0395898_0116142_1151_2275 367
805 3300037471 Ga0395905_0001928 Ga0395905_0001928_13392_14642 367
806 3300037471 Ga0395905_0011189 Ga0395905_0011189_6554_7678 367
807 3300037471 Ga0395905_0026059 Ga0395905_0026059_4162_5298 367
808 3300037471 Ga0395905_0105086 Ga0395905_0105086_1308_2432 367
809 3300037471 Ga0395905_0126128 Ga0395905_0126128_1115_2239 367
810 3300038443 Ga0395901_0003231 Ga0395901_0003231_9939_11189 367
811 3300038443 Ga0395901_0003420 Ga0395901_0003420_10699_11835 367
812 3300038443 Ga0395901_0037382 Ga0395901_0037382_3418_4545 367
813 3300038443 Ga0395901_0055287 Ga0395901_0055287_1982_3109 367
814 3300038443 Ga0395901_0080971 Ga0395901_0080971_1936_3060 367
815 3300038443 Ga0395901_0244308 Ga0395901_0244308_460_1584 367
816 3300038443 Ga0395901_0320598 Ga0395901_0320598_23_1147 367
817 3300041443 Ga0451789_0528223 Ga0451789_0528223_289_1413 367
818 3300041459 Ga0451800_1267821 Ga0451800_1267821_454_1578 367
819 3300041492 Ga0451835_0383021 Ga0451835_0383021_595_1719 367
820 3300041496 Ga0451839_0194646 Ga0451839_0194646_470_1594 367
821 3300041505 Ga0451849_0045844 Ga0451849_0045844_483_1607 367
822 3300041507 Ga0451851_0849119 Ga0451851_0849119_596_1720 367
823 3300044706 Ga0466964_0000352 Ga0466964_0000352_7907_9031 367
824 3300044735 Ga0466968_0041575 Ga0466968_0041575_669_1787 367
825 3300044901 Ga0466960_0003012 Ga0466960_0003012_3004_4128 367
826 3300045051 Ga0451576_0022984 Ga0451576_0022984_151_1290 367
827 3300046455 Ga0495603_0001231 Ga0495603_0001231_12893_14029 367
828 3300046455 Ga0495603_0013603 Ga0495603_0013603_454_1578 367
829 3300046455 Ga0495603_0041622 Ga0495603_0041622_1480_2616 367
830 3300046461 Ga0495641_0002482 Ga0495641_0002482_11375_12511 367
831 3300046461 Ga0495641_0057609 Ga0495641_0057609_169_1293 367
832 3300046473 Ga0495582_0014295 Ga0495582_0014295_624_1748 367
833 3300046491 Ga0495584_0010544 Ga0495584_0010544_828_1952 367
834 3300046499 Ga0495594_0001036 Ga0495594_0001036_10823_11959 367
835 3300046500 Ga0495596_0073991 Ga0495596_0073991_39_1175 367
836 3300046517 Ga0495630_0003323 Ga0495630_0003323_3825_4931 367
837 3300046517 Ga0495630_0031468 Ga0495630_0031468_1220_2344 367
838 3300046523 Ga0495644_0032726 Ga0495644_0032726_809_1933 367
839 3300046525 Ga0495663_0011150 Ga0495663_0011150_1172_2296 367
840 3300046535 Ga0495586_0070615 Ga0495586_0070615_618_1742 367
841 3300046538 Ga0495609_0014755 Ga0495609_0014755_2515_3639 367
842 3300046538 Ga0495609_0064070 Ga0495609_0064070_250_1374 367
843 3300046674 Ga0495588_0000812 Ga0495588_0000812_2320_3456 367
844 3300046674 Ga0495588_0056635 Ga0495588_0056635_218_1342 367
845 3300046674 Ga0495588_0122311 Ga0495588_0122311_93_1217 367
846 3300046681 Ga0495647_0041893 Ga0495647_0041893_388_1512 367
847 3300046684 Ga0495669_0015201 Ga0495669_0015201_491_1615 367
848 3300047315 Ga0495581_0017160 Ga0495581_0017160_1249_2373 367
849 3300047315 Ga0495581_0037888 Ga0495581_0037888_738_1874 367
850 3300047319 Ga0495674_0000010 Ga0495674_0000010_15383_16507 367
851 3300047321 Ga0495676_0006975 Ga0495676_0006975_9188_10324 367
852 3300047321 Ga0495676_0138506 Ga0495676_0138506_33_1157 367
853 3300048903 Ga0496100_0106876 Ga0496100_0106876_303_1427 367
854 3300048904 Ga0496101_0028279 Ga0496101_0028279_1109_2242 367
855 3300048904 Ga0496101_0065408 Ga0496101_0065408_732_1868 367
856 3300048904 Ga0496101_0163244 Ga0496101_0163244_560_1684 367
857 3300048905 Ga0496102_0023351 Ga0496102_0023351_4332_5456 367
858 3300048905 Ga0496102_0070584 Ga0496102_0070584_918_2054 367
859 3300048906 Ga0496103_0041804 Ga0496103_0041804_1515_2651 367
860 3300048907 Ga0496104_0001337 Ga0496104_0001337_1622_2803 367
861 3300048907 Ga0496104_0005710 Ga0496104_0005710_8612_9745 367
862 3300048907 Ga0496104_0012539 Ga0496104_0012539_6399_7523 367
863 3300048907 Ga0496104_0018592 Ga0496104_0018592_4417_5553 367
864 3300048908 Ga0496105_0003041 Ga0496105_0003041_3784_4965 367
865 3300048908 Ga0496105_0031958 Ga0496105_0031958_2601_3734 367
866 3300048908 Ga0496105_0084535 Ga0496105_0084535_16_1140 367
867 3300048909 Ga0496106_0026150 Ga0496106_0026150_2595_3764 367
868 3300048909 Ga0496106_0070837 Ga0496106_0070837_361_1494 367
869 3300048909 Ga0496106_0113253 Ga0496106_0113253_237_1373 367
870 3300048910 Ga0496107_0004496 Ga0496107_0004496_1355_2488 367
871 3300048911 Ga0496108_0000272 Ga0496108_0000272_32629_33810 367
872 3300048911 Ga0496108_0012780 Ga0496108_0012780_326_1450 367
873 3300048911 Ga0496108_0067233 Ga0496108_0067233_853_1986 367
874 3300048912 Ga0496109_0001933 Ga0496109_0001933_7355_8536 367
875 3300048912 Ga0496109_0039781 Ga0496109_0039781_627_1751 367
876 3300048912 Ga0496109_0093185 Ga0496109_0093185_584_1708 367
877 3300048913 Ga0496110_0000746 Ga0496110_0000746_6218_7399 367
878 3300048913 Ga0496110_0011829 Ga0496110_0011829_5065_6198 367
879 3300048913 Ga0496110_0056199 Ga0496110_0056199_2175_3299 367
880 3300048913 Ga0496110_0076452 Ga0496110_0076452_301_1437 367
881 3300048914 Ga0496111_0000499 Ga0496111_0000499_8368_9549 367
882 3300048914 Ga0496111_0033102 Ga0496111_0033102_1316_2440 367
883 3300048914 Ga0496111_0058869 Ga0496111_0058869_1171_2295 367
884 3300048915 Ga0496112_0001182 Ga0496112_0001182_8446_9627 367
885 3300048915 Ga0496112_0021074 Ga0496112_0021074_4893_6026 367
886 3300048915 Ga0496112_0096105 Ga0496112_0096105_854_1978 367
887 3300048915 Ga0496112_0137566 Ga0496112_0137566_169_1305 367
888 3300048916 Ga0496113_0000040 Ga0496113_0000040_42573_43754 367
889 3300048916 Ga0496113_0004976 Ga0496113_0004976_682_1815 367
890 3300048917 Ga0496114_0030568 Ga0496114_0030568_1141_2322 367
891 3300048917 Ga0496114_0039640 Ga0496114_0039640_2599_3723 367
892 3300048918 Ga0496115_0070347 Ga0496115_0070347_1610_2734 367
893 3300049576 Ga0501040_0022023 Ga0501040_0022023_1795_2925 367
894 3300049588 Ga0501072_0150155 Ga0501072_0150155_41_1171 367
895 3300050507 nmdc:mga05p37_148675_c1 nmdc:mga05p37_148675_c1_1604_2728 367
896 3300050507 nmdc:mga05p37_4144_c2 nmdc:mga05p37_4144_c2_14907_16031 367
897 3300050507 nmdc:mga05p37_45059_c1 nmdc:mga05p37_45059_c1_17_1141 367
898 3300050509 nmdc:mga0qj67_65425_c1 nmdc:mga0qj67_65425_c1_1298_2422 367
899 3300050512 nmdc:mga0n895_217996_c1 nmdc:mga0n895_217996_c1_571_1695 367
900 3300050513 nmdc:mga0rr50_55552_c1 nmdc:mga0rr50_55552_c1_823_1947 367
901 3300050513 nmdc:mga0rr50_78467_c1 nmdc:mga0rr50_78467_c1_1324_2529 367
902 3300050514 nmdc:mga08x19_2647_c1 nmdc:mga08x19_2647_c1_8631_9755 367
903 3300050515 nmdc:mga0a205_120264_c1 nmdc:mga0a205_120264_c1_1283_2407 367
904 3300050515 nmdc:mga0a205_252300_c1 nmdc:mga0a205_252300_c1_381_1586 367
905 3300050515 nmdc:mga0a205_89899_c1 nmdc:mga0a205_89899_c1_346_1470 367
906 3300053077 Ga0495601_0007612 Ga0495601_0007612_346_1452 367
907 3300053085 Ga0495619_0000507 Ga0495619_0000507_1042_2148 367
908 3300053085 Ga0495619_0001017 Ga0495619_0001017_11575_12678 367
909 3300005468 Ga0070707_100001917 Ga0070707_10000191716 368
910 3300005471 Ga0070698_100062959 Ga0070698_1000629593 368
911 3300005983 Ga0081540_1003071 Ga0081540_10030718 368
912 3300005985 Ga0081539_10006606 Ga0081539_100066063 368
913 3300026075 Ga0207708_10143876 Ga0207708_101438762 368
914 3300037466 Ga0395898_0033701 Ga0395898_0033701_2409_3545 368
915 3300038443 Ga0395901_0306200 Ga0395901_0306200_426_1598 368
916 3300048913 Ga0496110_0111152 Ga0496110_0111152_322_1464 368
917 3300048915 Ga0496112_0264118 Ga0496112_0264118_274_1410 368
918 3300049568 Ga0501031_0027314 Ga0501031_0027314_366_1505 368
919 3300049585 Ga0501069_0027636 Ga0501069_0027636_121_1260 368
920 3300049586 Ga0501070_0014204 Ga0501070_0014204_1105_2244 368
921 3300049743 Ga0501081_0004576 Ga0501081_0004576_7505_8644 368
922 3300049824 Ga0501045_0010111 Ga0501045_0010111_4279_5418 368
923 3300005435 Ga0070714_100067633 Ga0070714_1000676333 369
924 3300005458 Ga0070681_10150198 Ga0070681_101501982 369
925 3300005467 Ga0070706_100124960 Ga0070706_1001249602 369
926 3300005536 Ga0070697_100185522 Ga0070697_1001855222 369
927 3300005937 Ga0081455_10014238 Ga0081455_100142386 369
928 3300013102 Ga0157371_10162431 Ga0157371_101624312 369
929 3300013104 Ga0157370_10116274 Ga0157370_101162743 369
930 3300013105 Ga0157369_10002618 Ga0157369_1000261811 369
931 3300013297 Ga0157378_10044141 Ga0157378_100441413 369
932 3300025915 Ga0207693_10126291 Ga0207693_101262912 369
933 3300025940 Ga0207691_10195473 Ga0207691_101954732 369
934 3300035116 Ga0373945_0003511 Ga0373945_0003511_163_1287 369
935 3300035170 Ga0373943_0034514 Ga0373943_0034514_1080_2204 369
936 3300035171 Ga0373946_0014769 Ga0373946_0014769_1135_2259 369
937 3300035725 Ga0373947_0000237 Ga0373947_0000237_20668_21792 369
938 3300037068 Ga0373925_0002356 Ga0373925_0002356_12527_13651 369
939 3300041512 Ga0451853_3599974 Ga0451853_3599974_637_1779 369
940 3300044706 Ga0466964_0004673 Ga0466964_0004673_1187_2329 369
941 3300046459 Ga0495629_0002746 Ga0495629_0002746_1411_2535 369
942 3300046461 Ga0495641_0004633 Ga0495641_0004633_6714_7838 369
943 3300046463 Ga0495653_0170490 Ga0495653_0170490_22_1146 369
944 3300046473 Ga0495582_0001422 Ga0495582_0001422_1733_2857 369
945 3300046475 Ga0495639_0001181 Ga0495639_0001181_8880_10004 369
946 3300046476 Ga0495662_0003046 Ga0495662_0003046_1862_2986 369
947 3300046517 Ga0495630_0024498 Ga0495630_0024498_3106_4230 369
948 3300046526 Ga0495666_0099635 Ga0495666_0099635_230_1354 369
949 3300046531 Ga0495665_0002651 Ga0495665_0002651_4364_5488 369
950 3300046559 Ga0495667_0048893 Ga0495667_0048893_358_1482 369
951 3300046663 Ga0495635_0074004 Ga0495635_0074004_252_1376 369
952 3300046683 Ga0495658_0000794 Ga0495658_0000794_4371_5495 369
953 3300046689 Ga0495613_0014803 Ga0495613_0014803_2119_3243 369
954 3300046690 Ga0495624_0013790 Ga0495624_0013790_2468_3592 369
955 3300047315 Ga0495581_0000542 Ga0495581_0000542_2807_3931 369
956 3300047319 Ga0495674_0192849 Ga0495674_0192849_179_1303 369
957 3300047321 Ga0495676_0000583 Ga0495676_0000583_19226_20350 369
958 3300047322 Ga0495680_0015897 Ga0495680_0015897_4072_5196 369
959 3300047471 Ga0495684_0025947 Ga0495684_0025947_645_1769 369
960 3300047673 Ga0495593_0034402 Ga0495593_0034402_62_1186 369
961 3300048089 Ga0495614_0010208 Ga0495614_0010208_1544_2668 369
962 3300048912 Ga0496109_0024331 Ga0496109_0024331_1198_2349 369
963 3300049583 Ga0501067_0003396 Ga0501067_0003396_6938_8092 369
964 3300049584 Ga0501068_0001181 Ga0501068_0001181_4320_5474 369
965 3300049585 Ga0501069_0002399 Ga0501069_0002399_4044_5198 369
966 3300049587 Ga0501071_0018729 Ga0501071_0018729_556_1710 369
967 3300053085 Ga0495619_0002571 Ga0495619_0002571_3652_4776 369
968 3300005467 Ga0070706_100036466 Ga0070706_1000364664 370
969 3300005471 Ga0070698_100151900 Ga0070698_1001519002 370
970 3300005518 Ga0070699_100192617 Ga0070699_1001926172 370
971 3300005563 Ga0068855_100061321 Ga0068855_1000613213 370
972 3300005618 Ga0068864_100339051 Ga0068864_1003390512 370
973 3300005719 Ga0068861_100007901 Ga0068861_1000079011 370
974 3300005937 Ga0081455_10014350 Ga0081455_100143506 370
975 3300006914 Ga0075436_100022390 Ga0075436_1000223904 370
976 3300009094 Ga0111539_10252067 Ga0111539_102520672 370
977 3300009098 Ga0105245_10073970 Ga0105245_100739703 370
978 3300009147 Ga0114129_10117688 Ga0114129_101176882 370
979 3300009148 Ga0105243_10225101 Ga0105243_102251011 370
980 3300010375 Ga0105239_10041625 Ga0105239_100416255 370
981 3300010375 Ga0105239_10279800 Ga0105239_102798002 370
982 3300013306 Ga0163162_10056437 Ga0163162_100564374 370
983 3300013307 Ga0157372_10481927 Ga0157372_104819271 370
984 3300025910 Ga0207684_10056353 Ga0207684_100563532 370
985 3300025933 Ga0207706_10073803 Ga0207706_100738032 370
986 3300025972 Ga0207668_10179823 Ga0207668_101798232 370
987 3300026118 Ga0207675_100092869 Ga0207675_1000928693 370
988 3300027907 Ga0207428_10005252 Ga0207428_1000525212 370
989 3300035170 Ga0373943_0005293 Ga0373943_0005293_4263_5411 370
990 3300035695 Ga0373927_0045554 Ga0373927_0045554_106_1254 370
991 3300037068 Ga0373925_0093770 Ga0373925_0093770_145_1293 370
992 3300037312 Ga0395899_0010815 Ga0395899_0010815_3416_4567 370
993 3300037418 Ga0395900_0008263 Ga0395900_0008263_8481_9632 370
994 3300037466 Ga0395898_0007049 Ga0395898_0007049_9502_10653 370
995 3300037471 Ga0395905_0004549 Ga0395905_0004549_9989_11140 370
996 3300038443 Ga0395901_0006476 Ga0395901_0006476_7770_8921 370
997 3300042439 Ga0439464_0036941 Ga0439464_0036941_190_1335 370
998 3300045976 Ga0466967_0022717 Ga0466967_0022717_1335_2486 370
999 3300046517 Ga0495630_0155911 Ga0495630_0155911_469_1617 370
1000 3300047321 Ga0495676_0037005 Ga0495676_0037005_905_2053 370
1001 3300050508 nmdc:mga09592_135586_c1 nmdc:mga09592_135586_c1_194_1339 370
1002 3300050512 nmdc:mga0n895_13560_c1 nmdc:mga0n895_13560_c1_2020_3165 370
1003 3300050513 nmdc:mga0rr50_38904_c1 nmdc:mga0rr50_38904_c1_2258_3403 370
1004 3300050515 nmdc:mga0a205_68871_c1 nmdc:mga0a205_68871_c1_2262_3407 370
1005 3300046529 Ga0495652_0124915 Ga0495652_0124915_487_1611 371
1006 3300048088 Ga0495602_0113494 Ga0495602_0113494_61_1179 371
1007 3300048907 Ga0496104_0000133 Ga0496104_0000133_45391_46515 371
1008 3300048908 Ga0496105_0000595 Ga0496105_0000595_18696_19820 371
1009 3300053077 Ga0495601_0041154 Ga0495601_0041154_1385_2509 371
1010 3300037418 Ga0395900_0070002 Ga0395900_0070002_683_1840 372
1011 3300037466 Ga0395898_0346758 Ga0395898_0346758_246_1403 372
1012 3300001979 JGI24740J21852_10001919 JGI24740J21852_100019195 374
1013 3300009101 Ga0105247_10002698 Ga0105247_100026982 374
1014 3300009176 Ga0105242_10006738 Ga0105242_100067386 374
1015 3300025900 Ga0207710_10000179 Ga0207710_1000017992 374
1016 3300025934 Ga0207686_10002316 Ga0207686_100023166 374
1017 3300046543 Ga0495645_0057702 Ga0495645_0057702_1609_2736 374
1018 3300048907 Ga0496104_0000015 Ga0496104_0000015_174434_175567 374
1019 3300048908 Ga0496105_0000004 Ga0496105_0000004_300232_301365 374
1020 3300048922 Ga0496119_0019718 Ga0496119_0019718_1530_2663 374

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07687

M20_dimer

Peptidase dimerisation domain

221

315

0.93

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

114

411

0.82

PF04389

Peptidase_M28

Peptidase family M28

97

223

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rza-assembly1.cif.gz_B crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. aureus mu50 at 2.10 a resolution 0.9269 3 367
3rza-assembly1.cif.gz_B crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. aureus mu50 at 2.10 a resolution 0.9057 3 367
3gb0-assembly1.cif.gz_A-2 crystal structure of aminopeptidase pept (np_980509.1) from bacillus cereus atcc 10987 at 2.04 a resolution 0.8748 3 363
3gb0-assembly1.cif.gz_A-2 crystal structure of aminopeptidase pept (np_980509.1) from bacillus cereus atcc 10987 at 2.04 a resolution 0.8468 3 363
1fno-assembly1.cif.gz_A-2 peptidase t (tripeptidase) 0.8278 1 367
ID Description Score Start End Superfamily
3gb0A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9545 174 281 3.30.70.360
3gb0A01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9426 3 363 3.40.630.10
3gb0A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9202 174 281 3.30.70.360
3gb0A01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9032 3 363 3.40.630.10
3io1B02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8801 174 281 3.30.70.360
ID Description Score Start End GO Terms
AF-A0A7W0TJG2-F1-model_v4 Peptidase dimerization domain-containing protein 0.9825 151 367
AF-A0A1F5BLI0-F1-model_v4 Peptidase M20 dimerisation domain-containing protein 0.9753 3 362 GO:0004177
GO:0046872
AF-A0A7W0APW2-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9679 52 371 GO:0006508
GO:0008237
AF-A0A7W7MJ24-F1-model_v4 Tripeptide aminopeptidase (EC 3.4.11.4) 0.9666 3 365 GO:0045148
GO:0046872
AF-A0A0T6A5U6-F1-model_v4 Peptidase T-like protein 0.966 3 367 GO:0004177
GO:0046872

Feature Viewer

pLDDT pTM Quality
95.18 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map