F488335
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1018 | 273 | 1018 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300059509|Ga0587089_021695|Ga0587089_021695_308_883 |
| Length | 155 |
| Sequence | VPPVEAAGGEASRSHSDRKGLGIMKSFLVRASVGAAVAGLLPVAAVAQPWTPGSEVVGQPIQVTTNGVTNTVYLDPGGQLRILTPGGSTIPGTWTAANGQLCLAAGGPQECVPYAAPFQAGAPVTVTSSCGASESWLAQSTNAPXXXAAKSERGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 170 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 171 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 173 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 174 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 175 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 176 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 180 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 181 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 182 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 183 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 184 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 190 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 191 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 193 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 194 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 195 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 196 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 197 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 198 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 199 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 200 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 201 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 202 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 203 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 204 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 205 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 206 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 207 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 208 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 209 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 210 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 219 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 220 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 221 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 222 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 223 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 226 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 227 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 228 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 229 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300059602 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 15R_AD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89 |
| Metatranscriptomes | 11 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.77 |
| Rhizosphere | 98.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10017128 | 3300001979 | Bacteria | 2598 |
| 2 | JGI24739J22299_10005147 | 3300001989 | Bacteria | 4980 |
| 3 | JGI24737J22298_10001371 | 3300001990 | Bacteria | 8641 |
| 4 | JGI24737J22298_10001739 | 3300001990 | Bacteria | 7775 |
| 5 | JGI24737J22298_10010090 | 3300001990 | Bacteria | 3128 |
| 6 | JGI24737J22298_10115525 | 3300001990 | Unclassified | 793 |
| 7 | JGI24743J22301_10013607 | 3300001991 | Bacteria | 1492 |
| 8 | JGI24743J22301_10061766 | 3300001991 | Bacteria | 773 |
| 9 | JGI24743J22301_10083134 | 3300001991 | Bacteria | 677 |
| 10 | JGI24735J21928_10003163 | 3300002067 | Bacteria | 5635 |
| 11 | JGI24735J21928_10004503 | 3300002067 | Bacteria | 4686 |
| 12 | JGI24735J21928_10133570 | 3300002067 | Unclassified | 716 |
| 13 | JGI24735J21928_10139576 | 3300002067 | Unclassified | 699 |
| 14 | JGI24735J21928_10140301 | 3300002067 | Unclassified | 697 |
| 15 | JGI24738J21930_10000372 | 3300002075 | Bacteria | 12499 |
| 16 | JGI24738J21930_10001979 | 3300002075 | Bacteria | 5510 |
| 17 | JGI24744J21845_10008807 | 3300002077 | Bacteria | 2074 |
| 18 | Ga0058863_11670502 | 3300004799 | Bacteria | 655 |
| 19 | Ga0058863_11870082 | 3300004799 | Unclassified | 797 |
| 20 | Ga0058861_11885830 | 3300004800 | Unclassified | 705 |
| 21 | Ga0058861_12010952 | 3300004800 | Bacteria | 588 |
| 22 | Ga0058862_12414424 | 3300004803 | Unclassified | 531 |
| 23 | Ga0065712_10247602 | 3300005290 | Bacteria | 939 |
| 24 | Ga0065715_10524477 | 3300005293 | Bacteria | 761 |
| 25 | Ga0070658_10000477 | 3300005327 | Bacteria | 34731 |
| 26 | Ga0070658_10017337 | 3300005327 | Bacteria | 5763 |
| 27 | Ga0070658_10020280 | 3300005327 | Bacteria | 5326 |
| 28 | Ga0070658_10046871 | 3300005327 | Bacteria | 3497 |
| 29 | Ga0070658_10060437 | 3300005327 | Bacteria | 3086 |
| 30 | Ga0070658_10133965 | 3300005327 | Bacteria | 2066 |
| 31 | Ga0070658_10203782 | 3300005327 | Bacteria | 1670 |
| 32 | Ga0070658_10290916 | 3300005327 | Bacteria | 1392 |
| 33 | Ga0070658_10527296 | 3300005327 | Unclassified | 1021 |
| 34 | Ga0070658_10682718 | 3300005327 | Unclassified | 891 |
| 35 | Ga0070676_10001347 | 3300005328 | Bacteria | 12342 |
| 36 | Ga0070676_10003695 | 3300005328 | Bacteria | 8018 |
| 37 | Ga0070676_10068888 | 3300005328 | Bacteria | 2119 |
| 38 | Ga0070676_10120809 | 3300005328 | Bacteria | 1644 |
| 39 | Ga0070676_11095783 | 3300005328 | Bacteria | 601 |
| 40 | Ga0070683_100000747 | 3300005329 | Bacteria | 23810 |
| 41 | Ga0070683_100005454 | 3300005329 | Bacteria | 10628 |
| 42 | Ga0070683_100010424 | 3300005329 | Bacteria | 7992 |
| 43 | Ga0070683_100174143 | 3300005329 | Bacteria | 2043 |
| 44 | Ga0070683_100268394 | 3300005329 | Bacteria | 1623 |
| 45 | Ga0070683_100480230 | 3300005329 | Bacteria | 1187 |
| 46 | Ga0070683_100749937 | 3300005329 | Bacteria | 935 |
| 47 | Ga0070683_100988990 | 3300005329 | Bacteria | 807 |
| 48 | Ga0070690_100020500 | 3300005330 | Bacteria | 4028 |
| 49 | Ga0070690_100062783 | 3300005330 | Bacteria | 2396 |
| 50 | Ga0070670_100039466 | 3300005331 | Bacteria | 4060 |
| 51 | Ga0070670_100379339 | 3300005331 | Bacteria | 1245 |
| 52 | Ga0070670_100498666 | 3300005331 | Unclassified | 1082 |
| 53 | Ga0070670_100564450 | 3300005331 | Bacteria | 1016 |
| 54 | Ga0070670_100980266 | 3300005331 | Bacteria | 768 |
| 55 | Ga0070677_10041571 | 3300005333 | Bacteria | 1816 |
| 56 | Ga0068869_100006276 | 3300005334 | Bacteria | 7526 |
| 57 | Ga0068869_100095563 | 3300005334 | Bacteria | 2242 |
| 58 | Ga0068869_101175150 | 3300005334 | Unclassified | 673 |
| 59 | Ga0070666_10002947 | 3300005335 | Bacteria | 10304 |
| 60 | Ga0070666_10052734 | 3300005335 | Bacteria | 2742 |
| 61 | Ga0070666_10070029 | 3300005335 | Bacteria | 2386 |
| 62 | Ga0070666_10135878 | 3300005335 | Bacteria | 1711 |
| 63 | Ga0070680_100147453 | 3300005336 | Bacteria | 1974 |
| 64 | Ga0070680_100214594 | 3300005336 | Bacteria | 1624 |
| 65 | Ga0070680_100739970 | 3300005336 | Bacteria | 846 |
| 66 | Ga0070680_101013615 | 3300005336 | Bacteria | 717 |
| 67 | Ga0070682_100001753 | 3300005337 | Bacteria | 12079 |
| 68 | Ga0070682_100043356 | 3300005337 | Bacteria | 2781 |
| 69 | Ga0070682_100072790 | 3300005337 | Bacteria | 2203 |
| 70 | Ga0070682_101568571 | 3300005337 | Bacteria | 568 |
| 71 | Ga0068868_100044049 | 3300005338 | Bacteria | 3488 |
| 72 | Ga0068868_100196288 | 3300005338 | Unclassified | 1680 |
| 73 | Ga0068868_100463282 | 3300005338 | Unclassified | 1104 |
| 74 | Ga0068868_100537440 | 3300005338 | Bacteria | 1028 |
| 75 | Ga0068868_101062679 | 3300005338 | Unclassified | 743 |
| 76 | Ga0070660_100000425 | 3300005339 | Bacteria | 27941 |
| 77 | Ga0070660_100003141 | 3300005339 | Bacteria | 11350 |
| 78 | Ga0070660_100240795 | 3300005339 | Bacteria | 1474 |
| 79 | Ga0070660_100303797 | 3300005339 | Bacteria | 1308 |
| 80 | Ga0070660_100470796 | 3300005339 | Bacteria | 1043 |
| 81 | Ga0070660_100474837 | 3300005339 | Bacteria | 1039 |
| 82 | Ga0070660_101008537 | 3300005339 | Unclassified | 703 |
| 83 | Ga0070660_101219972 | 3300005339 | Unclassified | 638 |
| 84 | Ga0070689_100004740 | 3300005340 | Bacteria | 9229 |
| 85 | Ga0070691_10035664 | 3300005341 | Bacteria | 2342 |
| 86 | Ga0070687_100212620 | 3300005343 | Unclassified | 1179 |
| 87 | Ga0070687_100391664 | 3300005343 | Bacteria | 908 |
| 88 | Ga0070661_100000552 | 3300005344 | Bacteria | 28745 |
| 89 | Ga0070661_100001960 | 3300005344 | Bacteria | 14220 |
| 90 | Ga0070661_100002092 | 3300005344 | Bacteria | 13736 |
| 91 | Ga0070661_100008264 | 3300005344 | Bacteria | 7185 |
| 92 | Ga0070661_100036793 | 3300005344 | Bacteria | 3557 |
| 93 | Ga0070661_100044834 | 3300005344 | Bacteria | 3232 |
| 94 | Ga0070661_100133827 | 3300005344 | Bacteria | 1864 |
| 95 | Ga0070661_100182595 | 3300005344 | Bacteria | 1597 |
| 96 | Ga0070661_100584815 | 3300005344 | Bacteria | 901 |
| 97 | Ga0070661_101227442 | 3300005344 | Bacteria | 627 |
| 98 | Ga0070661_101458345 | 3300005344 | Unclassified | 576 |
| 99 | Ga0070692_10034895 | 3300005345 | Bacteria | 2544 |
| 100 | Ga0070692_10119051 | 3300005345 | Bacteria | 1470 |
| 101 | Ga0070668_100001719 | 3300005347 | Bacteria | 15902 |
| 102 | Ga0070668_100022957 | 3300005347 | Bacteria | 4717 |
| 103 | Ga0070669_100021055 | 3300005353 | Bacteria | 4659 |
| 104 | Ga0070669_100614306 | 3300005353 | Bacteria | 912 |
| 105 | Ga0070669_100666619 | 3300005353 | Bacteria | 876 |
| 106 | Ga0070675_100301932 | 3300005354 | Bacteria | 1411 |
| 107 | Ga0070671_100012445 | 3300005355 | Bacteria | 6851 |
| 108 | Ga0070671_100033760 | 3300005355 | Bacteria | 4234 |
| 109 | Ga0070671_100034275 | 3300005355 | Bacteria | 4202 |
| 110 | Ga0070671_100054845 | 3300005355 | Bacteria | 3315 |
| 111 | Ga0070671_100121365 | 3300005355 | Bacteria | 2199 |
| 112 | Ga0070671_100126515 | 3300005355 | Bacteria | 2151 |
| 113 | Ga0070674_100036573 | 3300005356 | Bacteria | 3297 |
| 114 | Ga0070674_100057775 | 3300005356 | Bacteria | 2694 |
| 115 | Ga0070673_100001046 | 3300005364 | Bacteria | 15704 |
| 116 | Ga0070673_100001556 | 3300005364 | Bacteria | 13518 |
| 117 | Ga0070673_100133524 | 3300005364 | Bacteria | 2086 |
| 118 | Ga0070673_100178351 | 3300005364 | Bacteria | 1817 |
| 119 | Ga0070673_100543444 | 3300005364 | Bacteria | 1055 |
| 120 | Ga0070673_100996216 | 3300005364 | Unclassified | 780 |
| 121 | Ga0070659_100000065 | 3300005366 | Bacteria | 82919 |
| 122 | Ga0070659_100011551 | 3300005366 | Bacteria | 6534 |
| 123 | Ga0070659_100013967 | 3300005366 | Bacteria | 5994 |
| 124 | Ga0070659_100016237 | 3300005366 | Bacteria | 5587 |
| 125 | Ga0070659_100040228 | 3300005366 | Bacteria | 3652 |
| 126 | Ga0070659_100041644 | 3300005366 | Bacteria | 3591 |
| 127 | Ga0070659_100068005 | 3300005366 | Bacteria | 2825 |
| 128 | Ga0070659_100089596 | 3300005366 | Bacteria | 2464 |
| 129 | Ga0070659_100140975 | 3300005366 | Bacteria | 1963 |
| 130 | Ga0070659_100257942 | 3300005366 | Bacteria | 1446 |
| 131 | Ga0070659_100603853 | 3300005366 | Bacteria | 943 |
| 132 | Ga0070659_101099487 | 3300005366 | Bacteria | 701 |
| 133 | Ga0070659_101117178 | 3300005366 | Bacteria | 695 |
| 134 | Ga0070659_101982550 | 3300005366 | Unclassified | 523 |
| 135 | Ga0070667_100008194 | 3300005367 | Bacteria | 8662 |
| 136 | Ga0070667_100011257 | 3300005367 | Bacteria | 7399 |
| 137 | Ga0070667_100020823 | 3300005367 | Bacteria | 5446 |
| 138 | Ga0070667_100024205 | 3300005367 | Bacteria | 5043 |
| 139 | Ga0070667_100032912 | 3300005367 | Bacteria | 4327 |
| 140 | Ga0070667_100086776 | 3300005367 | Bacteria | 2685 |
| 141 | Ga0070667_100228041 | 3300005367 | Bacteria | 1660 |
| 142 | Ga0070667_100263961 | 3300005367 | Bacteria | 1542 |
| 143 | Ga0070667_100383781 | 3300005367 | Bacteria | 1276 |
| 144 | Ga0070667_100385592 | 3300005367 | Bacteria | 1273 |
| 145 | Ga0070709_10770043 | 3300005434 | Unclassified | 753 |
| 146 | Ga0070714_100089684 | 3300005435 | Bacteria | 2692 |
| 147 | Ga0070714_100956649 | 3300005435 | Bacteria | 833 |
| 148 | Ga0070713_100347612 | 3300005436 | Bacteria | 1375 |
| 149 | Ga0070713_102240953 | 3300005436 | Bacteria | 529 |
| 150 | Ga0070663_100000647 | 3300005455 | Bacteria | 18662 |
| 151 | Ga0070663_100001839 | 3300005455 | Bacteria | 11825 |
| 152 | Ga0070663_100027782 | 3300005455 | Bacteria | 3845 |
| 153 | Ga0070663_100126737 | 3300005455 | Unclassified | 1935 |
| 154 | Ga0070663_100131939 | 3300005455 | Bacteria | 1898 |
| 155 | Ga0070663_100161020 | 3300005455 | Bacteria | 1727 |
| 156 | Ga0070663_100225129 | 3300005455 | Bacteria | 1474 |
| 157 | Ga0070663_100242476 | 3300005455 | Unclassified | 1423 |
| 158 | Ga0070663_100905861 | 3300005455 | Bacteria | 762 |
| 159 | Ga0070663_101033811 | 3300005455 | Bacteria | 716 |
| 160 | Ga0070663_101141897 | 3300005455 | Unclassified | 683 |
| 161 | Ga0070678_100074997 | 3300005456 | Bacteria | 2544 |
| 162 | Ga0070678_100098389 | 3300005456 | Bacteria | 2262 |
| 163 | Ga0070678_100724892 | 3300005456 | Unclassified | 897 |
| 164 | Ga0070662_100000010 | 3300005457 | Bacteria | 142717 |
| 165 | Ga0070662_100000323 | 3300005457 | Bacteria | 28556 |
| 166 | Ga0070662_100034343 | 3300005457 | Bacteria | 3575 |
| 167 | Ga0070662_100103504 | 3300005457 | Bacteria | 2159 |
| 168 | Ga0070662_100168055 | 3300005457 | Bacteria | 1720 |
| 169 | Ga0070662_100180546 | 3300005457 | Bacteria | 1663 |
| 170 | Ga0070662_100211513 | 3300005457 | Bacteria | 1543 |
| 171 | Ga0070662_100287009 | 3300005457 | Bacteria | 1333 |
| 172 | Ga0070662_100543773 | 3300005457 | Bacteria | 973 |
| 173 | Ga0070662_101383194 | 3300005457 | Bacteria | 606 |
| 174 | Ga0070681_10013516 | 3300005458 | Bacteria | 8117 |
| 175 | Ga0070681_10152303 | 3300005458 | Bacteria | 2239 |
| 176 | Ga0070681_10257261 | 3300005458 | Bacteria | 1658 |
| 177 | Ga0068867_100004677 | 3300005459 | Bacteria | 9632 |
| 178 | Ga0068867_100013102 | 3300005459 | Bacteria | 5870 |
| 179 | Ga0068867_100278207 | 3300005459 | Bacteria | 1371 |
| 180 | Ga0068867_100301265 | 3300005459 | Unclassified | 1321 |
| 181 | Ga0068867_100520616 | 3300005459 | Bacteria | 1025 |
| 182 | Ga0068867_101441810 | 3300005459 | Bacteria | 639 |
| 183 | Ga0070685_10239772 | 3300005466 | Bacteria | 1196 |
| 184 | Ga0070679_100014856 | 3300005530 | Bacteria | 7480 |
| 185 | Ga0070679_100128950 | 3300005530 | Bacteria | 2511 |
| 186 | Ga0070679_100181220 | 3300005530 | Bacteria | 2079 |
| 187 | Ga0070679_100398756 | 3300005530 | Bacteria | 1322 |
| 188 | Ga0070679_100526550 | 3300005530 | Unclassified | 1126 |
| 189 | Ga0070679_100946217 | 3300005530 | Bacteria | 805 |
| 190 | Ga0070679_101329082 | 3300005530 | Unclassified | 665 |
| 191 | Ga0070679_101519181 | 3300005530 | Unclassified | 617 |
| 192 | Ga0070679_102074640 | 3300005530 | Unclassified | 518 |
| 193 | Ga0070684_100029987 | 3300005535 | Bacteria | 4617 |
| 194 | Ga0070684_100094566 | 3300005535 | Bacteria | 2662 |
| 195 | Ga0070684_100121740 | 3300005535 | Bacteria | 2347 |
| 196 | Ga0070684_100541159 | 3300005535 | Bacteria | 1080 |
| 197 | Ga0070684_102071085 | 3300005535 | Unclassified | 537 |
| 198 | Ga0068853_100000067 | 3300005539 | Bacteria | 73891 |
| 199 | Ga0068853_100011651 | 3300005539 | Bacteria | 7145 |
| 200 | Ga0068853_100025346 | 3300005539 | Bacteria | 4976 |
| 201 | Ga0068853_100030531 | 3300005539 | Bacteria | 4553 |
| 202 | Ga0068853_100178754 | 3300005539 | Bacteria | 1923 |
| 203 | Ga0068853_100195932 | 3300005539 | Bacteria | 1837 |
| 204 | Ga0068853_100409380 | 3300005539 | Bacteria | 1270 |
| 205 | Ga0070672_100023632 | 3300005543 | Bacteria | 4534 |
| 206 | Ga0070672_100048432 | 3300005543 | Bacteria | 3302 |
| 207 | Ga0070672_100095965 | 3300005543 | Bacteria | 2398 |
| 208 | Ga0070686_100805827 | 3300005544 | Unclassified | 757 |
| 209 | Ga0070696_100089379 | 3300005546 | Bacteria | 2190 |
| 210 | Ga0070696_100619486 | 3300005546 | Bacteria | 874 |
| 211 | Ga0070696_100815875 | 3300005546 | Bacteria | 769 |
| 212 | Ga0070693_100000343 | 3300005547 | Bacteria | 21190 |
| 213 | Ga0070693_100012856 | 3300005547 | Bacteria | 4249 |
| 214 | Ga0070693_100015026 | 3300005547 | Bacteria | 3981 |
| 215 | Ga0070693_100034700 | 3300005547 | Bacteria | 2793 |
| 216 | Ga0070693_100068659 | 3300005547 | Bacteria | 2081 |
| 217 | Ga0070693_100076941 | 3300005547 | Bacteria | 1979 |
| 218 | Ga0070665_100013969 | 3300005548 | Bacteria | 8076 |
| 219 | Ga0070665_100100909 | 3300005548 | Bacteria | 2890 |
| 220 | Ga0070665_100119667 | 3300005548 | Bacteria | 2635 |
| 221 | Ga0070665_100453511 | 3300005548 | Bacteria | 1292 |
| 222 | Ga0070665_100516987 | 3300005548 | Bacteria | 1205 |
| 223 | Ga0068855_100017249 | 3300005563 | Bacteria | 8690 |
| 224 | Ga0068855_100018104 | 3300005563 | Bacteria | 8465 |
| 225 | Ga0068855_100066116 | 3300005563 | Bacteria | 4215 |
| 226 | Ga0068855_100079415 | 3300005563 | Bacteria | 3805 |
| 227 | Ga0068855_100109434 | 3300005563 | Bacteria | 3173 |
| 228 | Ga0068855_100295644 | 3300005563 | Bacteria | 1794 |
| 229 | Ga0068855_100558573 | 3300005563 | Unclassified | 1238 |
| 230 | Ga0068855_100751142 | 3300005563 | Bacteria | 1040 |
| 231 | Ga0068855_101023477 | 3300005563 | Unclassified | 867 |
| 232 | Ga0070664_100000228 | 3300005564 | Bacteria | 40132 |
| 233 | Ga0070664_100002696 | 3300005564 | Bacteria | 14326 |
| 234 | Ga0070664_100006881 | 3300005564 | Bacteria | 9167 |
| 235 | Ga0070664_100009565 | 3300005564 | Bacteria | 7860 |
| 236 | Ga0070664_100059968 | 3300005564 | Bacteria | 3238 |
| 237 | Ga0070664_100071624 | 3300005564 | Bacteria | 2971 |
| 238 | Ga0070664_100088394 | 3300005564 | Bacteria | 2679 |
| 239 | Ga0070664_100276125 | 3300005564 | Bacteria | 1515 |
| 240 | Ga0070664_100529306 | 3300005564 | Bacteria | 1088 |
| 241 | Ga0070664_100578245 | 3300005564 | Bacteria | 1040 |
| 242 | Ga0070664_100681133 | 3300005564 | Unclassified | 957 |
| 243 | Ga0070664_100862659 | 3300005564 | Bacteria | 848 |
| 244 | Ga0070664_100962590 | 3300005564 | Bacteria | 801 |
| 245 | Ga0070664_100977906 | 3300005564 | Bacteria | 795 |
| 246 | Ga0070664_102183787 | 3300005564 | Unclassified | 525 |
| 247 | Ga0068857_100005960 | 3300005577 | Bacteria | 10414 |
| 248 | Ga0068857_100018518 | 3300005577 | Bacteria | 6108 |
| 249 | Ga0068857_100026322 | 3300005577 | Bacteria | 5126 |
| 250 | Ga0068857_100208346 | 3300005577 | Bacteria | 1783 |
| 251 | Ga0068857_100354085 | 3300005577 | Bacteria | 1360 |
| 252 | Ga0068857_100380990 | 3300005577 | Bacteria | 1310 |
| 253 | Ga0068857_100413628 | 3300005577 | Bacteria | 1256 |
| 254 | Ga0068857_100561577 | 3300005577 | Bacteria | 1076 |
| 255 | Ga0068857_100773393 | 3300005577 | Bacteria | 916 |
| 256 | Ga0068857_102154810 | 3300005577 | Bacteria | 547 |
| 257 | Ga0068854_100001913 | 3300005578 | Bacteria | 12684 |
| 258 | Ga0068854_100006418 | 3300005578 | Bacteria | 7481 |
| 259 | Ga0068854_100011321 | 3300005578 | Bacteria | 5802 |
| 260 | Ga0068854_100025191 | 3300005578 | Bacteria | 4081 |
| 261 | Ga0068854_100083818 | 3300005578 | Bacteria | 2357 |
| 262 | Ga0068854_100411489 | 3300005578 | Bacteria | 1121 |
| 263 | Ga0068856_100000101 | 3300005614 | Bacteria | 82391 |
| 264 | Ga0068856_100023316 | 3300005614 | Bacteria | 6017 |
| 265 | Ga0068856_100061342 | 3300005614 | Bacteria | 3714 |
| 266 | Ga0068856_100079964 | 3300005614 | Bacteria | 3242 |
| 267 | Ga0068856_100153835 | 3300005614 | Bacteria | 2310 |
| 268 | Ga0068856_100334692 | 3300005614 | Unclassified | 1532 |
| 269 | Ga0068856_100391785 | 3300005614 | Bacteria | 1409 |
| 270 | Ga0068856_100689227 | 3300005614 | Unclassified | 1042 |
| 271 | Ga0070702_100377282 | 3300005615 | Bacteria | 1007 |
| 272 | Ga0068852_100000846 | 3300005616 | Bacteria | 20324 |
| 273 | Ga0068852_100001433 | 3300005616 | Bacteria | 16088 |
| 274 | Ga0068852_100003781 | 3300005616 | Bacteria | 10612 |
| 275 | Ga0068852_100013090 | 3300005616 | Bacteria | 6335 |
| 276 | Ga0068852_100023726 | 3300005616 | Bacteria | 4943 |
| 277 | Ga0068852_100087984 | 3300005616 | Bacteria | 2773 |
| 278 | Ga0068852_100093334 | 3300005616 | Bacteria | 2697 |
| 279 | Ga0068852_100094713 | 3300005616 | Bacteria | 2680 |
| 280 | Ga0068852_100437703 | 3300005616 | Bacteria | 1292 |
| 281 | Ga0068852_102470375 | 3300005616 | Unclassified | 540 |
| 282 | Ga0068859_100048611 | 3300005617 | Unclassified | 4260 |
| 283 | Ga0068859_100054434 | 3300005617 | Bacteria | 4024 |
| 284 | Ga0068859_100092224 | 3300005617 | Bacteria | 3080 |
| 285 | Ga0068859_100379073 | 3300005617 | Bacteria | 1510 |
| 286 | Ga0068859_100904590 | 3300005617 | Bacteria | 967 |
| 287 | Ga0068864_100000222 | 3300005618 | Bacteria | 51430 |
| 288 | Ga0068864_100007380 | 3300005618 | Bacteria | 9049 |
| 289 | Ga0068864_100089427 | 3300005618 | Bacteria | 2713 |
| 290 | Ga0068864_100180268 | 3300005618 | Bacteria | 1931 |
| 291 | Ga0068861_100169755 | 3300005719 | Bacteria | 1807 |
| 292 | Ga0068861_100329298 | 3300005719 | Bacteria | 1333 |
| 293 | Ga0068861_100430982 | 3300005719 | Bacteria | 1177 |
| 294 | Ga0068861_100485890 | 3300005719 | Bacteria | 1113 |
| 295 | Ga0068851_10032858 | 3300005834 | Bacteria | 2582 |
| 296 | Ga0068851_10047700 | 3300005834 | Bacteria | 2170 |
| 297 | Ga0068851_10051292 | 3300005834 | Unclassified | 2096 |
| 298 | Ga0068851_10154026 | 3300005834 | Bacteria | 1258 |
| 299 | Ga0068851_10167365 | 3300005834 | Bacteria | 1211 |
| 300 | Ga0068870_10103315 | 3300005840 | Bacteria | 1614 |
| 301 | Ga0068863_100002567 | 3300005841 | Bacteria | 18003 |
| 302 | Ga0068863_100034901 | 3300005841 | Bacteria | 4791 |
| 303 | Ga0068863_100116639 | 3300005841 | Bacteria | 2544 |
| 304 | Ga0068863_100360451 | 3300005841 | Unclassified | 1417 |
| 305 | Ga0068863_100770831 | 3300005841 | Unclassified | 958 |
| 306 | Ga0068858_100003320 | 3300005842 | Bacteria | 16021 |
| 307 | Ga0068858_100007141 | 3300005842 | Bacteria | 10844 |
| 308 | Ga0068860_100006803 | 3300005843 | Bacteria | 11459 |
| 309 | Ga0068860_100061591 | 3300005843 | Bacteria | 3565 |
| 310 | Ga0068860_100073377 | 3300005843 | Bacteria | 3253 |
| 311 | Ga0068860_100245076 | 3300005843 | Bacteria | 1744 |
| 312 | Ga0068862_100091796 | 3300005844 | Bacteria | 2646 |
| 313 | Ga0068862_100253229 | 3300005844 | Bacteria | 1605 |
| 314 | Ga0097621_100051529 | 3300006237 | Bacteria | 3350 |
| 315 | Ga0097621_100357207 | 3300006237 | Bacteria | 1301 |
| 316 | Ga0097621_100493047 | 3300006237 | Bacteria | 1109 |
| 317 | Ga0097621_100561732 | 3300006237 | Unclassified | 1040 |
| 318 | Ga0097621_101019463 | 3300006237 | Bacteria | 775 |
| 319 | Ga0097621_101092693 | 3300006237 | Bacteria | 748 |
| 320 | Ga0068871_100011090 | 3300006358 | Bacteria | 6604 |
| 321 | Ga0068871_100379801 | 3300006358 | Bacteria | 1255 |
| 322 | Ga0068871_100623150 | 3300006358 | Unclassified | 983 |
| 323 | Ga0068871_100662228 | 3300006358 | Bacteria | 954 |
| 324 | Ga0068871_101378884 | 3300006358 | Bacteria | 664 |
| 325 | Ga0068865_100006056 | 3300006881 | Bacteria | 7375 |
| 326 | Ga0068865_100034925 | 3300006881 | Bacteria | 3377 |
| 327 | Ga0097620_100048612 | 3300006931 | Unclassified | 4260 |
| 328 | Ga0097620_100054439 | 3300006931 | Bacteria | 4024 |
| 329 | Ga0097620_100092228 | 3300006931 | Bacteria | 3080 |
| 330 | Ga0097620_100379074 | 3300006931 | Bacteria | 1510 |
| 331 | Ga0097620_100904739 | 3300006931 | Bacteria | 967 |
| 332 | Ga0075435_100734814 | 3300007076 | Bacteria | 858 |
| 333 | Ga0105240_10087961 | 3300009093 | Bacteria | 3803 |
| 334 | Ga0105245_10006125 | 3300009098 | Bacteria | 10580 |
| 335 | Ga0105241_10032907 | 3300009174 | Bacteria | 3889 |
| 336 | Ga0105241_10130207 | 3300009174 | Bacteria | 2036 |
| 337 | Ga0105241_10157917 | 3300009174 | Bacteria | 1861 |
| 338 | Ga0105241_10342051 | 3300009174 | Bacteria | 1296 |
| 339 | Ga0105241_10702355 | 3300009174 | Unclassified | 923 |
| 340 | Ga0105242_10185671 | 3300009176 | Bacteria | 1837 |
| 341 | Ga0105248_10001119 | 3300009177 | Bacteria | 29831 |
| 342 | Ga0105248_10054729 | 3300009177 | Bacteria | 4475 |
| 343 | Ga0105248_10228619 | 3300009177 | Bacteria | 2094 |
| 344 | Ga0105248_10463115 | 3300009177 | Bacteria | 1429 |
| 345 | Ga0105248_10829284 | 3300009177 | Bacteria | 1044 |
| 346 | Ga0105248_11767199 | 3300009177 | Unclassified | 701 |
| 347 | Ga0105248_12304511 | 3300009177 | Bacteria | 613 |
| 348 | Ga0105237_10006758 | 3300009545 | Bacteria | 12663 |
| 349 | Ga0105238_10004367 | 3300009551 | Bacteria | 14023 |
| 350 | Ga0105238_10051275 | 3300009551 | Bacteria | 4151 |
| 351 | Ga0105238_10063618 | 3300009551 | Bacteria | 3690 |
| 352 | Ga0105238_10111637 | 3300009551 | Bacteria | 2714 |
| 353 | Ga0105238_10327601 | 3300009551 | Bacteria | 1518 |
| 354 | Ga0105238_12295790 | 3300009551 | Unclassified | 575 |
| 355 | Ga0105249_10320235 | 3300009553 | Bacteria | 1562 |
| 356 | Ga0105249_10935063 | 3300009553 | Bacteria | 934 |
| 357 | Ga0105239_10054356 | 3300010375 | Bacteria | 4392 |
| 358 | Ga0105239_10261369 | 3300010375 | Unclassified | 1945 |
| 359 | Ga0105246_10008301 | 3300011119 | Bacteria | 6378 |
| 360 | Ga0105246_10278750 | 3300011119 | Bacteria | 1340 |
| 361 | Ga0157373_10009790 | 3300013100 | Bacteria | 7070 |
| 362 | Ga0157373_10031339 | 3300013100 | Bacteria | 3828 |
| 363 | Ga0157373_10059487 | 3300013100 | Bacteria | 2708 |
| 364 | Ga0157373_10090355 | 3300013100 | Bacteria | 2157 |
| 365 | Ga0157373_10092027 | 3300013100 | Bacteria | 2136 |
| 366 | Ga0157373_10092672 | 3300013100 | Bacteria | 2128 |
| 367 | Ga0157373_10102375 | 3300013100 | Bacteria | 2015 |
| 368 | Ga0157373_10193781 | 3300013100 | Bacteria | 1432 |
| 369 | Ga0157373_10272822 | 3300013100 | Unclassified | 1198 |
| 370 | Ga0157373_10301096 | 3300013100 | Bacteria | 1138 |
| 371 | Ga0157373_10463145 | 3300013100 | Bacteria | 913 |
| 372 | Ga0157371_10003821 | 3300013102 | Bacteria | 13450 |
| 373 | Ga0157371_10025025 | 3300013102 | Bacteria | 4356 |
| 374 | Ga0157371_10026453 | 3300013102 | Bacteria | 4217 |
| 375 | Ga0157371_10075155 | 3300013102 | Bacteria | 2393 |
| 376 | Ga0157371_10092512 | 3300013102 | Bacteria | 2142 |
| 377 | Ga0157371_10128560 | 3300013102 | Bacteria | 1802 |
| 378 | Ga0157371_10870781 | 3300013102 | Unclassified | 682 |
| 379 | Ga0157371_10939038 | 3300013102 | Unclassified | 657 |
| 380 | Ga0157371_11244993 | 3300013102 | Unclassified | 574 |
| 381 | Ga0157370_10059532 | 3300013104 | Bacteria | 3629 |
| 382 | Ga0157370_10741220 | 3300013104 | Unclassified | 895 |
| 383 | Ga0157370_10929875 | 3300013104 | Unclassified | 789 |
| 384 | Ga0157369_10003181 | 3300013105 | Bacteria | 19593 |
| 385 | Ga0157369_10032210 | 3300013105 | Bacteria | 5767 |
| 386 | Ga0157369_10202481 | 3300013105 | Bacteria | 2083 |
| 387 | Ga0157369_10259977 | 3300013105 | Bacteria | 1810 |
| 388 | Ga0157369_10733218 | 3300013105 | Unclassified | 1017 |
| 389 | Ga0157369_10922308 | 3300013105 | Unclassified | 895 |
| 390 | Ga0157374_10303006 | 3300013296 | Bacteria | 1581 |
| 391 | Ga0157374_10480692 | 3300013296 | Unclassified | 1245 |
| 392 | Ga0157374_10519081 | 3300013296 | Unclassified | 1197 |
| 393 | Ga0157378_10006532 | 3300013297 | Bacteria | 10192 |
| 394 | Ga0157378_10007074 | 3300013297 | Bacteria | 9797 |
| 395 | Ga0157378_10344935 | 3300013297 | Bacteria | 1453 |
| 396 | Ga0163162_10032625 | 3300013306 | Bacteria | 5173 |
| 397 | Ga0163162_10438663 | 3300013306 | Unclassified | 1438 |
| 398 | Ga0157372_10011784 | 3300013307 | Bacteria | 9314 |
| 399 | Ga0157372_10035809 | 3300013307 | Bacteria | 5466 |
| 400 | Ga0157372_10045014 | 3300013307 | Bacteria | 4893 |
| 401 | Ga0157372_10046828 | 3300013307 | Bacteria | 4802 |
| 402 | Ga0157372_10359554 | 3300013307 | Bacteria | 1696 |
| 403 | Ga0157372_11666553 | 3300013307 | Unclassified | 734 |
| 404 | Ga0157372_12909297 | 3300013307 | Bacteria | 548 |
| 405 | Ga0157375_10007221 | 3300013308 | Bacteria | 9716 |
| 406 | Ga0157375_10024264 | 3300013308 | Bacteria | 5610 |
| 407 | Ga0157375_10271200 | 3300013308 | Bacteria | 1859 |
| 408 | Ga0163163_10019125 | 3300014325 | Bacteria | 6427 |
| 409 | Ga0157377_10204425 | 3300014745 | Bacteria | 1256 |
| 410 | Ga0157379_10165064 | 3300014968 | Bacteria | 1999 |
| 411 | Ga0157379_10182441 | 3300014968 | Unclassified | 1896 |
| 412 | Ga0157379_11204648 | 3300014968 | Bacteria | 728 |
| 413 | Ga0157376_10684688 | 3300014969 | Bacteria | 1029 |
| 414 | Ga0163161_10485228 | 3300017792 | Bacteria | 1004 |
| 415 | Ga0197907_10034936 | 3300020069 | Unclassified | 667 |
| 416 | Ga0197907_11002332 | 3300020069 | Bacteria | 910 |
| 417 | Ga0206356_10307274 | 3300020070 | Bacteria | 1016 |
| 418 | Ga0206356_11292785 | 3300020070 | Bacteria | 909 |
| 419 | Ga0206356_11311979 | 3300020070 | Unclassified | 949 |
| 420 | Ga0206356_11638823 | 3300020070 | Bacteria | 1524 |
| 421 | Ga0206352_10699940 | 3300020078 | Unclassified | 901 |
| 422 | Ga0206354_10948750 | 3300020081 | Bacteria | 990 |
| 423 | Ga0206353_10732796 | 3300020082 | Bacteria | 619 |
| 424 | Ga0224712_10171006 | 3300022467 | Bacteria | 974 |
| 425 | Ga0224712_10205286 | 3300022467 | Unclassified | 897 |
| 426 | Ga0207673_1020061 | 3300025290 | Bacteria | 900 |
| 427 | Ga0207697_10000158 | 3300025315 | Bacteria | 33821 |
| 428 | Ga0207697_10022280 | 3300025315 | Bacteria | 2595 |
| 429 | Ga0207697_10028059 | 3300025315 | Bacteria | 2301 |
| 430 | Ga0207697_10112020 | 3300025315 | Bacteria | 1169 |
| 431 | Ga0207656_10003880 | 3300025321 | Bacteria | 5185 |
| 432 | Ga0207656_10042249 | 3300025321 | Bacteria | 1939 |
| 433 | Ga0207656_10061879 | 3300025321 | Bacteria | 1644 |
| 434 | Ga0207656_10461209 | 3300025321 | Bacteria | 643 |
| 435 | Ga0207713_1039137 | 3300025735 | Bacteria | 2003 |
| 436 | Ga0207682_10035101 | 3300025893 | Bacteria | 2024 |
| 437 | Ga0207642_10364144 | 3300025899 | Unclassified | 856 |
| 438 | Ga0207688_10007071 | 3300025901 | Bacteria | 6102 |
| 439 | Ga0207688_10126968 | 3300025901 | Bacteria | 1492 |
| 440 | Ga0207680_10517167 | 3300025903 | Bacteria | 851 |
| 441 | Ga0207647_10000832 | 3300025904 | Bacteria | 23993 |
| 442 | Ga0207647_10004000 | 3300025904 | Bacteria | 10992 |
| 443 | Ga0207647_10008390 | 3300025904 | Bacteria | 7410 |
| 444 | Ga0207647_10061274 | 3300025904 | Bacteria | 2297 |
| 445 | Ga0207647_10064373 | 3300025904 | Bacteria | 2228 |
| 446 | Ga0207647_10079630 | 3300025904 | Bacteria | 1966 |
| 447 | Ga0207647_10464687 | 3300025904 | Bacteria | 708 |
| 448 | Ga0207645_10003931 | 3300025907 | Bacteria | 11101 |
| 449 | Ga0207645_10004831 | 3300025907 | Bacteria | 9899 |
| 450 | Ga0207645_10008901 | 3300025907 | Bacteria | 6973 |
| 451 | Ga0207645_10063906 | 3300025907 | Unclassified | 2352 |
| 452 | Ga0207645_10112926 | 3300025907 | Bacteria | 1760 |
| 453 | Ga0207643_10054699 | 3300025908 | Bacteria | 2269 |
| 454 | Ga0207643_10173377 | 3300025908 | Bacteria | 1303 |
| 455 | Ga0207643_10254530 | 3300025908 | Bacteria | 1082 |
| 456 | Ga0207705_10000113 | 3300025909 | Bacteria | 90567 |
| 457 | Ga0207705_10010345 | 3300025909 | Bacteria | 6787 |
| 458 | Ga0207705_10038951 | 3300025909 | Bacteria | 3406 |
| 459 | Ga0207705_10059966 | 3300025909 | Bacteria | 2747 |
| 460 | Ga0207705_10060833 | 3300025909 | Bacteria | 2728 |
| 461 | Ga0207705_10065521 | 3300025909 | Bacteria | 2626 |
| 462 | Ga0207705_10065899 | 3300025909 | Bacteria | 2619 |
| 463 | Ga0207705_10077431 | 3300025909 | Bacteria | 2419 |
| 464 | Ga0207705_10186859 | 3300025909 | Bacteria | 1566 |
| 465 | Ga0207705_10261160 | 3300025909 | Bacteria | 1322 |
| 466 | Ga0207705_11141639 | 3300025909 | Unclassified | 599 |
| 467 | Ga0207654_10106813 | 3300025911 | Bacteria | 1734 |
| 468 | Ga0207654_10178036 | 3300025911 | Unclassified | 1385 |
| 469 | Ga0207707_10008907 | 3300025912 | Bacteria | 8714 |
| 470 | Ga0207707_10453823 | 3300025912 | Unclassified | 1097 |
| 471 | Ga0207707_10495635 | 3300025912 | Bacteria | 1042 |
| 472 | Ga0207695_10622836 | 3300025913 | Unclassified | 960 |
| 473 | Ga0207671_10017531 | 3300025914 | Bacteria | 5516 |
| 474 | Ga0207693_10016003 | 3300025915 | Bacteria | 6004 |
| 475 | Ga0207660_10007589 | 3300025917 | Bacteria | 7020 |
| 476 | Ga0207660_10034958 | 3300025917 | Bacteria | 3486 |
| 477 | Ga0207660_10440534 | 3300025917 | Bacteria | 1053 |
| 478 | Ga0207660_10535163 | 3300025917 | Bacteria | 952 |
| 479 | Ga0207660_10665417 | 3300025917 | Bacteria | 849 |
| 480 | Ga0207660_10682176 | 3300025917 | Bacteria | 838 |
| 481 | Ga0207660_11701896 | 3300025917 | Bacteria | 507 |
| 482 | Ga0207662_10030474 | 3300025918 | Bacteria | 3130 |
| 483 | Ga0207662_10077107 | 3300025918 | Bacteria | 2027 |
| 484 | Ga0207662_10170760 | 3300025918 | Bacteria | 1394 |
| 485 | Ga0207657_10000026 | 3300025919 | Bacteria | 143118 |
| 486 | Ga0207657_10002103 | 3300025919 | Bacteria | 21540 |
| 487 | Ga0207657_10005900 | 3300025919 | Bacteria | 12750 |
| 488 | Ga0207657_10007800 | 3300025919 | Bacteria | 10926 |
| 489 | Ga0207657_10038093 | 3300025919 | Bacteria | 4285 |
| 490 | Ga0207657_10050216 | 3300025919 | Bacteria | 3630 |
| 491 | Ga0207657_10093297 | 3300025919 | Bacteria | 2507 |
| 492 | Ga0207657_10167001 | 3300025919 | Bacteria | 1784 |
| 493 | Ga0207657_10281976 | 3300025919 | Bacteria | 1319 |
| 494 | Ga0207657_10862110 | 3300025919 | Bacteria | 698 |
| 495 | Ga0207649_10000516 | 3300025920 | Bacteria | 27112 |
| 496 | Ga0207649_10002740 | 3300025920 | Bacteria | 9764 |
| 497 | Ga0207649_10032422 | 3300025920 | Bacteria | 3114 |
| 498 | Ga0207649_10038842 | 3300025920 | Bacteria | 2884 |
| 499 | Ga0207649_10070046 | 3300025920 | Bacteria | 2235 |
| 500 | Ga0207649_10085352 | 3300025920 | Bacteria | 2054 |
| 501 | Ga0207649_10183527 | 3300025920 | Bacteria | 1466 |
| 502 | Ga0207649_10517552 | 3300025920 | Bacteria | 909 |
| 503 | Ga0207652_10026485 | 3300025921 | Bacteria | 4830 |
| 504 | Ga0207652_10095828 | 3300025921 | Bacteria | 2614 |
| 505 | Ga0207652_10220094 | 3300025921 | Bacteria | 1711 |
| 506 | Ga0207652_10298249 | 3300025921 | Bacteria | 1455 |
| 507 | Ga0207652_10338914 | 3300025921 | Bacteria | 1357 |
| 508 | Ga0207652_10437556 | 3300025921 | Unclassified | 1179 |
| 509 | Ga0207652_10487035 | 3300025921 | Unclassified | 1111 |
| 510 | Ga0207652_10825776 | 3300025921 | Bacteria | 822 |
| 511 | Ga0207652_11286989 | 3300025921 | Unclassified | 634 |
| 512 | Ga0207681_10047787 | 3300025923 | Bacteria | 2885 |
| 513 | Ga0207681_10056834 | 3300025923 | Bacteria | 2670 |
| 514 | Ga0207681_10277952 | 3300025923 | Unclassified | 1317 |
| 515 | Ga0207694_10000776 | 3300025924 | Bacteria | 28653 |
| 516 | Ga0207694_10005699 | 3300025924 | Bacteria | 9549 |
| 517 | Ga0207694_10185516 | 3300025924 | Unclassified | 1688 |
| 518 | Ga0207694_10334497 | 3300025924 | Bacteria | 1251 |
| 519 | Ga0207694_10921080 | 3300025924 | Bacteria | 739 |
| 520 | Ga0207694_11500997 | 3300025924 | Unclassified | 569 |
| 521 | Ga0207650_10028115 | 3300025925 | Bacteria | 4030 |
| 522 | Ga0207650_10142089 | 3300025925 | Bacteria | 1888 |
| 523 | Ga0207659_10835872 | 3300025926 | Bacteria | 791 |
| 524 | Ga0207687_10048079 | 3300025927 | Bacteria | 2960 |
| 525 | Ga0207687_10062974 | 3300025927 | Bacteria | 2625 |
| 526 | Ga0207664_10146782 | 3300025929 | Bacteria | 2001 |
| 527 | Ga0207664_10161196 | 3300025929 | Bacteria | 1913 |
| 528 | Ga0207664_10251689 | 3300025929 | Bacteria | 1542 |
| 529 | Ga0207664_10374847 | 3300025929 | Bacteria | 1262 |
| 530 | Ga0207664_10801546 | 3300025929 | Unclassified | 847 |
| 531 | Ga0207644_10022380 | 3300025931 | Bacteria | 4319 |
| 532 | Ga0207644_10033303 | 3300025931 | Bacteria | 3599 |
| 533 | Ga0207644_10033934 | 3300025931 | Bacteria | 3570 |
| 534 | Ga0207644_10209882 | 3300025931 | Bacteria | 1539 |
| 535 | Ga0207644_10227290 | 3300025931 | Bacteria | 1481 |
| 536 | Ga0207690_10000649 | 3300025932 | Bacteria | 22307 |
| 537 | Ga0207690_10002369 | 3300025932 | Bacteria | 11421 |
| 538 | Ga0207690_10002565 | 3300025932 | Bacteria | 10974 |
| 539 | Ga0207690_10012713 | 3300025932 | Bacteria | 5046 |
| 540 | Ga0207690_10017432 | 3300025932 | Bacteria | 4383 |
| 541 | Ga0207690_10050183 | 3300025932 | Bacteria | 2784 |
| 542 | Ga0207690_10201848 | 3300025932 | Unclassified | 1511 |
| 543 | Ga0207690_10219429 | 3300025932 | Bacteria | 1454 |
| 544 | Ga0207690_10238263 | 3300025932 | Bacteria | 1400 |
| 545 | Ga0207690_10369349 | 3300025932 | Unclassified | 1138 |
| 546 | Ga0207690_10413049 | 3300025932 | Bacteria | 1078 |
| 547 | Ga0207690_10429139 | 3300025932 | Bacteria | 1059 |
| 548 | Ga0207690_10640821 | 3300025932 | Bacteria | 870 |
| 549 | Ga0207690_11098335 | 3300025932 | Unclassified | 663 |
| 550 | Ga0207706_10000031 | 3300025933 | Bacteria | 143109 |
| 551 | Ga0207706_10000829 | 3300025933 | Bacteria | 32031 |
| 552 | Ga0207706_10002893 | 3300025933 | Bacteria | 16604 |
| 553 | Ga0207706_10008630 | 3300025933 | Bacteria | 9389 |
| 554 | Ga0207706_10024282 | 3300025933 | Bacteria | 5434 |
| 555 | Ga0207706_10038293 | 3300025933 | Bacteria | 4254 |
| 556 | Ga0207706_10055308 | 3300025933 | Bacteria | 3500 |
| 557 | Ga0207706_10081488 | 3300025933 | Bacteria | 2843 |
| 558 | Ga0207706_10101934 | 3300025933 | Bacteria | 2526 |
| 559 | Ga0207706_10158840 | 3300025933 | Bacteria | 1988 |
| 560 | Ga0207706_10216949 | 3300025933 | Bacteria | 1676 |
| 561 | Ga0207706_10260604 | 3300025933 | Bacteria | 1514 |
| 562 | Ga0207706_10676408 | 3300025933 | Unclassified | 883 |
| 563 | Ga0207706_10963687 | 3300025933 | Unclassified | 718 |
| 564 | Ga0207686_10362636 | 3300025934 | Bacteria | 1094 |
| 565 | Ga0207709_10681923 | 3300025935 | Bacteria | 821 |
| 566 | Ga0207670_10044294 | 3300025936 | Bacteria | 2943 |
| 567 | Ga0207669_10108579 | 3300025937 | Bacteria | 1853 |
| 568 | Ga0207669_10828103 | 3300025937 | Bacteria | 769 |
| 569 | Ga0207704_10060374 | 3300025938 | Bacteria | 2346 |
| 570 | Ga0207704_11009349 | 3300025938 | Bacteria | 704 |
| 571 | Ga0207704_11083528 | 3300025938 | Unclassified | 680 |
| 572 | Ga0207691_10003632 | 3300025940 | Bacteria | 14973 |
| 573 | Ga0207691_10061499 | 3300025940 | Bacteria | 3411 |
| 574 | Ga0207691_10134809 | 3300025940 | Bacteria | 2179 |
| 575 | Ga0207691_10144668 | 3300025940 | Bacteria | 2093 |
| 576 | Ga0207711_10000446 | 3300025941 | Bacteria | 43126 |
| 577 | Ga0207711_10002065 | 3300025941 | Bacteria | 18165 |
| 578 | Ga0207711_10007845 | 3300025941 | Bacteria | 8923 |
| 579 | Ga0207711_10117724 | 3300025941 | Bacteria | 2369 |
| 580 | Ga0207711_10226883 | 3300025941 | Bacteria | 1710 |
| 581 | Ga0207711_10287123 | 3300025941 | Unclassified | 1516 |
| 582 | Ga0207711_10733378 | 3300025941 | Bacteria | 921 |
| 583 | Ga0207711_11023149 | 3300025941 | Unclassified | 766 |
| 584 | Ga0207689_10000017 | 3300025942 | Bacteria | 117159 |
| 585 | Ga0207689_10025109 | 3300025942 | Bacteria | 4995 |
| 586 | Ga0207689_10037964 | 3300025942 | Bacteria | 3991 |
| 587 | Ga0207689_10066588 | 3300025942 | Bacteria | 2961 |
| 588 | Ga0207689_10426773 | 3300025942 | Bacteria | 1107 |
| 589 | Ga0207661_10013965 | 3300025944 | Bacteria | 5873 |
| 590 | Ga0207661_10030599 | 3300025944 | Bacteria | 4149 |
| 591 | Ga0207661_10031712 | 3300025944 | Bacteria | 4087 |
| 592 | Ga0207661_10235922 | 3300025944 | Bacteria | 1621 |
| 593 | Ga0207661_10783699 | 3300025944 | Unclassified | 878 |
| 594 | Ga0207661_11073666 | 3300025944 | Unclassified | 741 |
| 595 | Ga0207679_10000236 | 3300025945 | Bacteria | 42583 |
| 596 | Ga0207679_10008515 | 3300025945 | Bacteria | 6534 |
| 597 | Ga0207679_10032946 | 3300025945 | Bacteria | 3643 |
| 598 | Ga0207679_10088718 | 3300025945 | Bacteria | 2385 |
| 599 | Ga0207679_10100327 | 3300025945 | Bacteria | 2262 |
| 600 | Ga0207679_10118558 | 3300025945 | Bacteria | 2102 |
| 601 | Ga0207679_10134912 | 3300025945 | Bacteria | 1986 |
| 602 | Ga0207679_10175160 | 3300025945 | Bacteria | 1770 |
| 603 | Ga0207679_10201523 | 3300025945 | Bacteria | 1662 |
| 604 | Ga0207679_10354516 | 3300025945 | Bacteria | 1280 |
| 605 | Ga0207679_10531731 | 3300025945 | Bacteria | 1053 |
| 606 | Ga0207679_11442595 | 3300025945 | Bacteria | 631 |
| 607 | Ga0207679_12014802 | 3300025945 | Unclassified | 525 |
| 608 | Ga0207667_10001718 | 3300025949 | Bacteria | 27571 |
| 609 | Ga0207667_10081840 | 3300025949 | Bacteria | 3345 |
| 610 | Ga0207667_10132858 | 3300025949 | Bacteria | 2563 |
| 611 | Ga0207667_10720816 | 3300025949 | Bacteria | 999 |
| 612 | Ga0207667_11750098 | 3300025949 | Unclassified | 587 |
| 613 | Ga0207651_10029701 | 3300025960 | Bacteria | 3468 |
| 614 | Ga0207651_10116028 | 3300025960 | Bacteria | 2020 |
| 615 | Ga0207651_10432706 | 3300025960 | Unclassified | 1125 |
| 616 | Ga0207651_10538401 | 3300025960 | Unclassified | 1014 |
| 617 | Ga0207651_11127555 | 3300025960 | Unclassified | 703 |
| 618 | Ga0207651_11547410 | 3300025960 | Unclassified | 597 |
| 619 | Ga0207651_12017645 | 3300025960 | Bacteria | 518 |
| 620 | Ga0207712_10079041 | 3300025961 | Bacteria | 2388 |
| 621 | Ga0207668_10002157 | 3300025972 | Bacteria | 11474 |
| 622 | Ga0207668_10073156 | 3300025972 | Bacteria | 2455 |
| 623 | Ga0207640_10007503 | 3300025981 | Bacteria | 6024 |
| 624 | Ga0207640_10010090 | 3300025981 | Bacteria | 5309 |
| 625 | Ga0207640_10032101 | 3300025981 | Bacteria | 3253 |
| 626 | Ga0207640_10034294 | 3300025981 | Bacteria | 3166 |
| 627 | Ga0207640_10107025 | 3300025981 | Bacteria | 1974 |
| 628 | Ga0207640_10114939 | 3300025981 | Unclassified | 1916 |
| 629 | Ga0207640_10128956 | 3300025981 | Bacteria | 1825 |
| 630 | Ga0207640_11504686 | 3300025981 | Unclassified | 605 |
| 631 | Ga0207658_10017651 | 3300025986 | Bacteria | 4920 |
| 632 | Ga0207658_10018455 | 3300025986 | Bacteria | 4817 |
| 633 | Ga0207658_10027437 | 3300025986 | Bacteria | 4001 |
| 634 | Ga0207658_10036587 | 3300025986 | Bacteria | 3520 |
| 635 | Ga0207658_10072042 | 3300025986 | Bacteria | 2618 |
| 636 | Ga0207658_10078804 | 3300025986 | Bacteria | 2518 |
| 637 | Ga0207658_10080766 | 3300025986 | Bacteria | 2491 |
| 638 | Ga0207658_10094610 | 3300025986 | Bacteria | 2326 |
| 639 | Ga0207677_10102695 | 3300026023 | Bacteria | 2109 |
| 640 | Ga0207677_10298705 | 3300026023 | Bacteria | 1329 |
| 641 | Ga0207677_10765304 | 3300026023 | Unclassified | 862 |
| 642 | Ga0207677_10815524 | 3300026023 | Unclassified | 836 |
| 643 | Ga0207703_10025106 | 3300026035 | Bacteria | 4687 |
| 644 | Ga0207703_10065655 | 3300026035 | Bacteria | 2983 |
| 645 | Ga0207703_10088896 | 3300026035 | Bacteria | 2594 |
| 646 | Ga0207703_10135939 | 3300026035 | Bacteria | 2128 |
| 647 | Ga0207639_10005817 | 3300026041 | Bacteria | 8356 |
| 648 | Ga0207639_10070955 | 3300026041 | Bacteria | 2723 |
| 649 | Ga0207639_10095747 | 3300026041 | Bacteria | 2387 |
| 650 | Ga0207639_10108892 | 3300026041 | Bacteria | 2253 |
| 651 | Ga0207639_10205373 | 3300026041 | Bacteria | 1692 |
| 652 | Ga0207639_10385639 | 3300026041 | Unclassified | 1259 |
| 653 | Ga0207639_10770962 | 3300026041 | Unclassified | 895 |
| 654 | Ga0207678_10002668 | 3300026067 | Bacteria | 16192 |
| 655 | Ga0207678_10010119 | 3300026067 | Bacteria | 8274 |
| 656 | Ga0207678_10010859 | 3300026067 | Bacteria | 8003 |
| 657 | Ga0207678_10012250 | 3300026067 | Bacteria | 7530 |
| 658 | Ga0207678_10023738 | 3300026067 | Bacteria | 5363 |
| 659 | Ga0207678_10138368 | 3300026067 | Bacteria | 2078 |
| 660 | Ga0207678_10154857 | 3300026067 | Bacteria | 1957 |
| 661 | Ga0207678_10176738 | 3300026067 | Unclassified | 1823 |
| 662 | Ga0207678_10209384 | 3300026067 | Bacteria | 1668 |
| 663 | Ga0207678_10300599 | 3300026067 | Unclassified | 1379 |
| 664 | Ga0207678_10502746 | 3300026067 | Bacteria | 1057 |
| 665 | Ga0207678_10586127 | 3300026067 | Bacteria | 977 |
| 666 | Ga0207708_10326846 | 3300026075 | Bacteria | 1253 |
| 667 | Ga0207708_10327175 | 3300026075 | Bacteria | 1252 |
| 668 | Ga0207702_10010631 | 3300026078 | Bacteria | 7690 |
| 669 | Ga0207702_10015012 | 3300026078 | Bacteria | 6423 |
| 670 | Ga0207702_10067734 | 3300026078 | Bacteria | 3064 |
| 671 | Ga0207702_10095158 | 3300026078 | Bacteria | 2616 |
| 672 | Ga0207702_10164850 | 3300026078 | Bacteria | 2026 |
| 673 | Ga0207702_10208008 | 3300026078 | Bacteria | 1818 |
| 674 | Ga0207702_10600741 | 3300026078 | Bacteria | 1080 |
| 675 | Ga0207702_10839137 | 3300026078 | Bacteria | 909 |
| 676 | Ga0207641_10011385 | 3300026088 | Bacteria | 7299 |
| 677 | Ga0207641_10019349 | 3300026088 | Bacteria | 5588 |
| 678 | Ga0207641_10033916 | 3300026088 | Bacteria | 4243 |
| 679 | Ga0207641_10337044 | 3300026088 | Bacteria | 1434 |
| 680 | Ga0207641_10433036 | 3300026088 | Unclassified | 1268 |
| 681 | Ga0207641_11196227 | 3300026088 | Bacteria | 760 |
| 682 | Ga0207648_10002318 | 3300026089 | Bacteria | 20543 |
| 683 | Ga0207648_10003142 | 3300026089 | Bacteria | 17423 |
| 684 | Ga0207648_10006581 | 3300026089 | Bacteria | 11535 |
| 685 | Ga0207648_10116265 | 3300026089 | Bacteria | 2351 |
| 686 | Ga0207676_10002072 | 3300026095 | Bacteria | 14553 |
| 687 | Ga0207676_10008483 | 3300026095 | Bacteria | 7307 |
| 688 | Ga0207676_10009522 | 3300026095 | Bacteria | 6915 |
| 689 | Ga0207676_10031676 | 3300026095 | Bacteria | 3978 |
| 690 | Ga0207676_10389840 | 3300026095 | Bacteria | 1299 |
| 691 | Ga0207674_10000527 | 3300026116 | Bacteria | 50282 |
| 692 | Ga0207674_10002277 | 3300026116 | Bacteria | 24338 |
| 693 | Ga0207674_10003088 | 3300026116 | Bacteria | 20583 |
| 694 | Ga0207674_10011531 | 3300026116 | Bacteria | 9928 |
| 695 | Ga0207674_10024167 | 3300026116 | Bacteria | 6497 |
| 696 | Ga0207674_10030316 | 3300026116 | Bacteria | 5688 |
| 697 | Ga0207674_10036857 | 3300026116 | Bacteria | 5090 |
| 698 | Ga0207674_10049289 | 3300026116 | Bacteria | 4308 |
| 699 | Ga0207674_10111820 | 3300026116 | Bacteria | 2705 |
| 700 | Ga0207674_10205136 | 3300026116 | Unclassified | 1921 |
| 701 | Ga0207674_10539760 | 3300026116 | Bacteria | 1127 |
| 702 | Ga0207675_100165697 | 3300026118 | Bacteria | 2110 |
| 703 | Ga0207675_100242894 | 3300026118 | Bacteria | 1740 |
| 704 | Ga0207675_100296014 | 3300026118 | Bacteria | 1575 |
| 705 | Ga0207675_100578154 | 3300026118 | Unclassified | 1125 |
| 706 | Ga0207675_100678760 | 3300026118 | Bacteria | 1038 |
| 707 | Ga0207683_10014943 | 3300026121 | Bacteria | 6608 |
| 708 | Ga0207683_10625691 | 3300026121 | Bacteria | 997 |
| 709 | Ga0207698_10000618 | 3300026142 | Bacteria | 20690 |
| 710 | Ga0207698_10001533 | 3300026142 | Bacteria | 13466 |
| 711 | Ga0207698_10007701 | 3300026142 | Bacteria | 6757 |
| 712 | Ga0207698_10009367 | 3300026142 | Bacteria | 6242 |
| 713 | Ga0207698_10046260 | 3300026142 | Bacteria | 3285 |
| 714 | Ga0207698_10280976 | 3300026142 | Bacteria | 1540 |
| 715 | Ga0207698_10361244 | 3300026142 | Unclassified | 1375 |
| 716 | Ga0207698_10379957 | 3300026142 | Bacteria | 1343 |
| 717 | Ga0207698_10397596 | 3300026142 | Bacteria | 1316 |
| 718 | Ga0207698_10727625 | 3300026142 | Bacteria | 989 |
| 719 | Ga0268266_10005677 | 3300028379 | Bacteria | 11570 |
| 720 | Ga0268266_10022882 | 3300028379 | Bacteria | 5318 |
| 721 | Ga0268266_10422373 | 3300028379 | Bacteria | 1263 |
| 722 | Ga0268265_10003245 | 3300028380 | Bacteria | 11805 |
| 723 | Ga0268265_10059407 | 3300028380 | Bacteria | 2925 |
| 724 | Ga0268265_10199537 | 3300028380 | Bacteria | 1734 |
| 725 | Ga0268265_11013896 | 3300028380 | Archaea | 820 |
| 726 | Ga0268264_10002543 | 3300028381 | Bacteria | 16012 |
| 727 | Ga0268264_10035529 | 3300028381 | Bacteria | 4104 |
| 728 | Ga0268264_10073947 | 3300028381 | Unclassified | 2894 |
| 729 | Ga0268264_10157795 | 3300028381 | Bacteria | 2040 |
| 730 | Ga0268264_10573422 | 3300028381 | Unclassified | 1109 |
| 731 | Ga0307513_10390646 | 3300031456 | Unclassified | 1128 |
| 732 | Ga0307408_100021556 | 3300031548 | Bacteria | 4362 |
| 733 | Ga0307408_101050659 | 3300031548 | Unclassified | 753 |
| 734 | Ga0307408_101720449 | 3300031548 | Unclassified | 598 |
| 735 | Ga0307405_10457021 | 3300031731 | Unclassified | 1014 |
| 736 | Ga0307405_10586539 | 3300031731 | Bacteria | 907 |
| 737 | Ga0307405_10881887 | 3300031731 | Unclassified | 755 |
| 738 | Ga0307413_10267439 | 3300031824 | Bacteria | 1278 |
| 739 | Ga0307413_10487033 | 3300031824 | Bacteria | 987 |
| 740 | Ga0307410_10107788 | 3300031852 | Bacteria | 2010 |
| 741 | Ga0307410_10135140 | 3300031852 | Unclassified | 1817 |
| 742 | Ga0307410_10342574 | 3300031852 | Unclassified | 1192 |
| 743 | Ga0307410_10408551 | 3300031852 | Bacteria | 1098 |
| 744 | Ga0307410_11529900 | 3300031852 | Unclassified | 588 |
| 745 | Ga0307406_10006893 | 3300031901 | Bacteria | 6292 |
| 746 | Ga0307406_10094729 | 3300031901 | Bacteria | 2019 |
| 747 | Ga0307406_10183254 | 3300031901 | Bacteria | 1526 |
| 748 | Ga0307406_10304271 | 3300031901 | Bacteria | 1226 |
| 749 | Ga0307406_11360434 | 3300031901 | Unclassified | 621 |
| 750 | Ga0307407_10007704 | 3300031903 | Bacteria | 4891 |
| 751 | Ga0307407_10520960 | 3300031903 | Bacteria | 874 |
| 752 | Ga0307412_10050121 | 3300031911 | Bacteria | 2754 |
| 753 | Ga0307412_10125807 | 3300031911 | Bacteria | 1854 |
| 754 | Ga0307412_10129002 | 3300031911 | Bacteria | 1834 |
| 755 | Ga0307409_100018684 | 3300031995 | Bacteria | 4670 |
| 756 | Ga0307409_100391047 | 3300031995 | Bacteria | 1325 |
| 757 | Ga0307409_100415965 | 3300031995 | Bacteria | 1288 |
| 758 | Ga0307409_101495403 | 3300031995 | Bacteria | 703 |
| 759 | Ga0307416_100034296 | 3300032002 | Bacteria | 3860 |
| 760 | Ga0307416_100186537 | 3300032002 | Bacteria | 1950 |
| 761 | Ga0307416_100798430 | 3300032002 | Bacteria | 1039 |
| 762 | Ga0307416_101024117 | 3300032002 | Unclassified | 929 |
| 763 | Ga0307416_101170537 | 3300032002 | Bacteria | 874 |
| 764 | Ga0307416_101697613 | 3300032002 | Unclassified | 736 |
| 765 | Ga0307414_12034875 | 3300032004 | Bacteria | 536 |
| 766 | Ga0307411_10208232 | 3300032005 | Bacteria | 1508 |
| 767 | Ga0307411_10308733 | 3300032005 | Bacteria | 1272 |
| 768 | Ga0307411_11720663 | 3300032005 | Bacteria | 581 |
| 769 | Ga0307415_100019849 | 3300032126 | Bacteria | 4089 |
| 770 | Ga0307415_100022433 | 3300032126 | Bacteria | 3896 |
| 771 | Ga0307415_100027339 | 3300032126 | Bacteria | 3613 |
| 772 | Ga0307415_100494859 | 3300032126 | Bacteria | 1067 |
| 773 | Ga0307415_100808616 | 3300032126 | Bacteria | 856 |
| 774 | Ga0373930_0092002 | 3300034816 | Unclassified | 712 |
| 775 | Ga0373938_0099370 | 3300034957 | Unclassified | 729 |
| 776 | Ga0373949_0066931 | 3300035090 | Unclassified | 934 |
| 777 | Ga0373951_0066124 | 3300035091 | Unclassified | 913 |
| 778 | Ga0373923_0002141 | 3300035111 | Bacteria | 5983 |
| 779 | Ga0373955_0006945 | 3300035172 | Bacteria | 5179 |
| 780 | Ga0373961_0010280 | 3300035241 | Bacteria | 2303 |
| 781 | Ga0373962_0085039 | 3300035242 | Unclassified | 966 |
| 782 | Ga0373933_0003124 | 3300035724 | Bacteria | 9231 |
| 783 | Ga0373937_0000641 | 3300036401 | Bacteria | 30684 |
| 784 | Ga0395899_0006584 | 3300037312 | Bacteria | 8999 |
| 785 | Ga0395899_0030400 | 3300037312 | Bacteria | 4062 |
| 786 | Ga0395899_0038361 | 3300037312 | Bacteria | 3588 |
| 787 | Ga0395899_0098825 | 3300037312 | Bacteria | 2109 |
| 788 | Ga0395899_0105236 | 3300037312 | Bacteria | 2033 |
| 789 | Ga0395899_0191082 | 3300037312 | Unclassified | 1433 |
| 790 | Ga0395899_0289732 | 3300037312 | Bacteria | 1111 |
| 791 | Ga0395899_0893212 | 3300037312 | Unclassified | 542 |
| 792 | Ga0395900_0106528 | 3300037418 | Bacteria | 2879 |
| 793 | Ga0395900_0107348 | 3300037418 | Bacteria | 2868 |
| 794 | Ga0395900_0176876 | 3300037418 | Bacteria | 2170 |
| 795 | Ga0395900_0177213 | 3300037418 | Bacteria | 2168 |
| 796 | Ga0395900_0245885 | 3300037418 | Bacteria | 1792 |
| 797 | Ga0395900_0254630 | 3300037418 | Unclassified | 1755 |
| 798 | Ga0395900_0262855 | 3300037418 | Bacteria | 1723 |
| 799 | Ga0395900_0355503 | 3300037418 | Bacteria | 1437 |
| 800 | Ga0395900_0442792 | 3300037418 | Bacteria | 1256 |
| 801 | Ga0395900_0480745 | 3300037418 | Bacteria | 1194 |
| 802 | Ga0395900_0582697 | 3300037418 | Bacteria | 1060 |
| 803 | Ga0395900_0591238 | 3300037418 | Unclassified | 1051 |
| 804 | Ga0395900_0607838 | 3300037418 | Bacteria | 1033 |
| 805 | Ga0395900_0880782 | 3300037418 | Bacteria | 819 |
| 806 | Ga0395900_1415124 | 3300037418 | Unclassified | 608 |
| 807 | Ga0395900_1515835 | 3300037418 | Unclassified | 582 |
| 808 | Ga0395900_1551262 | 3300037418 | Bacteria | 574 |
| 809 | Ga0395898_0018087 | 3300037466 | Bacteria | 7191 |
| 810 | Ga0395898_0197787 | 3300037466 | Bacteria | 1920 |
| 811 | Ga0395898_0242749 | 3300037466 | Bacteria | 1718 |
| 812 | Ga0395898_0253928 | 3300037466 | Bacteria | 1676 |
| 813 | Ga0395898_0263788 | 3300037466 | Unclassified | 1643 |
| 814 | Ga0395905_0000092 | 3300037471 | Bacteria | 149300 |
| 815 | Ga0395905_0008699 | 3300037471 | Bacteria | 9994 |
| 816 | Ga0395905_0017027 | 3300037471 | Bacteria | 6900 |
| 817 | Ga0395905_0021465 | 3300037471 | Bacteria | 6105 |
| 818 | Ga0395905_0033987 | 3300037471 | Bacteria | 4789 |
| 819 | Ga0395905_0070313 | 3300037471 | Bacteria | 3279 |
| 820 | Ga0395905_0088340 | 3300037471 | Bacteria | 2905 |
| 821 | Ga0395905_0141907 | 3300037471 | Bacteria | 2259 |
| 822 | Ga0395905_0179826 | 3300037471 | Bacteria | 1985 |
| 823 | Ga0395905_0200560 | 3300037471 | Bacteria | 1871 |
| 824 | Ga0395905_0226216 | 3300037471 | Unclassified | 1750 |
| 825 | Ga0395905_0306016 | 3300037471 | Bacteria | 1477 |
| 826 | Ga0395905_0552801 | 3300037471 | Bacteria | 1052 |
| 827 | Ga0395905_0560942 | 3300037471 | Bacteria | 1043 |
| 828 | Ga0395905_0645510 | 3300037471 | Unclassified | 960 |
| 829 | Ga0395905_0683408 | 3300037471 | Bacteria | 929 |
| 830 | Ga0395905_0727473 | 3300037471 | Bacteria | 895 |
| 831 | Ga0395905_1114477 | 3300037471 | Bacteria | 692 |
| 832 | Ga0395905_1438209 | 3300037471 | Unclassified | 594 |
| 833 | Ga0395905_1553021 | 3300037471 | Unclassified | 566 |
| 834 | Ga0395905_1568637 | 3300037471 | Unclassified | 563 |
| 835 | Ga0395901_0000268 | 3300038443 | Bacteria | 64837 |
| 836 | Ga0395901_0037677 | 3300038443 | Bacteria | 5000 |
| 837 | Ga0395901_0109048 | 3300038443 | Bacteria | 2906 |
| 838 | Ga0395901_0117722 | 3300038443 | Bacteria | 2791 |
| 839 | Ga0395901_0157477 | 3300038443 | Bacteria | 2385 |
| 840 | Ga0395901_0201949 | 3300038443 | Bacteria | 2083 |
| 841 | Ga0395901_0211352 | 3300038443 | Bacteria | 2030 |
| 842 | Ga0395901_0229427 | 3300038443 | Bacteria | 1939 |
| 843 | Ga0395901_0323654 | 3300038443 | Bacteria | 1595 |
| 844 | Ga0395901_0590479 | 3300038443 | Bacteria | 1121 |
| 845 | Ga0395901_0755119 | 3300038443 | Unclassified | 965 |
| 846 | Ga0395901_1876385 | 3300038443 | Unclassified | 547 |
| 847 | Ga0451855_1685400 | 3300041511 | Bacteria | 650 |
| 848 | Ga0439464_0000674 | 3300042439 | Bacteria | 7353 |
| 849 | Ga0466965_0306418 | 3300044683 | Unclassified | 863 |
| 850 | Ga0466961_0577514 | 3300044693 | Bacteria | 676 |
| 851 | Ga0466963_0002161 | 3300044694 | Bacteria | 10866 |
| 852 | Ga0466963_0002953 | 3300044694 | Bacteria | 9608 |
| 853 | Ga0466963_0078078 | 3300044694 | Bacteria | 2238 |
| 854 | Ga0466963_0144024 | 3300044694 | Bacteria | 1652 |
| 855 | Ga0466963_0180407 | 3300044694 | Bacteria | 1474 |
| 856 | Ga0466963_0245265 | 3300044694 | Unclassified | 1257 |
| 857 | Ga0466963_0308765 | 3300044694 | Bacteria | 1112 |
| 858 | Ga0466963_0438438 | 3300044694 | Bacteria | 921 |
| 859 | Ga0466963_0536849 | 3300044694 | Bacteria | 826 |
| 860 | Ga0466964_0871166 | 3300044706 | Unclassified | 513 |
| 861 | Ga0466971_0111804 | 3300044719 | Bacteria | 1261 |
| 862 | Ga0466970_0049888 | 3300044765 | Bacteria | 2232 |
| 863 | Ga0466957_0019839 | 3300044842 | Bacteria | 3957 |
| 864 | Ga0466957_0035844 | 3300044842 | Bacteria | 2978 |
| 865 | Ga0466957_0489150 | 3300044842 | Unclassified | 852 |
| 866 | Ga0466957_0519122 | 3300044842 | Unclassified | 827 |
| 867 | Ga0466957_1261126 | 3300044842 | Unclassified | 536 |
| 868 | Ga0466960_0435484 | 3300044901 | Unclassified | 760 |
| 869 | Ga0466959_0052591 | 3300045049 | Bacteria | 2982 |
| 870 | Ga0466959_0324334 | 3300045049 | Unclassified | 1052 |
| 871 | Ga0466958_0141356 | 3300045836 | Unclassified | 1515 |
| 872 | Ga0466967_0020400 | 3300045976 | Bacteria | 5356 |
| 873 | Ga0466967_0029143 | 3300045976 | Bacteria | 4616 |
| 874 | Ga0466967_0037978 | 3300045976 | Bacteria | 4127 |
| 875 | Ga0466967_0045428 | 3300045976 | Bacteria | 3816 |
| 876 | Ga0466967_0050943 | 3300045976 | Bacteria | 3626 |
| 877 | Ga0466967_0076801 | 3300045976 | Bacteria | 3005 |
| 878 | Ga0466967_0099774 | 3300045976 | Bacteria | 2652 |
| 879 | Ga0466967_0139429 | 3300045976 | Bacteria | 2257 |
| 880 | Ga0466967_0283333 | 3300045976 | Bacteria | 1590 |
| 881 | Ga0466967_0368833 | 3300045976 | Bacteria | 1392 |
| 882 | Ga0466967_0519627 | 3300045976 | Bacteria | 1170 |
| 883 | Ga0466967_0625859 | 3300045976 | Bacteria | 1063 |
| 884 | Ga0466967_0737680 | 3300045976 | Bacteria | 976 |
| 885 | Ga0466967_0796071 | 3300045976 | Bacteria | 938 |
| 886 | Ga0466967_0944532 | 3300045976 | Unclassified | 858 |
| 887 | Ga0466967_0947702 | 3300045976 | Bacteria | 856 |
| 888 | Ga0495598_0011985 | 3300046537 | Bacteria | 2114 |
| 889 | Ga0495621_0000006 | 3300046539 | Bacteria | 44306 |
| 890 | Ga0495633_0091937 | 3300046558 | Bacteria | 1410 |
| 891 | Ga0495669_0022152 | 3300046684 | Bacteria | 2760 |
| 892 | Ga0495669_0215423 | 3300046684 | Bacteria | 920 |
| 893 | Ga0495669_0243948 | 3300046684 | Bacteria | 862 |
| 894 | Ga0495670_0000238 | 3300046691 | Bacteria | 25286 |
| 895 | Ga0495677_0368719 | 3300047445 | Bacteria | 567 |
| 896 | Ga0495602_0057394 | 3300048088 | Bacteria | 3415 |
| 897 | Ga0496100_0867835 | 3300048903 | Unclassified | 708 |
| 898 | Ga0496102_0520496 | 3300048905 | Bacteria | 1112 |
| 899 | Ga0496102_0806018 | 3300048905 | Bacteria | 861 |
| 900 | Ga0496103_0066322 | 3300048906 | Bacteria | 2253 |
| 901 | Ga0496103_0067421 | 3300048906 | Bacteria | 2235 |
| 902 | Ga0496105_0256588 | 3300048908 | Bacteria | 1415 |
| 903 | Ga0496106_0266612 | 3300048909 | Unclassified | 1371 |
| 904 | Ga0496107_0032199 | 3300048910 | Bacteria | 3746 |
| 905 | Ga0496107_0168768 | 3300048910 | Bacteria | 1623 |
| 906 | Ga0496108_0004323 | 3300048911 | Bacteria | 11421 |
| 907 | Ga0496109_0148582 | 3300048912 | Unclassified | 2193 |
| 908 | Ga0496110_0018857 | 3300048913 | Bacteria | 5795 |
| 909 | Ga0496110_1124815 | 3300048913 | Unclassified | 694 |
| 910 | Ga0496111_0460234 | 3300048914 | Unclassified | 938 |
| 911 | Ga0496112_0016189 | 3300048915 | Bacteria | 6977 |
| 912 | Ga0496112_0309916 | 3300048915 | Bacteria | 1524 |
| 913 | Ga0496112_0797084 | 3300048915 | Unclassified | 870 |
| 914 | Ga0496113_1339998 | 3300048916 | Unclassified | 556 |
| 915 | Ga0501070_0737083 | 3300049586 | Bacteria | 777 |
| 916 | Ga0501071_0668488 | 3300049587 | Bacteria | 799 |
| 917 | Ga0501074_0115947 | 3300049590 | Bacteria | 1916 |
| 918 | Ga0501079_1330750 | 3300049741 | Unclassified | 565 |
| 919 | Ga0501080_0023202 | 3300049742 | Bacteria | 5754 |
| 920 | Ga0501080_0112494 | 3300049742 | Bacteria | 2524 |
| 921 | nmdc:mga0rr50_286977_c1 | 3300050513 | Unclassified | 1374 |
| 922 | Ga0587084_014175 | 3300059477 | Unclassified | 1107 |
| 923 | Ga0587084_017887 | 3300059477 | Unclassified | 1028 |
| 924 | Ga0587084_019545 | 3300059477 | Bacteria | 999 |
| 925 | Ga0587084_043786 | 3300059477 | Bacteria | 770 |
| 926 | Ga0587066_023228 | 3300059490 | Bacteria | 1045 |
| 927 | Ga0587066_027294 | 3300059490 | Bacteria | 992 |
| 928 | Ga0587066_034196 | 3300059490 | Bacteria | 924 |
| 929 | Ga0587066_139051 | 3300059490 | Unclassified | 591 |
| 930 | Ga0587070_018388 | 3300059491 | Unclassified | 1145 |
| 931 | Ga0587073_0029922 | 3300059492 | Unclassified | 1117 |
| 932 | Ga0587073_0041186 | 3300059492 | Bacteria | 1007 |
| 933 | Ga0587073_0248447 | 3300059492 | Unclassified | 557 |
| 934 | Ga0587077_034230 | 3300059493 | Bacteria | 986 |
| 935 | Ga0587077_045904 | 3300059493 | Bacteria | 896 |
| 936 | Ga0587080_021155 | 3300059503 | Bacteria | 1068 |
| 937 | Ga0587080_027021 | 3300059503 | Bacteria | 978 |
| 938 | Ga0587080_034007 | 3300059503 | Bacteria | 901 |
| 939 | Ga0587082_034001 | 3300059504 | Bacteria | 903 |
| 940 | Ga0587082_035086 | 3300059504 | Bacteria | 894 |
| 941 | Ga0587082_036180 | 3300059504 | Unclassified | 884 |
| 942 | Ga0587082_139513 | 3300059504 | Unclassified | 564 |
| 943 | Ga0587083_0029666 | 3300059505 | Bacteria | 1079 |
| 944 | Ga0587083_0050676 | 3300059505 | Bacteria | 904 |
| 945 | Ga0587083_0053251 | 3300059505 | Bacteria | 889 |
| 946 | Ga0587085_006090 | 3300059506 | Bacteria | 1452 |
| 947 | Ga0587085_024211 | 3300059506 | Bacteria | 950 |
| 948 | Ga0587086_014946 | 3300059507 | Bacteria | 996 |
| 949 | Ga0587086_020521 | 3300059507 | Bacteria | 898 |
| 950 | Ga0587088_005461 | 3300059508 | Bacteria | 1673 |
| 951 | Ga0587088_028967 | 3300059508 | Bacteria | 978 |
| 952 | Ga0587088_033577 | 3300059508 | Bacteria | 931 |
| 953 | Ga0587089_020133 | 3300059509 | Unclassified | 917 |
| 954 | Ga0587089_021695 | 3300059509 | Bacteria | 893 |
| 955 | Ga0587089_051640 | 3300059509 | Unclassified | 661 |
| 956 | Ga0587090_015200 | 3300059510 | Unclassified | 1135 |
| 957 | Ga0587090_018489 | 3300059510 | Bacteria | 1065 |
| 958 | Ga0587090_030190 | 3300059510 | Bacteria | 902 |
| 959 | Ga0587090_037292 | 3300059510 | Bacteria | 841 |
| 960 | Ga0587091_017818 | 3300059511 | Unclassified | 1201 |
| 961 | Ga0587091_024021 | 3300059511 | Bacteria | 1090 |
| 962 | Ga0587091_042426 | 3300059511 | Bacteria | 903 |
| 963 | Ga0587094_014432 | 3300059513 | Unclassified | 1079 |
| 964 | Ga0587094_018969 | 3300059513 | Bacteria | 983 |
| 965 | Ga0587095_005087 | 3300059514 | Bacteria | 984 |
| 966 | Ga0587095_006724 | 3300059514 | Bacteria | 899 |
| 967 | Ga0587074_03528 | 3300059602 | Unclassified | 555 |
| 968 | Ga0587106_015710 | 3300059605 | Bacteria | 1061 |
| 969 | Ga0587106_026336 | 3300059605 | Bacteria | 903 |
| 970 | Ga0587106_110278 | 3300059605 | Unclassified | 572 |
| 971 | Ga0587099_010211 | 3300059622 | Unclassified | 934 |
| 972 | Ga0587101_016965 | 3300059623 | Bacteria | 1004 |
| 973 | Ga0587101_019836 | 3300059623 | Bacteria | 957 |
| 974 | Ga0587109_038372 | 3300059624 | Unclassified | 940 |
| 975 | Ga0587113_009418 | 3300059625 | Bacteria | 885 |
| 976 | Ga0587128_020109 | 3300059630 | Bacteria | 1017 |
| 977 | Ga0587128_022297 | 3300059630 | Bacteria | 984 |
| 978 | Ga0587128_027758 | 3300059630 | Unclassified | 917 |
| 979 | Ga0587130_009408 | 3300059631 | Bacteria | 941 |
| 980 | Ga0587062_022745 | 3300059639 | Bacteria | 903 |
| 981 | Ga0587067_024876 | 3300059640 | Unclassified | 1061 |
| 982 | Ga0587067_038826 | 3300059640 | Bacteria | 916 |
| 983 | Ga0587068_031180 | 3300059641 | Bacteria | 925 |
| 984 | Ga0587068_033680 | 3300059641 | Bacteria | 900 |
| 985 | Ga0587069_019882 | 3300059642 | Bacteria | 997 |
| 986 | Ga0587069_030174 | 3300059642 | Bacteria | 872 |
| 987 | Ga0587069_124508 | 3300059642 | Unclassified | 550 |
| 988 | Ga0587072_031365 | 3300059643 | Bacteria | 994 |
| 989 | Ga0587072_038769 | 3300059643 | Bacteria | 918 |
| 990 | Ga0587075_012011 | 3300059644 | Bacteria | 1170 |
| 991 | Ga0587075_013438 | 3300059644 | Unclassified | 1126 |
| 992 | Ga0587075_016342 | 3300059644 | Bacteria | 1054 |
| 993 | Ga0587075_026979 | 3300059644 | Bacteria | 892 |
| 994 | Ga0587075_027629 | 3300059644 | Bacteria | 885 |
| 995 | Ga0587076_021445 | 3300059645 | Bacteria | 1070 |
| 996 | Ga0587076_035552 | 3300059645 | Bacteria | 906 |
| 997 | Ga0587076_036615 | 3300059645 | Bacteria | 898 |
| 998 | Ga0587078_001873 | 3300059646 | Bacteria | 1964 |
| 999 | Ga0587078_011898 | 3300059646 | Bacteria | 1016 |
| 1000 | Ga0587078_012899 | 3300059646 | Bacteria | 984 |
| 1001 | Ga0587079_026649 | 3300059647 | Unclassified | 1082 |
| 1002 | Ga0587079_032180 | 3300059647 | Bacteria | 1014 |
| 1003 | Ga0587079_063490 | 3300059647 | Unclassified | 806 |
| 1004 | Ga0587079_065604 | 3300059647 | Unclassified | 797 |
| 1005 | Ga0587102_007703 | 3300059649 | Bacteria | 1008 |
| 1006 | Ga0587102_023221 | 3300059649 | Bacteria | 715 |
| 1007 | Ga0587107_008996 | 3300059652 | Unclassified | 1168 |
| 1008 | Ga0587107_017830 | 3300059652 | Bacteria | 955 |
| 1009 | Ga0587107_017898 | 3300059652 | Bacteria | 953 |
| 1010 | Ga0587119_011274 | 3300059658 | Bacteria | 1027 |
| 1011 | Ga0587119_015410 | 3300059658 | Bacteria | 926 |
| 1012 | Ga0587071_027880 | 3300060344 | Unclassified | 1072 |
| 1013 | Ga0587071_028594 | 3300060344 | Unclassified | 1062 |
| 1014 | Ga0587071_030866 | 3300060344 | Bacteria | 1031 |
| 1015 | Ga0587071_040026 | 3300060344 | Bacteria | 936 |
| 1016 | Ga0587111_0052710 | 3300060346 | Bacteria | 903 |
| 1017 | Ga0587111_0088722 | 3300060346 | Unclassified | 751 |
| 1018 | Ga0466962_0115600 | 3300061719 | Unclassified | 1293 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005367 | Ga0070667_100086776 | Ga0070667_1000867763 | 118 |
| 2 | 3300005617 | Ga0068859_100904590 | Ga0068859_1009045902 | 118 |
| 3 | 3300005719 | Ga0068861_100430982 | Ga0068861_1004309822 | 118 |
| 4 | 3300006237 | Ga0097621_101019463 | Ga0097621_1010194632 | 118 |
| 5 | 3300006931 | Ga0097620_100904739 | Ga0097620_1009047392 | 118 |
| 6 | 3300025929 | Ga0207664_10251689 | Ga0207664_102516893 | 120 |
| 7 | 3300031852 | Ga0307410_10342574 | Ga0307410_103425741 | 120 |
| 8 | 3300031901 | Ga0307406_10183254 | Ga0307406_101832542 | 120 |
| 9 | 3300032002 | Ga0307416_101697613 | Ga0307416_1016976132 | 120 |
| 10 | 3300032005 | Ga0307411_10308733 | Ga0307411_103087332 | 120 |
| 11 | 3300032126 | Ga0307415_100808616 | Ga0307415_1008086161 | 120 |
| 12 | 3300044694 | Ga0466963_0308765 | Ga0466963_0308765_685_1068 | 121 |
| 13 | 3300005618 | Ga0068864_100180268 | Ga0068864_1001802681 | 122 |
| 14 | 3300031548 | Ga0307408_100021556 | Ga0307408_1000215563 | 122 |
| 15 | 3300031824 | Ga0307413_10487033 | Ga0307413_104870332 | 122 |
| 16 | 3300031852 | Ga0307410_10408551 | Ga0307410_104085512 | 122 |
| 17 | 3300031901 | Ga0307406_10006893 | Ga0307406_100068933 | 122 |
| 18 | 3300031903 | Ga0307407_10007704 | Ga0307407_100077044 | 122 |
| 19 | 3300031911 | Ga0307412_10050121 | Ga0307412_100501213 | 122 |
| 20 | 3300031995 | Ga0307409_100018684 | Ga0307409_1000186845 | 122 |
| 21 | 3300032002 | Ga0307416_100034296 | Ga0307416_1000342964 | 122 |
| 22 | 3300032002 | Ga0307416_101024117 | Ga0307416_1010241172 | 122 |
| 23 | 3300032126 | Ga0307415_100019849 | Ga0307415_1000198493 | 122 |
| 24 | 3300045976 | Ga0466967_0020400 | Ga0466967_0020400_1245_1652 | 122 |
| 25 | 3300046684 | Ga0495669_0215423 | Ga0495669_0215423_168_572 | 122 |
| 26 | 3300037471 | Ga0395905_0683408 | Ga0395905_0683408_318_704 | 123 |
| 27 | 3300037471 | Ga0395905_1568637 | Ga0395905_1568637_128_514 | 123 |
| 28 | 3300048903 | Ga0496100_0867835 | Ga0496100_0867835_73_465 | 123 |
| 29 | 3300004799 | Ga0058863_11670502 | Ga0058863_116705021 | 124 |
| 30 | 3300005331 | Ga0070670_100564450 | Ga0070670_1005644502 | 124 |
| 31 | 3300005364 | Ga0070673_100996216 | Ga0070673_1009962162 | 124 |
| 32 | 3300005366 | Ga0070659_100603853 | Ga0070659_1006038532 | 124 |
| 33 | 3300005457 | Ga0070662_101383194 | Ga0070662_1013831941 | 124 |
| 34 | 3300005530 | Ga0070679_101329082 | Ga0070679_1013290821 | 124 |
| 35 | 3300005577 | Ga0068857_100413628 | Ga0068857_1004136282 | 124 |
| 36 | 3300025921 | Ga0207652_10437556 | Ga0207652_104375563 | 124 |
| 37 | 3300025933 | Ga0207706_10676408 | Ga0207706_106764082 | 124 |
| 38 | 3300031548 | Ga0307408_101050659 | Ga0307408_1010506591 | 124 |
| 39 | 3300031731 | Ga0307405_10881887 | Ga0307405_108818871 | 124 |
| 40 | 3300037312 | Ga0395899_0191082 | Ga0395899_0191082_192_578 | 124 |
| 41 | 3300037418 | Ga0395900_0177213 | Ga0395900_0177213_1151_1537 | 124 |
| 42 | 3300037418 | Ga0395900_0591238 | Ga0395900_0591238_585_980 | 124 |
| 43 | 3300037418 | Ga0395900_1515835 | Ga0395900_1515835_129_518 | 124 |
| 44 | 3300037471 | Ga0395905_0070313 | Ga0395905_0070313_2511_2897 | 124 |
| 45 | 3300044694 | Ga0466963_0536849 | Ga0466963_0536849_330_740 | 124 |
| 46 | 3300045976 | Ga0466967_0045428 | Ga0466967_0045428_1156_1545 | 124 |
| 47 | 3300045976 | Ga0466967_0099774 | Ga0466967_0099774_220_630 | 124 |
| 48 | 3300045976 | Ga0466967_0625859 | Ga0466967_0625859_508_918 | 124 |
| 49 | 3300049590 | Ga0501074_0115947 | Ga0501074_0115947_1462_1857 | 124 |
| 50 | 3300049741 | Ga0501079_1330750 | Ga0501079_1330750_98_493 | 124 |
| 51 | 3300049742 | Ga0501080_0023202 | Ga0501080_0023202_3881_4276 | 124 |
| 52 | 3300059510 | Ga0587090_018489 | Ga0587090_018489_209_595 | 124 |
| 53 | 3300059647 | Ga0587079_065604 | Ga0587079_065604_281_667 | 124 |
| 54 | 3300004803 | Ga0058862_12414424 | Ga0058862_124144241 | 125 |
| 55 | 3300005290 | Ga0065712_10247602 | Ga0065712_102476022 | 125 |
| 56 | 3300005327 | Ga0070658_10020280 | Ga0070658_100202805 | 125 |
| 57 | 3300005328 | Ga0070676_10120809 | Ga0070676_101208093 | 125 |
| 58 | 3300005329 | Ga0070683_100268394 | Ga0070683_1002683942 | 125 |
| 59 | 3300005329 | Ga0070683_100749937 | Ga0070683_1007499372 | 125 |
| 60 | 3300005344 | Ga0070661_100008264 | Ga0070661_1000082643 | 125 |
| 61 | 3300005353 | Ga0070669_100614306 | Ga0070669_1006143062 | 125 |
| 62 | 3300005355 | Ga0070671_100012445 | Ga0070671_1000124452 | 125 |
| 63 | 3300005366 | Ga0070659_100011551 | Ga0070659_1000115514 | 125 |
| 64 | 3300005366 | Ga0070659_100013967 | Ga0070659_1000139679 | 125 |
| 65 | 3300005366 | Ga0070659_101117178 | Ga0070659_1011171781 | 125 |
| 66 | 3300005367 | Ga0070667_100011257 | Ga0070667_1000112572 | 125 |
| 67 | 3300005455 | Ga0070663_101033811 | Ga0070663_1010338111 | 125 |
| 68 | 3300005457 | Ga0070662_100103504 | Ga0070662_1001035042 | 125 |
| 69 | 3300005457 | Ga0070662_100168055 | Ga0070662_1001680552 | 125 |
| 70 | 3300005530 | Ga0070679_100398756 | Ga0070679_1003987561 | 125 |
| 71 | 3300005530 | Ga0070679_102074640 | Ga0070679_1020746401 | 125 |
| 72 | 3300005546 | Ga0070696_100815875 | Ga0070696_1008158751 | 125 |
| 73 | 3300005547 | Ga0070693_100068659 | Ga0070693_1000686593 | 125 |
| 74 | 3300005548 | Ga0070665_100100909 | Ga0070665_1001009093 | 125 |
| 75 | 3300005548 | Ga0070665_100119667 | Ga0070665_1001196672 | 125 |
| 76 | 3300005563 | Ga0068855_101023477 | Ga0068855_1010234772 | 125 |
| 77 | 3300005564 | Ga0070664_100002696 | Ga0070664_1000026963 | 125 |
| 78 | 3300005564 | Ga0070664_100862659 | Ga0070664_1008626592 | 125 |
| 79 | 3300005577 | Ga0068857_100018518 | Ga0068857_1000185183 | 125 |
| 80 | 3300005578 | Ga0068854_100411489 | Ga0068854_1004114892 | 125 |
| 81 | 3300005614 | Ga0068856_100023316 | Ga0068856_10002331610 | 125 |
| 82 | 3300005614 | Ga0068856_100334692 | Ga0068856_1003346922 | 125 |
| 83 | 3300005617 | Ga0068859_100048611 | Ga0068859_1000486112 | 125 |
| 84 | 3300005618 | Ga0068864_100007380 | Ga0068864_1000073808 | 125 |
| 85 | 3300005834 | Ga0068851_10167365 | Ga0068851_101673652 | 125 |
| 86 | 3300005840 | Ga0068870_10103315 | Ga0068870_101033152 | 125 |
| 87 | 3300005841 | Ga0068863_100116639 | Ga0068863_1001166392 | 125 |
| 88 | 3300005843 | Ga0068860_100061591 | Ga0068860_1000615914 | 125 |
| 89 | 3300006237 | Ga0097621_100493047 | Ga0097621_1004930472 | 125 |
| 90 | 3300006358 | Ga0068871_100011090 | Ga0068871_1000110907 | 125 |
| 91 | 3300006358 | Ga0068871_101378884 | Ga0068871_1013788842 | 125 |
| 92 | 3300006931 | Ga0097620_100048612 | Ga0097620_1000486124 | 125 |
| 93 | 3300009551 | Ga0105238_10327601 | Ga0105238_103276013 | 125 |
| 94 | 3300013100 | Ga0157373_10092027 | Ga0157373_100920272 | 125 |
| 95 | 3300013100 | Ga0157373_10102375 | Ga0157373_101023753 | 125 |
| 96 | 3300013100 | Ga0157373_10193781 | Ga0157373_101937813 | 125 |
| 97 | 3300013102 | Ga0157371_10870781 | Ga0157371_108707811 | 125 |
| 98 | 3300013104 | Ga0157370_10059532 | Ga0157370_100595323 | 125 |
| 99 | 3300025321 | Ga0207656_10461209 | Ga0207656_104612092 | 125 |
| 100 | 3300025735 | Ga0207713_1039137 | Ga0207713_10391373 | 125 |
| 101 | 3300025907 | Ga0207645_10063906 | Ga0207645_100639062 | 125 |
| 102 | 3300025912 | Ga0207707_10453823 | Ga0207707_104538232 | 125 |
| 103 | 3300025917 | Ga0207660_10034958 | Ga0207660_100349584 | 125 |
| 104 | 3300025918 | Ga0207662_10077107 | Ga0207662_100771072 | 125 |
| 105 | 3300025920 | Ga0207649_10070046 | Ga0207649_100700463 | 125 |
| 106 | 3300025920 | Ga0207649_10183527 | Ga0207649_101835272 | 125 |
| 107 | 3300025921 | Ga0207652_10825776 | Ga0207652_108257761 | 125 |
| 108 | 3300025921 | Ga0207652_11286989 | Ga0207652_112869891 | 125 |
| 109 | 3300025924 | Ga0207694_10921080 | Ga0207694_109210802 | 125 |
| 110 | 3300025931 | Ga0207644_10227290 | Ga0207644_102272902 | 125 |
| 111 | 3300025932 | Ga0207690_10050183 | Ga0207690_100501833 | 125 |
| 112 | 3300025932 | Ga0207690_10201848 | Ga0207690_102018481 | 125 |
| 113 | 3300025932 | Ga0207690_10640821 | Ga0207690_106408212 | 125 |
| 114 | 3300025933 | Ga0207706_10101934 | Ga0207706_101019342 | 125 |
| 115 | 3300025933 | Ga0207706_10158840 | Ga0207706_101588402 | 125 |
| 116 | 3300025945 | Ga0207679_10100327 | Ga0207679_101003273 | 125 |
| 117 | 3300025945 | Ga0207679_10354516 | Ga0207679_103545162 | 125 |
| 118 | 3300025945 | Ga0207679_10531731 | Ga0207679_105317312 | 125 |
| 119 | 3300025986 | Ga0207658_10018455 | Ga0207658_100184558 | 125 |
| 120 | 3300026035 | Ga0207703_10088896 | Ga0207703_100888963 | 125 |
| 121 | 3300026067 | Ga0207678_10176738 | Ga0207678_101767383 | 125 |
| 122 | 3300026067 | Ga0207678_10502746 | Ga0207678_105027462 | 125 |
| 123 | 3300026078 | Ga0207702_10015012 | Ga0207702_100150128 | 125 |
| 124 | 3300026078 | Ga0207702_10208008 | Ga0207702_102080082 | 125 |
| 125 | 3300026088 | Ga0207641_10019349 | Ga0207641_100193492 | 125 |
| 126 | 3300026088 | Ga0207641_11196227 | Ga0207641_111962272 | 125 |
| 127 | 3300026095 | Ga0207676_10008483 | Ga0207676_100084839 | 125 |
| 128 | 3300026116 | Ga0207674_10000527 | Ga0207674_1000052743 | 125 |
| 129 | 3300028379 | Ga0268266_10022882 | Ga0268266_100228823 | 125 |
| 130 | 3300028379 | Ga0268266_10422373 | Ga0268266_104223731 | 125 |
| 131 | 3300028381 | Ga0268264_10073947 | Ga0268264_100739472 | 125 |
| 132 | 3300031731 | Ga0307405_10457021 | Ga0307405_104570212 | 125 |
| 133 | 3300031901 | Ga0307406_10094729 | Ga0307406_100947292 | 125 |
| 134 | 3300031911 | Ga0307412_10125807 | Ga0307412_101258072 | 125 |
| 135 | 3300031995 | Ga0307409_101495403 | Ga0307409_1014954032 | 125 |
| 136 | 3300032002 | Ga0307416_100798430 | Ga0307416_1007984302 | 125 |
| 137 | 3300032004 | Ga0307414_12034875 | Ga0307414_120348751 | 125 |
| 138 | 3300032126 | Ga0307415_100027339 | Ga0307415_1000273393 | 125 |
| 139 | 3300037312 | Ga0395899_0006584 | Ga0395899_0006584_938_1342 | 125 |
| 140 | 3300037312 | Ga0395899_0289732 | Ga0395899_0289732_225_617 | 125 |
| 141 | 3300037418 | Ga0395900_0106528 | Ga0395900_0106528_1216_1608 | 125 |
| 142 | 3300037418 | Ga0395900_0355503 | Ga0395900_0355503_270_662 | 125 |
| 143 | 3300037418 | Ga0395900_0480745 | Ga0395900_0480745_212_616 | 125 |
| 144 | 3300037418 | Ga0395900_0880782 | Ga0395900_0880782_347_739 | 125 |
| 145 | 3300037418 | Ga0395900_1415124 | Ga0395900_1415124_140_556 | 125 |
| 146 | 3300037418 | Ga0395900_1551262 | Ga0395900_1551262_113_508 | 125 |
| 147 | 3300037466 | Ga0395898_0242749 | Ga0395898_0242749_161_553 | 125 |
| 148 | 3300037466 | Ga0395898_0253928 | Ga0395898_0253928_1042_1434 | 125 |
| 149 | 3300037466 | Ga0395898_0263788 | Ga0395898_0263788_343_759 | 125 |
| 150 | 3300037471 | Ga0395905_0021465 | Ga0395905_0021465_1678_2073 | 125 |
| 151 | 3300037471 | Ga0395905_0033987 | Ga0395905_0033987_821_1225 | 125 |
| 152 | 3300037471 | Ga0395905_0088340 | Ga0395905_0088340_1730_2122 | 125 |
| 153 | 3300037471 | Ga0395905_0179826 | Ga0395905_0179826_1216_1608 | 125 |
| 154 | 3300037471 | Ga0395905_0200560 | Ga0395905_0200560_1245_1637 | 125 |
| 155 | 3300037471 | Ga0395905_0226216 | Ga0395905_0226216_384_800 | 125 |
| 156 | 3300038443 | Ga0395901_0037677 | Ga0395901_0037677_1216_1608 | 125 |
| 157 | 3300038443 | Ga0395901_0117722 | Ga0395901_0117722_555_959 | 125 |
| 158 | 3300038443 | Ga0395901_0755119 | Ga0395901_0755119_278_670 | 125 |
| 159 | 3300044694 | Ga0466963_0002161 | Ga0466963_0002161_8862_9263 | 125 |
| 160 | 3300045049 | Ga0466959_0052591 | Ga0466959_0052591_2528_2950 | 125 |
| 161 | 3300045976 | Ga0466967_0037978 | Ga0466967_0037978_981_1382 | 125 |
| 162 | 3300048905 | Ga0496102_0806018 | Ga0496102_0806018_264_659 | 125 |
| 163 | 3300048906 | Ga0496103_0067421 | Ga0496103_0067421_1531_1926 | 125 |
| 164 | 3300048908 | Ga0496105_0256588 | Ga0496105_0256588_602_997 | 125 |
| 165 | 3300048910 | Ga0496107_0032199 | Ga0496107_0032199_1888_2283 | 125 |
| 166 | 3300048911 | Ga0496108_0004323 | Ga0496108_0004323_310_705 | 125 |
| 167 | 3300048912 | Ga0496109_0148582 | Ga0496109_0148582_1174_1569 | 125 |
| 168 | 3300048913 | Ga0496110_0018857 | Ga0496110_0018857_530_925 | 125 |
| 169 | 3300048915 | Ga0496112_0016189 | Ga0496112_0016189_2691_3086 | 125 |
| 170 | 3300049586 | Ga0501070_0737083 | Ga0501070_0737083_12_410 | 125 |
| 171 | 3300049587 | Ga0501071_0668488 | Ga0501071_0668488_342_740 | 125 |
| 172 | 3300049742 | Ga0501080_0112494 | Ga0501080_0112494_2023_2421 | 125 |
| 173 | 3300059477 | Ga0587084_019545 | Ga0587084_019545_83_478 | 125 |
| 174 | 3300059490 | Ga0587066_139051 | Ga0587066_139051_177_569 | 125 |
| 175 | 3300059503 | Ga0587080_021155 | Ga0587080_021155_502_897 | 125 |
| 176 | 3300059505 | Ga0587083_0029666 | Ga0587083_0029666_506_901 | 125 |
| 177 | 3300059506 | Ga0587085_006090 | Ga0587085_006090_657_1052 | 125 |
| 178 | 3300059508 | Ga0587088_033577 | Ga0587088_033577_20_415 | 125 |
| 179 | 3300059511 | Ga0587091_024021 | Ga0587091_024021_535_930 | 125 |
| 180 | 3300059513 | Ga0587094_018969 | Ga0587094_018969_513_908 | 125 |
| 181 | 3300059514 | Ga0587095_005087 | Ga0587095_005087_502_897 | 125 |
| 182 | 3300059623 | Ga0587101_019836 | Ga0587101_019836_512_907 | 125 |
| 183 | 3300059630 | Ga0587128_022297 | Ga0587128_022297_574_969 | 125 |
| 184 | 3300059640 | Ga0587067_038826 | Ga0587067_038826_30_425 | 125 |
| 185 | 3300059641 | Ga0587068_031180 | Ga0587068_031180_512_907 | 125 |
| 186 | 3300059644 | Ga0587075_012011 | Ga0587075_012011_647_1042 | 125 |
| 187 | 3300059652 | Ga0587107_017830 | Ga0587107_017830_58_453 | 125 |
| 188 | 3300059658 | Ga0587119_015410 | Ga0587119_015410_10_405 | 125 |
| 189 | 3300060344 | Ga0587071_030866 | Ga0587071_030866_120_515 | 125 |
| 190 | 3300061719 | Ga0466962_0115600 | Ga0466962_0115600_746_1168 | 125 |
| 191 | 3300005327 | Ga0070658_10133965 | Ga0070658_101339653 | 126 |
| 192 | 3300005455 | Ga0070663_100225129 | Ga0070663_1002251292 | 126 |
| 193 | 3300005457 | Ga0070662_100287009 | Ga0070662_1002870091 | 126 |
| 194 | 3300005564 | Ga0070664_100276125 | Ga0070664_1002761253 | 126 |
| 195 | 3300005564 | Ga0070664_100977906 | Ga0070664_1009779061 | 126 |
| 196 | 3300005616 | Ga0068852_102470375 | Ga0068852_1024703751 | 126 |
| 197 | 3300025909 | Ga0207705_10065899 | Ga0207705_100658993 | 126 |
| 198 | 3300025909 | Ga0207705_11141639 | Ga0207705_111416391 | 126 |
| 199 | 3300025915 | Ga0207693_10016003 | Ga0207693_100160039 | 126 |
| 200 | 3300025933 | Ga0207706_10260604 | Ga0207706_102606042 | 126 |
| 201 | 3300025944 | Ga0207661_10783699 | Ga0207661_107836992 | 126 |
| 202 | 3300025945 | Ga0207679_10032946 | Ga0207679_100329462 | 126 |
| 203 | 3300025945 | Ga0207679_11442595 | Ga0207679_114425951 | 126 |
| 204 | 3300026067 | Ga0207678_10300599 | Ga0207678_103005992 | 126 |
| 205 | 3300026116 | Ga0207674_10024167 | Ga0207674_100241678 | 126 |
| 206 | 3300031456 | Ga0307513_10390646 | Ga0307513_103906463 | 126 |
| 207 | 3300031548 | Ga0307408_101720449 | Ga0307408_1017204491 | 126 |
| 208 | 3300031852 | Ga0307410_10107788 | Ga0307410_101077882 | 126 |
| 209 | 3300031852 | Ga0307410_11529900 | Ga0307410_115299002 | 126 |
| 210 | 3300031901 | Ga0307406_11360434 | Ga0307406_113604341 | 126 |
| 211 | 3300031911 | Ga0307412_10129002 | Ga0307412_101290022 | 126 |
| 212 | 3300031995 | Ga0307409_100391047 | Ga0307409_1003910473 | 126 |
| 213 | 3300032005 | Ga0307411_11720663 | Ga0307411_117206631 | 126 |
| 214 | 3300032126 | Ga0307415_100494859 | Ga0307415_1004948591 | 126 |
| 215 | 3300037418 | Ga0395900_0262855 | Ga0395900_0262855_234_629 | 126 |
| 216 | 3300037418 | Ga0395900_0607838 | Ga0395900_0607838_168_569 | 126 |
| 217 | 3300037471 | Ga0395905_0017027 | Ga0395905_0017027_5148_5543 | 126 |
| 218 | 3300037471 | Ga0395905_0727473 | Ga0395905_0727473_420_812 | 126 |
| 219 | 3300037471 | Ga0395905_1438209 | Ga0395905_1438209_162_563 | 126 |
| 220 | 3300038443 | Ga0395901_0323654 | Ga0395901_0323654_802_1203 | 126 |
| 221 | 3300044693 | Ga0466961_0577514 | Ga0466961_0577514_218_616 | 126 |
| 222 | 3300044694 | Ga0466963_0245265 | Ga0466963_0245265_393_791 | 126 |
| 223 | 3300044719 | Ga0466971_0111804 | Ga0466971_0111804_368_766 | 126 |
| 224 | 3300044765 | Ga0466970_0049888 | Ga0466970_0049888_1157_1555 | 126 |
| 225 | 3300044842 | Ga0466957_0019839 | Ga0466957_0019839_1226_1624 | 126 |
| 226 | 3300045049 | Ga0466959_0324334 | Ga0466959_0324334_174_572 | 126 |
| 227 | 3300045836 | Ga0466958_0141356 | Ga0466958_0141356_1069_1467 | 126 |
| 228 | 3300045976 | Ga0466967_0944532 | Ga0466967_0944532_320_718 | 126 |
| 229 | 3300045976 | Ga0466967_0947702 | Ga0466967_0947702_190_585 | 126 |
| 230 | 3300047445 | Ga0495677_0368719 | Ga0495677_0368719_71_463 | 126 |
| 231 | 3300002067 | JGI24735J21928_10003163 | JGI24735J21928_100031637 | 127 |
| 232 | 3300004799 | Ga0058863_11870082 | Ga0058863_118700821 | 127 |
| 233 | 3300004800 | Ga0058861_11885830 | Ga0058861_118858302 | 127 |
| 234 | 3300004800 | Ga0058861_12010952 | Ga0058861_120109521 | 127 |
| 235 | 3300005327 | Ga0070658_10017337 | Ga0070658_100173376 | 127 |
| 236 | 3300005327 | Ga0070658_10203782 | Ga0070658_102037822 | 127 |
| 237 | 3300005327 | Ga0070658_10290916 | Ga0070658_102909163 | 127 |
| 238 | 3300005327 | Ga0070658_10682718 | Ga0070658_106827182 | 127 |
| 239 | 3300005328 | Ga0070676_10003695 | Ga0070676_100036959 | 127 |
| 240 | 3300005328 | Ga0070676_11095783 | Ga0070676_110957831 | 127 |
| 241 | 3300005329 | Ga0070683_100174143 | Ga0070683_1001741432 | 127 |
| 242 | 3300005334 | Ga0068869_101175150 | Ga0068869_1011751502 | 127 |
| 243 | 3300005335 | Ga0070666_10070029 | Ga0070666_100700293 | 127 |
| 244 | 3300005336 | Ga0070680_100214594 | Ga0070680_1002145942 | 127 |
| 245 | 3300005336 | Ga0070680_101013615 | Ga0070680_1010136151 | 127 |
| 246 | 3300005337 | Ga0070682_100043356 | Ga0070682_1000433562 | 127 |
| 247 | 3300005339 | Ga0070660_100003141 | Ga0070660_1000031417 | 127 |
| 248 | 3300005339 | Ga0070660_100240795 | Ga0070660_1002407952 | 127 |
| 249 | 3300005339 | Ga0070660_100470796 | Ga0070660_1004707962 | 127 |
| 250 | 3300005341 | Ga0070691_10035664 | Ga0070691_100356643 | 127 |
| 251 | 3300005343 | Ga0070687_100212620 | Ga0070687_1002126202 | 127 |
| 252 | 3300005344 | Ga0070661_100001960 | Ga0070661_1000019605 | 127 |
| 253 | 3300005344 | Ga0070661_100036793 | Ga0070661_1000367933 | 127 |
| 254 | 3300005344 | Ga0070661_100182595 | Ga0070661_1001825952 | 127 |
| 255 | 3300005347 | Ga0070668_100001719 | Ga0070668_1000017199 | 127 |
| 256 | 3300005353 | Ga0070669_100021055 | Ga0070669_1000210554 | 127 |
| 257 | 3300005355 | Ga0070671_100121365 | Ga0070671_1001213653 | 127 |
| 258 | 3300005356 | Ga0070674_100036573 | Ga0070674_1000365733 | 127 |
| 259 | 3300005364 | Ga0070673_100178351 | Ga0070673_1001783512 | 127 |
| 260 | 3300005366 | Ga0070659_100040228 | Ga0070659_1000402282 | 127 |
| 261 | 3300005366 | Ga0070659_100041644 | Ga0070659_1000416444 | 127 |
| 262 | 3300005366 | Ga0070659_100089596 | Ga0070659_1000895962 | 127 |
| 263 | 3300005366 | Ga0070659_100257942 | Ga0070659_1002579422 | 127 |
| 264 | 3300005366 | Ga0070659_101099487 | Ga0070659_1010994871 | 127 |
| 265 | 3300005367 | Ga0070667_100024205 | Ga0070667_1000242054 | 127 |
| 266 | 3300005367 | Ga0070667_100228041 | Ga0070667_1002280412 | 127 |
| 267 | 3300005367 | Ga0070667_100263961 | Ga0070667_1002639612 | 127 |
| 268 | 3300005367 | Ga0070667_100383781 | Ga0070667_1003837812 | 127 |
| 269 | 3300005367 | Ga0070667_100385592 | Ga0070667_1003855922 | 127 |
| 270 | 3300005455 | Ga0070663_100126737 | Ga0070663_1001267372 | 127 |
| 271 | 3300005455 | Ga0070663_100161020 | Ga0070663_1001610203 | 127 |
| 272 | 3300005456 | Ga0070678_100098389 | Ga0070678_1000983892 | 127 |
| 273 | 3300005457 | Ga0070662_100034343 | Ga0070662_1000343433 | 127 |
| 274 | 3300005458 | Ga0070681_10013516 | Ga0070681_100135166 | 127 |
| 275 | 3300005458 | Ga0070681_10152303 | Ga0070681_101523033 | 127 |
| 276 | 3300005458 | Ga0070681_10257261 | Ga0070681_102572613 | 127 |
| 277 | 3300005459 | Ga0068867_100004677 | Ga0068867_1000046778 | 127 |
| 278 | 3300005459 | Ga0068867_100278207 | Ga0068867_1002782072 | 127 |
| 279 | 3300005459 | Ga0068867_100520616 | Ga0068867_1005206162 | 127 |
| 280 | 3300005530 | Ga0070679_100128950 | Ga0070679_1001289502 | 127 |
| 281 | 3300005530 | Ga0070679_100181220 | Ga0070679_1001812203 | 127 |
| 282 | 3300005530 | Ga0070679_100526550 | Ga0070679_1005265502 | 127 |
| 283 | 3300005535 | Ga0070684_100094566 | Ga0070684_1000945662 | 127 |
| 284 | 3300005547 | Ga0070693_100012856 | Ga0070693_1000128562 | 127 |
| 285 | 3300005547 | Ga0070693_100015026 | Ga0070693_1000150265 | 127 |
| 286 | 3300005548 | Ga0070665_100453511 | Ga0070665_1004535113 | 127 |
| 287 | 3300005563 | Ga0068855_100295644 | Ga0068855_1002956442 | 127 |
| 288 | 3300005563 | Ga0068855_100558573 | Ga0068855_1005585732 | 127 |
| 289 | 3300005564 | Ga0070664_100006881 | Ga0070664_1000068813 | 127 |
| 290 | 3300005564 | Ga0070664_100578245 | Ga0070664_1005782452 | 127 |
| 291 | 3300005564 | Ga0070664_100681133 | Ga0070664_1006811331 | 127 |
| 292 | 3300005564 | Ga0070664_100962590 | Ga0070664_1009625902 | 127 |
| 293 | 3300005577 | Ga0068857_100208346 | Ga0068857_1002083463 | 127 |
| 294 | 3300005577 | Ga0068857_100354085 | Ga0068857_1003540852 | 127 |
| 295 | 3300005577 | Ga0068857_100773393 | Ga0068857_1007733932 | 127 |
| 296 | 3300005578 | Ga0068854_100083818 | Ga0068854_1000838183 | 127 |
| 297 | 3300005614 | Ga0068856_100061342 | Ga0068856_1000613423 | 127 |
| 298 | 3300005615 | Ga0070702_100377282 | Ga0070702_1003772821 | 127 |
| 299 | 3300005616 | Ga0068852_100023726 | Ga0068852_1000237267 | 127 |
| 300 | 3300005616 | Ga0068852_100087984 | Ga0068852_1000879843 | 127 |
| 301 | 3300005617 | Ga0068859_100054434 | Ga0068859_1000544345 | 127 |
| 302 | 3300005617 | Ga0068859_100379073 | Ga0068859_1003790732 | 127 |
| 303 | 3300005719 | Ga0068861_100169755 | Ga0068861_1001697552 | 127 |
| 304 | 3300005719 | Ga0068861_100329298 | Ga0068861_1003292981 | 127 |
| 305 | 3300005719 | Ga0068861_100485890 | Ga0068861_1004858902 | 127 |
| 306 | 3300005834 | Ga0068851_10032858 | Ga0068851_100328583 | 127 |
| 307 | 3300005834 | Ga0068851_10047700 | Ga0068851_100477002 | 127 |
| 308 | 3300005841 | Ga0068863_100034901 | Ga0068863_1000349014 | 127 |
| 309 | 3300005841 | Ga0068863_100770831 | Ga0068863_1007708311 | 127 |
| 310 | 3300005842 | Ga0068858_100007141 | Ga0068858_1000071419 | 127 |
| 311 | 3300005843 | Ga0068860_100006803 | Ga0068860_10000680310 | 127 |
| 312 | 3300005843 | Ga0068860_100245076 | Ga0068860_1002450762 | 127 |
| 313 | 3300005844 | Ga0068862_100253229 | Ga0068862_1002532292 | 127 |
| 314 | 3300006237 | Ga0097621_101092693 | Ga0097621_1010926931 | 127 |
| 315 | 3300006881 | Ga0068865_100034925 | Ga0068865_1000349254 | 127 |
| 316 | 3300006931 | Ga0097620_100054439 | Ga0097620_1000544395 | 127 |
| 317 | 3300006931 | Ga0097620_100379074 | Ga0097620_1003790742 | 127 |
| 318 | 3300009174 | Ga0105241_10130207 | Ga0105241_101302073 | 127 |
| 319 | 3300009174 | Ga0105241_10157917 | Ga0105241_101579171 | 127 |
| 320 | 3300009174 | Ga0105241_10702355 | Ga0105241_107023552 | 127 |
| 321 | 3300009177 | Ga0105248_11767199 | Ga0105248_117671992 | 127 |
| 322 | 3300009177 | Ga0105248_12304511 | Ga0105248_123045111 | 127 |
| 323 | 3300009545 | Ga0105237_10006758 | Ga0105237_1000675810 | 127 |
| 324 | 3300009551 | Ga0105238_10111637 | Ga0105238_101116374 | 127 |
| 325 | 3300009553 | Ga0105249_10320235 | Ga0105249_103202352 | 127 |
| 326 | 3300009553 | Ga0105249_10935063 | Ga0105249_109350632 | 127 |
| 327 | 3300010375 | Ga0105239_10054356 | Ga0105239_100543564 | 127 |
| 328 | 3300011119 | Ga0105246_10278750 | Ga0105246_102787502 | 127 |
| 329 | 3300013100 | Ga0157373_10031339 | Ga0157373_100313394 | 127 |
| 330 | 3300013100 | Ga0157373_10059487 | Ga0157373_100594874 | 127 |
| 331 | 3300013100 | Ga0157373_10092672 | Ga0157373_100926723 | 127 |
| 332 | 3300013100 | Ga0157373_10272822 | Ga0157373_102728222 | 127 |
| 333 | 3300013102 | Ga0157371_10025025 | Ga0157371_100250254 | 127 |
| 334 | 3300013102 | Ga0157371_10128560 | Ga0157371_101285602 | 127 |
| 335 | 3300013104 | Ga0157370_10741220 | Ga0157370_107412203 | 127 |
| 336 | 3300013104 | Ga0157370_10929875 | Ga0157370_109298751 | 127 |
| 337 | 3300013105 | Ga0157369_10259977 | Ga0157369_102599772 | 127 |
| 338 | 3300013105 | Ga0157369_10922308 | Ga0157369_109223083 | 127 |
| 339 | 3300013307 | Ga0157372_10011784 | Ga0157372_1001178410 | 127 |
| 340 | 3300013307 | Ga0157372_11666553 | Ga0157372_116665531 | 127 |
| 341 | 3300014968 | Ga0157379_11204648 | Ga0157379_112046482 | 127 |
| 342 | 3300020069 | Ga0197907_10034936 | Ga0197907_100349362 | 127 |
| 343 | 3300020070 | Ga0206356_10307274 | Ga0206356_103072742 | 127 |
| 344 | 3300020070 | Ga0206356_11311979 | Ga0206356_113119793 | 127 |
| 345 | 3300020078 | Ga0206352_10699940 | Ga0206352_106999401 | 127 |
| 346 | 3300022467 | Ga0224712_10171006 | Ga0224712_101710062 | 127 |
| 347 | 3300022467 | Ga0224712_10205286 | Ga0224712_102052861 | 127 |
| 348 | 3300025315 | Ga0207697_10028059 | Ga0207697_100280593 | 127 |
| 349 | 3300025321 | Ga0207656_10003880 | Ga0207656_100038807 | 127 |
| 350 | 3300025321 | Ga0207656_10042249 | Ga0207656_100422492 | 127 |
| 351 | 3300025899 | Ga0207642_10364144 | Ga0207642_103641442 | 127 |
| 352 | 3300025904 | Ga0207647_10000832 | Ga0207647_1000083218 | 127 |
| 353 | 3300025904 | Ga0207647_10464687 | Ga0207647_104646872 | 127 |
| 354 | 3300025907 | Ga0207645_10004831 | Ga0207645_100048314 | 127 |
| 355 | 3300025907 | Ga0207645_10008901 | Ga0207645_100089013 | 127 |
| 356 | 3300025907 | Ga0207645_10112926 | Ga0207645_101129262 | 127 |
| 357 | 3300025908 | Ga0207643_10054699 | Ga0207643_100546993 | 127 |
| 358 | 3300025909 | Ga0207705_10038951 | Ga0207705_100389512 | 127 |
| 359 | 3300025909 | Ga0207705_10060833 | Ga0207705_100608332 | 127 |
| 360 | 3300025909 | Ga0207705_10186859 | Ga0207705_101868592 | 127 |
| 361 | 3300025911 | Ga0207654_10106813 | Ga0207654_101068132 | 127 |
| 362 | 3300025912 | Ga0207707_10008907 | Ga0207707_100089073 | 127 |
| 363 | 3300025912 | Ga0207707_10495635 | Ga0207707_104956352 | 127 |
| 364 | 3300025914 | Ga0207671_10017531 | Ga0207671_100175318 | 127 |
| 365 | 3300025917 | Ga0207660_10665417 | Ga0207660_106654172 | 127 |
| 366 | 3300025917 | Ga0207660_10682176 | Ga0207660_106821762 | 127 |
| 367 | 3300025918 | Ga0207662_10030474 | Ga0207662_100304745 | 127 |
| 368 | 3300025919 | Ga0207657_10038093 | Ga0207657_100380933 | 127 |
| 369 | 3300025919 | Ga0207657_10050216 | Ga0207657_100502161 | 127 |
| 370 | 3300025919 | Ga0207657_10167001 | Ga0207657_101670012 | 127 |
| 371 | 3300025920 | Ga0207649_10002740 | Ga0207649_100027404 | 127 |
| 372 | 3300025920 | Ga0207649_10038842 | Ga0207649_100388424 | 127 |
| 373 | 3300025921 | Ga0207652_10298249 | Ga0207652_102982493 | 127 |
| 374 | 3300025921 | Ga0207652_10338914 | Ga0207652_103389142 | 127 |
| 375 | 3300025921 | Ga0207652_10487035 | Ga0207652_104870352 | 127 |
| 376 | 3300025923 | Ga0207681_10047787 | Ga0207681_100477873 | 127 |
| 377 | 3300025923 | Ga0207681_10277952 | Ga0207681_102779521 | 127 |
| 378 | 3300025924 | Ga0207694_10000776 | Ga0207694_1000077623 | 127 |
| 379 | 3300025932 | Ga0207690_10002565 | Ga0207690_100025655 | 127 |
| 380 | 3300025932 | Ga0207690_10219429 | Ga0207690_102194293 | 127 |
| 381 | 3300025932 | Ga0207690_10369349 | Ga0207690_103693492 | 127 |
| 382 | 3300025933 | Ga0207706_10038293 | Ga0207706_100382937 | 127 |
| 383 | 3300025933 | Ga0207706_10055308 | Ga0207706_100553082 | 127 |
| 384 | 3300025933 | Ga0207706_10963687 | Ga0207706_109636872 | 127 |
| 385 | 3300025935 | Ga0207709_10681923 | Ga0207709_106819232 | 127 |
| 386 | 3300025938 | Ga0207704_10060374 | Ga0207704_100603742 | 127 |
| 387 | 3300025938 | Ga0207704_11083528 | Ga0207704_110835282 | 127 |
| 388 | 3300025940 | Ga0207691_10144668 | Ga0207691_101446681 | 127 |
| 389 | 3300025941 | Ga0207711_10226883 | Ga0207711_102268833 | 127 |
| 390 | 3300025941 | Ga0207711_11023149 | Ga0207711_110231492 | 127 |
| 391 | 3300025942 | Ga0207689_10025109 | Ga0207689_100251092 | 127 |
| 392 | 3300025942 | Ga0207689_10037964 | Ga0207689_100379647 | 127 |
| 393 | 3300025942 | Ga0207689_10426773 | Ga0207689_104267732 | 127 |
| 394 | 3300025944 | Ga0207661_11073666 | Ga0207661_110736662 | 127 |
| 395 | 3300025945 | Ga0207679_10088718 | Ga0207679_100887182 | 127 |
| 396 | 3300025945 | Ga0207679_10118558 | Ga0207679_101185583 | 127 |
| 397 | 3300025945 | Ga0207679_10134912 | Ga0207679_101349122 | 127 |
| 398 | 3300025949 | Ga0207667_10132858 | Ga0207667_101328584 | 127 |
| 399 | 3300025960 | Ga0207651_10116028 | Ga0207651_101160282 | 127 |
| 400 | 3300025960 | Ga0207651_10538401 | Ga0207651_105384011 | 127 |
| 401 | 3300025960 | Ga0207651_12017645 | Ga0207651_120176451 | 127 |
| 402 | 3300025961 | Ga0207712_10079041 | Ga0207712_100790413 | 127 |
| 403 | 3300025972 | Ga0207668_10002157 | Ga0207668_1000215712 | 127 |
| 404 | 3300025981 | Ga0207640_10007503 | Ga0207640_100075037 | 127 |
| 405 | 3300025981 | Ga0207640_10034294 | Ga0207640_100342943 | 127 |
| 406 | 3300025981 | Ga0207640_11504686 | Ga0207640_115046861 | 127 |
| 407 | 3300025986 | Ga0207658_10036587 | Ga0207658_100365874 | 127 |
| 408 | 3300025986 | Ga0207658_10078804 | Ga0207658_100788044 | 127 |
| 409 | 3300025986 | Ga0207658_10080766 | Ga0207658_100807662 | 127 |
| 410 | 3300025986 | Ga0207658_10094610 | Ga0207658_100946102 | 127 |
| 411 | 3300026035 | Ga0207703_10135939 | Ga0207703_101359393 | 127 |
| 412 | 3300026041 | Ga0207639_10770962 | Ga0207639_107709623 | 127 |
| 413 | 3300026067 | Ga0207678_10010859 | Ga0207678_100108598 | 127 |
| 414 | 3300026067 | Ga0207678_10138368 | Ga0207678_101383682 | 127 |
| 415 | 3300026075 | Ga0207708_10327175 | Ga0207708_103271751 | 127 |
| 416 | 3300026078 | Ga0207702_10095158 | Ga0207702_100951585 | 127 |
| 417 | 3300026088 | Ga0207641_10033916 | Ga0207641_100339164 | 127 |
| 418 | 3300026088 | Ga0207641_10433036 | Ga0207641_104330362 | 127 |
| 419 | 3300026089 | Ga0207648_10002318 | Ga0207648_1000231822 | 127 |
| 420 | 3300026089 | Ga0207648_10116265 | Ga0207648_101162653 | 127 |
| 421 | 3300026095 | Ga0207676_10002072 | Ga0207676_100020729 | 127 |
| 422 | 3300026116 | Ga0207674_10002277 | Ga0207674_1000227711 | 127 |
| 423 | 3300026116 | Ga0207674_10030316 | Ga0207674_100303164 | 127 |
| 424 | 3300026116 | Ga0207674_10036857 | Ga0207674_100368571 | 127 |
| 425 | 3300026116 | Ga0207674_10111820 | Ga0207674_101118202 | 127 |
| 426 | 3300026118 | Ga0207675_100165697 | Ga0207675_1001656971 | 127 |
| 427 | 3300026118 | Ga0207675_100678760 | Ga0207675_1006787602 | 127 |
| 428 | 3300026121 | Ga0207683_10014943 | Ga0207683_1001494310 | 127 |
| 429 | 3300026121 | Ga0207683_10625691 | Ga0207683_106256912 | 127 |
| 430 | 3300026142 | Ga0207698_10046260 | Ga0207698_100462606 | 127 |
| 431 | 3300026142 | Ga0207698_10280976 | Ga0207698_102809763 | 127 |
| 432 | 3300026142 | Ga0207698_10361244 | Ga0207698_103612443 | 127 |
| 433 | 3300028380 | Ga0268265_10003245 | Ga0268265_100032457 | 127 |
| 434 | 3300028380 | Ga0268265_10199537 | Ga0268265_101995373 | 127 |
| 435 | 3300028380 | Ga0268265_11013896 | Ga0268265_110138961 | 127 |
| 436 | 3300028381 | Ga0268264_10002543 | Ga0268264_100025439 | 127 |
| 437 | 3300028381 | Ga0268264_10035529 | Ga0268264_100355295 | 127 |
| 438 | 3300032002 | Ga0307416_101170537 | Ga0307416_1011705372 | 127 |
| 439 | 3300032005 | Ga0307411_10208232 | Ga0307411_102082322 | 127 |
| 440 | 3300037418 | Ga0395900_0254630 | Ga0395900_0254630_1071_1469 | 127 |
| 441 | 3300037471 | Ga0395905_0552801 | Ga0395905_0552801_197_604 | 127 |
| 442 | 3300037471 | Ga0395905_0645510 | Ga0395905_0645510_315_713 | 127 |
| 443 | 3300038443 | Ga0395901_1876385 | Ga0395901_1876385_17_415 | 127 |
| 444 | 3300042439 | Ga0439464_0000674 | Ga0439464_0000674_740_1135 | 127 |
| 445 | 3300044683 | Ga0466965_0306418 | Ga0466965_0306418_242_640 | 127 |
| 446 | 3300044694 | Ga0466963_0002953 | Ga0466963_0002953_225_623 | 127 |
| 447 | 3300044694 | Ga0466963_0078078 | Ga0466963_0078078_618_1019 | 127 |
| 448 | 3300044694 | Ga0466963_0438438 | Ga0466963_0438438_145_552 | 127 |
| 449 | 3300044842 | Ga0466957_0519122 | Ga0466957_0519122_205_606 | 127 |
| 450 | 3300045976 | Ga0466967_0050943 | Ga0466967_0050943_1523_1921 | 127 |
| 451 | 3300045976 | Ga0466967_0139429 | Ga0466967_0139429_525_923 | 127 |
| 452 | 3300045976 | Ga0466967_0283333 | Ga0466967_0283333_434_835 | 127 |
| 453 | 3300045976 | Ga0466967_0796071 | Ga0466967_0796071_453_860 | 127 |
| 454 | 3300046537 | Ga0495598_0011985 | Ga0495598_0011985_816_1214 | 127 |
| 455 | 3300046539 | Ga0495621_0000006 | Ga0495621_0000006_34474_34872 | 127 |
| 456 | 3300046558 | Ga0495633_0091937 | Ga0495633_0091937_238_636 | 127 |
| 457 | 3300046684 | Ga0495669_0022152 | Ga0495669_0022152_436_834 | 127 |
| 458 | 3300046691 | Ga0495670_0000238 | Ga0495670_0000238_3806_4204 | 127 |
| 459 | 3300048905 | Ga0496102_0520496 | Ga0496102_0520496_322_720 | 127 |
| 460 | 3300048913 | Ga0496110_1124815 | Ga0496110_1124815_131_529 | 127 |
| 461 | 3300048914 | Ga0496111_0460234 | Ga0496111_0460234_21_419 | 127 |
| 462 | 3300048915 | Ga0496112_0309916 | Ga0496112_0309916_966_1364 | 127 |
| 463 | 3300048916 | Ga0496113_1339998 | Ga0496113_1339998_117_515 | 127 |
| 464 | 3300059477 | Ga0587084_014175 | Ga0587084_014175_489_887 | 127 |
| 465 | 3300059490 | Ga0587066_023228 | Ga0587066_023228_81_479 | 127 |
| 466 | 3300059490 | Ga0587066_034196 | Ga0587066_034196_510_908 | 127 |
| 467 | 3300059491 | Ga0587070_018388 | Ga0587070_018388_259_657 | 127 |
| 468 | 3300059492 | Ga0587073_0248447 | Ga0587073_0248447_21_416 | 127 |
| 469 | 3300059493 | Ga0587077_034230 | Ga0587077_034230_487_885 | 127 |
| 470 | 3300059503 | Ga0587080_034007 | Ga0587080_034007_488_886 | 127 |
| 471 | 3300059504 | Ga0587082_034001 | Ga0587082_034001_16_414 | 127 |
| 472 | 3300059505 | Ga0587083_0050676 | Ga0587083_0050676_17_415 | 127 |
| 473 | 3300059506 | Ga0587085_024211 | Ga0587085_024211_63_461 | 127 |
| 474 | 3300059507 | Ga0587086_014946 | Ga0587086_014946_487_885 | 127 |
| 475 | 3300059508 | Ga0587088_028967 | Ga0587088_028967_490_888 | 127 |
| 476 | 3300059509 | Ga0587089_020133 | Ga0587089_020133_32_430 | 127 |
| 477 | 3300059509 | Ga0587089_021695 | Ga0587089_021695_308_883 | 127 |
| 478 | 3300059510 | Ga0587090_030190 | Ga0587090_030190_16_414 | 127 |
| 479 | 3300059511 | Ga0587091_042426 | Ga0587091_042426_16_414 | 127 |
| 480 | 3300059513 | Ga0587094_014432 | Ga0587094_014432_490_888 | 127 |
| 481 | 3300059514 | Ga0587095_006724 | Ga0587095_006724_16_414 | 127 |
| 482 | 3300059605 | Ga0587106_026336 | Ga0587106_026336_16_414 | 127 |
| 483 | 3300059605 | Ga0587106_110278 | Ga0587106_110278_20_415 | 127 |
| 484 | 3300059622 | Ga0587099_010211 | Ga0587099_010211_509_907 | 127 |
| 485 | 3300059623 | Ga0587101_016965 | Ga0587101_016965_117_515 | 127 |
| 486 | 3300059624 | Ga0587109_038372 | Ga0587109_038372_463_861 | 127 |
| 487 | 3300059625 | Ga0587113_009418 | Ga0587113_009418_476_874 | 127 |
| 488 | 3300059630 | Ga0587128_020109 | Ga0587128_020109_489_887 | 127 |
| 489 | 3300059631 | Ga0587130_009408 | Ga0587130_009408_62_460 | 127 |
| 490 | 3300059639 | Ga0587062_022745 | Ga0587062_022745_16_414 | 127 |
| 491 | 3300059641 | Ga0587068_033680 | Ga0587068_033680_487_885 | 127 |
| 492 | 3300059642 | Ga0587069_019882 | Ga0587069_019882_490_888 | 127 |
| 493 | 3300059643 | Ga0587072_031365 | Ga0587072_031365_485_883 | 127 |
| 494 | 3300059644 | Ga0587075_013438 | Ga0587075_013438_489_887 | 127 |
| 495 | 3300059644 | Ga0587075_016342 | Ga0587075_016342_124_522 | 127 |
| 496 | 3300059645 | Ga0587076_036615 | Ga0587076_036615_12_410 | 127 |
| 497 | 3300059646 | Ga0587078_001873 | Ga0587078_001873_265_663 | 127 |
| 498 | 3300059646 | Ga0587078_012899 | Ga0587078_012899_485_883 | 127 |
| 499 | 3300059647 | Ga0587079_026649 | Ga0587079_026649_489_887 | 127 |
| 500 | 3300059649 | Ga0587102_023221 | Ga0587102_023221_112_510 | 127 |
| 501 | 3300059652 | Ga0587107_008996 | Ga0587107_008996_285_683 | 127 |
| 502 | 3300059658 | Ga0587119_011274 | Ga0587119_011274_490_888 | 127 |
| 503 | 3300060344 | Ga0587071_027880 | Ga0587071_027880_185_583 | 127 |
| 504 | 3300060346 | Ga0587111_0052710 | Ga0587111_0052710_16_414 | 127 |
| 505 | 3300001990 | JGI24737J22298_10001371 | JGI24737J22298_100013719 | 128 |
| 506 | 3300002067 | JGI24735J21928_10139576 | JGI24735J21928_101395762 | 128 |
| 507 | 3300002075 | JGI24738J21930_10001979 | JGI24738J21930_100019797 | 128 |
| 508 | 3300005327 | Ga0070658_10000477 | Ga0070658_1000047717 | 128 |
| 509 | 3300005329 | Ga0070683_100000747 | Ga0070683_10000074719 | 128 |
| 510 | 3300005329 | Ga0070683_100480230 | Ga0070683_1004802302 | 128 |
| 511 | 3300005329 | Ga0070683_100988990 | Ga0070683_1009889902 | 128 |
| 512 | 3300005330 | Ga0070690_100062783 | Ga0070690_1000627832 | 128 |
| 513 | 3300005331 | Ga0070670_100498666 | Ga0070670_1004986661 | 128 |
| 514 | 3300005335 | Ga0070666_10002947 | Ga0070666_100029475 | 128 |
| 515 | 3300005336 | Ga0070680_100147453 | Ga0070680_1001474531 | 128 |
| 516 | 3300005337 | Ga0070682_100072790 | Ga0070682_1000727903 | 128 |
| 517 | 3300005337 | Ga0070682_101568571 | Ga0070682_1015685711 | 128 |
| 518 | 3300005339 | Ga0070660_100000425 | Ga0070660_10000042518 | 128 |
| 519 | 3300005339 | Ga0070660_100474837 | Ga0070660_1004748372 | 128 |
| 520 | 3300005339 | Ga0070660_101219972 | Ga0070660_1012199722 | 128 |
| 521 | 3300005344 | Ga0070661_100000552 | Ga0070661_10000055215 | 128 |
| 522 | 3300005344 | Ga0070661_100044834 | Ga0070661_1000448345 | 128 |
| 523 | 3300005345 | Ga0070692_10119051 | Ga0070692_101190511 | 128 |
| 524 | 3300005355 | Ga0070671_100054845 | Ga0070671_1000548452 | 128 |
| 525 | 3300005366 | Ga0070659_100000065 | Ga0070659_10000006524 | 128 |
| 526 | 3300005366 | Ga0070659_100140975 | Ga0070659_1001409753 | 128 |
| 527 | 3300005367 | Ga0070667_100020823 | Ga0070667_1000208237 | 128 |
| 528 | 3300005367 | Ga0070667_100032912 | Ga0070667_1000329122 | 128 |
| 529 | 3300005435 | Ga0070714_100089684 | Ga0070714_1000896841 | 128 |
| 530 | 3300005435 | Ga0070714_100956649 | Ga0070714_1009566492 | 128 |
| 531 | 3300005436 | Ga0070713_102240953 | Ga0070713_1022409531 | 128 |
| 532 | 3300005455 | Ga0070663_100001839 | Ga0070663_10000183910 | 128 |
| 533 | 3300005457 | Ga0070662_100000010 | Ga0070662_10000001067 | 128 |
| 534 | 3300005530 | Ga0070679_100014856 | Ga0070679_1000148568 | 128 |
| 535 | 3300005530 | Ga0070679_100946217 | Ga0070679_1009462172 | 128 |
| 536 | 3300005535 | Ga0070684_100029987 | Ga0070684_1000299877 | 128 |
| 537 | 3300005535 | Ga0070684_100541159 | Ga0070684_1005411592 | 128 |
| 538 | 3300005535 | Ga0070684_102071085 | Ga0070684_1020710851 | 128 |
| 539 | 3300005539 | Ga0068853_100000067 | Ga0068853_10000006736 | 128 |
| 540 | 3300005539 | Ga0068853_100011651 | Ga0068853_10001165111 | 128 |
| 541 | 3300005539 | Ga0068853_100030531 | Ga0068853_1000305316 | 128 |
| 542 | 3300005544 | Ga0070686_100805827 | Ga0070686_1008058272 | 128 |
| 543 | 3300005546 | Ga0070696_100089379 | Ga0070696_1000893791 | 128 |
| 544 | 3300005547 | Ga0070693_100000343 | Ga0070693_1000003439 | 128 |
| 545 | 3300005548 | Ga0070665_100013969 | Ga0070665_1000139699 | 128 |
| 546 | 3300005563 | Ga0068855_100017249 | Ga0068855_1000172497 | 128 |
| 547 | 3300005563 | Ga0068855_100018104 | Ga0068855_1000181043 | 128 |
| 548 | 3300005563 | Ga0068855_100109434 | Ga0068855_1001094345 | 128 |
| 549 | 3300005563 | Ga0068855_100751142 | Ga0068855_1007511422 | 128 |
| 550 | 3300005564 | Ga0070664_100000228 | Ga0070664_10000022835 | 128 |
| 551 | 3300005577 | Ga0068857_100561577 | Ga0068857_1005615772 | 128 |
| 552 | 3300005577 | Ga0068857_102154810 | Ga0068857_1021548101 | 128 |
| 553 | 3300005578 | Ga0068854_100025191 | Ga0068854_1000251913 | 128 |
| 554 | 3300005614 | Ga0068856_100000101 | Ga0068856_10000010170 | 128 |
| 555 | 3300005614 | Ga0068856_100079964 | Ga0068856_1000799643 | 128 |
| 556 | 3300005614 | Ga0068856_100153835 | Ga0068856_1001538352 | 128 |
| 557 | 3300005616 | Ga0068852_100000846 | Ga0068852_1000008468 | 128 |
| 558 | 3300005616 | Ga0068852_100001433 | Ga0068852_10000143310 | 128 |
| 559 | 3300005616 | Ga0068852_100003781 | Ga0068852_1000037817 | 128 |
| 560 | 3300005616 | Ga0068852_100094713 | Ga0068852_1000947132 | 128 |
| 561 | 3300005616 | Ga0068852_100437703 | Ga0068852_1004377031 | 128 |
| 562 | 3300005618 | Ga0068864_100089427 | Ga0068864_1000894272 | 128 |
| 563 | 3300005834 | Ga0068851_10051292 | Ga0068851_100512922 | 128 |
| 564 | 3300005841 | Ga0068863_100360451 | Ga0068863_1003604512 | 128 |
| 565 | 3300005843 | Ga0068860_100073377 | Ga0068860_1000733773 | 128 |
| 566 | 3300006237 | Ga0097621_100051529 | Ga0097621_1000515294 | 128 |
| 567 | 3300009174 | Ga0105241_10032907 | Ga0105241_100329075 | 128 |
| 568 | 3300009177 | Ga0105248_10054729 | Ga0105248_100547297 | 128 |
| 569 | 3300009551 | Ga0105238_10004367 | Ga0105238_100043678 | 128 |
| 570 | 3300009551 | Ga0105238_10051275 | Ga0105238_100512754 | 128 |
| 571 | 3300009551 | Ga0105238_12295790 | Ga0105238_122957901 | 128 |
| 572 | 3300013100 | Ga0157373_10009790 | Ga0157373_100097909 | 128 |
| 573 | 3300013100 | Ga0157373_10301096 | Ga0157373_103010962 | 128 |
| 574 | 3300013102 | Ga0157371_10003821 | Ga0157371_100038216 | 128 |
| 575 | 3300013102 | Ga0157371_10075155 | Ga0157371_100751554 | 128 |
| 576 | 3300013102 | Ga0157371_10092512 | Ga0157371_100925122 | 128 |
| 577 | 3300013105 | Ga0157369_10003181 | Ga0157369_1000318114 | 128 |
| 578 | 3300013105 | Ga0157369_10032210 | Ga0157369_100322104 | 128 |
| 579 | 3300013105 | Ga0157369_10202481 | Ga0157369_102024812 | 128 |
| 580 | 3300013105 | Ga0157369_10733218 | Ga0157369_107332182 | 128 |
| 581 | 3300013296 | Ga0157374_10480692 | Ga0157374_104806922 | 128 |
| 582 | 3300013307 | Ga0157372_10359554 | Ga0157372_103595543 | 128 |
| 583 | 3300013307 | Ga0157372_12909297 | Ga0157372_129092971 | 128 |
| 584 | 3300014325 | Ga0163163_10019125 | Ga0163163_100191258 | 128 |
| 585 | 3300014968 | Ga0157379_10165064 | Ga0157379_101650643 | 128 |
| 586 | 3300014968 | Ga0157379_10182441 | Ga0157379_101824413 | 128 |
| 587 | 3300020069 | Ga0197907_11002332 | Ga0197907_110023322 | 128 |
| 588 | 3300020070 | Ga0206356_11292785 | Ga0206356_112927852 | 128 |
| 589 | 3300020070 | Ga0206356_11638823 | Ga0206356_116388232 | 128 |
| 590 | 3300020081 | Ga0206354_10948750 | Ga0206354_109487501 | 128 |
| 591 | 3300020082 | Ga0206353_10732796 | Ga0206353_107327962 | 128 |
| 592 | 3300025904 | Ga0207647_10008390 | Ga0207647_100083908 | 128 |
| 593 | 3300025904 | Ga0207647_10064373 | Ga0207647_100643732 | 128 |
| 594 | 3300025904 | Ga0207647_10079630 | Ga0207647_100796301 | 128 |
| 595 | 3300025909 | Ga0207705_10000113 | Ga0207705_1000011314 | 128 |
| 596 | 3300025909 | Ga0207705_10059966 | Ga0207705_100599664 | 128 |
| 597 | 3300025909 | Ga0207705_10065521 | Ga0207705_100655214 | 128 |
| 598 | 3300025909 | Ga0207705_10077431 | Ga0207705_100774313 | 128 |
| 599 | 3300025911 | Ga0207654_10178036 | Ga0207654_101780362 | 128 |
| 600 | 3300025917 | Ga0207660_11701896 | Ga0207660_117018961 | 128 |
| 601 | 3300025919 | Ga0207657_10000026 | Ga0207657_1000002670 | 128 |
| 602 | 3300025919 | Ga0207657_10093297 | Ga0207657_100932973 | 128 |
| 603 | 3300025920 | Ga0207649_10000516 | Ga0207649_1000051619 | 128 |
| 604 | 3300025920 | Ga0207649_10085352 | Ga0207649_100853523 | 128 |
| 605 | 3300025921 | Ga0207652_10220094 | Ga0207652_102200941 | 128 |
| 606 | 3300025924 | Ga0207694_10005699 | Ga0207694_100056996 | 128 |
| 607 | 3300025924 | Ga0207694_10185516 | Ga0207694_101855163 | 128 |
| 608 | 3300025924 | Ga0207694_11500997 | Ga0207694_115009972 | 128 |
| 609 | 3300025929 | Ga0207664_10146782 | Ga0207664_101467822 | 128 |
| 610 | 3300025929 | Ga0207664_10374847 | Ga0207664_103748471 | 128 |
| 611 | 3300025929 | Ga0207664_10801546 | Ga0207664_108015462 | 128 |
| 612 | 3300025931 | Ga0207644_10033934 | Ga0207644_100339344 | 128 |
| 613 | 3300025931 | Ga0207644_10209882 | Ga0207644_102098822 | 128 |
| 614 | 3300025932 | Ga0207690_10000649 | Ga0207690_1000064915 | 128 |
| 615 | 3300025932 | Ga0207690_10413049 | Ga0207690_104130492 | 128 |
| 616 | 3300025932 | Ga0207690_10429139 | Ga0207690_104291392 | 128 |
| 617 | 3300025933 | Ga0207706_10000031 | Ga0207706_1000003165 | 128 |
| 618 | 3300025933 | Ga0207706_10216949 | Ga0207706_102169493 | 128 |
| 619 | 3300025941 | Ga0207711_10000446 | Ga0207711_1000044639 | 128 |
| 620 | 3300025941 | Ga0207711_10007845 | Ga0207711_100078459 | 128 |
| 621 | 3300025941 | Ga0207711_10287123 | Ga0207711_102871232 | 128 |
| 622 | 3300025944 | Ga0207661_10013965 | Ga0207661_100139654 | 128 |
| 623 | 3300025944 | Ga0207661_10031712 | Ga0207661_100317125 | 128 |
| 624 | 3300025945 | Ga0207679_10000236 | Ga0207679_1000023618 | 128 |
| 625 | 3300025949 | Ga0207667_10001718 | Ga0207667_1000171826 | 128 |
| 626 | 3300025949 | Ga0207667_10081840 | Ga0207667_100818402 | 128 |
| 627 | 3300025949 | Ga0207667_10720816 | Ga0207667_107208162 | 128 |
| 628 | 3300025949 | Ga0207667_11750098 | Ga0207667_117500981 | 128 |
| 629 | 3300025981 | Ga0207640_10114939 | Ga0207640_101149392 | 128 |
| 630 | 3300025986 | Ga0207658_10027437 | Ga0207658_100274372 | 128 |
| 631 | 3300025986 | Ga0207658_10072042 | Ga0207658_100720423 | 128 |
| 632 | 3300026035 | Ga0207703_10065655 | Ga0207703_100656553 | 128 |
| 633 | 3300026041 | Ga0207639_10005817 | Ga0207639_100058179 | 128 |
| 634 | 3300026041 | Ga0207639_10070955 | Ga0207639_100709552 | 128 |
| 635 | 3300026041 | Ga0207639_10095747 | Ga0207639_100957473 | 128 |
| 636 | 3300026067 | Ga0207678_10012250 | Ga0207678_100122508 | 128 |
| 637 | 3300026067 | Ga0207678_10209384 | Ga0207678_102093842 | 128 |
| 638 | 3300026078 | Ga0207702_10010631 | Ga0207702_100106312 | 128 |
| 639 | 3300026078 | Ga0207702_10067734 | Ga0207702_100677343 | 128 |
| 640 | 3300026078 | Ga0207702_10164850 | Ga0207702_101648502 | 128 |
| 641 | 3300026078 | Ga0207702_10600741 | Ga0207702_106007412 | 128 |
| 642 | 3300026088 | Ga0207641_10337044 | Ga0207641_103370442 | 128 |
| 643 | 3300026095 | Ga0207676_10031676 | Ga0207676_100316764 | 128 |
| 644 | 3300026116 | Ga0207674_10539760 | Ga0207674_105397602 | 128 |
| 645 | 3300026118 | Ga0207675_100578154 | Ga0207675_1005781542 | 128 |
| 646 | 3300026142 | Ga0207698_10000618 | Ga0207698_100006183 | 128 |
| 647 | 3300026142 | Ga0207698_10001533 | Ga0207698_100015332 | 128 |
| 648 | 3300026142 | Ga0207698_10007701 | Ga0207698_100077016 | 128 |
| 649 | 3300026142 | Ga0207698_10009367 | Ga0207698_100093673 | 128 |
| 650 | 3300026142 | Ga0207698_10379957 | Ga0207698_103799573 | 128 |
| 651 | 3300028379 | Ga0268266_10005677 | Ga0268266_100056778 | 128 |
| 652 | 3300028381 | Ga0268264_10573422 | Ga0268264_105734222 | 128 |
| 653 | 3300031731 | Ga0307405_10586539 | Ga0307405_105865391 | 128 |
| 654 | 3300031824 | Ga0307413_10267439 | Ga0307413_102674393 | 128 |
| 655 | 3300031852 | Ga0307410_10135140 | Ga0307410_101351403 | 128 |
| 656 | 3300031901 | Ga0307406_10304271 | Ga0307406_103042712 | 128 |
| 657 | 3300031903 | Ga0307407_10520960 | Ga0307407_105209602 | 128 |
| 658 | 3300031995 | Ga0307409_100415965 | Ga0307409_1004159652 | 128 |
| 659 | 3300032002 | Ga0307416_100186537 | Ga0307416_1001865373 | 128 |
| 660 | 3300032126 | Ga0307415_100022433 | Ga0307415_1000224332 | 128 |
| 661 | 3300034816 | Ga0373930_0092002 | Ga0373930_0092002_28_429 | 128 |
| 662 | 3300034957 | Ga0373938_0099370 | Ga0373938_0099370_111_512 | 128 |
| 663 | 3300035090 | Ga0373949_0066931 | Ga0373949_0066931_117_518 | 128 |
| 664 | 3300035091 | Ga0373951_0066124 | Ga0373951_0066124_268_669 | 128 |
| 665 | 3300035241 | Ga0373961_0010280 | Ga0373961_0010280_1541_1942 | 128 |
| 666 | 3300035242 | Ga0373962_0085039 | Ga0373962_0085039_359_760 | 128 |
| 667 | 3300037312 | Ga0395899_0030400 | Ga0395899_0030400_1921_2325 | 128 |
| 668 | 3300037312 | Ga0395899_0038361 | Ga0395899_0038361_1269_1673 | 128 |
| 669 | 3300037312 | Ga0395899_0098825 | Ga0395899_0098825_27_431 | 128 |
| 670 | 3300037312 | Ga0395899_0105236 | Ga0395899_0105236_1608_2012 | 128 |
| 671 | 3300037312 | Ga0395899_0893212 | Ga0395899_0893212_122_526 | 128 |
| 672 | 3300037418 | Ga0395900_0107348 | Ga0395900_0107348_1847_2251 | 128 |
| 673 | 3300037418 | Ga0395900_0176876 | Ga0395900_0176876_175_579 | 128 |
| 674 | 3300037418 | Ga0395900_0245885 | Ga0395900_0245885_83_487 | 128 |
| 675 | 3300037418 | Ga0395900_0442792 | Ga0395900_0442792_669_1073 | 128 |
| 676 | 3300037418 | Ga0395900_0582697 | Ga0395900_0582697_501_905 | 128 |
| 677 | 3300037466 | Ga0395898_0018087 | Ga0395898_0018087_3815_4219 | 128 |
| 678 | 3300037466 | Ga0395898_0197787 | Ga0395898_0197787_165_569 | 128 |
| 679 | 3300037471 | Ga0395905_0008699 | Ga0395905_0008699_2543_2947 | 128 |
| 680 | 3300037471 | Ga0395905_0141907 | Ga0395905_0141907_624_1028 | 128 |
| 681 | 3300037471 | Ga0395905_0306016 | Ga0395905_0306016_574_978 | 128 |
| 682 | 3300037471 | Ga0395905_0560942 | Ga0395905_0560942_372_776 | 128 |
| 683 | 3300037471 | Ga0395905_1114477 | Ga0395905_1114477_271_675 | 128 |
| 684 | 3300037471 | Ga0395905_1553021 | Ga0395905_1553021_145_549 | 128 |
| 685 | 3300038443 | Ga0395901_0000268 | Ga0395901_0000268_42980_43384 | 128 |
| 686 | 3300038443 | Ga0395901_0109048 | Ga0395901_0109048_2232_2636 | 128 |
| 687 | 3300038443 | Ga0395901_0157477 | Ga0395901_0157477_346_750 | 128 |
| 688 | 3300038443 | Ga0395901_0201949 | Ga0395901_0201949_364_768 | 128 |
| 689 | 3300038443 | Ga0395901_0211352 | Ga0395901_0211352_397_801 | 128 |
| 690 | 3300038443 | Ga0395901_0590479 | Ga0395901_0590479_354_758 | 128 |
| 691 | 3300044694 | Ga0466963_0144024 | Ga0466963_0144024_1222_1629 | 128 |
| 692 | 3300044694 | Ga0466963_0180407 | Ga0466963_0180407_57_461 | 128 |
| 693 | 3300044706 | Ga0466964_0871166 | Ga0466964_0871166_39_443 | 128 |
| 694 | 3300044842 | Ga0466957_0035844 | Ga0466957_0035844_191_595 | 128 |
| 695 | 3300044842 | Ga0466957_0489150 | Ga0466957_0489150_335_742 | 128 |
| 696 | 3300044842 | Ga0466957_1261126 | Ga0466957_1261126_82_486 | 128 |
| 697 | 3300044901 | Ga0466960_0435484 | Ga0466960_0435484_275_718 | 128 |
| 698 | 3300045976 | Ga0466967_0076801 | Ga0466967_0076801_749_1153 | 128 |
| 699 | 3300045976 | Ga0466967_0368833 | Ga0466967_0368833_626_1033 | 128 |
| 700 | 3300045976 | Ga0466967_0519627 | Ga0466967_0519627_445_846 | 128 |
| 701 | 3300045976 | Ga0466967_0737680 | Ga0466967_0737680_312_716 | 128 |
| 702 | 3300046684 | Ga0495669_0243948 | Ga0495669_0243948_204_605 | 128 |
| 703 | 3300048909 | Ga0496106_0266612 | Ga0496106_0266612_839_1243 | 128 |
| 704 | 3300048910 | Ga0496107_0168768 | Ga0496107_0168768_1022_1426 | 128 |
| 705 | 3300059477 | Ga0587084_017887 | Ga0587084_017887_461_865 | 128 |
| 706 | 3300059477 | Ga0587084_043786 | Ga0587084_043786_23_427 | 128 |
| 707 | 3300059490 | Ga0587066_027294 | Ga0587066_027294_572_976 | 128 |
| 708 | 3300059492 | Ga0587073_0029922 | Ga0587073_0029922_526_930 | 128 |
| 709 | 3300059492 | Ga0587073_0041186 | Ga0587073_0041186_490_894 | 128 |
| 710 | 3300059493 | Ga0587077_045904 | Ga0587077_045904_470_874 | 128 |
| 711 | 3300059503 | Ga0587080_027021 | Ga0587080_027021_154_558 | 128 |
| 712 | 3300059504 | Ga0587082_035086 | Ga0587082_035086_20_424 | 128 |
| 713 | 3300059504 | Ga0587082_036180 | Ga0587082_036180_464_868 | 128 |
| 714 | 3300059505 | Ga0587083_0053251 | Ga0587083_0053251_469_873 | 128 |
| 715 | 3300059507 | Ga0587086_020521 | Ga0587086_020521_475_879 | 128 |
| 716 | 3300059508 | Ga0587088_005461 | Ga0587088_005461_519_923 | 128 |
| 717 | 3300059509 | Ga0587089_051640 | Ga0587089_051640_12_416 | 128 |
| 718 | 3300059510 | Ga0587090_015200 | Ga0587090_015200_472_876 | 128 |
| 719 | 3300059510 | Ga0587090_037292 | Ga0587090_037292_320_724 | 128 |
| 720 | 3300059511 | Ga0587091_017818 | Ga0587091_017818_472_876 | 128 |
| 721 | 3300059602 | Ga0587074_03528 | Ga0587074_03528_123_527 | 128 |
| 722 | 3300059605 | Ga0587106_015710 | Ga0587106_015710_187_591 | 128 |
| 723 | 3300059630 | Ga0587128_027758 | Ga0587128_027758_43_447 | 128 |
| 724 | 3300059640 | Ga0587067_024876 | Ga0587067_024876_189_593 | 128 |
| 725 | 3300059642 | Ga0587069_030174 | Ga0587069_030174_347_751 | 128 |
| 726 | 3300059643 | Ga0587072_038769 | Ga0587072_038769_484_888 | 128 |
| 727 | 3300059644 | Ga0587075_026979 | Ga0587075_026979_469_873 | 128 |
| 728 | 3300059644 | Ga0587075_027629 | Ga0587075_027629_469_873 | 128 |
| 729 | 3300059645 | Ga0587076_021445 | Ga0587076_021445_43_447 | 128 |
| 730 | 3300059645 | Ga0587076_035552 | Ga0587076_035552_16_420 | 128 |
| 731 | 3300059646 | Ga0587078_011898 | Ga0587078_011898_142_546 | 128 |
| 732 | 3300059647 | Ga0587079_032180 | Ga0587079_032180_469_873 | 128 |
| 733 | 3300059649 | Ga0587102_007703 | Ga0587102_007703_472_876 | 128 |
| 734 | 3300059652 | Ga0587107_017898 | Ga0587107_017898_60_464 | 128 |
| 735 | 3300060344 | Ga0587071_028594 | Ga0587071_028594_472_876 | 128 |
| 736 | 3300060344 | Ga0587071_040026 | Ga0587071_040026_62_466 | 128 |
| 737 | 3300001990 | JGI24737J22298_10010090 | JGI24737J22298_100100903 | 129 |
| 738 | 3300001990 | JGI24737J22298_10115525 | JGI24737J22298_101155252 | 129 |
| 739 | 3300001991 | JGI24743J22301_10013607 | JGI24743J22301_100136072 | 129 |
| 740 | 3300001991 | JGI24743J22301_10083134 | JGI24743J22301_100831342 | 129 |
| 741 | 3300002067 | JGI24735J21928_10004503 | JGI24735J21928_100045031 | 129 |
| 742 | 3300002067 | JGI24735J21928_10133570 | JGI24735J21928_101335701 | 129 |
| 743 | 3300002067 | JGI24735J21928_10140301 | JGI24735J21928_101403012 | 129 |
| 744 | 3300002077 | JGI24744J21845_10008807 | JGI24744J21845_100088073 | 129 |
| 745 | 3300005293 | Ga0065715_10524477 | Ga0065715_105244772 | 129 |
| 746 | 3300005327 | Ga0070658_10046871 | Ga0070658_100468711 | 129 |
| 747 | 3300005327 | Ga0070658_10060437 | Ga0070658_100604372 | 129 |
| 748 | 3300005327 | Ga0070658_10527296 | Ga0070658_105272962 | 129 |
| 749 | 3300005328 | Ga0070676_10068888 | Ga0070676_100688883 | 129 |
| 750 | 3300005329 | Ga0070683_100005454 | Ga0070683_10000545411 | 129 |
| 751 | 3300005329 | Ga0070683_100010424 | Ga0070683_1000104245 | 129 |
| 752 | 3300005331 | Ga0070670_100379339 | Ga0070670_1003793392 | 129 |
| 753 | 3300005331 | Ga0070670_100980266 | Ga0070670_1009802662 | 129 |
| 754 | 3300005334 | Ga0068869_100095563 | Ga0068869_1000955633 | 129 |
| 755 | 3300005335 | Ga0070666_10135878 | Ga0070666_101358782 | 129 |
| 756 | 3300005336 | Ga0070680_100739970 | Ga0070680_1007399702 | 129 |
| 757 | 3300005337 | Ga0070682_100001753 | Ga0070682_10000175313 | 129 |
| 758 | 3300005338 | Ga0068868_100044049 | Ga0068868_1000440493 | 129 |
| 759 | 3300005338 | Ga0068868_100463282 | Ga0068868_1004632822 | 129 |
| 760 | 3300005338 | Ga0068868_100537440 | Ga0068868_1005374402 | 129 |
| 761 | 3300005338 | Ga0068868_101062679 | Ga0068868_1010626792 | 129 |
| 762 | 3300005339 | Ga0070660_100303797 | Ga0070660_1003037972 | 129 |
| 763 | 3300005339 | Ga0070660_101008537 | Ga0070660_1010085372 | 129 |
| 764 | 3300005344 | Ga0070661_100002092 | Ga0070661_1000020924 | 129 |
| 765 | 3300005344 | Ga0070661_100133827 | Ga0070661_1001338273 | 129 |
| 766 | 3300005344 | Ga0070661_101227442 | Ga0070661_1012274421 | 129 |
| 767 | 3300005344 | Ga0070661_101458345 | Ga0070661_1014583451 | 129 |
| 768 | 3300005345 | Ga0070692_10034895 | Ga0070692_100348953 | 129 |
| 769 | 3300005353 | Ga0070669_100666619 | Ga0070669_1006666192 | 129 |
| 770 | 3300005354 | Ga0070675_100301932 | Ga0070675_1003019322 | 129 |
| 771 | 3300005355 | Ga0070671_100033760 | Ga0070671_1000337603 | 129 |
| 772 | 3300005355 | Ga0070671_100126515 | Ga0070671_1001265152 | 129 |
| 773 | 3300005356 | Ga0070674_100057775 | Ga0070674_1000577753 | 129 |
| 774 | 3300005364 | Ga0070673_100001556 | Ga0070673_10000155613 | 129 |
| 775 | 3300005364 | Ga0070673_100133524 | Ga0070673_1001335243 | 129 |
| 776 | 3300005364 | Ga0070673_100543444 | Ga0070673_1005434442 | 129 |
| 777 | 3300005366 | Ga0070659_100068005 | Ga0070659_1000680052 | 129 |
| 778 | 3300005366 | Ga0070659_101982550 | Ga0070659_1019825501 | 129 |
| 779 | 3300005434 | Ga0070709_10770043 | Ga0070709_107700431 | 129 |
| 780 | 3300005436 | Ga0070713_100347612 | Ga0070713_1003476122 | 129 |
| 781 | 3300005455 | Ga0070663_100000647 | Ga0070663_1000006479 | 129 |
| 782 | 3300005455 | Ga0070663_100027782 | Ga0070663_1000277823 | 129 |
| 783 | 3300005455 | Ga0070663_100242476 | Ga0070663_1002424763 | 129 |
| 784 | 3300005455 | Ga0070663_100905861 | Ga0070663_1009058611 | 129 |
| 785 | 3300005455 | Ga0070663_101141897 | Ga0070663_1011418972 | 129 |
| 786 | 3300005456 | Ga0070678_100724892 | Ga0070678_1007248922 | 129 |
| 787 | 3300005457 | Ga0070662_100180546 | Ga0070662_1001805461 | 129 |
| 788 | 3300005457 | Ga0070662_100211513 | Ga0070662_1002115132 | 129 |
| 789 | 3300005457 | Ga0070662_100543773 | Ga0070662_1005437732 | 129 |
| 790 | 3300005459 | Ga0068867_100301265 | Ga0068867_1003012652 | 129 |
| 791 | 3300005459 | Ga0068867_101441810 | Ga0068867_1014418101 | 129 |
| 792 | 3300005530 | Ga0070679_101519181 | Ga0070679_1015191811 | 129 |
| 793 | 3300005535 | Ga0070684_100121740 | Ga0070684_1001217403 | 129 |
| 794 | 3300005539 | Ga0068853_100178754 | Ga0068853_1001787542 | 129 |
| 795 | 3300005539 | Ga0068853_100195932 | Ga0068853_1001959322 | 129 |
| 796 | 3300005539 | Ga0068853_100409380 | Ga0068853_1004093802 | 129 |
| 797 | 3300005543 | Ga0070672_100048432 | Ga0070672_1000484326 | 129 |
| 798 | 3300005543 | Ga0070672_100095965 | Ga0070672_1000959653 | 129 |
| 799 | 3300005546 | Ga0070696_100619486 | Ga0070696_1006194862 | 129 |
| 800 | 3300005547 | Ga0070693_100034700 | Ga0070693_1000347003 | 129 |
| 801 | 3300005547 | Ga0070693_100076941 | Ga0070693_1000769413 | 129 |
| 802 | 3300005548 | Ga0070665_100516987 | Ga0070665_1005169872 | 129 |
| 803 | 3300005563 | Ga0068855_100066116 | Ga0068855_1000661164 | 129 |
| 804 | 3300005563 | Ga0068855_100079415 | Ga0068855_1000794154 | 129 |
| 805 | 3300005564 | Ga0070664_100009565 | Ga0070664_1000095653 | 129 |
| 806 | 3300005564 | Ga0070664_100059968 | Ga0070664_1000599683 | 129 |
| 807 | 3300005564 | Ga0070664_100088394 | Ga0070664_1000883944 | 129 |
| 808 | 3300005564 | Ga0070664_100529306 | Ga0070664_1005293062 | 129 |
| 809 | 3300005564 | Ga0070664_102183787 | Ga0070664_1021837871 | 129 |
| 810 | 3300005577 | Ga0068857_100026322 | Ga0068857_1000263225 | 129 |
| 811 | 3300005577 | Ga0068857_100380990 | Ga0068857_1003809901 | 129 |
| 812 | 3300005578 | Ga0068854_100001913 | Ga0068854_1000019133 | 129 |
| 813 | 3300005578 | Ga0068854_100011321 | Ga0068854_1000113213 | 129 |
| 814 | 3300005614 | Ga0068856_100391785 | Ga0068856_1003917852 | 129 |
| 815 | 3300005616 | Ga0068852_100093334 | Ga0068852_1000933344 | 129 |
| 816 | 3300006237 | Ga0097621_100357207 | Ga0097621_1003572072 | 129 |
| 817 | 3300006358 | Ga0068871_100623150 | Ga0068871_1006231502 | 129 |
| 818 | 3300006358 | Ga0068871_100662228 | Ga0068871_1006622282 | 129 |
| 819 | 3300009176 | Ga0105242_10185671 | Ga0105242_101856712 | 129 |
| 820 | 3300009177 | Ga0105248_10228619 | Ga0105248_102286192 | 129 |
| 821 | 3300009177 | Ga0105248_10463115 | Ga0105248_104631152 | 129 |
| 822 | 3300009177 | Ga0105248_10829284 | Ga0105248_108292842 | 129 |
| 823 | 3300013100 | Ga0157373_10090355 | Ga0157373_100903552 | 129 |
| 824 | 3300013100 | Ga0157373_10463145 | Ga0157373_104631452 | 129 |
| 825 | 3300013102 | Ga0157371_10026453 | Ga0157371_100264533 | 129 |
| 826 | 3300013102 | Ga0157371_10939038 | Ga0157371_109390381 | 129 |
| 827 | 3300013102 | Ga0157371_11244993 | Ga0157371_112449931 | 129 |
| 828 | 3300013296 | Ga0157374_10303006 | Ga0157374_103030063 | 129 |
| 829 | 3300013296 | Ga0157374_10519081 | Ga0157374_105190813 | 129 |
| 830 | 3300013297 | Ga0157378_10007074 | Ga0157378_100070745 | 129 |
| 831 | 3300013297 | Ga0157378_10344935 | Ga0157378_103449353 | 129 |
| 832 | 3300013306 | Ga0163162_10032625 | Ga0163162_100326255 | 129 |
| 833 | 3300013307 | Ga0157372_10045014 | Ga0157372_100450145 | 129 |
| 834 | 3300013307 | Ga0157372_10046828 | Ga0157372_100468285 | 129 |
| 835 | 3300013308 | Ga0157375_10007221 | Ga0157375_100072219 | 129 |
| 836 | 3300013308 | Ga0157375_10271200 | Ga0157375_102712002 | 129 |
| 837 | 3300014969 | Ga0157376_10684688 | Ga0157376_106846882 | 129 |
| 838 | 3300025315 | Ga0207697_10022280 | Ga0207697_100222803 | 129 |
| 839 | 3300025315 | Ga0207697_10112020 | Ga0207697_101120202 | 129 |
| 840 | 3300025893 | Ga0207682_10035101 | Ga0207682_100351011 | 129 |
| 841 | 3300025901 | Ga0207688_10126968 | Ga0207688_101269682 | 129 |
| 842 | 3300025903 | Ga0207680_10517167 | Ga0207680_105171672 | 129 |
| 843 | 3300025904 | Ga0207647_10061274 | Ga0207647_100612743 | 129 |
| 844 | 3300025908 | Ga0207643_10173377 | Ga0207643_101733772 | 129 |
| 845 | 3300025908 | Ga0207643_10254530 | Ga0207643_102545302 | 129 |
| 846 | 3300025909 | Ga0207705_10010345 | Ga0207705_100103456 | 129 |
| 847 | 3300025909 | Ga0207705_10261160 | Ga0207705_102611602 | 129 |
| 848 | 3300025917 | Ga0207660_10007589 | Ga0207660_100075894 | 129 |
| 849 | 3300025917 | Ga0207660_10440534 | Ga0207660_104405341 | 129 |
| 850 | 3300025917 | Ga0207660_10535163 | Ga0207660_105351632 | 129 |
| 851 | 3300025918 | Ga0207662_10170760 | Ga0207662_101707602 | 129 |
| 852 | 3300025919 | Ga0207657_10002103 | Ga0207657_1000210317 | 129 |
| 853 | 3300025919 | Ga0207657_10005900 | Ga0207657_100059004 | 129 |
| 854 | 3300025919 | Ga0207657_10281976 | Ga0207657_102819761 | 129 |
| 855 | 3300025919 | Ga0207657_10862110 | Ga0207657_108621102 | 129 |
| 856 | 3300025920 | Ga0207649_10032422 | Ga0207649_100324222 | 129 |
| 857 | 3300025921 | Ga0207652_10026485 | Ga0207652_100264855 | 129 |
| 858 | 3300025921 | Ga0207652_10095828 | Ga0207652_100958284 | 129 |
| 859 | 3300025925 | Ga0207650_10142089 | Ga0207650_101420893 | 129 |
| 860 | 3300025926 | Ga0207659_10835872 | Ga0207659_108358722 | 129 |
| 861 | 3300025927 | Ga0207687_10062974 | Ga0207687_100629743 | 129 |
| 862 | 3300025929 | Ga0207664_10161196 | Ga0207664_101611963 | 129 |
| 863 | 3300025931 | Ga0207644_10022380 | Ga0207644_100223804 | 129 |
| 864 | 3300025932 | Ga0207690_10002369 | Ga0207690_100023699 | 129 |
| 865 | 3300025932 | Ga0207690_10012713 | Ga0207690_100127133 | 129 |
| 866 | 3300025932 | Ga0207690_10238263 | Ga0207690_102382632 | 129 |
| 867 | 3300025932 | Ga0207690_11098335 | Ga0207690_110983352 | 129 |
| 868 | 3300025933 | Ga0207706_10002893 | Ga0207706_1000289313 | 129 |
| 869 | 3300025933 | Ga0207706_10008630 | Ga0207706_100086304 | 129 |
| 870 | 3300025933 | Ga0207706_10024282 | Ga0207706_100242822 | 129 |
| 871 | 3300025933 | Ga0207706_10081488 | Ga0207706_100814882 | 129 |
| 872 | 3300025934 | Ga0207686_10362636 | Ga0207686_103626361 | 129 |
| 873 | 3300025937 | Ga0207669_10108579 | Ga0207669_101085792 | 129 |
| 874 | 3300025938 | Ga0207704_11009349 | Ga0207704_110093491 | 129 |
| 875 | 3300025940 | Ga0207691_10061499 | Ga0207691_100614992 | 129 |
| 876 | 3300025940 | Ga0207691_10134809 | Ga0207691_101348093 | 129 |
| 877 | 3300025941 | Ga0207711_10117724 | Ga0207711_101177244 | 129 |
| 878 | 3300025941 | Ga0207711_10733378 | Ga0207711_107333782 | 129 |
| 879 | 3300025942 | Ga0207689_10066588 | Ga0207689_100665883 | 129 |
| 880 | 3300025944 | Ga0207661_10030599 | Ga0207661_100305994 | 129 |
| 881 | 3300025944 | Ga0207661_10235922 | Ga0207661_102359222 | 129 |
| 882 | 3300025945 | Ga0207679_10008515 | Ga0207679_100085153 | 129 |
| 883 | 3300025945 | Ga0207679_10201523 | Ga0207679_102015232 | 129 |
| 884 | 3300025945 | Ga0207679_12014802 | Ga0207679_120148021 | 129 |
| 885 | 3300025960 | Ga0207651_10432706 | Ga0207651_104327062 | 129 |
| 886 | 3300025960 | Ga0207651_11127555 | Ga0207651_111275552 | 129 |
| 887 | 3300025960 | Ga0207651_11547410 | Ga0207651_115474102 | 129 |
| 888 | 3300025981 | Ga0207640_10010090 | Ga0207640_100100903 | 129 |
| 889 | 3300025981 | Ga0207640_10107025 | Ga0207640_101070252 | 129 |
| 890 | 3300025981 | Ga0207640_10128956 | Ga0207640_101289562 | 129 |
| 891 | 3300026023 | Ga0207677_10102695 | Ga0207677_101026953 | 129 |
| 892 | 3300026023 | Ga0207677_10765304 | Ga0207677_107653042 | 129 |
| 893 | 3300026023 | Ga0207677_10815524 | Ga0207677_108155242 | 129 |
| 894 | 3300026041 | Ga0207639_10108892 | Ga0207639_101088922 | 129 |
| 895 | 3300026041 | Ga0207639_10385639 | Ga0207639_103856391 | 129 |
| 896 | 3300026067 | Ga0207678_10002668 | Ga0207678_1000266814 | 129 |
| 897 | 3300026067 | Ga0207678_10010119 | Ga0207678_100101194 | 129 |
| 898 | 3300026067 | Ga0207678_10023738 | Ga0207678_100237382 | 129 |
| 899 | 3300026067 | Ga0207678_10586127 | Ga0207678_105861272 | 129 |
| 900 | 3300026089 | Ga0207648_10006581 | Ga0207648_1000658110 | 129 |
| 901 | 3300026095 | Ga0207676_10389840 | Ga0207676_103898402 | 129 |
| 902 | 3300026116 | Ga0207674_10011531 | Ga0207674_100115319 | 129 |
| 903 | 3300026116 | Ga0207674_10049289 | Ga0207674_100492891 | 129 |
| 904 | 3300026116 | Ga0207674_10205136 | Ga0207674_102051363 | 129 |
| 905 | 3300026118 | Ga0207675_100242894 | Ga0207675_1002428942 | 129 |
| 906 | 3300026142 | Ga0207698_10397596 | Ga0207698_103975962 | 129 |
| 907 | 3300035111 | Ga0373923_0002141 | Ga0373923_0002141_1841_2251 | 129 |
| 908 | 3300035172 | Ga0373955_0006945 | Ga0373955_0006945_3067_3477 | 129 |
| 909 | 3300035724 | Ga0373933_0003124 | Ga0373933_0003124_5807_6217 | 129 |
| 910 | 3300036401 | Ga0373937_0000641 | Ga0373937_0000641_12257_12667 | 129 |
| 911 | 3300037471 | Ga0395905_0000092 | Ga0395905_0000092_99873_100277 | 129 |
| 912 | 3300038443 | Ga0395901_0229427 | Ga0395901_0229427_556_960 | 129 |
| 913 | 3300041511 | Ga0451855_1685400 | Ga0451855_1685400_136_543 | 129 |
| 914 | 3300045976 | Ga0466967_0029143 | Ga0466967_0029143_1618_2028 | 129 |
| 915 | 3300048088 | Ga0495602_0057394 | Ga0495602_0057394_1758_2168 | 129 |
| 916 | 3300048906 | Ga0496103_0066322 | Ga0496103_0066322_581_1006 | 129 |
| 917 | 3300048915 | Ga0496112_0797084 | Ga0496112_0797084_293_718 | 129 |
| 918 | 3300059504 | Ga0587082_139513 | Ga0587082_139513_139_546 | 129 |
| 919 | 3300059642 | Ga0587069_124508 | Ga0587069_124508_125_532 | 129 |
| 920 | 3300059647 | Ga0587079_063490 | Ga0587079_063490_267_674 | 129 |
| 921 | 3300060346 | Ga0587111_0088722 | Ga0587111_0088722_151_558 | 129 |
| 922 | 3300001979 | JGI24740J21852_10017128 | JGI24740J21852_100171283 | 131 |
| 923 | 3300001989 | JGI24739J22299_10005147 | JGI24739J22299_100051477 | 131 |
| 924 | 3300001990 | JGI24737J22298_10001739 | JGI24737J22298_100017394 | 131 |
| 925 | 3300001991 | JGI24743J22301_10061766 | JGI24743J22301_100617662 | 131 |
| 926 | 3300002075 | JGI24738J21930_10000372 | JGI24738J21930_100003723 | 131 |
| 927 | 3300005328 | Ga0070676_10001347 | Ga0070676_100013473 | 131 |
| 928 | 3300005330 | Ga0070690_100020500 | Ga0070690_1000205005 | 131 |
| 929 | 3300005331 | Ga0070670_100039466 | Ga0070670_1000394663 | 131 |
| 930 | 3300005333 | Ga0070677_10041571 | Ga0070677_100415713 | 131 |
| 931 | 3300005334 | Ga0068869_100006276 | Ga0068869_1000062768 | 131 |
| 932 | 3300005335 | Ga0070666_10052734 | Ga0070666_100527342 | 131 |
| 933 | 3300005338 | Ga0068868_100196288 | Ga0068868_1001962882 | 131 |
| 934 | 3300005340 | Ga0070689_100004740 | Ga0070689_1000047403 | 131 |
| 935 | 3300005343 | Ga0070687_100391664 | Ga0070687_1003916642 | 131 |
| 936 | 3300005344 | Ga0070661_100584815 | Ga0070661_1005848152 | 131 |
| 937 | 3300005347 | Ga0070668_100022957 | Ga0070668_1000229575 | 131 |
| 938 | 3300005355 | Ga0070671_100034275 | Ga0070671_1000342753 | 131 |
| 939 | 3300005364 | Ga0070673_100001046 | Ga0070673_1000010464 | 131 |
| 940 | 3300005366 | Ga0070659_100016237 | Ga0070659_1000162373 | 131 |
| 941 | 3300005367 | Ga0070667_100008194 | Ga0070667_1000081949 | 131 |
| 942 | 3300005455 | Ga0070663_100131939 | Ga0070663_1001319392 | 131 |
| 943 | 3300005456 | Ga0070678_100074997 | Ga0070678_1000749973 | 131 |
| 944 | 3300005457 | Ga0070662_100000323 | Ga0070662_1000003235 | 131 |
| 945 | 3300005459 | Ga0068867_100013102 | Ga0068867_1000131024 | 131 |
| 946 | 3300005466 | Ga0070685_10239772 | Ga0070685_102397722 | 131 |
| 947 | 3300005539 | Ga0068853_100025346 | Ga0068853_1000253468 | 131 |
| 948 | 3300005543 | Ga0070672_100023632 | Ga0070672_1000236323 | 131 |
| 949 | 3300005564 | Ga0070664_100071624 | Ga0070664_1000716244 | 131 |
| 950 | 3300005577 | Ga0068857_100005960 | Ga0068857_1000059608 | 131 |
| 951 | 3300005578 | Ga0068854_100006418 | Ga0068854_1000064183 | 131 |
| 952 | 3300005614 | Ga0068856_100689227 | Ga0068856_1006892272 | 131 |
| 953 | 3300005616 | Ga0068852_100013090 | Ga0068852_1000130904 | 131 |
| 954 | 3300005617 | Ga0068859_100092224 | Ga0068859_1000922243 | 131 |
| 955 | 3300005618 | Ga0068864_100000222 | Ga0068864_10000022242 | 131 |
| 956 | 3300005834 | Ga0068851_10154026 | Ga0068851_101540263 | 131 |
| 957 | 3300005841 | Ga0068863_100002567 | Ga0068863_1000025674 | 131 |
| 958 | 3300005842 | Ga0068858_100003320 | Ga0068858_1000033203 | 131 |
| 959 | 3300005844 | Ga0068862_100091796 | Ga0068862_1000917963 | 131 |
| 960 | 3300006237 | Ga0097621_100561732 | Ga0097621_1005617321 | 131 |
| 961 | 3300006358 | Ga0068871_100379801 | Ga0068871_1003798012 | 131 |
| 962 | 3300006881 | Ga0068865_100006056 | Ga0068865_1000060569 | 131 |
| 963 | 3300006931 | Ga0097620_100092228 | Ga0097620_1000922284 | 131 |
| 964 | 3300007076 | Ga0075435_100734814 | Ga0075435_1007348142 | 131 |
| 965 | 3300009093 | Ga0105240_10087961 | Ga0105240_100879617 | 131 |
| 966 | 3300009098 | Ga0105245_10006125 | Ga0105245_100061259 | 131 |
| 967 | 3300009174 | Ga0105241_10342051 | Ga0105241_103420512 | 131 |
| 968 | 3300009177 | Ga0105248_10001119 | Ga0105248_1000111928 | 131 |
| 969 | 3300009551 | Ga0105238_10063618 | Ga0105238_100636182 | 131 |
| 970 | 3300010375 | Ga0105239_10261369 | Ga0105239_102613692 | 131 |
| 971 | 3300011119 | Ga0105246_10008301 | Ga0105246_100083014 | 131 |
| 972 | 3300013297 | Ga0157378_10006532 | Ga0157378_100065329 | 131 |
| 973 | 3300013306 | Ga0163162_10438663 | Ga0163162_104386632 | 131 |
| 974 | 3300013307 | Ga0157372_10035809 | Ga0157372_100358098 | 131 |
| 975 | 3300013308 | Ga0157375_10024264 | Ga0157375_100242644 | 131 |
| 976 | 3300014745 | Ga0157377_10204425 | Ga0157377_102044252 | 131 |
| 977 | 3300017792 | Ga0163161_10485228 | Ga0163161_104852282 | 131 |
| 978 | 3300025290 | Ga0207673_1020061 | Ga0207673_10200611 | 131 |
| 979 | 3300025315 | Ga0207697_10000158 | Ga0207697_1000015831 | 131 |
| 980 | 3300025321 | Ga0207656_10061879 | Ga0207656_100618792 | 131 |
| 981 | 3300025901 | Ga0207688_10007071 | Ga0207688_100070713 | 131 |
| 982 | 3300025904 | Ga0207647_10004000 | Ga0207647_100040007 | 131 |
| 983 | 3300025907 | Ga0207645_10003931 | Ga0207645_1000393112 | 131 |
| 984 | 3300025913 | Ga0207695_10622836 | Ga0207695_106228361 | 131 |
| 985 | 3300025919 | Ga0207657_10007800 | Ga0207657_100078004 | 131 |
| 986 | 3300025920 | Ga0207649_10517552 | Ga0207649_105175522 | 131 |
| 987 | 3300025923 | Ga0207681_10056834 | Ga0207681_100568343 | 131 |
| 988 | 3300025924 | Ga0207694_10334497 | Ga0207694_103344973 | 131 |
| 989 | 3300025925 | Ga0207650_10028115 | Ga0207650_100281151 | 131 |
| 990 | 3300025927 | Ga0207687_10048079 | Ga0207687_100480793 | 131 |
| 991 | 3300025931 | Ga0207644_10033303 | Ga0207644_100333033 | 131 |
| 992 | 3300025932 | Ga0207690_10017432 | Ga0207690_100174327 | 131 |
| 993 | 3300025933 | Ga0207706_10000829 | Ga0207706_1000082920 | 131 |
| 994 | 3300025936 | Ga0207670_10044294 | Ga0207670_100442942 | 131 |
| 995 | 3300025937 | Ga0207669_10828103 | Ga0207669_108281031 | 131 |
| 996 | 3300025940 | Ga0207691_10003632 | Ga0207691_100036324 | 131 |
| 997 | 3300025941 | Ga0207711_10002065 | Ga0207711_1000206518 | 131 |
| 998 | 3300025942 | Ga0207689_10000017 | Ga0207689_1000001760 | 131 |
| 999 | 3300025945 | Ga0207679_10175160 | Ga0207679_101751602 | 131 |
| 1000 | 3300025960 | Ga0207651_10029701 | Ga0207651_100297011 | 131 |
| 1001 | 3300025972 | Ga0207668_10073156 | Ga0207668_100731563 | 131 |
| 1002 | 3300025981 | Ga0207640_10032101 | Ga0207640_100321013 | 131 |
| 1003 | 3300025986 | Ga0207658_10017651 | Ga0207658_100176517 | 131 |
| 1004 | 3300026023 | Ga0207677_10298705 | Ga0207677_102987051 | 131 |
| 1005 | 3300026035 | Ga0207703_10025106 | Ga0207703_100251068 | 131 |
| 1006 | 3300026041 | Ga0207639_10205373 | Ga0207639_102053732 | 131 |
| 1007 | 3300026067 | Ga0207678_10154857 | Ga0207678_101548572 | 131 |
| 1008 | 3300026075 | Ga0207708_10326846 | Ga0207708_103268462 | 131 |
| 1009 | 3300026078 | Ga0207702_10839137 | Ga0207702_108391372 | 131 |
| 1010 | 3300026088 | Ga0207641_10011385 | Ga0207641_100113853 | 131 |
| 1011 | 3300026089 | Ga0207648_10003142 | Ga0207648_100031425 | 131 |
| 1012 | 3300026095 | Ga0207676_10009522 | Ga0207676_100095224 | 131 |
| 1013 | 3300026116 | Ga0207674_10003088 | Ga0207674_100030888 | 131 |
| 1014 | 3300026118 | Ga0207675_100296014 | Ga0207675_1002960142 | 131 |
| 1015 | 3300026142 | Ga0207698_10727625 | Ga0207698_107276252 | 131 |
| 1016 | 3300028380 | Ga0268265_10059407 | Ga0268265_100594071 | 131 |
| 1017 | 3300028381 | Ga0268264_10157795 | Ga0268264_101577953 | 131 |
| 1018 | 3300050513 | nmdc:mga0rr50_286977_c1 | nmdc:mga0rr50_286977_c1_814_1209 | 131 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8adc-assembly1.cif.gz_B | viral tegument-like dubs | 0.7687 | 34 | 61 |
| 8adc-assembly2.cif.gz_A | viral tegument-like dubs | 0.7541 | 34 | 62 |
| 8adb-assembly1.cif.gz_A | viral tegument-like dubs | 0.7535 | 34 | 67 |
| 4u3q-assembly1.cif.gz_B | crystal structure of recombinant tp0435 from treponema pallidum | 0.6771 | 34 | 101 |
| 6c9n-assembly1.cif.gz_A | mycobacterium tuberculosis adenosine kinase bound to sangivamycin | 0.6679 | 44 | 73 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4HYS3_91_210_3.10.330.10 | Alpha Beta;Roll;Vcp-like ATPase; Chain A, domain 2; | 0.7542 | 92 | 116 | 3.10.330.10 |
| af_O45110_151_229_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.6776 | 41 | 65 | 2.30.30.30 |
| af_A0A2R8QJQ6_302_523_3.90.70.120 | Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A; | 0.6615 | 34 | 65 | 3.90.70.120 |
| af_A0A0R0ELK1_770_819_2.30.30.60 | Mainly Beta;Roll;SH3 type barrels.; | 0.6557 | 35 | 67 | 2.30.30.60 |
| af_Q2FWM2_2_319_3.40.1190.20 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.6554 | 44 | 73 | 3.40.1190.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7T2GKA4-F1-model_v4 | Uncharacterized protein | 0.8998 | 30 | 111 |
|
| AF-A0A519Q9Y9-F1-model_v4 | DUF3313 domain-containing protein | 0.8746 | 21 | 112 |
|
| AF-A0A7H0G918-F1-model_v4 | deleted | 0.8704 | 66 | 130 |
|
| AF-A0A158S7G9-F1-model_v4 | Uncharacterized protein | 0.8638 | 25 | 116 |
|
| AF-A0A1H7XGQ5-F1-model_v4 | Tetratricopeptide repeat-containing protein | 0.8287 | 38 | 87 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar