F488335

General Info

Members Datasets Scaffolds Average Seq Length
1018 273 1018 133

Family's Representative Sequence

Representative Sequence 3300059509|Ga0587089_021695|Ga0587089_021695_308_883
Length 155
Sequence VPPVEAAGGEASRSHSDRKGLGIMKSFLVRASVGAAVAGLLPVAAVAQPWTPGSEVVGQPIQVTTNGVTNTVYLDPGGQLRILTPGGSTIPGTWTAANGQLCLAAGGPQECVPYAAPFQAGAPVTVTSSCGASESWLAQSTNAPXXXAAKSERGL

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
183 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
184 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
185 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
189 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
198 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
199 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
204 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
211 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
212 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
215 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059602 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 15R_AD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89
Metatranscriptomes 11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.77
Rhizosphere 98.04
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10017128 3300001979 Bacteria 2598
2 JGI24739J22299_10005147 3300001989 Bacteria 4980
3 JGI24737J22298_10001371 3300001990 Bacteria 8641
4 JGI24737J22298_10001739 3300001990 Bacteria 7775
5 JGI24737J22298_10010090 3300001990 Bacteria 3128
6 JGI24737J22298_10115525 3300001990 Unclassified 793
7 JGI24743J22301_10013607 3300001991 Bacteria 1492
8 JGI24743J22301_10061766 3300001991 Bacteria 773
9 JGI24743J22301_10083134 3300001991 Bacteria 677
10 JGI24735J21928_10003163 3300002067 Bacteria 5635
11 JGI24735J21928_10004503 3300002067 Bacteria 4686
12 JGI24735J21928_10133570 3300002067 Unclassified 716
13 JGI24735J21928_10139576 3300002067 Unclassified 699
14 JGI24735J21928_10140301 3300002067 Unclassified 697
15 JGI24738J21930_10000372 3300002075 Bacteria 12499
16 JGI24738J21930_10001979 3300002075 Bacteria 5510
17 JGI24744J21845_10008807 3300002077 Bacteria 2074
18 Ga0058863_11670502 3300004799 Bacteria 655
19 Ga0058863_11870082 3300004799 Unclassified 797
20 Ga0058861_11885830 3300004800 Unclassified 705
21 Ga0058861_12010952 3300004800 Bacteria 588
22 Ga0058862_12414424 3300004803 Unclassified 531
23 Ga0065712_10247602 3300005290 Bacteria 939
24 Ga0065715_10524477 3300005293 Bacteria 761
25 Ga0070658_10000477 3300005327 Bacteria 34731
26 Ga0070658_10017337 3300005327 Bacteria 5763
27 Ga0070658_10020280 3300005327 Bacteria 5326
28 Ga0070658_10046871 3300005327 Bacteria 3497
29 Ga0070658_10060437 3300005327 Bacteria 3086
30 Ga0070658_10133965 3300005327 Bacteria 2066
31 Ga0070658_10203782 3300005327 Bacteria 1670
32 Ga0070658_10290916 3300005327 Bacteria 1392
33 Ga0070658_10527296 3300005327 Unclassified 1021
34 Ga0070658_10682718 3300005327 Unclassified 891
35 Ga0070676_10001347 3300005328 Bacteria 12342
36 Ga0070676_10003695 3300005328 Bacteria 8018
37 Ga0070676_10068888 3300005328 Bacteria 2119
38 Ga0070676_10120809 3300005328 Bacteria 1644
39 Ga0070676_11095783 3300005328 Bacteria 601
40 Ga0070683_100000747 3300005329 Bacteria 23810
41 Ga0070683_100005454 3300005329 Bacteria 10628
42 Ga0070683_100010424 3300005329 Bacteria 7992
43 Ga0070683_100174143 3300005329 Bacteria 2043
44 Ga0070683_100268394 3300005329 Bacteria 1623
45 Ga0070683_100480230 3300005329 Bacteria 1187
46 Ga0070683_100749937 3300005329 Bacteria 935
47 Ga0070683_100988990 3300005329 Bacteria 807
48 Ga0070690_100020500 3300005330 Bacteria 4028
49 Ga0070690_100062783 3300005330 Bacteria 2396
50 Ga0070670_100039466 3300005331 Bacteria 4060
51 Ga0070670_100379339 3300005331 Bacteria 1245
52 Ga0070670_100498666 3300005331 Unclassified 1082
53 Ga0070670_100564450 3300005331 Bacteria 1016
54 Ga0070670_100980266 3300005331 Bacteria 768
55 Ga0070677_10041571 3300005333 Bacteria 1816
56 Ga0068869_100006276 3300005334 Bacteria 7526
57 Ga0068869_100095563 3300005334 Bacteria 2242
58 Ga0068869_101175150 3300005334 Unclassified 673
59 Ga0070666_10002947 3300005335 Bacteria 10304
60 Ga0070666_10052734 3300005335 Bacteria 2742
61 Ga0070666_10070029 3300005335 Bacteria 2386
62 Ga0070666_10135878 3300005335 Bacteria 1711
63 Ga0070680_100147453 3300005336 Bacteria 1974
64 Ga0070680_100214594 3300005336 Bacteria 1624
65 Ga0070680_100739970 3300005336 Bacteria 846
66 Ga0070680_101013615 3300005336 Bacteria 717
67 Ga0070682_100001753 3300005337 Bacteria 12079
68 Ga0070682_100043356 3300005337 Bacteria 2781
69 Ga0070682_100072790 3300005337 Bacteria 2203
70 Ga0070682_101568571 3300005337 Bacteria 568
71 Ga0068868_100044049 3300005338 Bacteria 3488
72 Ga0068868_100196288 3300005338 Unclassified 1680
73 Ga0068868_100463282 3300005338 Unclassified 1104
74 Ga0068868_100537440 3300005338 Bacteria 1028
75 Ga0068868_101062679 3300005338 Unclassified 743
76 Ga0070660_100000425 3300005339 Bacteria 27941
77 Ga0070660_100003141 3300005339 Bacteria 11350
78 Ga0070660_100240795 3300005339 Bacteria 1474
79 Ga0070660_100303797 3300005339 Bacteria 1308
80 Ga0070660_100470796 3300005339 Bacteria 1043
81 Ga0070660_100474837 3300005339 Bacteria 1039
82 Ga0070660_101008537 3300005339 Unclassified 703
83 Ga0070660_101219972 3300005339 Unclassified 638
84 Ga0070689_100004740 3300005340 Bacteria 9229
85 Ga0070691_10035664 3300005341 Bacteria 2342
86 Ga0070687_100212620 3300005343 Unclassified 1179
87 Ga0070687_100391664 3300005343 Bacteria 908
88 Ga0070661_100000552 3300005344 Bacteria 28745
89 Ga0070661_100001960 3300005344 Bacteria 14220
90 Ga0070661_100002092 3300005344 Bacteria 13736
91 Ga0070661_100008264 3300005344 Bacteria 7185
92 Ga0070661_100036793 3300005344 Bacteria 3557
93 Ga0070661_100044834 3300005344 Bacteria 3232
94 Ga0070661_100133827 3300005344 Bacteria 1864
95 Ga0070661_100182595 3300005344 Bacteria 1597
96 Ga0070661_100584815 3300005344 Bacteria 901
97 Ga0070661_101227442 3300005344 Bacteria 627
98 Ga0070661_101458345 3300005344 Unclassified 576
99 Ga0070692_10034895 3300005345 Bacteria 2544
100 Ga0070692_10119051 3300005345 Bacteria 1470
101 Ga0070668_100001719 3300005347 Bacteria 15902
102 Ga0070668_100022957 3300005347 Bacteria 4717
103 Ga0070669_100021055 3300005353 Bacteria 4659
104 Ga0070669_100614306 3300005353 Bacteria 912
105 Ga0070669_100666619 3300005353 Bacteria 876
106 Ga0070675_100301932 3300005354 Bacteria 1411
107 Ga0070671_100012445 3300005355 Bacteria 6851
108 Ga0070671_100033760 3300005355 Bacteria 4234
109 Ga0070671_100034275 3300005355 Bacteria 4202
110 Ga0070671_100054845 3300005355 Bacteria 3315
111 Ga0070671_100121365 3300005355 Bacteria 2199
112 Ga0070671_100126515 3300005355 Bacteria 2151
113 Ga0070674_100036573 3300005356 Bacteria 3297
114 Ga0070674_100057775 3300005356 Bacteria 2694
115 Ga0070673_100001046 3300005364 Bacteria 15704
116 Ga0070673_100001556 3300005364 Bacteria 13518
117 Ga0070673_100133524 3300005364 Bacteria 2086
118 Ga0070673_100178351 3300005364 Bacteria 1817
119 Ga0070673_100543444 3300005364 Bacteria 1055
120 Ga0070673_100996216 3300005364 Unclassified 780
121 Ga0070659_100000065 3300005366 Bacteria 82919
122 Ga0070659_100011551 3300005366 Bacteria 6534
123 Ga0070659_100013967 3300005366 Bacteria 5994
124 Ga0070659_100016237 3300005366 Bacteria 5587
125 Ga0070659_100040228 3300005366 Bacteria 3652
126 Ga0070659_100041644 3300005366 Bacteria 3591
127 Ga0070659_100068005 3300005366 Bacteria 2825
128 Ga0070659_100089596 3300005366 Bacteria 2464
129 Ga0070659_100140975 3300005366 Bacteria 1963
130 Ga0070659_100257942 3300005366 Bacteria 1446
131 Ga0070659_100603853 3300005366 Bacteria 943
132 Ga0070659_101099487 3300005366 Bacteria 701
133 Ga0070659_101117178 3300005366 Bacteria 695
134 Ga0070659_101982550 3300005366 Unclassified 523
135 Ga0070667_100008194 3300005367 Bacteria 8662
136 Ga0070667_100011257 3300005367 Bacteria 7399
137 Ga0070667_100020823 3300005367 Bacteria 5446
138 Ga0070667_100024205 3300005367 Bacteria 5043
139 Ga0070667_100032912 3300005367 Bacteria 4327
140 Ga0070667_100086776 3300005367 Bacteria 2685
141 Ga0070667_100228041 3300005367 Bacteria 1660
142 Ga0070667_100263961 3300005367 Bacteria 1542
143 Ga0070667_100383781 3300005367 Bacteria 1276
144 Ga0070667_100385592 3300005367 Bacteria 1273
145 Ga0070709_10770043 3300005434 Unclassified 753
146 Ga0070714_100089684 3300005435 Bacteria 2692
147 Ga0070714_100956649 3300005435 Bacteria 833
148 Ga0070713_100347612 3300005436 Bacteria 1375
149 Ga0070713_102240953 3300005436 Bacteria 529
150 Ga0070663_100000647 3300005455 Bacteria 18662
151 Ga0070663_100001839 3300005455 Bacteria 11825
152 Ga0070663_100027782 3300005455 Bacteria 3845
153 Ga0070663_100126737 3300005455 Unclassified 1935
154 Ga0070663_100131939 3300005455 Bacteria 1898
155 Ga0070663_100161020 3300005455 Bacteria 1727
156 Ga0070663_100225129 3300005455 Bacteria 1474
157 Ga0070663_100242476 3300005455 Unclassified 1423
158 Ga0070663_100905861 3300005455 Bacteria 762
159 Ga0070663_101033811 3300005455 Bacteria 716
160 Ga0070663_101141897 3300005455 Unclassified 683
161 Ga0070678_100074997 3300005456 Bacteria 2544
162 Ga0070678_100098389 3300005456 Bacteria 2262
163 Ga0070678_100724892 3300005456 Unclassified 897
164 Ga0070662_100000010 3300005457 Bacteria 142717
165 Ga0070662_100000323 3300005457 Bacteria 28556
166 Ga0070662_100034343 3300005457 Bacteria 3575
167 Ga0070662_100103504 3300005457 Bacteria 2159
168 Ga0070662_100168055 3300005457 Bacteria 1720
169 Ga0070662_100180546 3300005457 Bacteria 1663
170 Ga0070662_100211513 3300005457 Bacteria 1543
171 Ga0070662_100287009 3300005457 Bacteria 1333
172 Ga0070662_100543773 3300005457 Bacteria 973
173 Ga0070662_101383194 3300005457 Bacteria 606
174 Ga0070681_10013516 3300005458 Bacteria 8117
175 Ga0070681_10152303 3300005458 Bacteria 2239
176 Ga0070681_10257261 3300005458 Bacteria 1658
177 Ga0068867_100004677 3300005459 Bacteria 9632
178 Ga0068867_100013102 3300005459 Bacteria 5870
179 Ga0068867_100278207 3300005459 Bacteria 1371
180 Ga0068867_100301265 3300005459 Unclassified 1321
181 Ga0068867_100520616 3300005459 Bacteria 1025
182 Ga0068867_101441810 3300005459 Bacteria 639
183 Ga0070685_10239772 3300005466 Bacteria 1196
184 Ga0070679_100014856 3300005530 Bacteria 7480
185 Ga0070679_100128950 3300005530 Bacteria 2511
186 Ga0070679_100181220 3300005530 Bacteria 2079
187 Ga0070679_100398756 3300005530 Bacteria 1322
188 Ga0070679_100526550 3300005530 Unclassified 1126
189 Ga0070679_100946217 3300005530 Bacteria 805
190 Ga0070679_101329082 3300005530 Unclassified 665
191 Ga0070679_101519181 3300005530 Unclassified 617
192 Ga0070679_102074640 3300005530 Unclassified 518
193 Ga0070684_100029987 3300005535 Bacteria 4617
194 Ga0070684_100094566 3300005535 Bacteria 2662
195 Ga0070684_100121740 3300005535 Bacteria 2347
196 Ga0070684_100541159 3300005535 Bacteria 1080
197 Ga0070684_102071085 3300005535 Unclassified 537
198 Ga0068853_100000067 3300005539 Bacteria 73891
199 Ga0068853_100011651 3300005539 Bacteria 7145
200 Ga0068853_100025346 3300005539 Bacteria 4976
201 Ga0068853_100030531 3300005539 Bacteria 4553
202 Ga0068853_100178754 3300005539 Bacteria 1923
203 Ga0068853_100195932 3300005539 Bacteria 1837
204 Ga0068853_100409380 3300005539 Bacteria 1270
205 Ga0070672_100023632 3300005543 Bacteria 4534
206 Ga0070672_100048432 3300005543 Bacteria 3302
207 Ga0070672_100095965 3300005543 Bacteria 2398
208 Ga0070686_100805827 3300005544 Unclassified 757
209 Ga0070696_100089379 3300005546 Bacteria 2190
210 Ga0070696_100619486 3300005546 Bacteria 874
211 Ga0070696_100815875 3300005546 Bacteria 769
212 Ga0070693_100000343 3300005547 Bacteria 21190
213 Ga0070693_100012856 3300005547 Bacteria 4249
214 Ga0070693_100015026 3300005547 Bacteria 3981
215 Ga0070693_100034700 3300005547 Bacteria 2793
216 Ga0070693_100068659 3300005547 Bacteria 2081
217 Ga0070693_100076941 3300005547 Bacteria 1979
218 Ga0070665_100013969 3300005548 Bacteria 8076
219 Ga0070665_100100909 3300005548 Bacteria 2890
220 Ga0070665_100119667 3300005548 Bacteria 2635
221 Ga0070665_100453511 3300005548 Bacteria 1292
222 Ga0070665_100516987 3300005548 Bacteria 1205
223 Ga0068855_100017249 3300005563 Bacteria 8690
224 Ga0068855_100018104 3300005563 Bacteria 8465
225 Ga0068855_100066116 3300005563 Bacteria 4215
226 Ga0068855_100079415 3300005563 Bacteria 3805
227 Ga0068855_100109434 3300005563 Bacteria 3173
228 Ga0068855_100295644 3300005563 Bacteria 1794
229 Ga0068855_100558573 3300005563 Unclassified 1238
230 Ga0068855_100751142 3300005563 Bacteria 1040
231 Ga0068855_101023477 3300005563 Unclassified 867
232 Ga0070664_100000228 3300005564 Bacteria 40132
233 Ga0070664_100002696 3300005564 Bacteria 14326
234 Ga0070664_100006881 3300005564 Bacteria 9167
235 Ga0070664_100009565 3300005564 Bacteria 7860
236 Ga0070664_100059968 3300005564 Bacteria 3238
237 Ga0070664_100071624 3300005564 Bacteria 2971
238 Ga0070664_100088394 3300005564 Bacteria 2679
239 Ga0070664_100276125 3300005564 Bacteria 1515
240 Ga0070664_100529306 3300005564 Bacteria 1088
241 Ga0070664_100578245 3300005564 Bacteria 1040
242 Ga0070664_100681133 3300005564 Unclassified 957
243 Ga0070664_100862659 3300005564 Bacteria 848
244 Ga0070664_100962590 3300005564 Bacteria 801
245 Ga0070664_100977906 3300005564 Bacteria 795
246 Ga0070664_102183787 3300005564 Unclassified 525
247 Ga0068857_100005960 3300005577 Bacteria 10414
248 Ga0068857_100018518 3300005577 Bacteria 6108
249 Ga0068857_100026322 3300005577 Bacteria 5126
250 Ga0068857_100208346 3300005577 Bacteria 1783
251 Ga0068857_100354085 3300005577 Bacteria 1360
252 Ga0068857_100380990 3300005577 Bacteria 1310
253 Ga0068857_100413628 3300005577 Bacteria 1256
254 Ga0068857_100561577 3300005577 Bacteria 1076
255 Ga0068857_100773393 3300005577 Bacteria 916
256 Ga0068857_102154810 3300005577 Bacteria 547
257 Ga0068854_100001913 3300005578 Bacteria 12684
258 Ga0068854_100006418 3300005578 Bacteria 7481
259 Ga0068854_100011321 3300005578 Bacteria 5802
260 Ga0068854_100025191 3300005578 Bacteria 4081
261 Ga0068854_100083818 3300005578 Bacteria 2357
262 Ga0068854_100411489 3300005578 Bacteria 1121
263 Ga0068856_100000101 3300005614 Bacteria 82391
264 Ga0068856_100023316 3300005614 Bacteria 6017
265 Ga0068856_100061342 3300005614 Bacteria 3714
266 Ga0068856_100079964 3300005614 Bacteria 3242
267 Ga0068856_100153835 3300005614 Bacteria 2310
268 Ga0068856_100334692 3300005614 Unclassified 1532
269 Ga0068856_100391785 3300005614 Bacteria 1409
270 Ga0068856_100689227 3300005614 Unclassified 1042
271 Ga0070702_100377282 3300005615 Bacteria 1007
272 Ga0068852_100000846 3300005616 Bacteria 20324
273 Ga0068852_100001433 3300005616 Bacteria 16088
274 Ga0068852_100003781 3300005616 Bacteria 10612
275 Ga0068852_100013090 3300005616 Bacteria 6335
276 Ga0068852_100023726 3300005616 Bacteria 4943
277 Ga0068852_100087984 3300005616 Bacteria 2773
278 Ga0068852_100093334 3300005616 Bacteria 2697
279 Ga0068852_100094713 3300005616 Bacteria 2680
280 Ga0068852_100437703 3300005616 Bacteria 1292
281 Ga0068852_102470375 3300005616 Unclassified 540
282 Ga0068859_100048611 3300005617 Unclassified 4260
283 Ga0068859_100054434 3300005617 Bacteria 4024
284 Ga0068859_100092224 3300005617 Bacteria 3080
285 Ga0068859_100379073 3300005617 Bacteria 1510
286 Ga0068859_100904590 3300005617 Bacteria 967
287 Ga0068864_100000222 3300005618 Bacteria 51430
288 Ga0068864_100007380 3300005618 Bacteria 9049
289 Ga0068864_100089427 3300005618 Bacteria 2713
290 Ga0068864_100180268 3300005618 Bacteria 1931
291 Ga0068861_100169755 3300005719 Bacteria 1807
292 Ga0068861_100329298 3300005719 Bacteria 1333
293 Ga0068861_100430982 3300005719 Bacteria 1177
294 Ga0068861_100485890 3300005719 Bacteria 1113
295 Ga0068851_10032858 3300005834 Bacteria 2582
296 Ga0068851_10047700 3300005834 Bacteria 2170
297 Ga0068851_10051292 3300005834 Unclassified 2096
298 Ga0068851_10154026 3300005834 Bacteria 1258
299 Ga0068851_10167365 3300005834 Bacteria 1211
300 Ga0068870_10103315 3300005840 Bacteria 1614
301 Ga0068863_100002567 3300005841 Bacteria 18003
302 Ga0068863_100034901 3300005841 Bacteria 4791
303 Ga0068863_100116639 3300005841 Bacteria 2544
304 Ga0068863_100360451 3300005841 Unclassified 1417
305 Ga0068863_100770831 3300005841 Unclassified 958
306 Ga0068858_100003320 3300005842 Bacteria 16021
307 Ga0068858_100007141 3300005842 Bacteria 10844
308 Ga0068860_100006803 3300005843 Bacteria 11459
309 Ga0068860_100061591 3300005843 Bacteria 3565
310 Ga0068860_100073377 3300005843 Bacteria 3253
311 Ga0068860_100245076 3300005843 Bacteria 1744
312 Ga0068862_100091796 3300005844 Bacteria 2646
313 Ga0068862_100253229 3300005844 Bacteria 1605
314 Ga0097621_100051529 3300006237 Bacteria 3350
315 Ga0097621_100357207 3300006237 Bacteria 1301
316 Ga0097621_100493047 3300006237 Bacteria 1109
317 Ga0097621_100561732 3300006237 Unclassified 1040
318 Ga0097621_101019463 3300006237 Bacteria 775
319 Ga0097621_101092693 3300006237 Bacteria 748
320 Ga0068871_100011090 3300006358 Bacteria 6604
321 Ga0068871_100379801 3300006358 Bacteria 1255
322 Ga0068871_100623150 3300006358 Unclassified 983
323 Ga0068871_100662228 3300006358 Bacteria 954
324 Ga0068871_101378884 3300006358 Bacteria 664
325 Ga0068865_100006056 3300006881 Bacteria 7375
326 Ga0068865_100034925 3300006881 Bacteria 3377
327 Ga0097620_100048612 3300006931 Unclassified 4260
328 Ga0097620_100054439 3300006931 Bacteria 4024
329 Ga0097620_100092228 3300006931 Bacteria 3080
330 Ga0097620_100379074 3300006931 Bacteria 1510
331 Ga0097620_100904739 3300006931 Bacteria 967
332 Ga0075435_100734814 3300007076 Bacteria 858
333 Ga0105240_10087961 3300009093 Bacteria 3803
334 Ga0105245_10006125 3300009098 Bacteria 10580
335 Ga0105241_10032907 3300009174 Bacteria 3889
336 Ga0105241_10130207 3300009174 Bacteria 2036
337 Ga0105241_10157917 3300009174 Bacteria 1861
338 Ga0105241_10342051 3300009174 Bacteria 1296
339 Ga0105241_10702355 3300009174 Unclassified 923
340 Ga0105242_10185671 3300009176 Bacteria 1837
341 Ga0105248_10001119 3300009177 Bacteria 29831
342 Ga0105248_10054729 3300009177 Bacteria 4475
343 Ga0105248_10228619 3300009177 Bacteria 2094
344 Ga0105248_10463115 3300009177 Bacteria 1429
345 Ga0105248_10829284 3300009177 Bacteria 1044
346 Ga0105248_11767199 3300009177 Unclassified 701
347 Ga0105248_12304511 3300009177 Bacteria 613
348 Ga0105237_10006758 3300009545 Bacteria 12663
349 Ga0105238_10004367 3300009551 Bacteria 14023
350 Ga0105238_10051275 3300009551 Bacteria 4151
351 Ga0105238_10063618 3300009551 Bacteria 3690
352 Ga0105238_10111637 3300009551 Bacteria 2714
353 Ga0105238_10327601 3300009551 Bacteria 1518
354 Ga0105238_12295790 3300009551 Unclassified 575
355 Ga0105249_10320235 3300009553 Bacteria 1562
356 Ga0105249_10935063 3300009553 Bacteria 934
357 Ga0105239_10054356 3300010375 Bacteria 4392
358 Ga0105239_10261369 3300010375 Unclassified 1945
359 Ga0105246_10008301 3300011119 Bacteria 6378
360 Ga0105246_10278750 3300011119 Bacteria 1340
361 Ga0157373_10009790 3300013100 Bacteria 7070
362 Ga0157373_10031339 3300013100 Bacteria 3828
363 Ga0157373_10059487 3300013100 Bacteria 2708
364 Ga0157373_10090355 3300013100 Bacteria 2157
365 Ga0157373_10092027 3300013100 Bacteria 2136
366 Ga0157373_10092672 3300013100 Bacteria 2128
367 Ga0157373_10102375 3300013100 Bacteria 2015
368 Ga0157373_10193781 3300013100 Bacteria 1432
369 Ga0157373_10272822 3300013100 Unclassified 1198
370 Ga0157373_10301096 3300013100 Bacteria 1138
371 Ga0157373_10463145 3300013100 Bacteria 913
372 Ga0157371_10003821 3300013102 Bacteria 13450
373 Ga0157371_10025025 3300013102 Bacteria 4356
374 Ga0157371_10026453 3300013102 Bacteria 4217
375 Ga0157371_10075155 3300013102 Bacteria 2393
376 Ga0157371_10092512 3300013102 Bacteria 2142
377 Ga0157371_10128560 3300013102 Bacteria 1802
378 Ga0157371_10870781 3300013102 Unclassified 682
379 Ga0157371_10939038 3300013102 Unclassified 657
380 Ga0157371_11244993 3300013102 Unclassified 574
381 Ga0157370_10059532 3300013104 Bacteria 3629
382 Ga0157370_10741220 3300013104 Unclassified 895
383 Ga0157370_10929875 3300013104 Unclassified 789
384 Ga0157369_10003181 3300013105 Bacteria 19593
385 Ga0157369_10032210 3300013105 Bacteria 5767
386 Ga0157369_10202481 3300013105 Bacteria 2083
387 Ga0157369_10259977 3300013105 Bacteria 1810
388 Ga0157369_10733218 3300013105 Unclassified 1017
389 Ga0157369_10922308 3300013105 Unclassified 895
390 Ga0157374_10303006 3300013296 Bacteria 1581
391 Ga0157374_10480692 3300013296 Unclassified 1245
392 Ga0157374_10519081 3300013296 Unclassified 1197
393 Ga0157378_10006532 3300013297 Bacteria 10192
394 Ga0157378_10007074 3300013297 Bacteria 9797
395 Ga0157378_10344935 3300013297 Bacteria 1453
396 Ga0163162_10032625 3300013306 Bacteria 5173
397 Ga0163162_10438663 3300013306 Unclassified 1438
398 Ga0157372_10011784 3300013307 Bacteria 9314
399 Ga0157372_10035809 3300013307 Bacteria 5466
400 Ga0157372_10045014 3300013307 Bacteria 4893
401 Ga0157372_10046828 3300013307 Bacteria 4802
402 Ga0157372_10359554 3300013307 Bacteria 1696
403 Ga0157372_11666553 3300013307 Unclassified 734
404 Ga0157372_12909297 3300013307 Bacteria 548
405 Ga0157375_10007221 3300013308 Bacteria 9716
406 Ga0157375_10024264 3300013308 Bacteria 5610
407 Ga0157375_10271200 3300013308 Bacteria 1859
408 Ga0163163_10019125 3300014325 Bacteria 6427
409 Ga0157377_10204425 3300014745 Bacteria 1256
410 Ga0157379_10165064 3300014968 Bacteria 1999
411 Ga0157379_10182441 3300014968 Unclassified 1896
412 Ga0157379_11204648 3300014968 Bacteria 728
413 Ga0157376_10684688 3300014969 Bacteria 1029
414 Ga0163161_10485228 3300017792 Bacteria 1004
415 Ga0197907_10034936 3300020069 Unclassified 667
416 Ga0197907_11002332 3300020069 Bacteria 910
417 Ga0206356_10307274 3300020070 Bacteria 1016
418 Ga0206356_11292785 3300020070 Bacteria 909
419 Ga0206356_11311979 3300020070 Unclassified 949
420 Ga0206356_11638823 3300020070 Bacteria 1524
421 Ga0206352_10699940 3300020078 Unclassified 901
422 Ga0206354_10948750 3300020081 Bacteria 990
423 Ga0206353_10732796 3300020082 Bacteria 619
424 Ga0224712_10171006 3300022467 Bacteria 974
425 Ga0224712_10205286 3300022467 Unclassified 897
426 Ga0207673_1020061 3300025290 Bacteria 900
427 Ga0207697_10000158 3300025315 Bacteria 33821
428 Ga0207697_10022280 3300025315 Bacteria 2595
429 Ga0207697_10028059 3300025315 Bacteria 2301
430 Ga0207697_10112020 3300025315 Bacteria 1169
431 Ga0207656_10003880 3300025321 Bacteria 5185
432 Ga0207656_10042249 3300025321 Bacteria 1939
433 Ga0207656_10061879 3300025321 Bacteria 1644
434 Ga0207656_10461209 3300025321 Bacteria 643
435 Ga0207713_1039137 3300025735 Bacteria 2003
436 Ga0207682_10035101 3300025893 Bacteria 2024
437 Ga0207642_10364144 3300025899 Unclassified 856
438 Ga0207688_10007071 3300025901 Bacteria 6102
439 Ga0207688_10126968 3300025901 Bacteria 1492
440 Ga0207680_10517167 3300025903 Bacteria 851
441 Ga0207647_10000832 3300025904 Bacteria 23993
442 Ga0207647_10004000 3300025904 Bacteria 10992
443 Ga0207647_10008390 3300025904 Bacteria 7410
444 Ga0207647_10061274 3300025904 Bacteria 2297
445 Ga0207647_10064373 3300025904 Bacteria 2228
446 Ga0207647_10079630 3300025904 Bacteria 1966
447 Ga0207647_10464687 3300025904 Bacteria 708
448 Ga0207645_10003931 3300025907 Bacteria 11101
449 Ga0207645_10004831 3300025907 Bacteria 9899
450 Ga0207645_10008901 3300025907 Bacteria 6973
451 Ga0207645_10063906 3300025907 Unclassified 2352
452 Ga0207645_10112926 3300025907 Bacteria 1760
453 Ga0207643_10054699 3300025908 Bacteria 2269
454 Ga0207643_10173377 3300025908 Bacteria 1303
455 Ga0207643_10254530 3300025908 Bacteria 1082
456 Ga0207705_10000113 3300025909 Bacteria 90567
457 Ga0207705_10010345 3300025909 Bacteria 6787
458 Ga0207705_10038951 3300025909 Bacteria 3406
459 Ga0207705_10059966 3300025909 Bacteria 2747
460 Ga0207705_10060833 3300025909 Bacteria 2728
461 Ga0207705_10065521 3300025909 Bacteria 2626
462 Ga0207705_10065899 3300025909 Bacteria 2619
463 Ga0207705_10077431 3300025909 Bacteria 2419
464 Ga0207705_10186859 3300025909 Bacteria 1566
465 Ga0207705_10261160 3300025909 Bacteria 1322
466 Ga0207705_11141639 3300025909 Unclassified 599
467 Ga0207654_10106813 3300025911 Bacteria 1734
468 Ga0207654_10178036 3300025911 Unclassified 1385
469 Ga0207707_10008907 3300025912 Bacteria 8714
470 Ga0207707_10453823 3300025912 Unclassified 1097
471 Ga0207707_10495635 3300025912 Bacteria 1042
472 Ga0207695_10622836 3300025913 Unclassified 960
473 Ga0207671_10017531 3300025914 Bacteria 5516
474 Ga0207693_10016003 3300025915 Bacteria 6004
475 Ga0207660_10007589 3300025917 Bacteria 7020
476 Ga0207660_10034958 3300025917 Bacteria 3486
477 Ga0207660_10440534 3300025917 Bacteria 1053
478 Ga0207660_10535163 3300025917 Bacteria 952
479 Ga0207660_10665417 3300025917 Bacteria 849
480 Ga0207660_10682176 3300025917 Bacteria 838
481 Ga0207660_11701896 3300025917 Bacteria 507
482 Ga0207662_10030474 3300025918 Bacteria 3130
483 Ga0207662_10077107 3300025918 Bacteria 2027
484 Ga0207662_10170760 3300025918 Bacteria 1394
485 Ga0207657_10000026 3300025919 Bacteria 143118
486 Ga0207657_10002103 3300025919 Bacteria 21540
487 Ga0207657_10005900 3300025919 Bacteria 12750
488 Ga0207657_10007800 3300025919 Bacteria 10926
489 Ga0207657_10038093 3300025919 Bacteria 4285
490 Ga0207657_10050216 3300025919 Bacteria 3630
491 Ga0207657_10093297 3300025919 Bacteria 2507
492 Ga0207657_10167001 3300025919 Bacteria 1784
493 Ga0207657_10281976 3300025919 Bacteria 1319
494 Ga0207657_10862110 3300025919 Bacteria 698
495 Ga0207649_10000516 3300025920 Bacteria 27112
496 Ga0207649_10002740 3300025920 Bacteria 9764
497 Ga0207649_10032422 3300025920 Bacteria 3114
498 Ga0207649_10038842 3300025920 Bacteria 2884
499 Ga0207649_10070046 3300025920 Bacteria 2235
500 Ga0207649_10085352 3300025920 Bacteria 2054
501 Ga0207649_10183527 3300025920 Bacteria 1466
502 Ga0207649_10517552 3300025920 Bacteria 909
503 Ga0207652_10026485 3300025921 Bacteria 4830
504 Ga0207652_10095828 3300025921 Bacteria 2614
505 Ga0207652_10220094 3300025921 Bacteria 1711
506 Ga0207652_10298249 3300025921 Bacteria 1455
507 Ga0207652_10338914 3300025921 Bacteria 1357
508 Ga0207652_10437556 3300025921 Unclassified 1179
509 Ga0207652_10487035 3300025921 Unclassified 1111
510 Ga0207652_10825776 3300025921 Bacteria 822
511 Ga0207652_11286989 3300025921 Unclassified 634
512 Ga0207681_10047787 3300025923 Bacteria 2885
513 Ga0207681_10056834 3300025923 Bacteria 2670
514 Ga0207681_10277952 3300025923 Unclassified 1317
515 Ga0207694_10000776 3300025924 Bacteria 28653
516 Ga0207694_10005699 3300025924 Bacteria 9549
517 Ga0207694_10185516 3300025924 Unclassified 1688
518 Ga0207694_10334497 3300025924 Bacteria 1251
519 Ga0207694_10921080 3300025924 Bacteria 739
520 Ga0207694_11500997 3300025924 Unclassified 569
521 Ga0207650_10028115 3300025925 Bacteria 4030
522 Ga0207650_10142089 3300025925 Bacteria 1888
523 Ga0207659_10835872 3300025926 Bacteria 791
524 Ga0207687_10048079 3300025927 Bacteria 2960
525 Ga0207687_10062974 3300025927 Bacteria 2625
526 Ga0207664_10146782 3300025929 Bacteria 2001
527 Ga0207664_10161196 3300025929 Bacteria 1913
528 Ga0207664_10251689 3300025929 Bacteria 1542
529 Ga0207664_10374847 3300025929 Bacteria 1262
530 Ga0207664_10801546 3300025929 Unclassified 847
531 Ga0207644_10022380 3300025931 Bacteria 4319
532 Ga0207644_10033303 3300025931 Bacteria 3599
533 Ga0207644_10033934 3300025931 Bacteria 3570
534 Ga0207644_10209882 3300025931 Bacteria 1539
535 Ga0207644_10227290 3300025931 Bacteria 1481
536 Ga0207690_10000649 3300025932 Bacteria 22307
537 Ga0207690_10002369 3300025932 Bacteria 11421
538 Ga0207690_10002565 3300025932 Bacteria 10974
539 Ga0207690_10012713 3300025932 Bacteria 5046
540 Ga0207690_10017432 3300025932 Bacteria 4383
541 Ga0207690_10050183 3300025932 Bacteria 2784
542 Ga0207690_10201848 3300025932 Unclassified 1511
543 Ga0207690_10219429 3300025932 Bacteria 1454
544 Ga0207690_10238263 3300025932 Bacteria 1400
545 Ga0207690_10369349 3300025932 Unclassified 1138
546 Ga0207690_10413049 3300025932 Bacteria 1078
547 Ga0207690_10429139 3300025932 Bacteria 1059
548 Ga0207690_10640821 3300025932 Bacteria 870
549 Ga0207690_11098335 3300025932 Unclassified 663
550 Ga0207706_10000031 3300025933 Bacteria 143109
551 Ga0207706_10000829 3300025933 Bacteria 32031
552 Ga0207706_10002893 3300025933 Bacteria 16604
553 Ga0207706_10008630 3300025933 Bacteria 9389
554 Ga0207706_10024282 3300025933 Bacteria 5434
555 Ga0207706_10038293 3300025933 Bacteria 4254
556 Ga0207706_10055308 3300025933 Bacteria 3500
557 Ga0207706_10081488 3300025933 Bacteria 2843
558 Ga0207706_10101934 3300025933 Bacteria 2526
559 Ga0207706_10158840 3300025933 Bacteria 1988
560 Ga0207706_10216949 3300025933 Bacteria 1676
561 Ga0207706_10260604 3300025933 Bacteria 1514
562 Ga0207706_10676408 3300025933 Unclassified 883
563 Ga0207706_10963687 3300025933 Unclassified 718
564 Ga0207686_10362636 3300025934 Bacteria 1094
565 Ga0207709_10681923 3300025935 Bacteria 821
566 Ga0207670_10044294 3300025936 Bacteria 2943
567 Ga0207669_10108579 3300025937 Bacteria 1853
568 Ga0207669_10828103 3300025937 Bacteria 769
569 Ga0207704_10060374 3300025938 Bacteria 2346
570 Ga0207704_11009349 3300025938 Bacteria 704
571 Ga0207704_11083528 3300025938 Unclassified 680
572 Ga0207691_10003632 3300025940 Bacteria 14973
573 Ga0207691_10061499 3300025940 Bacteria 3411
574 Ga0207691_10134809 3300025940 Bacteria 2179
575 Ga0207691_10144668 3300025940 Bacteria 2093
576 Ga0207711_10000446 3300025941 Bacteria 43126
577 Ga0207711_10002065 3300025941 Bacteria 18165
578 Ga0207711_10007845 3300025941 Bacteria 8923
579 Ga0207711_10117724 3300025941 Bacteria 2369
580 Ga0207711_10226883 3300025941 Bacteria 1710
581 Ga0207711_10287123 3300025941 Unclassified 1516
582 Ga0207711_10733378 3300025941 Bacteria 921
583 Ga0207711_11023149 3300025941 Unclassified 766
584 Ga0207689_10000017 3300025942 Bacteria 117159
585 Ga0207689_10025109 3300025942 Bacteria 4995
586 Ga0207689_10037964 3300025942 Bacteria 3991
587 Ga0207689_10066588 3300025942 Bacteria 2961
588 Ga0207689_10426773 3300025942 Bacteria 1107
589 Ga0207661_10013965 3300025944 Bacteria 5873
590 Ga0207661_10030599 3300025944 Bacteria 4149
591 Ga0207661_10031712 3300025944 Bacteria 4087
592 Ga0207661_10235922 3300025944 Bacteria 1621
593 Ga0207661_10783699 3300025944 Unclassified 878
594 Ga0207661_11073666 3300025944 Unclassified 741
595 Ga0207679_10000236 3300025945 Bacteria 42583
596 Ga0207679_10008515 3300025945 Bacteria 6534
597 Ga0207679_10032946 3300025945 Bacteria 3643
598 Ga0207679_10088718 3300025945 Bacteria 2385
599 Ga0207679_10100327 3300025945 Bacteria 2262
600 Ga0207679_10118558 3300025945 Bacteria 2102
601 Ga0207679_10134912 3300025945 Bacteria 1986
602 Ga0207679_10175160 3300025945 Bacteria 1770
603 Ga0207679_10201523 3300025945 Bacteria 1662
604 Ga0207679_10354516 3300025945 Bacteria 1280
605 Ga0207679_10531731 3300025945 Bacteria 1053
606 Ga0207679_11442595 3300025945 Bacteria 631
607 Ga0207679_12014802 3300025945 Unclassified 525
608 Ga0207667_10001718 3300025949 Bacteria 27571
609 Ga0207667_10081840 3300025949 Bacteria 3345
610 Ga0207667_10132858 3300025949 Bacteria 2563
611 Ga0207667_10720816 3300025949 Bacteria 999
612 Ga0207667_11750098 3300025949 Unclassified 587
613 Ga0207651_10029701 3300025960 Bacteria 3468
614 Ga0207651_10116028 3300025960 Bacteria 2020
615 Ga0207651_10432706 3300025960 Unclassified 1125
616 Ga0207651_10538401 3300025960 Unclassified 1014
617 Ga0207651_11127555 3300025960 Unclassified 703
618 Ga0207651_11547410 3300025960 Unclassified 597
619 Ga0207651_12017645 3300025960 Bacteria 518
620 Ga0207712_10079041 3300025961 Bacteria 2388
621 Ga0207668_10002157 3300025972 Bacteria 11474
622 Ga0207668_10073156 3300025972 Bacteria 2455
623 Ga0207640_10007503 3300025981 Bacteria 6024
624 Ga0207640_10010090 3300025981 Bacteria 5309
625 Ga0207640_10032101 3300025981 Bacteria 3253
626 Ga0207640_10034294 3300025981 Bacteria 3166
627 Ga0207640_10107025 3300025981 Bacteria 1974
628 Ga0207640_10114939 3300025981 Unclassified 1916
629 Ga0207640_10128956 3300025981 Bacteria 1825
630 Ga0207640_11504686 3300025981 Unclassified 605
631 Ga0207658_10017651 3300025986 Bacteria 4920
632 Ga0207658_10018455 3300025986 Bacteria 4817
633 Ga0207658_10027437 3300025986 Bacteria 4001
634 Ga0207658_10036587 3300025986 Bacteria 3520
635 Ga0207658_10072042 3300025986 Bacteria 2618
636 Ga0207658_10078804 3300025986 Bacteria 2518
637 Ga0207658_10080766 3300025986 Bacteria 2491
638 Ga0207658_10094610 3300025986 Bacteria 2326
639 Ga0207677_10102695 3300026023 Bacteria 2109
640 Ga0207677_10298705 3300026023 Bacteria 1329
641 Ga0207677_10765304 3300026023 Unclassified 862
642 Ga0207677_10815524 3300026023 Unclassified 836
643 Ga0207703_10025106 3300026035 Bacteria 4687
644 Ga0207703_10065655 3300026035 Bacteria 2983
645 Ga0207703_10088896 3300026035 Bacteria 2594
646 Ga0207703_10135939 3300026035 Bacteria 2128
647 Ga0207639_10005817 3300026041 Bacteria 8356
648 Ga0207639_10070955 3300026041 Bacteria 2723
649 Ga0207639_10095747 3300026041 Bacteria 2387
650 Ga0207639_10108892 3300026041 Bacteria 2253
651 Ga0207639_10205373 3300026041 Bacteria 1692
652 Ga0207639_10385639 3300026041 Unclassified 1259
653 Ga0207639_10770962 3300026041 Unclassified 895
654 Ga0207678_10002668 3300026067 Bacteria 16192
655 Ga0207678_10010119 3300026067 Bacteria 8274
656 Ga0207678_10010859 3300026067 Bacteria 8003
657 Ga0207678_10012250 3300026067 Bacteria 7530
658 Ga0207678_10023738 3300026067 Bacteria 5363
659 Ga0207678_10138368 3300026067 Bacteria 2078
660 Ga0207678_10154857 3300026067 Bacteria 1957
661 Ga0207678_10176738 3300026067 Unclassified 1823
662 Ga0207678_10209384 3300026067 Bacteria 1668
663 Ga0207678_10300599 3300026067 Unclassified 1379
664 Ga0207678_10502746 3300026067 Bacteria 1057
665 Ga0207678_10586127 3300026067 Bacteria 977
666 Ga0207708_10326846 3300026075 Bacteria 1253
667 Ga0207708_10327175 3300026075 Bacteria 1252
668 Ga0207702_10010631 3300026078 Bacteria 7690
669 Ga0207702_10015012 3300026078 Bacteria 6423
670 Ga0207702_10067734 3300026078 Bacteria 3064
671 Ga0207702_10095158 3300026078 Bacteria 2616
672 Ga0207702_10164850 3300026078 Bacteria 2026
673 Ga0207702_10208008 3300026078 Bacteria 1818
674 Ga0207702_10600741 3300026078 Bacteria 1080
675 Ga0207702_10839137 3300026078 Bacteria 909
676 Ga0207641_10011385 3300026088 Bacteria 7299
677 Ga0207641_10019349 3300026088 Bacteria 5588
678 Ga0207641_10033916 3300026088 Bacteria 4243
679 Ga0207641_10337044 3300026088 Bacteria 1434
680 Ga0207641_10433036 3300026088 Unclassified 1268
681 Ga0207641_11196227 3300026088 Bacteria 760
682 Ga0207648_10002318 3300026089 Bacteria 20543
683 Ga0207648_10003142 3300026089 Bacteria 17423
684 Ga0207648_10006581 3300026089 Bacteria 11535
685 Ga0207648_10116265 3300026089 Bacteria 2351
686 Ga0207676_10002072 3300026095 Bacteria 14553
687 Ga0207676_10008483 3300026095 Bacteria 7307
688 Ga0207676_10009522 3300026095 Bacteria 6915
689 Ga0207676_10031676 3300026095 Bacteria 3978
690 Ga0207676_10389840 3300026095 Bacteria 1299
691 Ga0207674_10000527 3300026116 Bacteria 50282
692 Ga0207674_10002277 3300026116 Bacteria 24338
693 Ga0207674_10003088 3300026116 Bacteria 20583
694 Ga0207674_10011531 3300026116 Bacteria 9928
695 Ga0207674_10024167 3300026116 Bacteria 6497
696 Ga0207674_10030316 3300026116 Bacteria 5688
697 Ga0207674_10036857 3300026116 Bacteria 5090
698 Ga0207674_10049289 3300026116 Bacteria 4308
699 Ga0207674_10111820 3300026116 Bacteria 2705
700 Ga0207674_10205136 3300026116 Unclassified 1921
701 Ga0207674_10539760 3300026116 Bacteria 1127
702 Ga0207675_100165697 3300026118 Bacteria 2110
703 Ga0207675_100242894 3300026118 Bacteria 1740
704 Ga0207675_100296014 3300026118 Bacteria 1575
705 Ga0207675_100578154 3300026118 Unclassified 1125
706 Ga0207675_100678760 3300026118 Bacteria 1038
707 Ga0207683_10014943 3300026121 Bacteria 6608
708 Ga0207683_10625691 3300026121 Bacteria 997
709 Ga0207698_10000618 3300026142 Bacteria 20690
710 Ga0207698_10001533 3300026142 Bacteria 13466
711 Ga0207698_10007701 3300026142 Bacteria 6757
712 Ga0207698_10009367 3300026142 Bacteria 6242
713 Ga0207698_10046260 3300026142 Bacteria 3285
714 Ga0207698_10280976 3300026142 Bacteria 1540
715 Ga0207698_10361244 3300026142 Unclassified 1375
716 Ga0207698_10379957 3300026142 Bacteria 1343
717 Ga0207698_10397596 3300026142 Bacteria 1316
718 Ga0207698_10727625 3300026142 Bacteria 989
719 Ga0268266_10005677 3300028379 Bacteria 11570
720 Ga0268266_10022882 3300028379 Bacteria 5318
721 Ga0268266_10422373 3300028379 Bacteria 1263
722 Ga0268265_10003245 3300028380 Bacteria 11805
723 Ga0268265_10059407 3300028380 Bacteria 2925
724 Ga0268265_10199537 3300028380 Bacteria 1734
725 Ga0268265_11013896 3300028380 Archaea 820
726 Ga0268264_10002543 3300028381 Bacteria 16012
727 Ga0268264_10035529 3300028381 Bacteria 4104
728 Ga0268264_10073947 3300028381 Unclassified 2894
729 Ga0268264_10157795 3300028381 Bacteria 2040
730 Ga0268264_10573422 3300028381 Unclassified 1109
731 Ga0307513_10390646 3300031456 Unclassified 1128
732 Ga0307408_100021556 3300031548 Bacteria 4362
733 Ga0307408_101050659 3300031548 Unclassified 753
734 Ga0307408_101720449 3300031548 Unclassified 598
735 Ga0307405_10457021 3300031731 Unclassified 1014
736 Ga0307405_10586539 3300031731 Bacteria 907
737 Ga0307405_10881887 3300031731 Unclassified 755
738 Ga0307413_10267439 3300031824 Bacteria 1278
739 Ga0307413_10487033 3300031824 Bacteria 987
740 Ga0307410_10107788 3300031852 Bacteria 2010
741 Ga0307410_10135140 3300031852 Unclassified 1817
742 Ga0307410_10342574 3300031852 Unclassified 1192
743 Ga0307410_10408551 3300031852 Bacteria 1098
744 Ga0307410_11529900 3300031852 Unclassified 588
745 Ga0307406_10006893 3300031901 Bacteria 6292
746 Ga0307406_10094729 3300031901 Bacteria 2019
747 Ga0307406_10183254 3300031901 Bacteria 1526
748 Ga0307406_10304271 3300031901 Bacteria 1226
749 Ga0307406_11360434 3300031901 Unclassified 621
750 Ga0307407_10007704 3300031903 Bacteria 4891
751 Ga0307407_10520960 3300031903 Bacteria 874
752 Ga0307412_10050121 3300031911 Bacteria 2754
753 Ga0307412_10125807 3300031911 Bacteria 1854
754 Ga0307412_10129002 3300031911 Bacteria 1834
755 Ga0307409_100018684 3300031995 Bacteria 4670
756 Ga0307409_100391047 3300031995 Bacteria 1325
757 Ga0307409_100415965 3300031995 Bacteria 1288
758 Ga0307409_101495403 3300031995 Bacteria 703
759 Ga0307416_100034296 3300032002 Bacteria 3860
760 Ga0307416_100186537 3300032002 Bacteria 1950
761 Ga0307416_100798430 3300032002 Bacteria 1039
762 Ga0307416_101024117 3300032002 Unclassified 929
763 Ga0307416_101170537 3300032002 Bacteria 874
764 Ga0307416_101697613 3300032002 Unclassified 736
765 Ga0307414_12034875 3300032004 Bacteria 536
766 Ga0307411_10208232 3300032005 Bacteria 1508
767 Ga0307411_10308733 3300032005 Bacteria 1272
768 Ga0307411_11720663 3300032005 Bacteria 581
769 Ga0307415_100019849 3300032126 Bacteria 4089
770 Ga0307415_100022433 3300032126 Bacteria 3896
771 Ga0307415_100027339 3300032126 Bacteria 3613
772 Ga0307415_100494859 3300032126 Bacteria 1067
773 Ga0307415_100808616 3300032126 Bacteria 856
774 Ga0373930_0092002 3300034816 Unclassified 712
775 Ga0373938_0099370 3300034957 Unclassified 729
776 Ga0373949_0066931 3300035090 Unclassified 934
777 Ga0373951_0066124 3300035091 Unclassified 913
778 Ga0373923_0002141 3300035111 Bacteria 5983
779 Ga0373955_0006945 3300035172 Bacteria 5179
780 Ga0373961_0010280 3300035241 Bacteria 2303
781 Ga0373962_0085039 3300035242 Unclassified 966
782 Ga0373933_0003124 3300035724 Bacteria 9231
783 Ga0373937_0000641 3300036401 Bacteria 30684
784 Ga0395899_0006584 3300037312 Bacteria 8999
785 Ga0395899_0030400 3300037312 Bacteria 4062
786 Ga0395899_0038361 3300037312 Bacteria 3588
787 Ga0395899_0098825 3300037312 Bacteria 2109
788 Ga0395899_0105236 3300037312 Bacteria 2033
789 Ga0395899_0191082 3300037312 Unclassified 1433
790 Ga0395899_0289732 3300037312 Bacteria 1111
791 Ga0395899_0893212 3300037312 Unclassified 542
792 Ga0395900_0106528 3300037418 Bacteria 2879
793 Ga0395900_0107348 3300037418 Bacteria 2868
794 Ga0395900_0176876 3300037418 Bacteria 2170
795 Ga0395900_0177213 3300037418 Bacteria 2168
796 Ga0395900_0245885 3300037418 Bacteria 1792
797 Ga0395900_0254630 3300037418 Unclassified 1755
798 Ga0395900_0262855 3300037418 Bacteria 1723
799 Ga0395900_0355503 3300037418 Bacteria 1437
800 Ga0395900_0442792 3300037418 Bacteria 1256
801 Ga0395900_0480745 3300037418 Bacteria 1194
802 Ga0395900_0582697 3300037418 Bacteria 1060
803 Ga0395900_0591238 3300037418 Unclassified 1051
804 Ga0395900_0607838 3300037418 Bacteria 1033
805 Ga0395900_0880782 3300037418 Bacteria 819
806 Ga0395900_1415124 3300037418 Unclassified 608
807 Ga0395900_1515835 3300037418 Unclassified 582
808 Ga0395900_1551262 3300037418 Bacteria 574
809 Ga0395898_0018087 3300037466 Bacteria 7191
810 Ga0395898_0197787 3300037466 Bacteria 1920
811 Ga0395898_0242749 3300037466 Bacteria 1718
812 Ga0395898_0253928 3300037466 Bacteria 1676
813 Ga0395898_0263788 3300037466 Unclassified 1643
814 Ga0395905_0000092 3300037471 Bacteria 149300
815 Ga0395905_0008699 3300037471 Bacteria 9994
816 Ga0395905_0017027 3300037471 Bacteria 6900
817 Ga0395905_0021465 3300037471 Bacteria 6105
818 Ga0395905_0033987 3300037471 Bacteria 4789
819 Ga0395905_0070313 3300037471 Bacteria 3279
820 Ga0395905_0088340 3300037471 Bacteria 2905
821 Ga0395905_0141907 3300037471 Bacteria 2259
822 Ga0395905_0179826 3300037471 Bacteria 1985
823 Ga0395905_0200560 3300037471 Bacteria 1871
824 Ga0395905_0226216 3300037471 Unclassified 1750
825 Ga0395905_0306016 3300037471 Bacteria 1477
826 Ga0395905_0552801 3300037471 Bacteria 1052
827 Ga0395905_0560942 3300037471 Bacteria 1043
828 Ga0395905_0645510 3300037471 Unclassified 960
829 Ga0395905_0683408 3300037471 Bacteria 929
830 Ga0395905_0727473 3300037471 Bacteria 895
831 Ga0395905_1114477 3300037471 Bacteria 692
832 Ga0395905_1438209 3300037471 Unclassified 594
833 Ga0395905_1553021 3300037471 Unclassified 566
834 Ga0395905_1568637 3300037471 Unclassified 563
835 Ga0395901_0000268 3300038443 Bacteria 64837
836 Ga0395901_0037677 3300038443 Bacteria 5000
837 Ga0395901_0109048 3300038443 Bacteria 2906
838 Ga0395901_0117722 3300038443 Bacteria 2791
839 Ga0395901_0157477 3300038443 Bacteria 2385
840 Ga0395901_0201949 3300038443 Bacteria 2083
841 Ga0395901_0211352 3300038443 Bacteria 2030
842 Ga0395901_0229427 3300038443 Bacteria 1939
843 Ga0395901_0323654 3300038443 Bacteria 1595
844 Ga0395901_0590479 3300038443 Bacteria 1121
845 Ga0395901_0755119 3300038443 Unclassified 965
846 Ga0395901_1876385 3300038443 Unclassified 547
847 Ga0451855_1685400 3300041511 Bacteria 650
848 Ga0439464_0000674 3300042439 Bacteria 7353
849 Ga0466965_0306418 3300044683 Unclassified 863
850 Ga0466961_0577514 3300044693 Bacteria 676
851 Ga0466963_0002161 3300044694 Bacteria 10866
852 Ga0466963_0002953 3300044694 Bacteria 9608
853 Ga0466963_0078078 3300044694 Bacteria 2238
854 Ga0466963_0144024 3300044694 Bacteria 1652
855 Ga0466963_0180407 3300044694 Bacteria 1474
856 Ga0466963_0245265 3300044694 Unclassified 1257
857 Ga0466963_0308765 3300044694 Bacteria 1112
858 Ga0466963_0438438 3300044694 Bacteria 921
859 Ga0466963_0536849 3300044694 Bacteria 826
860 Ga0466964_0871166 3300044706 Unclassified 513
861 Ga0466971_0111804 3300044719 Bacteria 1261
862 Ga0466970_0049888 3300044765 Bacteria 2232
863 Ga0466957_0019839 3300044842 Bacteria 3957
864 Ga0466957_0035844 3300044842 Bacteria 2978
865 Ga0466957_0489150 3300044842 Unclassified 852
866 Ga0466957_0519122 3300044842 Unclassified 827
867 Ga0466957_1261126 3300044842 Unclassified 536
868 Ga0466960_0435484 3300044901 Unclassified 760
869 Ga0466959_0052591 3300045049 Bacteria 2982
870 Ga0466959_0324334 3300045049 Unclassified 1052
871 Ga0466958_0141356 3300045836 Unclassified 1515
872 Ga0466967_0020400 3300045976 Bacteria 5356
873 Ga0466967_0029143 3300045976 Bacteria 4616
874 Ga0466967_0037978 3300045976 Bacteria 4127
875 Ga0466967_0045428 3300045976 Bacteria 3816
876 Ga0466967_0050943 3300045976 Bacteria 3626
877 Ga0466967_0076801 3300045976 Bacteria 3005
878 Ga0466967_0099774 3300045976 Bacteria 2652
879 Ga0466967_0139429 3300045976 Bacteria 2257
880 Ga0466967_0283333 3300045976 Bacteria 1590
881 Ga0466967_0368833 3300045976 Bacteria 1392
882 Ga0466967_0519627 3300045976 Bacteria 1170
883 Ga0466967_0625859 3300045976 Bacteria 1063
884 Ga0466967_0737680 3300045976 Bacteria 976
885 Ga0466967_0796071 3300045976 Bacteria 938
886 Ga0466967_0944532 3300045976 Unclassified 858
887 Ga0466967_0947702 3300045976 Bacteria 856
888 Ga0495598_0011985 3300046537 Bacteria 2114
889 Ga0495621_0000006 3300046539 Bacteria 44306
890 Ga0495633_0091937 3300046558 Bacteria 1410
891 Ga0495669_0022152 3300046684 Bacteria 2760
892 Ga0495669_0215423 3300046684 Bacteria 920
893 Ga0495669_0243948 3300046684 Bacteria 862
894 Ga0495670_0000238 3300046691 Bacteria 25286
895 Ga0495677_0368719 3300047445 Bacteria 567
896 Ga0495602_0057394 3300048088 Bacteria 3415
897 Ga0496100_0867835 3300048903 Unclassified 708
898 Ga0496102_0520496 3300048905 Bacteria 1112
899 Ga0496102_0806018 3300048905 Bacteria 861
900 Ga0496103_0066322 3300048906 Bacteria 2253
901 Ga0496103_0067421 3300048906 Bacteria 2235
902 Ga0496105_0256588 3300048908 Bacteria 1415
903 Ga0496106_0266612 3300048909 Unclassified 1371
904 Ga0496107_0032199 3300048910 Bacteria 3746
905 Ga0496107_0168768 3300048910 Bacteria 1623
906 Ga0496108_0004323 3300048911 Bacteria 11421
907 Ga0496109_0148582 3300048912 Unclassified 2193
908 Ga0496110_0018857 3300048913 Bacteria 5795
909 Ga0496110_1124815 3300048913 Unclassified 694
910 Ga0496111_0460234 3300048914 Unclassified 938
911 Ga0496112_0016189 3300048915 Bacteria 6977
912 Ga0496112_0309916 3300048915 Bacteria 1524
913 Ga0496112_0797084 3300048915 Unclassified 870
914 Ga0496113_1339998 3300048916 Unclassified 556
915 Ga0501070_0737083 3300049586 Bacteria 777
916 Ga0501071_0668488 3300049587 Bacteria 799
917 Ga0501074_0115947 3300049590 Bacteria 1916
918 Ga0501079_1330750 3300049741 Unclassified 565
919 Ga0501080_0023202 3300049742 Bacteria 5754
920 Ga0501080_0112494 3300049742 Bacteria 2524
921 nmdc:mga0rr50_286977_c1 3300050513 Unclassified 1374
922 Ga0587084_014175 3300059477 Unclassified 1107
923 Ga0587084_017887 3300059477 Unclassified 1028
924 Ga0587084_019545 3300059477 Bacteria 999
925 Ga0587084_043786 3300059477 Bacteria 770
926 Ga0587066_023228 3300059490 Bacteria 1045
927 Ga0587066_027294 3300059490 Bacteria 992
928 Ga0587066_034196 3300059490 Bacteria 924
929 Ga0587066_139051 3300059490 Unclassified 591
930 Ga0587070_018388 3300059491 Unclassified 1145
931 Ga0587073_0029922 3300059492 Unclassified 1117
932 Ga0587073_0041186 3300059492 Bacteria 1007
933 Ga0587073_0248447 3300059492 Unclassified 557
934 Ga0587077_034230 3300059493 Bacteria 986
935 Ga0587077_045904 3300059493 Bacteria 896
936 Ga0587080_021155 3300059503 Bacteria 1068
937 Ga0587080_027021 3300059503 Bacteria 978
938 Ga0587080_034007 3300059503 Bacteria 901
939 Ga0587082_034001 3300059504 Bacteria 903
940 Ga0587082_035086 3300059504 Bacteria 894
941 Ga0587082_036180 3300059504 Unclassified 884
942 Ga0587082_139513 3300059504 Unclassified 564
943 Ga0587083_0029666 3300059505 Bacteria 1079
944 Ga0587083_0050676 3300059505 Bacteria 904
945 Ga0587083_0053251 3300059505 Bacteria 889
946 Ga0587085_006090 3300059506 Bacteria 1452
947 Ga0587085_024211 3300059506 Bacteria 950
948 Ga0587086_014946 3300059507 Bacteria 996
949 Ga0587086_020521 3300059507 Bacteria 898
950 Ga0587088_005461 3300059508 Bacteria 1673
951 Ga0587088_028967 3300059508 Bacteria 978
952 Ga0587088_033577 3300059508 Bacteria 931
953 Ga0587089_020133 3300059509 Unclassified 917
954 Ga0587089_021695 3300059509 Bacteria 893
955 Ga0587089_051640 3300059509 Unclassified 661
956 Ga0587090_015200 3300059510 Unclassified 1135
957 Ga0587090_018489 3300059510 Bacteria 1065
958 Ga0587090_030190 3300059510 Bacteria 902
959 Ga0587090_037292 3300059510 Bacteria 841
960 Ga0587091_017818 3300059511 Unclassified 1201
961 Ga0587091_024021 3300059511 Bacteria 1090
962 Ga0587091_042426 3300059511 Bacteria 903
963 Ga0587094_014432 3300059513 Unclassified 1079
964 Ga0587094_018969 3300059513 Bacteria 983
965 Ga0587095_005087 3300059514 Bacteria 984
966 Ga0587095_006724 3300059514 Bacteria 899
967 Ga0587074_03528 3300059602 Unclassified 555
968 Ga0587106_015710 3300059605 Bacteria 1061
969 Ga0587106_026336 3300059605 Bacteria 903
970 Ga0587106_110278 3300059605 Unclassified 572
971 Ga0587099_010211 3300059622 Unclassified 934
972 Ga0587101_016965 3300059623 Bacteria 1004
973 Ga0587101_019836 3300059623 Bacteria 957
974 Ga0587109_038372 3300059624 Unclassified 940
975 Ga0587113_009418 3300059625 Bacteria 885
976 Ga0587128_020109 3300059630 Bacteria 1017
977 Ga0587128_022297 3300059630 Bacteria 984
978 Ga0587128_027758 3300059630 Unclassified 917
979 Ga0587130_009408 3300059631 Bacteria 941
980 Ga0587062_022745 3300059639 Bacteria 903
981 Ga0587067_024876 3300059640 Unclassified 1061
982 Ga0587067_038826 3300059640 Bacteria 916
983 Ga0587068_031180 3300059641 Bacteria 925
984 Ga0587068_033680 3300059641 Bacteria 900
985 Ga0587069_019882 3300059642 Bacteria 997
986 Ga0587069_030174 3300059642 Bacteria 872
987 Ga0587069_124508 3300059642 Unclassified 550
988 Ga0587072_031365 3300059643 Bacteria 994
989 Ga0587072_038769 3300059643 Bacteria 918
990 Ga0587075_012011 3300059644 Bacteria 1170
991 Ga0587075_013438 3300059644 Unclassified 1126
992 Ga0587075_016342 3300059644 Bacteria 1054
993 Ga0587075_026979 3300059644 Bacteria 892
994 Ga0587075_027629 3300059644 Bacteria 885
995 Ga0587076_021445 3300059645 Bacteria 1070
996 Ga0587076_035552 3300059645 Bacteria 906
997 Ga0587076_036615 3300059645 Bacteria 898
998 Ga0587078_001873 3300059646 Bacteria 1964
999 Ga0587078_011898 3300059646 Bacteria 1016
1000 Ga0587078_012899 3300059646 Bacteria 984
1001 Ga0587079_026649 3300059647 Unclassified 1082
1002 Ga0587079_032180 3300059647 Bacteria 1014
1003 Ga0587079_063490 3300059647 Unclassified 806
1004 Ga0587079_065604 3300059647 Unclassified 797
1005 Ga0587102_007703 3300059649 Bacteria 1008
1006 Ga0587102_023221 3300059649 Bacteria 715
1007 Ga0587107_008996 3300059652 Unclassified 1168
1008 Ga0587107_017830 3300059652 Bacteria 955
1009 Ga0587107_017898 3300059652 Bacteria 953
1010 Ga0587119_011274 3300059658 Bacteria 1027
1011 Ga0587119_015410 3300059658 Bacteria 926
1012 Ga0587071_027880 3300060344 Unclassified 1072
1013 Ga0587071_028594 3300060344 Unclassified 1062
1014 Ga0587071_030866 3300060344 Bacteria 1031
1015 Ga0587071_040026 3300060344 Bacteria 936
1016 Ga0587111_0052710 3300060346 Bacteria 903
1017 Ga0587111_0088722 3300060346 Unclassified 751
1018 Ga0466962_0115600 3300061719 Unclassified 1293

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005367 Ga0070667_100086776 Ga0070667_1000867763 118
2 3300005617 Ga0068859_100904590 Ga0068859_1009045902 118
3 3300005719 Ga0068861_100430982 Ga0068861_1004309822 118
4 3300006237 Ga0097621_101019463 Ga0097621_1010194632 118
5 3300006931 Ga0097620_100904739 Ga0097620_1009047392 118
6 3300025929 Ga0207664_10251689 Ga0207664_102516893 120
7 3300031852 Ga0307410_10342574 Ga0307410_103425741 120
8 3300031901 Ga0307406_10183254 Ga0307406_101832542 120
9 3300032002 Ga0307416_101697613 Ga0307416_1016976132 120
10 3300032005 Ga0307411_10308733 Ga0307411_103087332 120
11 3300032126 Ga0307415_100808616 Ga0307415_1008086161 120
12 3300044694 Ga0466963_0308765 Ga0466963_0308765_685_1068 121
13 3300005618 Ga0068864_100180268 Ga0068864_1001802681 122
14 3300031548 Ga0307408_100021556 Ga0307408_1000215563 122
15 3300031824 Ga0307413_10487033 Ga0307413_104870332 122
16 3300031852 Ga0307410_10408551 Ga0307410_104085512 122
17 3300031901 Ga0307406_10006893 Ga0307406_100068933 122
18 3300031903 Ga0307407_10007704 Ga0307407_100077044 122
19 3300031911 Ga0307412_10050121 Ga0307412_100501213 122
20 3300031995 Ga0307409_100018684 Ga0307409_1000186845 122
21 3300032002 Ga0307416_100034296 Ga0307416_1000342964 122
22 3300032002 Ga0307416_101024117 Ga0307416_1010241172 122
23 3300032126 Ga0307415_100019849 Ga0307415_1000198493 122
24 3300045976 Ga0466967_0020400 Ga0466967_0020400_1245_1652 122
25 3300046684 Ga0495669_0215423 Ga0495669_0215423_168_572 122
26 3300037471 Ga0395905_0683408 Ga0395905_0683408_318_704 123
27 3300037471 Ga0395905_1568637 Ga0395905_1568637_128_514 123
28 3300048903 Ga0496100_0867835 Ga0496100_0867835_73_465 123
29 3300004799 Ga0058863_11670502 Ga0058863_116705021 124
30 3300005331 Ga0070670_100564450 Ga0070670_1005644502 124
31 3300005364 Ga0070673_100996216 Ga0070673_1009962162 124
32 3300005366 Ga0070659_100603853 Ga0070659_1006038532 124
33 3300005457 Ga0070662_101383194 Ga0070662_1013831941 124
34 3300005530 Ga0070679_101329082 Ga0070679_1013290821 124
35 3300005577 Ga0068857_100413628 Ga0068857_1004136282 124
36 3300025921 Ga0207652_10437556 Ga0207652_104375563 124
37 3300025933 Ga0207706_10676408 Ga0207706_106764082 124
38 3300031548 Ga0307408_101050659 Ga0307408_1010506591 124
39 3300031731 Ga0307405_10881887 Ga0307405_108818871 124
40 3300037312 Ga0395899_0191082 Ga0395899_0191082_192_578 124
41 3300037418 Ga0395900_0177213 Ga0395900_0177213_1151_1537 124
42 3300037418 Ga0395900_0591238 Ga0395900_0591238_585_980 124
43 3300037418 Ga0395900_1515835 Ga0395900_1515835_129_518 124
44 3300037471 Ga0395905_0070313 Ga0395905_0070313_2511_2897 124
45 3300044694 Ga0466963_0536849 Ga0466963_0536849_330_740 124
46 3300045976 Ga0466967_0045428 Ga0466967_0045428_1156_1545 124
47 3300045976 Ga0466967_0099774 Ga0466967_0099774_220_630 124
48 3300045976 Ga0466967_0625859 Ga0466967_0625859_508_918 124
49 3300049590 Ga0501074_0115947 Ga0501074_0115947_1462_1857 124
50 3300049741 Ga0501079_1330750 Ga0501079_1330750_98_493 124
51 3300049742 Ga0501080_0023202 Ga0501080_0023202_3881_4276 124
52 3300059510 Ga0587090_018489 Ga0587090_018489_209_595 124
53 3300059647 Ga0587079_065604 Ga0587079_065604_281_667 124
54 3300004803 Ga0058862_12414424 Ga0058862_124144241 125
55 3300005290 Ga0065712_10247602 Ga0065712_102476022 125
56 3300005327 Ga0070658_10020280 Ga0070658_100202805 125
57 3300005328 Ga0070676_10120809 Ga0070676_101208093 125
58 3300005329 Ga0070683_100268394 Ga0070683_1002683942 125
59 3300005329 Ga0070683_100749937 Ga0070683_1007499372 125
60 3300005344 Ga0070661_100008264 Ga0070661_1000082643 125
61 3300005353 Ga0070669_100614306 Ga0070669_1006143062 125
62 3300005355 Ga0070671_100012445 Ga0070671_1000124452 125
63 3300005366 Ga0070659_100011551 Ga0070659_1000115514 125
64 3300005366 Ga0070659_100013967 Ga0070659_1000139679 125
65 3300005366 Ga0070659_101117178 Ga0070659_1011171781 125
66 3300005367 Ga0070667_100011257 Ga0070667_1000112572 125
67 3300005455 Ga0070663_101033811 Ga0070663_1010338111 125
68 3300005457 Ga0070662_100103504 Ga0070662_1001035042 125
69 3300005457 Ga0070662_100168055 Ga0070662_1001680552 125
70 3300005530 Ga0070679_100398756 Ga0070679_1003987561 125
71 3300005530 Ga0070679_102074640 Ga0070679_1020746401 125
72 3300005546 Ga0070696_100815875 Ga0070696_1008158751 125
73 3300005547 Ga0070693_100068659 Ga0070693_1000686593 125
74 3300005548 Ga0070665_100100909 Ga0070665_1001009093 125
75 3300005548 Ga0070665_100119667 Ga0070665_1001196672 125
76 3300005563 Ga0068855_101023477 Ga0068855_1010234772 125
77 3300005564 Ga0070664_100002696 Ga0070664_1000026963 125
78 3300005564 Ga0070664_100862659 Ga0070664_1008626592 125
79 3300005577 Ga0068857_100018518 Ga0068857_1000185183 125
80 3300005578 Ga0068854_100411489 Ga0068854_1004114892 125
81 3300005614 Ga0068856_100023316 Ga0068856_10002331610 125
82 3300005614 Ga0068856_100334692 Ga0068856_1003346922 125
83 3300005617 Ga0068859_100048611 Ga0068859_1000486112 125
84 3300005618 Ga0068864_100007380 Ga0068864_1000073808 125
85 3300005834 Ga0068851_10167365 Ga0068851_101673652 125
86 3300005840 Ga0068870_10103315 Ga0068870_101033152 125
87 3300005841 Ga0068863_100116639 Ga0068863_1001166392 125
88 3300005843 Ga0068860_100061591 Ga0068860_1000615914 125
89 3300006237 Ga0097621_100493047 Ga0097621_1004930472 125
90 3300006358 Ga0068871_100011090 Ga0068871_1000110907 125
91 3300006358 Ga0068871_101378884 Ga0068871_1013788842 125
92 3300006931 Ga0097620_100048612 Ga0097620_1000486124 125
93 3300009551 Ga0105238_10327601 Ga0105238_103276013 125
94 3300013100 Ga0157373_10092027 Ga0157373_100920272 125
95 3300013100 Ga0157373_10102375 Ga0157373_101023753 125
96 3300013100 Ga0157373_10193781 Ga0157373_101937813 125
97 3300013102 Ga0157371_10870781 Ga0157371_108707811 125
98 3300013104 Ga0157370_10059532 Ga0157370_100595323 125
99 3300025321 Ga0207656_10461209 Ga0207656_104612092 125
100 3300025735 Ga0207713_1039137 Ga0207713_10391373 125
101 3300025907 Ga0207645_10063906 Ga0207645_100639062 125
102 3300025912 Ga0207707_10453823 Ga0207707_104538232 125
103 3300025917 Ga0207660_10034958 Ga0207660_100349584 125
104 3300025918 Ga0207662_10077107 Ga0207662_100771072 125
105 3300025920 Ga0207649_10070046 Ga0207649_100700463 125
106 3300025920 Ga0207649_10183527 Ga0207649_101835272 125
107 3300025921 Ga0207652_10825776 Ga0207652_108257761 125
108 3300025921 Ga0207652_11286989 Ga0207652_112869891 125
109 3300025924 Ga0207694_10921080 Ga0207694_109210802 125
110 3300025931 Ga0207644_10227290 Ga0207644_102272902 125
111 3300025932 Ga0207690_10050183 Ga0207690_100501833 125
112 3300025932 Ga0207690_10201848 Ga0207690_102018481 125
113 3300025932 Ga0207690_10640821 Ga0207690_106408212 125
114 3300025933 Ga0207706_10101934 Ga0207706_101019342 125
115 3300025933 Ga0207706_10158840 Ga0207706_101588402 125
116 3300025945 Ga0207679_10100327 Ga0207679_101003273 125
117 3300025945 Ga0207679_10354516 Ga0207679_103545162 125
118 3300025945 Ga0207679_10531731 Ga0207679_105317312 125
119 3300025986 Ga0207658_10018455 Ga0207658_100184558 125
120 3300026035 Ga0207703_10088896 Ga0207703_100888963 125
121 3300026067 Ga0207678_10176738 Ga0207678_101767383 125
122 3300026067 Ga0207678_10502746 Ga0207678_105027462 125
123 3300026078 Ga0207702_10015012 Ga0207702_100150128 125
124 3300026078 Ga0207702_10208008 Ga0207702_102080082 125
125 3300026088 Ga0207641_10019349 Ga0207641_100193492 125
126 3300026088 Ga0207641_11196227 Ga0207641_111962272 125
127 3300026095 Ga0207676_10008483 Ga0207676_100084839 125
128 3300026116 Ga0207674_10000527 Ga0207674_1000052743 125
129 3300028379 Ga0268266_10022882 Ga0268266_100228823 125
130 3300028379 Ga0268266_10422373 Ga0268266_104223731 125
131 3300028381 Ga0268264_10073947 Ga0268264_100739472 125
132 3300031731 Ga0307405_10457021 Ga0307405_104570212 125
133 3300031901 Ga0307406_10094729 Ga0307406_100947292 125
134 3300031911 Ga0307412_10125807 Ga0307412_101258072 125
135 3300031995 Ga0307409_101495403 Ga0307409_1014954032 125
136 3300032002 Ga0307416_100798430 Ga0307416_1007984302 125
137 3300032004 Ga0307414_12034875 Ga0307414_120348751 125
138 3300032126 Ga0307415_100027339 Ga0307415_1000273393 125
139 3300037312 Ga0395899_0006584 Ga0395899_0006584_938_1342 125
140 3300037312 Ga0395899_0289732 Ga0395899_0289732_225_617 125
141 3300037418 Ga0395900_0106528 Ga0395900_0106528_1216_1608 125
142 3300037418 Ga0395900_0355503 Ga0395900_0355503_270_662 125
143 3300037418 Ga0395900_0480745 Ga0395900_0480745_212_616 125
144 3300037418 Ga0395900_0880782 Ga0395900_0880782_347_739 125
145 3300037418 Ga0395900_1415124 Ga0395900_1415124_140_556 125
146 3300037418 Ga0395900_1551262 Ga0395900_1551262_113_508 125
147 3300037466 Ga0395898_0242749 Ga0395898_0242749_161_553 125
148 3300037466 Ga0395898_0253928 Ga0395898_0253928_1042_1434 125
149 3300037466 Ga0395898_0263788 Ga0395898_0263788_343_759 125
150 3300037471 Ga0395905_0021465 Ga0395905_0021465_1678_2073 125
151 3300037471 Ga0395905_0033987 Ga0395905_0033987_821_1225 125
152 3300037471 Ga0395905_0088340 Ga0395905_0088340_1730_2122 125
153 3300037471 Ga0395905_0179826 Ga0395905_0179826_1216_1608 125
154 3300037471 Ga0395905_0200560 Ga0395905_0200560_1245_1637 125
155 3300037471 Ga0395905_0226216 Ga0395905_0226216_384_800 125
156 3300038443 Ga0395901_0037677 Ga0395901_0037677_1216_1608 125
157 3300038443 Ga0395901_0117722 Ga0395901_0117722_555_959 125
158 3300038443 Ga0395901_0755119 Ga0395901_0755119_278_670 125
159 3300044694 Ga0466963_0002161 Ga0466963_0002161_8862_9263 125
160 3300045049 Ga0466959_0052591 Ga0466959_0052591_2528_2950 125
161 3300045976 Ga0466967_0037978 Ga0466967_0037978_981_1382 125
162 3300048905 Ga0496102_0806018 Ga0496102_0806018_264_659 125
163 3300048906 Ga0496103_0067421 Ga0496103_0067421_1531_1926 125
164 3300048908 Ga0496105_0256588 Ga0496105_0256588_602_997 125
165 3300048910 Ga0496107_0032199 Ga0496107_0032199_1888_2283 125
166 3300048911 Ga0496108_0004323 Ga0496108_0004323_310_705 125
167 3300048912 Ga0496109_0148582 Ga0496109_0148582_1174_1569 125
168 3300048913 Ga0496110_0018857 Ga0496110_0018857_530_925 125
169 3300048915 Ga0496112_0016189 Ga0496112_0016189_2691_3086 125
170 3300049586 Ga0501070_0737083 Ga0501070_0737083_12_410 125
171 3300049587 Ga0501071_0668488 Ga0501071_0668488_342_740 125
172 3300049742 Ga0501080_0112494 Ga0501080_0112494_2023_2421 125
173 3300059477 Ga0587084_019545 Ga0587084_019545_83_478 125
174 3300059490 Ga0587066_139051 Ga0587066_139051_177_569 125
175 3300059503 Ga0587080_021155 Ga0587080_021155_502_897 125
176 3300059505 Ga0587083_0029666 Ga0587083_0029666_506_901 125
177 3300059506 Ga0587085_006090 Ga0587085_006090_657_1052 125
178 3300059508 Ga0587088_033577 Ga0587088_033577_20_415 125
179 3300059511 Ga0587091_024021 Ga0587091_024021_535_930 125
180 3300059513 Ga0587094_018969 Ga0587094_018969_513_908 125
181 3300059514 Ga0587095_005087 Ga0587095_005087_502_897 125
182 3300059623 Ga0587101_019836 Ga0587101_019836_512_907 125
183 3300059630 Ga0587128_022297 Ga0587128_022297_574_969 125
184 3300059640 Ga0587067_038826 Ga0587067_038826_30_425 125
185 3300059641 Ga0587068_031180 Ga0587068_031180_512_907 125
186 3300059644 Ga0587075_012011 Ga0587075_012011_647_1042 125
187 3300059652 Ga0587107_017830 Ga0587107_017830_58_453 125
188 3300059658 Ga0587119_015410 Ga0587119_015410_10_405 125
189 3300060344 Ga0587071_030866 Ga0587071_030866_120_515 125
190 3300061719 Ga0466962_0115600 Ga0466962_0115600_746_1168 125
191 3300005327 Ga0070658_10133965 Ga0070658_101339653 126
192 3300005455 Ga0070663_100225129 Ga0070663_1002251292 126
193 3300005457 Ga0070662_100287009 Ga0070662_1002870091 126
194 3300005564 Ga0070664_100276125 Ga0070664_1002761253 126
195 3300005564 Ga0070664_100977906 Ga0070664_1009779061 126
196 3300005616 Ga0068852_102470375 Ga0068852_1024703751 126
197 3300025909 Ga0207705_10065899 Ga0207705_100658993 126
198 3300025909 Ga0207705_11141639 Ga0207705_111416391 126
199 3300025915 Ga0207693_10016003 Ga0207693_100160039 126
200 3300025933 Ga0207706_10260604 Ga0207706_102606042 126
201 3300025944 Ga0207661_10783699 Ga0207661_107836992 126
202 3300025945 Ga0207679_10032946 Ga0207679_100329462 126
203 3300025945 Ga0207679_11442595 Ga0207679_114425951 126
204 3300026067 Ga0207678_10300599 Ga0207678_103005992 126
205 3300026116 Ga0207674_10024167 Ga0207674_100241678 126
206 3300031456 Ga0307513_10390646 Ga0307513_103906463 126
207 3300031548 Ga0307408_101720449 Ga0307408_1017204491 126
208 3300031852 Ga0307410_10107788 Ga0307410_101077882 126
209 3300031852 Ga0307410_11529900 Ga0307410_115299002 126
210 3300031901 Ga0307406_11360434 Ga0307406_113604341 126
211 3300031911 Ga0307412_10129002 Ga0307412_101290022 126
212 3300031995 Ga0307409_100391047 Ga0307409_1003910473 126
213 3300032005 Ga0307411_11720663 Ga0307411_117206631 126
214 3300032126 Ga0307415_100494859 Ga0307415_1004948591 126
215 3300037418 Ga0395900_0262855 Ga0395900_0262855_234_629 126
216 3300037418 Ga0395900_0607838 Ga0395900_0607838_168_569 126
217 3300037471 Ga0395905_0017027 Ga0395905_0017027_5148_5543 126
218 3300037471 Ga0395905_0727473 Ga0395905_0727473_420_812 126
219 3300037471 Ga0395905_1438209 Ga0395905_1438209_162_563 126
220 3300038443 Ga0395901_0323654 Ga0395901_0323654_802_1203 126
221 3300044693 Ga0466961_0577514 Ga0466961_0577514_218_616 126
222 3300044694 Ga0466963_0245265 Ga0466963_0245265_393_791 126
223 3300044719 Ga0466971_0111804 Ga0466971_0111804_368_766 126
224 3300044765 Ga0466970_0049888 Ga0466970_0049888_1157_1555 126
225 3300044842 Ga0466957_0019839 Ga0466957_0019839_1226_1624 126
226 3300045049 Ga0466959_0324334 Ga0466959_0324334_174_572 126
227 3300045836 Ga0466958_0141356 Ga0466958_0141356_1069_1467 126
228 3300045976 Ga0466967_0944532 Ga0466967_0944532_320_718 126
229 3300045976 Ga0466967_0947702 Ga0466967_0947702_190_585 126
230 3300047445 Ga0495677_0368719 Ga0495677_0368719_71_463 126
231 3300002067 JGI24735J21928_10003163 JGI24735J21928_100031637 127
232 3300004799 Ga0058863_11870082 Ga0058863_118700821 127
233 3300004800 Ga0058861_11885830 Ga0058861_118858302 127
234 3300004800 Ga0058861_12010952 Ga0058861_120109521 127
235 3300005327 Ga0070658_10017337 Ga0070658_100173376 127
236 3300005327 Ga0070658_10203782 Ga0070658_102037822 127
237 3300005327 Ga0070658_10290916 Ga0070658_102909163 127
238 3300005327 Ga0070658_10682718 Ga0070658_106827182 127
239 3300005328 Ga0070676_10003695 Ga0070676_100036959 127
240 3300005328 Ga0070676_11095783 Ga0070676_110957831 127
241 3300005329 Ga0070683_100174143 Ga0070683_1001741432 127
242 3300005334 Ga0068869_101175150 Ga0068869_1011751502 127
243 3300005335 Ga0070666_10070029 Ga0070666_100700293 127
244 3300005336 Ga0070680_100214594 Ga0070680_1002145942 127
245 3300005336 Ga0070680_101013615 Ga0070680_1010136151 127
246 3300005337 Ga0070682_100043356 Ga0070682_1000433562 127
247 3300005339 Ga0070660_100003141 Ga0070660_1000031417 127
248 3300005339 Ga0070660_100240795 Ga0070660_1002407952 127
249 3300005339 Ga0070660_100470796 Ga0070660_1004707962 127
250 3300005341 Ga0070691_10035664 Ga0070691_100356643 127
251 3300005343 Ga0070687_100212620 Ga0070687_1002126202 127
252 3300005344 Ga0070661_100001960 Ga0070661_1000019605 127
253 3300005344 Ga0070661_100036793 Ga0070661_1000367933 127
254 3300005344 Ga0070661_100182595 Ga0070661_1001825952 127
255 3300005347 Ga0070668_100001719 Ga0070668_1000017199 127
256 3300005353 Ga0070669_100021055 Ga0070669_1000210554 127
257 3300005355 Ga0070671_100121365 Ga0070671_1001213653 127
258 3300005356 Ga0070674_100036573 Ga0070674_1000365733 127
259 3300005364 Ga0070673_100178351 Ga0070673_1001783512 127
260 3300005366 Ga0070659_100040228 Ga0070659_1000402282 127
261 3300005366 Ga0070659_100041644 Ga0070659_1000416444 127
262 3300005366 Ga0070659_100089596 Ga0070659_1000895962 127
263 3300005366 Ga0070659_100257942 Ga0070659_1002579422 127
264 3300005366 Ga0070659_101099487 Ga0070659_1010994871 127
265 3300005367 Ga0070667_100024205 Ga0070667_1000242054 127
266 3300005367 Ga0070667_100228041 Ga0070667_1002280412 127
267 3300005367 Ga0070667_100263961 Ga0070667_1002639612 127
268 3300005367 Ga0070667_100383781 Ga0070667_1003837812 127
269 3300005367 Ga0070667_100385592 Ga0070667_1003855922 127
270 3300005455 Ga0070663_100126737 Ga0070663_1001267372 127
271 3300005455 Ga0070663_100161020 Ga0070663_1001610203 127
272 3300005456 Ga0070678_100098389 Ga0070678_1000983892 127
273 3300005457 Ga0070662_100034343 Ga0070662_1000343433 127
274 3300005458 Ga0070681_10013516 Ga0070681_100135166 127
275 3300005458 Ga0070681_10152303 Ga0070681_101523033 127
276 3300005458 Ga0070681_10257261 Ga0070681_102572613 127
277 3300005459 Ga0068867_100004677 Ga0068867_1000046778 127
278 3300005459 Ga0068867_100278207 Ga0068867_1002782072 127
279 3300005459 Ga0068867_100520616 Ga0068867_1005206162 127
280 3300005530 Ga0070679_100128950 Ga0070679_1001289502 127
281 3300005530 Ga0070679_100181220 Ga0070679_1001812203 127
282 3300005530 Ga0070679_100526550 Ga0070679_1005265502 127
283 3300005535 Ga0070684_100094566 Ga0070684_1000945662 127
284 3300005547 Ga0070693_100012856 Ga0070693_1000128562 127
285 3300005547 Ga0070693_100015026 Ga0070693_1000150265 127
286 3300005548 Ga0070665_100453511 Ga0070665_1004535113 127
287 3300005563 Ga0068855_100295644 Ga0068855_1002956442 127
288 3300005563 Ga0068855_100558573 Ga0068855_1005585732 127
289 3300005564 Ga0070664_100006881 Ga0070664_1000068813 127
290 3300005564 Ga0070664_100578245 Ga0070664_1005782452 127
291 3300005564 Ga0070664_100681133 Ga0070664_1006811331 127
292 3300005564 Ga0070664_100962590 Ga0070664_1009625902 127
293 3300005577 Ga0068857_100208346 Ga0068857_1002083463 127
294 3300005577 Ga0068857_100354085 Ga0068857_1003540852 127
295 3300005577 Ga0068857_100773393 Ga0068857_1007733932 127
296 3300005578 Ga0068854_100083818 Ga0068854_1000838183 127
297 3300005614 Ga0068856_100061342 Ga0068856_1000613423 127
298 3300005615 Ga0070702_100377282 Ga0070702_1003772821 127
299 3300005616 Ga0068852_100023726 Ga0068852_1000237267 127
300 3300005616 Ga0068852_100087984 Ga0068852_1000879843 127
301 3300005617 Ga0068859_100054434 Ga0068859_1000544345 127
302 3300005617 Ga0068859_100379073 Ga0068859_1003790732 127
303 3300005719 Ga0068861_100169755 Ga0068861_1001697552 127
304 3300005719 Ga0068861_100329298 Ga0068861_1003292981 127
305 3300005719 Ga0068861_100485890 Ga0068861_1004858902 127
306 3300005834 Ga0068851_10032858 Ga0068851_100328583 127
307 3300005834 Ga0068851_10047700 Ga0068851_100477002 127
308 3300005841 Ga0068863_100034901 Ga0068863_1000349014 127
309 3300005841 Ga0068863_100770831 Ga0068863_1007708311 127
310 3300005842 Ga0068858_100007141 Ga0068858_1000071419 127
311 3300005843 Ga0068860_100006803 Ga0068860_10000680310 127
312 3300005843 Ga0068860_100245076 Ga0068860_1002450762 127
313 3300005844 Ga0068862_100253229 Ga0068862_1002532292 127
314 3300006237 Ga0097621_101092693 Ga0097621_1010926931 127
315 3300006881 Ga0068865_100034925 Ga0068865_1000349254 127
316 3300006931 Ga0097620_100054439 Ga0097620_1000544395 127
317 3300006931 Ga0097620_100379074 Ga0097620_1003790742 127
318 3300009174 Ga0105241_10130207 Ga0105241_101302073 127
319 3300009174 Ga0105241_10157917 Ga0105241_101579171 127
320 3300009174 Ga0105241_10702355 Ga0105241_107023552 127
321 3300009177 Ga0105248_11767199 Ga0105248_117671992 127
322 3300009177 Ga0105248_12304511 Ga0105248_123045111 127
323 3300009545 Ga0105237_10006758 Ga0105237_1000675810 127
324 3300009551 Ga0105238_10111637 Ga0105238_101116374 127
325 3300009553 Ga0105249_10320235 Ga0105249_103202352 127
326 3300009553 Ga0105249_10935063 Ga0105249_109350632 127
327 3300010375 Ga0105239_10054356 Ga0105239_100543564 127
328 3300011119 Ga0105246_10278750 Ga0105246_102787502 127
329 3300013100 Ga0157373_10031339 Ga0157373_100313394 127
330 3300013100 Ga0157373_10059487 Ga0157373_100594874 127
331 3300013100 Ga0157373_10092672 Ga0157373_100926723 127
332 3300013100 Ga0157373_10272822 Ga0157373_102728222 127
333 3300013102 Ga0157371_10025025 Ga0157371_100250254 127
334 3300013102 Ga0157371_10128560 Ga0157371_101285602 127
335 3300013104 Ga0157370_10741220 Ga0157370_107412203 127
336 3300013104 Ga0157370_10929875 Ga0157370_109298751 127
337 3300013105 Ga0157369_10259977 Ga0157369_102599772 127
338 3300013105 Ga0157369_10922308 Ga0157369_109223083 127
339 3300013307 Ga0157372_10011784 Ga0157372_1001178410 127
340 3300013307 Ga0157372_11666553 Ga0157372_116665531 127
341 3300014968 Ga0157379_11204648 Ga0157379_112046482 127
342 3300020069 Ga0197907_10034936 Ga0197907_100349362 127
343 3300020070 Ga0206356_10307274 Ga0206356_103072742 127
344 3300020070 Ga0206356_11311979 Ga0206356_113119793 127
345 3300020078 Ga0206352_10699940 Ga0206352_106999401 127
346 3300022467 Ga0224712_10171006 Ga0224712_101710062 127
347 3300022467 Ga0224712_10205286 Ga0224712_102052861 127
348 3300025315 Ga0207697_10028059 Ga0207697_100280593 127
349 3300025321 Ga0207656_10003880 Ga0207656_100038807 127
350 3300025321 Ga0207656_10042249 Ga0207656_100422492 127
351 3300025899 Ga0207642_10364144 Ga0207642_103641442 127
352 3300025904 Ga0207647_10000832 Ga0207647_1000083218 127
353 3300025904 Ga0207647_10464687 Ga0207647_104646872 127
354 3300025907 Ga0207645_10004831 Ga0207645_100048314 127
355 3300025907 Ga0207645_10008901 Ga0207645_100089013 127
356 3300025907 Ga0207645_10112926 Ga0207645_101129262 127
357 3300025908 Ga0207643_10054699 Ga0207643_100546993 127
358 3300025909 Ga0207705_10038951 Ga0207705_100389512 127
359 3300025909 Ga0207705_10060833 Ga0207705_100608332 127
360 3300025909 Ga0207705_10186859 Ga0207705_101868592 127
361 3300025911 Ga0207654_10106813 Ga0207654_101068132 127
362 3300025912 Ga0207707_10008907 Ga0207707_100089073 127
363 3300025912 Ga0207707_10495635 Ga0207707_104956352 127
364 3300025914 Ga0207671_10017531 Ga0207671_100175318 127
365 3300025917 Ga0207660_10665417 Ga0207660_106654172 127
366 3300025917 Ga0207660_10682176 Ga0207660_106821762 127
367 3300025918 Ga0207662_10030474 Ga0207662_100304745 127
368 3300025919 Ga0207657_10038093 Ga0207657_100380933 127
369 3300025919 Ga0207657_10050216 Ga0207657_100502161 127
370 3300025919 Ga0207657_10167001 Ga0207657_101670012 127
371 3300025920 Ga0207649_10002740 Ga0207649_100027404 127
372 3300025920 Ga0207649_10038842 Ga0207649_100388424 127
373 3300025921 Ga0207652_10298249 Ga0207652_102982493 127
374 3300025921 Ga0207652_10338914 Ga0207652_103389142 127
375 3300025921 Ga0207652_10487035 Ga0207652_104870352 127
376 3300025923 Ga0207681_10047787 Ga0207681_100477873 127
377 3300025923 Ga0207681_10277952 Ga0207681_102779521 127
378 3300025924 Ga0207694_10000776 Ga0207694_1000077623 127
379 3300025932 Ga0207690_10002565 Ga0207690_100025655 127
380 3300025932 Ga0207690_10219429 Ga0207690_102194293 127
381 3300025932 Ga0207690_10369349 Ga0207690_103693492 127
382 3300025933 Ga0207706_10038293 Ga0207706_100382937 127
383 3300025933 Ga0207706_10055308 Ga0207706_100553082 127
384 3300025933 Ga0207706_10963687 Ga0207706_109636872 127
385 3300025935 Ga0207709_10681923 Ga0207709_106819232 127
386 3300025938 Ga0207704_10060374 Ga0207704_100603742 127
387 3300025938 Ga0207704_11083528 Ga0207704_110835282 127
388 3300025940 Ga0207691_10144668 Ga0207691_101446681 127
389 3300025941 Ga0207711_10226883 Ga0207711_102268833 127
390 3300025941 Ga0207711_11023149 Ga0207711_110231492 127
391 3300025942 Ga0207689_10025109 Ga0207689_100251092 127
392 3300025942 Ga0207689_10037964 Ga0207689_100379647 127
393 3300025942 Ga0207689_10426773 Ga0207689_104267732 127
394 3300025944 Ga0207661_11073666 Ga0207661_110736662 127
395 3300025945 Ga0207679_10088718 Ga0207679_100887182 127
396 3300025945 Ga0207679_10118558 Ga0207679_101185583 127
397 3300025945 Ga0207679_10134912 Ga0207679_101349122 127
398 3300025949 Ga0207667_10132858 Ga0207667_101328584 127
399 3300025960 Ga0207651_10116028 Ga0207651_101160282 127
400 3300025960 Ga0207651_10538401 Ga0207651_105384011 127
401 3300025960 Ga0207651_12017645 Ga0207651_120176451 127
402 3300025961 Ga0207712_10079041 Ga0207712_100790413 127
403 3300025972 Ga0207668_10002157 Ga0207668_1000215712 127
404 3300025981 Ga0207640_10007503 Ga0207640_100075037 127
405 3300025981 Ga0207640_10034294 Ga0207640_100342943 127
406 3300025981 Ga0207640_11504686 Ga0207640_115046861 127
407 3300025986 Ga0207658_10036587 Ga0207658_100365874 127
408 3300025986 Ga0207658_10078804 Ga0207658_100788044 127
409 3300025986 Ga0207658_10080766 Ga0207658_100807662 127
410 3300025986 Ga0207658_10094610 Ga0207658_100946102 127
411 3300026035 Ga0207703_10135939 Ga0207703_101359393 127
412 3300026041 Ga0207639_10770962 Ga0207639_107709623 127
413 3300026067 Ga0207678_10010859 Ga0207678_100108598 127
414 3300026067 Ga0207678_10138368 Ga0207678_101383682 127
415 3300026075 Ga0207708_10327175 Ga0207708_103271751 127
416 3300026078 Ga0207702_10095158 Ga0207702_100951585 127
417 3300026088 Ga0207641_10033916 Ga0207641_100339164 127
418 3300026088 Ga0207641_10433036 Ga0207641_104330362 127
419 3300026089 Ga0207648_10002318 Ga0207648_1000231822 127
420 3300026089 Ga0207648_10116265 Ga0207648_101162653 127
421 3300026095 Ga0207676_10002072 Ga0207676_100020729 127
422 3300026116 Ga0207674_10002277 Ga0207674_1000227711 127
423 3300026116 Ga0207674_10030316 Ga0207674_100303164 127
424 3300026116 Ga0207674_10036857 Ga0207674_100368571 127
425 3300026116 Ga0207674_10111820 Ga0207674_101118202 127
426 3300026118 Ga0207675_100165697 Ga0207675_1001656971 127
427 3300026118 Ga0207675_100678760 Ga0207675_1006787602 127
428 3300026121 Ga0207683_10014943 Ga0207683_1001494310 127
429 3300026121 Ga0207683_10625691 Ga0207683_106256912 127
430 3300026142 Ga0207698_10046260 Ga0207698_100462606 127
431 3300026142 Ga0207698_10280976 Ga0207698_102809763 127
432 3300026142 Ga0207698_10361244 Ga0207698_103612443 127
433 3300028380 Ga0268265_10003245 Ga0268265_100032457 127
434 3300028380 Ga0268265_10199537 Ga0268265_101995373 127
435 3300028380 Ga0268265_11013896 Ga0268265_110138961 127
436 3300028381 Ga0268264_10002543 Ga0268264_100025439 127
437 3300028381 Ga0268264_10035529 Ga0268264_100355295 127
438 3300032002 Ga0307416_101170537 Ga0307416_1011705372 127
439 3300032005 Ga0307411_10208232 Ga0307411_102082322 127
440 3300037418 Ga0395900_0254630 Ga0395900_0254630_1071_1469 127
441 3300037471 Ga0395905_0552801 Ga0395905_0552801_197_604 127
442 3300037471 Ga0395905_0645510 Ga0395905_0645510_315_713 127
443 3300038443 Ga0395901_1876385 Ga0395901_1876385_17_415 127
444 3300042439 Ga0439464_0000674 Ga0439464_0000674_740_1135 127
445 3300044683 Ga0466965_0306418 Ga0466965_0306418_242_640 127
446 3300044694 Ga0466963_0002953 Ga0466963_0002953_225_623 127
447 3300044694 Ga0466963_0078078 Ga0466963_0078078_618_1019 127
448 3300044694 Ga0466963_0438438 Ga0466963_0438438_145_552 127
449 3300044842 Ga0466957_0519122 Ga0466957_0519122_205_606 127
450 3300045976 Ga0466967_0050943 Ga0466967_0050943_1523_1921 127
451 3300045976 Ga0466967_0139429 Ga0466967_0139429_525_923 127
452 3300045976 Ga0466967_0283333 Ga0466967_0283333_434_835 127
453 3300045976 Ga0466967_0796071 Ga0466967_0796071_453_860 127
454 3300046537 Ga0495598_0011985 Ga0495598_0011985_816_1214 127
455 3300046539 Ga0495621_0000006 Ga0495621_0000006_34474_34872 127
456 3300046558 Ga0495633_0091937 Ga0495633_0091937_238_636 127
457 3300046684 Ga0495669_0022152 Ga0495669_0022152_436_834 127
458 3300046691 Ga0495670_0000238 Ga0495670_0000238_3806_4204 127
459 3300048905 Ga0496102_0520496 Ga0496102_0520496_322_720 127
460 3300048913 Ga0496110_1124815 Ga0496110_1124815_131_529 127
461 3300048914 Ga0496111_0460234 Ga0496111_0460234_21_419 127
462 3300048915 Ga0496112_0309916 Ga0496112_0309916_966_1364 127
463 3300048916 Ga0496113_1339998 Ga0496113_1339998_117_515 127
464 3300059477 Ga0587084_014175 Ga0587084_014175_489_887 127
465 3300059490 Ga0587066_023228 Ga0587066_023228_81_479 127
466 3300059490 Ga0587066_034196 Ga0587066_034196_510_908 127
467 3300059491 Ga0587070_018388 Ga0587070_018388_259_657 127
468 3300059492 Ga0587073_0248447 Ga0587073_0248447_21_416 127
469 3300059493 Ga0587077_034230 Ga0587077_034230_487_885 127
470 3300059503 Ga0587080_034007 Ga0587080_034007_488_886 127
471 3300059504 Ga0587082_034001 Ga0587082_034001_16_414 127
472 3300059505 Ga0587083_0050676 Ga0587083_0050676_17_415 127
473 3300059506 Ga0587085_024211 Ga0587085_024211_63_461 127
474 3300059507 Ga0587086_014946 Ga0587086_014946_487_885 127
475 3300059508 Ga0587088_028967 Ga0587088_028967_490_888 127
476 3300059509 Ga0587089_020133 Ga0587089_020133_32_430 127
477 3300059509 Ga0587089_021695 Ga0587089_021695_308_883 127
478 3300059510 Ga0587090_030190 Ga0587090_030190_16_414 127
479 3300059511 Ga0587091_042426 Ga0587091_042426_16_414 127
480 3300059513 Ga0587094_014432 Ga0587094_014432_490_888 127
481 3300059514 Ga0587095_006724 Ga0587095_006724_16_414 127
482 3300059605 Ga0587106_026336 Ga0587106_026336_16_414 127
483 3300059605 Ga0587106_110278 Ga0587106_110278_20_415 127
484 3300059622 Ga0587099_010211 Ga0587099_010211_509_907 127
485 3300059623 Ga0587101_016965 Ga0587101_016965_117_515 127
486 3300059624 Ga0587109_038372 Ga0587109_038372_463_861 127
487 3300059625 Ga0587113_009418 Ga0587113_009418_476_874 127
488 3300059630 Ga0587128_020109 Ga0587128_020109_489_887 127
489 3300059631 Ga0587130_009408 Ga0587130_009408_62_460 127
490 3300059639 Ga0587062_022745 Ga0587062_022745_16_414 127
491 3300059641 Ga0587068_033680 Ga0587068_033680_487_885 127
492 3300059642 Ga0587069_019882 Ga0587069_019882_490_888 127
493 3300059643 Ga0587072_031365 Ga0587072_031365_485_883 127
494 3300059644 Ga0587075_013438 Ga0587075_013438_489_887 127
495 3300059644 Ga0587075_016342 Ga0587075_016342_124_522 127
496 3300059645 Ga0587076_036615 Ga0587076_036615_12_410 127
497 3300059646 Ga0587078_001873 Ga0587078_001873_265_663 127
498 3300059646 Ga0587078_012899 Ga0587078_012899_485_883 127
499 3300059647 Ga0587079_026649 Ga0587079_026649_489_887 127
500 3300059649 Ga0587102_023221 Ga0587102_023221_112_510 127
501 3300059652 Ga0587107_008996 Ga0587107_008996_285_683 127
502 3300059658 Ga0587119_011274 Ga0587119_011274_490_888 127
503 3300060344 Ga0587071_027880 Ga0587071_027880_185_583 127
504 3300060346 Ga0587111_0052710 Ga0587111_0052710_16_414 127
505 3300001990 JGI24737J22298_10001371 JGI24737J22298_100013719 128
506 3300002067 JGI24735J21928_10139576 JGI24735J21928_101395762 128
507 3300002075 JGI24738J21930_10001979 JGI24738J21930_100019797 128
508 3300005327 Ga0070658_10000477 Ga0070658_1000047717 128
509 3300005329 Ga0070683_100000747 Ga0070683_10000074719 128
510 3300005329 Ga0070683_100480230 Ga0070683_1004802302 128
511 3300005329 Ga0070683_100988990 Ga0070683_1009889902 128
512 3300005330 Ga0070690_100062783 Ga0070690_1000627832 128
513 3300005331 Ga0070670_100498666 Ga0070670_1004986661 128
514 3300005335 Ga0070666_10002947 Ga0070666_100029475 128
515 3300005336 Ga0070680_100147453 Ga0070680_1001474531 128
516 3300005337 Ga0070682_100072790 Ga0070682_1000727903 128
517 3300005337 Ga0070682_101568571 Ga0070682_1015685711 128
518 3300005339 Ga0070660_100000425 Ga0070660_10000042518 128
519 3300005339 Ga0070660_100474837 Ga0070660_1004748372 128
520 3300005339 Ga0070660_101219972 Ga0070660_1012199722 128
521 3300005344 Ga0070661_100000552 Ga0070661_10000055215 128
522 3300005344 Ga0070661_100044834 Ga0070661_1000448345 128
523 3300005345 Ga0070692_10119051 Ga0070692_101190511 128
524 3300005355 Ga0070671_100054845 Ga0070671_1000548452 128
525 3300005366 Ga0070659_100000065 Ga0070659_10000006524 128
526 3300005366 Ga0070659_100140975 Ga0070659_1001409753 128
527 3300005367 Ga0070667_100020823 Ga0070667_1000208237 128
528 3300005367 Ga0070667_100032912 Ga0070667_1000329122 128
529 3300005435 Ga0070714_100089684 Ga0070714_1000896841 128
530 3300005435 Ga0070714_100956649 Ga0070714_1009566492 128
531 3300005436 Ga0070713_102240953 Ga0070713_1022409531 128
532 3300005455 Ga0070663_100001839 Ga0070663_10000183910 128
533 3300005457 Ga0070662_100000010 Ga0070662_10000001067 128
534 3300005530 Ga0070679_100014856 Ga0070679_1000148568 128
535 3300005530 Ga0070679_100946217 Ga0070679_1009462172 128
536 3300005535 Ga0070684_100029987 Ga0070684_1000299877 128
537 3300005535 Ga0070684_100541159 Ga0070684_1005411592 128
538 3300005535 Ga0070684_102071085 Ga0070684_1020710851 128
539 3300005539 Ga0068853_100000067 Ga0068853_10000006736 128
540 3300005539 Ga0068853_100011651 Ga0068853_10001165111 128
541 3300005539 Ga0068853_100030531 Ga0068853_1000305316 128
542 3300005544 Ga0070686_100805827 Ga0070686_1008058272 128
543 3300005546 Ga0070696_100089379 Ga0070696_1000893791 128
544 3300005547 Ga0070693_100000343 Ga0070693_1000003439 128
545 3300005548 Ga0070665_100013969 Ga0070665_1000139699 128
546 3300005563 Ga0068855_100017249 Ga0068855_1000172497 128
547 3300005563 Ga0068855_100018104 Ga0068855_1000181043 128
548 3300005563 Ga0068855_100109434 Ga0068855_1001094345 128
549 3300005563 Ga0068855_100751142 Ga0068855_1007511422 128
550 3300005564 Ga0070664_100000228 Ga0070664_10000022835 128
551 3300005577 Ga0068857_100561577 Ga0068857_1005615772 128
552 3300005577 Ga0068857_102154810 Ga0068857_1021548101 128
553 3300005578 Ga0068854_100025191 Ga0068854_1000251913 128
554 3300005614 Ga0068856_100000101 Ga0068856_10000010170 128
555 3300005614 Ga0068856_100079964 Ga0068856_1000799643 128
556 3300005614 Ga0068856_100153835 Ga0068856_1001538352 128
557 3300005616 Ga0068852_100000846 Ga0068852_1000008468 128
558 3300005616 Ga0068852_100001433 Ga0068852_10000143310 128
559 3300005616 Ga0068852_100003781 Ga0068852_1000037817 128
560 3300005616 Ga0068852_100094713 Ga0068852_1000947132 128
561 3300005616 Ga0068852_100437703 Ga0068852_1004377031 128
562 3300005618 Ga0068864_100089427 Ga0068864_1000894272 128
563 3300005834 Ga0068851_10051292 Ga0068851_100512922 128
564 3300005841 Ga0068863_100360451 Ga0068863_1003604512 128
565 3300005843 Ga0068860_100073377 Ga0068860_1000733773 128
566 3300006237 Ga0097621_100051529 Ga0097621_1000515294 128
567 3300009174 Ga0105241_10032907 Ga0105241_100329075 128
568 3300009177 Ga0105248_10054729 Ga0105248_100547297 128
569 3300009551 Ga0105238_10004367 Ga0105238_100043678 128
570 3300009551 Ga0105238_10051275 Ga0105238_100512754 128
571 3300009551 Ga0105238_12295790 Ga0105238_122957901 128
572 3300013100 Ga0157373_10009790 Ga0157373_100097909 128
573 3300013100 Ga0157373_10301096 Ga0157373_103010962 128
574 3300013102 Ga0157371_10003821 Ga0157371_100038216 128
575 3300013102 Ga0157371_10075155 Ga0157371_100751554 128
576 3300013102 Ga0157371_10092512 Ga0157371_100925122 128
577 3300013105 Ga0157369_10003181 Ga0157369_1000318114 128
578 3300013105 Ga0157369_10032210 Ga0157369_100322104 128
579 3300013105 Ga0157369_10202481 Ga0157369_102024812 128
580 3300013105 Ga0157369_10733218 Ga0157369_107332182 128
581 3300013296 Ga0157374_10480692 Ga0157374_104806922 128
582 3300013307 Ga0157372_10359554 Ga0157372_103595543 128
583 3300013307 Ga0157372_12909297 Ga0157372_129092971 128
584 3300014325 Ga0163163_10019125 Ga0163163_100191258 128
585 3300014968 Ga0157379_10165064 Ga0157379_101650643 128
586 3300014968 Ga0157379_10182441 Ga0157379_101824413 128
587 3300020069 Ga0197907_11002332 Ga0197907_110023322 128
588 3300020070 Ga0206356_11292785 Ga0206356_112927852 128
589 3300020070 Ga0206356_11638823 Ga0206356_116388232 128
590 3300020081 Ga0206354_10948750 Ga0206354_109487501 128
591 3300020082 Ga0206353_10732796 Ga0206353_107327962 128
592 3300025904 Ga0207647_10008390 Ga0207647_100083908 128
593 3300025904 Ga0207647_10064373 Ga0207647_100643732 128
594 3300025904 Ga0207647_10079630 Ga0207647_100796301 128
595 3300025909 Ga0207705_10000113 Ga0207705_1000011314 128
596 3300025909 Ga0207705_10059966 Ga0207705_100599664 128
597 3300025909 Ga0207705_10065521 Ga0207705_100655214 128
598 3300025909 Ga0207705_10077431 Ga0207705_100774313 128
599 3300025911 Ga0207654_10178036 Ga0207654_101780362 128
600 3300025917 Ga0207660_11701896 Ga0207660_117018961 128
601 3300025919 Ga0207657_10000026 Ga0207657_1000002670 128
602 3300025919 Ga0207657_10093297 Ga0207657_100932973 128
603 3300025920 Ga0207649_10000516 Ga0207649_1000051619 128
604 3300025920 Ga0207649_10085352 Ga0207649_100853523 128
605 3300025921 Ga0207652_10220094 Ga0207652_102200941 128
606 3300025924 Ga0207694_10005699 Ga0207694_100056996 128
607 3300025924 Ga0207694_10185516 Ga0207694_101855163 128
608 3300025924 Ga0207694_11500997 Ga0207694_115009972 128
609 3300025929 Ga0207664_10146782 Ga0207664_101467822 128
610 3300025929 Ga0207664_10374847 Ga0207664_103748471 128
611 3300025929 Ga0207664_10801546 Ga0207664_108015462 128
612 3300025931 Ga0207644_10033934 Ga0207644_100339344 128
613 3300025931 Ga0207644_10209882 Ga0207644_102098822 128
614 3300025932 Ga0207690_10000649 Ga0207690_1000064915 128
615 3300025932 Ga0207690_10413049 Ga0207690_104130492 128
616 3300025932 Ga0207690_10429139 Ga0207690_104291392 128
617 3300025933 Ga0207706_10000031 Ga0207706_1000003165 128
618 3300025933 Ga0207706_10216949 Ga0207706_102169493 128
619 3300025941 Ga0207711_10000446 Ga0207711_1000044639 128
620 3300025941 Ga0207711_10007845 Ga0207711_100078459 128
621 3300025941 Ga0207711_10287123 Ga0207711_102871232 128
622 3300025944 Ga0207661_10013965 Ga0207661_100139654 128
623 3300025944 Ga0207661_10031712 Ga0207661_100317125 128
624 3300025945 Ga0207679_10000236 Ga0207679_1000023618 128
625 3300025949 Ga0207667_10001718 Ga0207667_1000171826 128
626 3300025949 Ga0207667_10081840 Ga0207667_100818402 128
627 3300025949 Ga0207667_10720816 Ga0207667_107208162 128
628 3300025949 Ga0207667_11750098 Ga0207667_117500981 128
629 3300025981 Ga0207640_10114939 Ga0207640_101149392 128
630 3300025986 Ga0207658_10027437 Ga0207658_100274372 128
631 3300025986 Ga0207658_10072042 Ga0207658_100720423 128
632 3300026035 Ga0207703_10065655 Ga0207703_100656553 128
633 3300026041 Ga0207639_10005817 Ga0207639_100058179 128
634 3300026041 Ga0207639_10070955 Ga0207639_100709552 128
635 3300026041 Ga0207639_10095747 Ga0207639_100957473 128
636 3300026067 Ga0207678_10012250 Ga0207678_100122508 128
637 3300026067 Ga0207678_10209384 Ga0207678_102093842 128
638 3300026078 Ga0207702_10010631 Ga0207702_100106312 128
639 3300026078 Ga0207702_10067734 Ga0207702_100677343 128
640 3300026078 Ga0207702_10164850 Ga0207702_101648502 128
641 3300026078 Ga0207702_10600741 Ga0207702_106007412 128
642 3300026088 Ga0207641_10337044 Ga0207641_103370442 128
643 3300026095 Ga0207676_10031676 Ga0207676_100316764 128
644 3300026116 Ga0207674_10539760 Ga0207674_105397602 128
645 3300026118 Ga0207675_100578154 Ga0207675_1005781542 128
646 3300026142 Ga0207698_10000618 Ga0207698_100006183 128
647 3300026142 Ga0207698_10001533 Ga0207698_100015332 128
648 3300026142 Ga0207698_10007701 Ga0207698_100077016 128
649 3300026142 Ga0207698_10009367 Ga0207698_100093673 128
650 3300026142 Ga0207698_10379957 Ga0207698_103799573 128
651 3300028379 Ga0268266_10005677 Ga0268266_100056778 128
652 3300028381 Ga0268264_10573422 Ga0268264_105734222 128
653 3300031731 Ga0307405_10586539 Ga0307405_105865391 128
654 3300031824 Ga0307413_10267439 Ga0307413_102674393 128
655 3300031852 Ga0307410_10135140 Ga0307410_101351403 128
656 3300031901 Ga0307406_10304271 Ga0307406_103042712 128
657 3300031903 Ga0307407_10520960 Ga0307407_105209602 128
658 3300031995 Ga0307409_100415965 Ga0307409_1004159652 128
659 3300032002 Ga0307416_100186537 Ga0307416_1001865373 128
660 3300032126 Ga0307415_100022433 Ga0307415_1000224332 128
661 3300034816 Ga0373930_0092002 Ga0373930_0092002_28_429 128
662 3300034957 Ga0373938_0099370 Ga0373938_0099370_111_512 128
663 3300035090 Ga0373949_0066931 Ga0373949_0066931_117_518 128
664 3300035091 Ga0373951_0066124 Ga0373951_0066124_268_669 128
665 3300035241 Ga0373961_0010280 Ga0373961_0010280_1541_1942 128
666 3300035242 Ga0373962_0085039 Ga0373962_0085039_359_760 128
667 3300037312 Ga0395899_0030400 Ga0395899_0030400_1921_2325 128
668 3300037312 Ga0395899_0038361 Ga0395899_0038361_1269_1673 128
669 3300037312 Ga0395899_0098825 Ga0395899_0098825_27_431 128
670 3300037312 Ga0395899_0105236 Ga0395899_0105236_1608_2012 128
671 3300037312 Ga0395899_0893212 Ga0395899_0893212_122_526 128
672 3300037418 Ga0395900_0107348 Ga0395900_0107348_1847_2251 128
673 3300037418 Ga0395900_0176876 Ga0395900_0176876_175_579 128
674 3300037418 Ga0395900_0245885 Ga0395900_0245885_83_487 128
675 3300037418 Ga0395900_0442792 Ga0395900_0442792_669_1073 128
676 3300037418 Ga0395900_0582697 Ga0395900_0582697_501_905 128
677 3300037466 Ga0395898_0018087 Ga0395898_0018087_3815_4219 128
678 3300037466 Ga0395898_0197787 Ga0395898_0197787_165_569 128
679 3300037471 Ga0395905_0008699 Ga0395905_0008699_2543_2947 128
680 3300037471 Ga0395905_0141907 Ga0395905_0141907_624_1028 128
681 3300037471 Ga0395905_0306016 Ga0395905_0306016_574_978 128
682 3300037471 Ga0395905_0560942 Ga0395905_0560942_372_776 128
683 3300037471 Ga0395905_1114477 Ga0395905_1114477_271_675 128
684 3300037471 Ga0395905_1553021 Ga0395905_1553021_145_549 128
685 3300038443 Ga0395901_0000268 Ga0395901_0000268_42980_43384 128
686 3300038443 Ga0395901_0109048 Ga0395901_0109048_2232_2636 128
687 3300038443 Ga0395901_0157477 Ga0395901_0157477_346_750 128
688 3300038443 Ga0395901_0201949 Ga0395901_0201949_364_768 128
689 3300038443 Ga0395901_0211352 Ga0395901_0211352_397_801 128
690 3300038443 Ga0395901_0590479 Ga0395901_0590479_354_758 128
691 3300044694 Ga0466963_0144024 Ga0466963_0144024_1222_1629 128
692 3300044694 Ga0466963_0180407 Ga0466963_0180407_57_461 128
693 3300044706 Ga0466964_0871166 Ga0466964_0871166_39_443 128
694 3300044842 Ga0466957_0035844 Ga0466957_0035844_191_595 128
695 3300044842 Ga0466957_0489150 Ga0466957_0489150_335_742 128
696 3300044842 Ga0466957_1261126 Ga0466957_1261126_82_486 128
697 3300044901 Ga0466960_0435484 Ga0466960_0435484_275_718 128
698 3300045976 Ga0466967_0076801 Ga0466967_0076801_749_1153 128
699 3300045976 Ga0466967_0368833 Ga0466967_0368833_626_1033 128
700 3300045976 Ga0466967_0519627 Ga0466967_0519627_445_846 128
701 3300045976 Ga0466967_0737680 Ga0466967_0737680_312_716 128
702 3300046684 Ga0495669_0243948 Ga0495669_0243948_204_605 128
703 3300048909 Ga0496106_0266612 Ga0496106_0266612_839_1243 128
704 3300048910 Ga0496107_0168768 Ga0496107_0168768_1022_1426 128
705 3300059477 Ga0587084_017887 Ga0587084_017887_461_865 128
706 3300059477 Ga0587084_043786 Ga0587084_043786_23_427 128
707 3300059490 Ga0587066_027294 Ga0587066_027294_572_976 128
708 3300059492 Ga0587073_0029922 Ga0587073_0029922_526_930 128
709 3300059492 Ga0587073_0041186 Ga0587073_0041186_490_894 128
710 3300059493 Ga0587077_045904 Ga0587077_045904_470_874 128
711 3300059503 Ga0587080_027021 Ga0587080_027021_154_558 128
712 3300059504 Ga0587082_035086 Ga0587082_035086_20_424 128
713 3300059504 Ga0587082_036180 Ga0587082_036180_464_868 128
714 3300059505 Ga0587083_0053251 Ga0587083_0053251_469_873 128
715 3300059507 Ga0587086_020521 Ga0587086_020521_475_879 128
716 3300059508 Ga0587088_005461 Ga0587088_005461_519_923 128
717 3300059509 Ga0587089_051640 Ga0587089_051640_12_416 128
718 3300059510 Ga0587090_015200 Ga0587090_015200_472_876 128
719 3300059510 Ga0587090_037292 Ga0587090_037292_320_724 128
720 3300059511 Ga0587091_017818 Ga0587091_017818_472_876 128
721 3300059602 Ga0587074_03528 Ga0587074_03528_123_527 128
722 3300059605 Ga0587106_015710 Ga0587106_015710_187_591 128
723 3300059630 Ga0587128_027758 Ga0587128_027758_43_447 128
724 3300059640 Ga0587067_024876 Ga0587067_024876_189_593 128
725 3300059642 Ga0587069_030174 Ga0587069_030174_347_751 128
726 3300059643 Ga0587072_038769 Ga0587072_038769_484_888 128
727 3300059644 Ga0587075_026979 Ga0587075_026979_469_873 128
728 3300059644 Ga0587075_027629 Ga0587075_027629_469_873 128
729 3300059645 Ga0587076_021445 Ga0587076_021445_43_447 128
730 3300059645 Ga0587076_035552 Ga0587076_035552_16_420 128
731 3300059646 Ga0587078_011898 Ga0587078_011898_142_546 128
732 3300059647 Ga0587079_032180 Ga0587079_032180_469_873 128
733 3300059649 Ga0587102_007703 Ga0587102_007703_472_876 128
734 3300059652 Ga0587107_017898 Ga0587107_017898_60_464 128
735 3300060344 Ga0587071_028594 Ga0587071_028594_472_876 128
736 3300060344 Ga0587071_040026 Ga0587071_040026_62_466 128
737 3300001990 JGI24737J22298_10010090 JGI24737J22298_100100903 129
738 3300001990 JGI24737J22298_10115525 JGI24737J22298_101155252 129
739 3300001991 JGI24743J22301_10013607 JGI24743J22301_100136072 129
740 3300001991 JGI24743J22301_10083134 JGI24743J22301_100831342 129
741 3300002067 JGI24735J21928_10004503 JGI24735J21928_100045031 129
742 3300002067 JGI24735J21928_10133570 JGI24735J21928_101335701 129
743 3300002067 JGI24735J21928_10140301 JGI24735J21928_101403012 129
744 3300002077 JGI24744J21845_10008807 JGI24744J21845_100088073 129
745 3300005293 Ga0065715_10524477 Ga0065715_105244772 129
746 3300005327 Ga0070658_10046871 Ga0070658_100468711 129
747 3300005327 Ga0070658_10060437 Ga0070658_100604372 129
748 3300005327 Ga0070658_10527296 Ga0070658_105272962 129
749 3300005328 Ga0070676_10068888 Ga0070676_100688883 129
750 3300005329 Ga0070683_100005454 Ga0070683_10000545411 129
751 3300005329 Ga0070683_100010424 Ga0070683_1000104245 129
752 3300005331 Ga0070670_100379339 Ga0070670_1003793392 129
753 3300005331 Ga0070670_100980266 Ga0070670_1009802662 129
754 3300005334 Ga0068869_100095563 Ga0068869_1000955633 129
755 3300005335 Ga0070666_10135878 Ga0070666_101358782 129
756 3300005336 Ga0070680_100739970 Ga0070680_1007399702 129
757 3300005337 Ga0070682_100001753 Ga0070682_10000175313 129
758 3300005338 Ga0068868_100044049 Ga0068868_1000440493 129
759 3300005338 Ga0068868_100463282 Ga0068868_1004632822 129
760 3300005338 Ga0068868_100537440 Ga0068868_1005374402 129
761 3300005338 Ga0068868_101062679 Ga0068868_1010626792 129
762 3300005339 Ga0070660_100303797 Ga0070660_1003037972 129
763 3300005339 Ga0070660_101008537 Ga0070660_1010085372 129
764 3300005344 Ga0070661_100002092 Ga0070661_1000020924 129
765 3300005344 Ga0070661_100133827 Ga0070661_1001338273 129
766 3300005344 Ga0070661_101227442 Ga0070661_1012274421 129
767 3300005344 Ga0070661_101458345 Ga0070661_1014583451 129
768 3300005345 Ga0070692_10034895 Ga0070692_100348953 129
769 3300005353 Ga0070669_100666619 Ga0070669_1006666192 129
770 3300005354 Ga0070675_100301932 Ga0070675_1003019322 129
771 3300005355 Ga0070671_100033760 Ga0070671_1000337603 129
772 3300005355 Ga0070671_100126515 Ga0070671_1001265152 129
773 3300005356 Ga0070674_100057775 Ga0070674_1000577753 129
774 3300005364 Ga0070673_100001556 Ga0070673_10000155613 129
775 3300005364 Ga0070673_100133524 Ga0070673_1001335243 129
776 3300005364 Ga0070673_100543444 Ga0070673_1005434442 129
777 3300005366 Ga0070659_100068005 Ga0070659_1000680052 129
778 3300005366 Ga0070659_101982550 Ga0070659_1019825501 129
779 3300005434 Ga0070709_10770043 Ga0070709_107700431 129
780 3300005436 Ga0070713_100347612 Ga0070713_1003476122 129
781 3300005455 Ga0070663_100000647 Ga0070663_1000006479 129
782 3300005455 Ga0070663_100027782 Ga0070663_1000277823 129
783 3300005455 Ga0070663_100242476 Ga0070663_1002424763 129
784 3300005455 Ga0070663_100905861 Ga0070663_1009058611 129
785 3300005455 Ga0070663_101141897 Ga0070663_1011418972 129
786 3300005456 Ga0070678_100724892 Ga0070678_1007248922 129
787 3300005457 Ga0070662_100180546 Ga0070662_1001805461 129
788 3300005457 Ga0070662_100211513 Ga0070662_1002115132 129
789 3300005457 Ga0070662_100543773 Ga0070662_1005437732 129
790 3300005459 Ga0068867_100301265 Ga0068867_1003012652 129
791 3300005459 Ga0068867_101441810 Ga0068867_1014418101 129
792 3300005530 Ga0070679_101519181 Ga0070679_1015191811 129
793 3300005535 Ga0070684_100121740 Ga0070684_1001217403 129
794 3300005539 Ga0068853_100178754 Ga0068853_1001787542 129
795 3300005539 Ga0068853_100195932 Ga0068853_1001959322 129
796 3300005539 Ga0068853_100409380 Ga0068853_1004093802 129
797 3300005543 Ga0070672_100048432 Ga0070672_1000484326 129
798 3300005543 Ga0070672_100095965 Ga0070672_1000959653 129
799 3300005546 Ga0070696_100619486 Ga0070696_1006194862 129
800 3300005547 Ga0070693_100034700 Ga0070693_1000347003 129
801 3300005547 Ga0070693_100076941 Ga0070693_1000769413 129
802 3300005548 Ga0070665_100516987 Ga0070665_1005169872 129
803 3300005563 Ga0068855_100066116 Ga0068855_1000661164 129
804 3300005563 Ga0068855_100079415 Ga0068855_1000794154 129
805 3300005564 Ga0070664_100009565 Ga0070664_1000095653 129
806 3300005564 Ga0070664_100059968 Ga0070664_1000599683 129
807 3300005564 Ga0070664_100088394 Ga0070664_1000883944 129
808 3300005564 Ga0070664_100529306 Ga0070664_1005293062 129
809 3300005564 Ga0070664_102183787 Ga0070664_1021837871 129
810 3300005577 Ga0068857_100026322 Ga0068857_1000263225 129
811 3300005577 Ga0068857_100380990 Ga0068857_1003809901 129
812 3300005578 Ga0068854_100001913 Ga0068854_1000019133 129
813 3300005578 Ga0068854_100011321 Ga0068854_1000113213 129
814 3300005614 Ga0068856_100391785 Ga0068856_1003917852 129
815 3300005616 Ga0068852_100093334 Ga0068852_1000933344 129
816 3300006237 Ga0097621_100357207 Ga0097621_1003572072 129
817 3300006358 Ga0068871_100623150 Ga0068871_1006231502 129
818 3300006358 Ga0068871_100662228 Ga0068871_1006622282 129
819 3300009176 Ga0105242_10185671 Ga0105242_101856712 129
820 3300009177 Ga0105248_10228619 Ga0105248_102286192 129
821 3300009177 Ga0105248_10463115 Ga0105248_104631152 129
822 3300009177 Ga0105248_10829284 Ga0105248_108292842 129
823 3300013100 Ga0157373_10090355 Ga0157373_100903552 129
824 3300013100 Ga0157373_10463145 Ga0157373_104631452 129
825 3300013102 Ga0157371_10026453 Ga0157371_100264533 129
826 3300013102 Ga0157371_10939038 Ga0157371_109390381 129
827 3300013102 Ga0157371_11244993 Ga0157371_112449931 129
828 3300013296 Ga0157374_10303006 Ga0157374_103030063 129
829 3300013296 Ga0157374_10519081 Ga0157374_105190813 129
830 3300013297 Ga0157378_10007074 Ga0157378_100070745 129
831 3300013297 Ga0157378_10344935 Ga0157378_103449353 129
832 3300013306 Ga0163162_10032625 Ga0163162_100326255 129
833 3300013307 Ga0157372_10045014 Ga0157372_100450145 129
834 3300013307 Ga0157372_10046828 Ga0157372_100468285 129
835 3300013308 Ga0157375_10007221 Ga0157375_100072219 129
836 3300013308 Ga0157375_10271200 Ga0157375_102712002 129
837 3300014969 Ga0157376_10684688 Ga0157376_106846882 129
838 3300025315 Ga0207697_10022280 Ga0207697_100222803 129
839 3300025315 Ga0207697_10112020 Ga0207697_101120202 129
840 3300025893 Ga0207682_10035101 Ga0207682_100351011 129
841 3300025901 Ga0207688_10126968 Ga0207688_101269682 129
842 3300025903 Ga0207680_10517167 Ga0207680_105171672 129
843 3300025904 Ga0207647_10061274 Ga0207647_100612743 129
844 3300025908 Ga0207643_10173377 Ga0207643_101733772 129
845 3300025908 Ga0207643_10254530 Ga0207643_102545302 129
846 3300025909 Ga0207705_10010345 Ga0207705_100103456 129
847 3300025909 Ga0207705_10261160 Ga0207705_102611602 129
848 3300025917 Ga0207660_10007589 Ga0207660_100075894 129
849 3300025917 Ga0207660_10440534 Ga0207660_104405341 129
850 3300025917 Ga0207660_10535163 Ga0207660_105351632 129
851 3300025918 Ga0207662_10170760 Ga0207662_101707602 129
852 3300025919 Ga0207657_10002103 Ga0207657_1000210317 129
853 3300025919 Ga0207657_10005900 Ga0207657_100059004 129
854 3300025919 Ga0207657_10281976 Ga0207657_102819761 129
855 3300025919 Ga0207657_10862110 Ga0207657_108621102 129
856 3300025920 Ga0207649_10032422 Ga0207649_100324222 129
857 3300025921 Ga0207652_10026485 Ga0207652_100264855 129
858 3300025921 Ga0207652_10095828 Ga0207652_100958284 129
859 3300025925 Ga0207650_10142089 Ga0207650_101420893 129
860 3300025926 Ga0207659_10835872 Ga0207659_108358722 129
861 3300025927 Ga0207687_10062974 Ga0207687_100629743 129
862 3300025929 Ga0207664_10161196 Ga0207664_101611963 129
863 3300025931 Ga0207644_10022380 Ga0207644_100223804 129
864 3300025932 Ga0207690_10002369 Ga0207690_100023699 129
865 3300025932 Ga0207690_10012713 Ga0207690_100127133 129
866 3300025932 Ga0207690_10238263 Ga0207690_102382632 129
867 3300025932 Ga0207690_11098335 Ga0207690_110983352 129
868 3300025933 Ga0207706_10002893 Ga0207706_1000289313 129
869 3300025933 Ga0207706_10008630 Ga0207706_100086304 129
870 3300025933 Ga0207706_10024282 Ga0207706_100242822 129
871 3300025933 Ga0207706_10081488 Ga0207706_100814882 129
872 3300025934 Ga0207686_10362636 Ga0207686_103626361 129
873 3300025937 Ga0207669_10108579 Ga0207669_101085792 129
874 3300025938 Ga0207704_11009349 Ga0207704_110093491 129
875 3300025940 Ga0207691_10061499 Ga0207691_100614992 129
876 3300025940 Ga0207691_10134809 Ga0207691_101348093 129
877 3300025941 Ga0207711_10117724 Ga0207711_101177244 129
878 3300025941 Ga0207711_10733378 Ga0207711_107333782 129
879 3300025942 Ga0207689_10066588 Ga0207689_100665883 129
880 3300025944 Ga0207661_10030599 Ga0207661_100305994 129
881 3300025944 Ga0207661_10235922 Ga0207661_102359222 129
882 3300025945 Ga0207679_10008515 Ga0207679_100085153 129
883 3300025945 Ga0207679_10201523 Ga0207679_102015232 129
884 3300025945 Ga0207679_12014802 Ga0207679_120148021 129
885 3300025960 Ga0207651_10432706 Ga0207651_104327062 129
886 3300025960 Ga0207651_11127555 Ga0207651_111275552 129
887 3300025960 Ga0207651_11547410 Ga0207651_115474102 129
888 3300025981 Ga0207640_10010090 Ga0207640_100100903 129
889 3300025981 Ga0207640_10107025 Ga0207640_101070252 129
890 3300025981 Ga0207640_10128956 Ga0207640_101289562 129
891 3300026023 Ga0207677_10102695 Ga0207677_101026953 129
892 3300026023 Ga0207677_10765304 Ga0207677_107653042 129
893 3300026023 Ga0207677_10815524 Ga0207677_108155242 129
894 3300026041 Ga0207639_10108892 Ga0207639_101088922 129
895 3300026041 Ga0207639_10385639 Ga0207639_103856391 129
896 3300026067 Ga0207678_10002668 Ga0207678_1000266814 129
897 3300026067 Ga0207678_10010119 Ga0207678_100101194 129
898 3300026067 Ga0207678_10023738 Ga0207678_100237382 129
899 3300026067 Ga0207678_10586127 Ga0207678_105861272 129
900 3300026089 Ga0207648_10006581 Ga0207648_1000658110 129
901 3300026095 Ga0207676_10389840 Ga0207676_103898402 129
902 3300026116 Ga0207674_10011531 Ga0207674_100115319 129
903 3300026116 Ga0207674_10049289 Ga0207674_100492891 129
904 3300026116 Ga0207674_10205136 Ga0207674_102051363 129
905 3300026118 Ga0207675_100242894 Ga0207675_1002428942 129
906 3300026142 Ga0207698_10397596 Ga0207698_103975962 129
907 3300035111 Ga0373923_0002141 Ga0373923_0002141_1841_2251 129
908 3300035172 Ga0373955_0006945 Ga0373955_0006945_3067_3477 129
909 3300035724 Ga0373933_0003124 Ga0373933_0003124_5807_6217 129
910 3300036401 Ga0373937_0000641 Ga0373937_0000641_12257_12667 129
911 3300037471 Ga0395905_0000092 Ga0395905_0000092_99873_100277 129
912 3300038443 Ga0395901_0229427 Ga0395901_0229427_556_960 129
913 3300041511 Ga0451855_1685400 Ga0451855_1685400_136_543 129
914 3300045976 Ga0466967_0029143 Ga0466967_0029143_1618_2028 129
915 3300048088 Ga0495602_0057394 Ga0495602_0057394_1758_2168 129
916 3300048906 Ga0496103_0066322 Ga0496103_0066322_581_1006 129
917 3300048915 Ga0496112_0797084 Ga0496112_0797084_293_718 129
918 3300059504 Ga0587082_139513 Ga0587082_139513_139_546 129
919 3300059642 Ga0587069_124508 Ga0587069_124508_125_532 129
920 3300059647 Ga0587079_063490 Ga0587079_063490_267_674 129
921 3300060346 Ga0587111_0088722 Ga0587111_0088722_151_558 129
922 3300001979 JGI24740J21852_10017128 JGI24740J21852_100171283 131
923 3300001989 JGI24739J22299_10005147 JGI24739J22299_100051477 131
924 3300001990 JGI24737J22298_10001739 JGI24737J22298_100017394 131
925 3300001991 JGI24743J22301_10061766 JGI24743J22301_100617662 131
926 3300002075 JGI24738J21930_10000372 JGI24738J21930_100003723 131
927 3300005328 Ga0070676_10001347 Ga0070676_100013473 131
928 3300005330 Ga0070690_100020500 Ga0070690_1000205005 131
929 3300005331 Ga0070670_100039466 Ga0070670_1000394663 131
930 3300005333 Ga0070677_10041571 Ga0070677_100415713 131
931 3300005334 Ga0068869_100006276 Ga0068869_1000062768 131
932 3300005335 Ga0070666_10052734 Ga0070666_100527342 131
933 3300005338 Ga0068868_100196288 Ga0068868_1001962882 131
934 3300005340 Ga0070689_100004740 Ga0070689_1000047403 131
935 3300005343 Ga0070687_100391664 Ga0070687_1003916642 131
936 3300005344 Ga0070661_100584815 Ga0070661_1005848152 131
937 3300005347 Ga0070668_100022957 Ga0070668_1000229575 131
938 3300005355 Ga0070671_100034275 Ga0070671_1000342753 131
939 3300005364 Ga0070673_100001046 Ga0070673_1000010464 131
940 3300005366 Ga0070659_100016237 Ga0070659_1000162373 131
941 3300005367 Ga0070667_100008194 Ga0070667_1000081949 131
942 3300005455 Ga0070663_100131939 Ga0070663_1001319392 131
943 3300005456 Ga0070678_100074997 Ga0070678_1000749973 131
944 3300005457 Ga0070662_100000323 Ga0070662_1000003235 131
945 3300005459 Ga0068867_100013102 Ga0068867_1000131024 131
946 3300005466 Ga0070685_10239772 Ga0070685_102397722 131
947 3300005539 Ga0068853_100025346 Ga0068853_1000253468 131
948 3300005543 Ga0070672_100023632 Ga0070672_1000236323 131
949 3300005564 Ga0070664_100071624 Ga0070664_1000716244 131
950 3300005577 Ga0068857_100005960 Ga0068857_1000059608 131
951 3300005578 Ga0068854_100006418 Ga0068854_1000064183 131
952 3300005614 Ga0068856_100689227 Ga0068856_1006892272 131
953 3300005616 Ga0068852_100013090 Ga0068852_1000130904 131
954 3300005617 Ga0068859_100092224 Ga0068859_1000922243 131
955 3300005618 Ga0068864_100000222 Ga0068864_10000022242 131
956 3300005834 Ga0068851_10154026 Ga0068851_101540263 131
957 3300005841 Ga0068863_100002567 Ga0068863_1000025674 131
958 3300005842 Ga0068858_100003320 Ga0068858_1000033203 131
959 3300005844 Ga0068862_100091796 Ga0068862_1000917963 131
960 3300006237 Ga0097621_100561732 Ga0097621_1005617321 131
961 3300006358 Ga0068871_100379801 Ga0068871_1003798012 131
962 3300006881 Ga0068865_100006056 Ga0068865_1000060569 131
963 3300006931 Ga0097620_100092228 Ga0097620_1000922284 131
964 3300007076 Ga0075435_100734814 Ga0075435_1007348142 131
965 3300009093 Ga0105240_10087961 Ga0105240_100879617 131
966 3300009098 Ga0105245_10006125 Ga0105245_100061259 131
967 3300009174 Ga0105241_10342051 Ga0105241_103420512 131
968 3300009177 Ga0105248_10001119 Ga0105248_1000111928 131
969 3300009551 Ga0105238_10063618 Ga0105238_100636182 131
970 3300010375 Ga0105239_10261369 Ga0105239_102613692 131
971 3300011119 Ga0105246_10008301 Ga0105246_100083014 131
972 3300013297 Ga0157378_10006532 Ga0157378_100065329 131
973 3300013306 Ga0163162_10438663 Ga0163162_104386632 131
974 3300013307 Ga0157372_10035809 Ga0157372_100358098 131
975 3300013308 Ga0157375_10024264 Ga0157375_100242644 131
976 3300014745 Ga0157377_10204425 Ga0157377_102044252 131
977 3300017792 Ga0163161_10485228 Ga0163161_104852282 131
978 3300025290 Ga0207673_1020061 Ga0207673_10200611 131
979 3300025315 Ga0207697_10000158 Ga0207697_1000015831 131
980 3300025321 Ga0207656_10061879 Ga0207656_100618792 131
981 3300025901 Ga0207688_10007071 Ga0207688_100070713 131
982 3300025904 Ga0207647_10004000 Ga0207647_100040007 131
983 3300025907 Ga0207645_10003931 Ga0207645_1000393112 131
984 3300025913 Ga0207695_10622836 Ga0207695_106228361 131
985 3300025919 Ga0207657_10007800 Ga0207657_100078004 131
986 3300025920 Ga0207649_10517552 Ga0207649_105175522 131
987 3300025923 Ga0207681_10056834 Ga0207681_100568343 131
988 3300025924 Ga0207694_10334497 Ga0207694_103344973 131
989 3300025925 Ga0207650_10028115 Ga0207650_100281151 131
990 3300025927 Ga0207687_10048079 Ga0207687_100480793 131
991 3300025931 Ga0207644_10033303 Ga0207644_100333033 131
992 3300025932 Ga0207690_10017432 Ga0207690_100174327 131
993 3300025933 Ga0207706_10000829 Ga0207706_1000082920 131
994 3300025936 Ga0207670_10044294 Ga0207670_100442942 131
995 3300025937 Ga0207669_10828103 Ga0207669_108281031 131
996 3300025940 Ga0207691_10003632 Ga0207691_100036324 131
997 3300025941 Ga0207711_10002065 Ga0207711_1000206518 131
998 3300025942 Ga0207689_10000017 Ga0207689_1000001760 131
999 3300025945 Ga0207679_10175160 Ga0207679_101751602 131
1000 3300025960 Ga0207651_10029701 Ga0207651_100297011 131
1001 3300025972 Ga0207668_10073156 Ga0207668_100731563 131
1002 3300025981 Ga0207640_10032101 Ga0207640_100321013 131
1003 3300025986 Ga0207658_10017651 Ga0207658_100176517 131
1004 3300026023 Ga0207677_10298705 Ga0207677_102987051 131
1005 3300026035 Ga0207703_10025106 Ga0207703_100251068 131
1006 3300026041 Ga0207639_10205373 Ga0207639_102053732 131
1007 3300026067 Ga0207678_10154857 Ga0207678_101548572 131
1008 3300026075 Ga0207708_10326846 Ga0207708_103268462 131
1009 3300026078 Ga0207702_10839137 Ga0207702_108391372 131
1010 3300026088 Ga0207641_10011385 Ga0207641_100113853 131
1011 3300026089 Ga0207648_10003142 Ga0207648_100031425 131
1012 3300026095 Ga0207676_10009522 Ga0207676_100095224 131
1013 3300026116 Ga0207674_10003088 Ga0207674_100030888 131
1014 3300026118 Ga0207675_100296014 Ga0207675_1002960142 131
1015 3300026142 Ga0207698_10727625 Ga0207698_107276252 131
1016 3300028380 Ga0268265_10059407 Ga0268265_100594071 131
1017 3300028381 Ga0268264_10157795 Ga0268264_101577953 131
1018 3300050513 nmdc:mga0rr50_286977_c1 nmdc:mga0rr50_286977_c1_814_1209 131

Structural Annotation

Top 5 Hits

ID Description Score Start End
8adc-assembly1.cif.gz_B viral tegument-like dubs 0.7687 34 61
8adc-assembly2.cif.gz_A viral tegument-like dubs 0.7541 34 62
8adb-assembly1.cif.gz_A viral tegument-like dubs 0.7535 34 67
4u3q-assembly1.cif.gz_B crystal structure of recombinant tp0435 from treponema pallidum 0.6771 34 101
6c9n-assembly1.cif.gz_A mycobacterium tuberculosis adenosine kinase bound to sangivamycin 0.6679 44 73
ID Description Score Start End Superfamily
af_A4HYS3_91_210_3.10.330.10 Alpha Beta;Roll;Vcp-like ATPase; Chain A, domain 2; 0.7542 92 116 3.10.330.10
af_O45110_151_229_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.6776 41 65 2.30.30.30
af_A0A2R8QJQ6_302_523_3.90.70.120 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A; 0.6615 34 65 3.90.70.120
af_A0A0R0ELK1_770_819_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.6557 35 67 2.30.30.60
af_Q2FWM2_2_319_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.6554 44 73 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A7T2GKA4-F1-model_v4 Uncharacterized protein 0.8998 30 111
AF-A0A519Q9Y9-F1-model_v4 DUF3313 domain-containing protein 0.8746 21 112
AF-A0A7H0G918-F1-model_v4 deleted 0.8704 66 130
AF-A0A158S7G9-F1-model_v4 Uncharacterized protein 0.8638 25 116
AF-A0A1H7XGQ5-F1-model_v4 Tetratricopeptide repeat-containing protein 0.8287 38 87

Feature Viewer

pLDDT pTM Quality
83.41 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map