F488303

General Info

Members Datasets Scaffolds Average Seq Length
1017 506 769 701

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|640427133|640488702
Length 790
Sequence DAGRHRLQRRPRDLAEPDGALGGAGLQTGRQRVSRPGKRAADGGAYRPALTDACRPTIGWLNRLAFPGGTFDCCLRPRRLEWRDNNSAMREPEMSDISVHHRACHLCEAICGLTIQTEGERILSIKGDPLDSFSRGHICPKAVALQDIQNDPDRLRHPMRRCGDEWQAISWEEAYELVAERLAEIRERHGSNAVAIYQGNPSVHNYGLTTHSNYFLGLLKTRNRFSATSVDQLPHHLTSHLMYGHGLLLPVPDIDHTDFMLILGGNPLASNGSIMTVPDVEKRLKAIRARGGKLVVVDPRRSETAAIADQHLFVRPGQDAALLFGLLNTLFEEGLTRASELPLDGIEEVRTAIAAFSAEAMSARCGVPAEQIRQLARDFAAADRAVCYGRMGVSTQAFGTLCQWLVQLINLVTGNLDRVGGALCTEPAVDLVETTKGGHFDAWRSRVSQLPEYGGELPVAALAEEMLEPGEGQVRALITVAGNPVLSTPNGRKLEQALDGLEFMLSVDFYINETTRYADVILPPTAPLEHDHYDATFNLLAVRNVTRFNLPVLPKPEGALHDWEIFIGLAEAYAGRVGVELKPTMPPQQMMDLALRHGPYGDKSERKLSLAALEDYPHGLDLGPLKPNLARRLKTPNKRIQATPALMLDDLQRFAAQPQAGADELLLIGRRHVRSNNSWMHNYQRLVKGKPRHQLLMHPTDMAARALQDGQRVRVHSRVGVVEVEALASEEMMPGVVSLPHGWGHARPGVQLDIARQQPGASCNDLTDERQLDVSGNAALNGVTVQVSAA

Samples

Sample ID Description Type Environment
1 2511231004 Pseudomonas sp. GM102 Isolate Nodule
2 2511231006 Pseudomonas sp. GM17 Isolate Nodule
3 2511231007 Pseudomonas sp. GM18 Isolate Nodule
4 2511231008 Pseudomonas sp. GM21 Isolate Nodule
5 2511231010 Pseudomonas sp. GM25 Isolate Nodule
6 2511231011 Pseudomonas sp. GM30 Isolate Nodule
7 2511231012 Pseudomonas sp. GM33 Isolate Nodule
8 2511231014 Pseudomonas sp. GM48 Isolate Nodule
9 2511231015 Pseudomonas sp. GM49 Isolate Nodule
10 2511231016 Pseudomonas sp. GM50 Isolate Nodule
11 2511231017 Pseudomonas sp. GM55 Isolate Nodule
12 2511231018 Pseudomonas sp. GM60 Isolate Nodule
13 2511231019 Pseudomonas sp. GM67 Isolate Nodule
14 2511231020 Pseudomonas sp. GM74 Isolate Nodule
15 2511231021 Pseudomonas sp. GM78 Isolate Nodule
16 2511231022 Pseudomonas sp. GM79 Isolate Nodule
17 2511231023 Pseudomonas sp. GM80 Isolate Nodule
18 2511231031 Pseudomonas sp. GM16 Isolate Nodule
19 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
20 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
21 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
22 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
23 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
24 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
25 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
26 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
27 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
28 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
29 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
30 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
31 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
32 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
33 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
34 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
35 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
36 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
37 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
38 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
39 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
40 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
41 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
42 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
43 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
44 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
45 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
46 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
47 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
48 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
49 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
50 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
51 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
52 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
53 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
54 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
55 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
56 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
57 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
58 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
59 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
60 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
61 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
62 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
63 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
64 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
65 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
66 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
67 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
68 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
69 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
70 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
71 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
72 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
73 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
74 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
75 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
76 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
77 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
78 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
79 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
80 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
81 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
82 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
83 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
84 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
85 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
86 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
87 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
88 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
89 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
90 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
91 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
92 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
93 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
94 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
95 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
96 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
97 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
98 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
99 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
100 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
101 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
102 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
103 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
104 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
105 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
106 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
107 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
108 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
109 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
110 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
111 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
112 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
113 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
114 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
115 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
116 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
117 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
118 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
119 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
120 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
121 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
122 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
123 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
124 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
125 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
126 2765235841 Pseudomonas putida AA7 Isolate Unclassified
127 2773857670 Pseudomonas sp. 478 Isolate Unclassified
128 2773857673 Pseudomonas sp. 443 Isolate Unclassified
129 2784132063 Pseudomonas sp. 424 Isolate Unclassified
130 2784132072 Pseudomonas sp. 460 Isolate Unclassified
131 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
132 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
133 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
134 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
135 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
136 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
137 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
138 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
139 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
140 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
141 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
142 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
143 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
144 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
145 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
146 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
147 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
148 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
149 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
150 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
151 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
152 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
153 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
154 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
155 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
156 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
157 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
158 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
159 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
160 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
161 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
162 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
163 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
164 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
165 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
166 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
167 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
168 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
169 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
170 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
171 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
172 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
173 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
174 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
175 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
176 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
177 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
178 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
179 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
180 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
181 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
182 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
183 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
184 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
185 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
186 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
187 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
188 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
189 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
190 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
191 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
192 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
193 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
194 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
195 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
196 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
197 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
198 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
199 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
200 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
201 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
202 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
203 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
204 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
205 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
206 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
207 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
208 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
209 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
210 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
211 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
212 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
213 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
214 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
215 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
216 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
217 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
218 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
219 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
220 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
221 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
222 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
223 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
224 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
225 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
226 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
227 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
228 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
229 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
230 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
231 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
232 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
233 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
234 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
235 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
236 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
237 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
238 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
239 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
240 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
241 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
242 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
243 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
244 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
245 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
246 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
247 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
248 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
249 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
250 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
251 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
252 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
253 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
254 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
255 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
256 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
257 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
258 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
259 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
260 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
261 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
262 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
263 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
264 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
265 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
266 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
267 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
268 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
269 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
270 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
271 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
272 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
273 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
274 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
275 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
276 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
277 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
278 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
279 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
280 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
281 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
282 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
283 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
284 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
285 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
286 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
287 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
290 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
291 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
292 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
293 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
294 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
295 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
296 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
298 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
299 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
300 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
301 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
302 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
303 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
320 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
321 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
322 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
323 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
324 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
328 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
329 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
330 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
331 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
332 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
333 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
334 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
335 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
336 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
337 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
338 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
339 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
340 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
341 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
342 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
343 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
344 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
345 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
346 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
347 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
348 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
349 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
350 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
351 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
352 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
353 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
354 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
355 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
356 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
357 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
358 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
359 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
360 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
361 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
362 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
363 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
364 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
365 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
366 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
367 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
368 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
369 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
370 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
371 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
372 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
373 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
374 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
375 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
376 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
377 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
378 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
379 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
380 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
381 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
382 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
383 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
384 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
385 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
386 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
387 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
388 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
389 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
390 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
391 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
392 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
393 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
394 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
395 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
396 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
397 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
398 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
399 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
400 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
401 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
402 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
403 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
404 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
405 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
406 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
407 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
408 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
409 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
410 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
411 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
412 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
413 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
414 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
415 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
416 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
417 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
418 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
419 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
420 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
421 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
422 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
423 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
424 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
425 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
426 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
427 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
428 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
429 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
430 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
431 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
432 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
433 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
434 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
435 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
436 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
437 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
438 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
439 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
440 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
441 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
442 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
443 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
444 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
445 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
446 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
447 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
448 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
449 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
450 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
451 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
452 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
453 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
454 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
455 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
459 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
461 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
462 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
463 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
464 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
465 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
466 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
467 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
468 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
469 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
470 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
471 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
472 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
473 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
474 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
475 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
476 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
477 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
478 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
479 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
480 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
481 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
482 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
483 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
484 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
485 8052494512 Pseudomonas putida LD6 Isolate Unclassified
486 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
487 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
488 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
489 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
490 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
491 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
492 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
493 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
494 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
495 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
496 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
497 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
498 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
499 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
500 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
501 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
502 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
503 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
504 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
505 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
506 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.61
Metatranscriptomes 0
Isolates 24.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.6
Nodule 2.56
Rhizoplane 7.28
Rhizosphere 70.8
Stem 0
Stem Tuber 0
Unclassified 13.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10001313 3300001990 Bacteria 8807
2 JGI25162J39368_1000034 3300002737 Bacteria 183428
3 JGI25163J39215_1001370 3300002771 Bacteria 4125
4 JGI25163J39215_1001449 3300002771 Bacteria 3895
5 JGI25164J39214_1000018 3300002772 Bacteria 185215
6 JGI25164J39214_1000304 3300002772 Bacteria 32781
7 JGI25165J46597_1000123 3300003214 Bacteria 131481
8 JGI25165J46597_1000575 3300003214 Bacteria 32781
9 Ga0055538_1000073 3300003751 Bacteria 90843
10 Ga0055539_1000109 3300003752 Bacteria 90843
11 Ga0055533_1000117 3300003756 Bacteria 90843
12 Ga0055532_1000283 3300003758 Bacteria 32601
13 Ga0055525_1000156 3300003759 Bacteria 90843
14 Ga0055536_1003129 3300003781 Bacteria 8985
15 Ga0055536_1012012 3300003781 Bacteria 3255
16 Ga0055536_1012314 3300003781 Bacteria 3185
17 Ga0055530_10003450 3300003791 Bacteria 8985
18 Ga0055530_10009909 3300003791 Bacteria 3591
19 Ga0055540_1000849 3300003792 Bacteria 20440
20 Ga0055540_1002831 3300003792 Bacteria 8847
21 Ga0055540_1008308 3300003792 Bacteria 3753
22 Ga0055531_10000573 3300003794 Bacteria 32112
23 Ga0055541_1000074 3300003841 Bacteria 90843
24 Ga0065714_10065199 3300005288 Bacteria 12019
25 Ga0065714_10067505 3300005288 Bacteria 5429
26 Ga0065714_10072768 3300005288 Bacteria 3305
27 Ga0065714_10077307 3300005288 Bacteria 2700
28 Ga0065714_10077484 3300005288 Bacteria 2685
29 Ga0065714_10081270 3300005288 Bacteria 2376
30 Ga0065704_10070645 3300005289 Bacteria 18454
31 Ga0065704_10093716 3300005289 Bacteria 2580
32 Ga0065704_10093739 3300005289 Bacteria 2574
33 Ga0065712_10005361 3300005290 Bacteria 4531
34 Ga0065712_10067808 3300005290 Bacteria 30719
35 Ga0065715_10002829 3300005293 Bacteria 4618
36 Ga0065707_10100167 3300005295 Bacteria 2950
37 Ga0070658_10031202 3300005327 Bacteria 4279
38 Ga0070683_100003158 3300005329 Bacteria 13282
39 Ga0070670_100005001 3300005331 Bacteria 11155
40 Ga0070670_100094465 3300005331 Bacteria 2572
41 Ga0070660_100009380 3300005339 Bacteria 6879
42 Ga0070689_100002206 3300005340 Bacteria 12625
43 Ga0070669_100005309 3300005353 Bacteria 9304
44 Ga0070659_100018251 3300005366 Bacteria 5294
45 Ga0070662_100002261 3300005457 Bacteria 11813
46 Ga0068853_100042334 3300005539 Bacteria 3894
47 Ga0070693_100008503 3300005547 Bacteria 5067
48 Ga0070665_100000865 3300005548 Bacteria 39234
49 Ga0070665_100041084 3300005548 Bacteria 4648
50 Ga0070664_100002637 3300005564 Bacteria 14465
51 Ga0068854_100028702 3300005578 Bacteria 3847
52 Ga0068856_100063831 3300005614 Bacteria 3638
53 Ga0068851_10000006 3300005834 Bacteria 258116
54 Ga0068860_100100040 3300005843 Bacteria 2766
55 Ga0075432_10007294 3300006058 Bacteria 3764
56 Ga0075432_10014552 3300006058 Bacteria 2679
57 Ga0075362_10022416 3300006177 Bacteria 2661
58 Ga0075436_100058307 3300006914 Bacteria 2666
59 Ga0099823_1000052 3300006944 Bacteria 56662
60 Ga0079104_1000202 3300006946 Bacteria 83431
61 Ga0079104_1003010 3300006946 Bacteria 8281
62 Ga0099826_10002165 3300006948 Bacteria 12502
63 Ga0105251_10000035 3300009011 Bacteria 117861
64 Ga0105251_10001730 3300009011 Bacteria 18229
65 Ga0105251_10024190 3300009011 Bacteria 3121
66 Ga0105251_10029612 3300009011 Bacteria 2757
67 Ga0105251_10029711 3300009011 Bacteria 2751
68 Ga0105251_10030994 3300009011 Bacteria 2679
69 Ga0105251_10033226 3300009011 Bacteria 2563
70 Ga0105251_10041566 3300009011 Bacteria 2236
71 Ga0105244_10001239 3300009036 Bacteria 20944
72 Ga0105244_10017260 3300009036 Bacteria 4084
73 Ga0105244_10023428 3300009036 Bacteria 3385
74 Ga0105244_10026959 3300009036 Bacteria 3103
75 Ga0105244_10032621 3300009036 Bacteria 2755
76 Ga0105244_10034773 3300009036 Bacteria 2651
77 Ga0105244_10035232 3300009036 Bacteria 2630
78 Ga0105250_10000056 3300009092 Bacteria 114085
79 Ga0105250_10014720 3300009092 Bacteria 3209
80 Ga0105250_10015060 3300009092 Bacteria 3169
81 Ga0105250_10015386 3300009092 Bacteria 3131
82 Ga0105250_10015561 3300009092 Bacteria 3114
83 Ga0105250_10015844 3300009092 Bacteria 3081
84 Ga0105250_10028354 3300009092 Bacteria 2255
85 Ga0105247_10061324 3300009101 Bacteria 2332
86 Ga0105243_10000133 3300009148 Bacteria 85133
87 Ga0105243_10013241 3300009148 Bacteria 6236
88 Ga0105243_10055268 3300009148 Bacteria 3154
89 Ga0105243_10065587 3300009148 Bacteria 2917
90 Ga0105243_10085452 3300009148 Bacteria 2586
91 Ga0105242_10002285 3300009176 Bacteria 15140
92 Ga0105248_10035793 3300009177 Bacteria 5553
93 Ga0105237_10005854 3300009545 Bacteria 13790
94 Ga0105239_10008909 3300010375 Bacteria 11355
95 Ga0105246_10001386 3300011119 Bacteria 14308
96 Ga0105246_10006579 3300011119 Bacteria 7096
97 Ga0105246_10056823 3300011119 Bacteria 2706
98 Ga0157345_1000466 3300012498 Bacteria 3875
99 Ga0157373_10058499 3300013100 Bacteria 2733
100 Ga0157373_10059460 3300013100 Bacteria 2708
101 Ga0157373_10060687 3300013100 Bacteria 2678
102 Ga0157373_10064824 3300013100 Bacteria 2586
103 Ga0157373_10065719 3300013100 Bacteria 2566
104 Ga0157371_10005665 3300013102 Bacteria 10486
105 Ga0157371_10035009 3300013102 Bacteria 3600
106 Ga0157370_10018287 3300013104 Bacteria 7050
107 Ga0157370_10081418 3300013104 Bacteria 3046
108 Ga0157369_10098005 3300013105 Bacteria 3127
109 Ga0157369_10101594 3300013105 Bacteria 3064
110 Ga0157369_10110445 3300013105 Bacteria 2923
111 Ga0157369_10121333 3300013105 Bacteria 2773
112 Ga0157369_10124194 3300013105 Bacteria 2738
113 Ga0157369_10142667 3300013105 Bacteria 2534
114 Ga0163162_10015613 3300013306 Bacteria 7422
115 Ga0163162_10062608 3300013306 Bacteria 3761
116 Ga0163162_10091796 3300013306 Bacteria 3120
117 Ga0157372_10128859 3300013307 Bacteria 2910
118 Ga0157375_10010253 3300013308 Bacteria 8243
119 Ga0163163_10023175 3300014325 Bacteria 5890
120 Ga0157380_10059801 3300014326 Bacteria 3042
121 Ga0182008_10009257 3300014497 Bacteria 5324
122 Ga0182008_10021127 3300014497 Bacteria 3346
123 Ga0182008_10026059 3300014497 Bacteria 2966
124 Ga0182008_10029299 3300014497 Bacteria 2782
125 Ga0182008_10033809 3300014497 Bacteria 2565
126 Ga0182006_1010175 3300015261 Bacteria 4191
127 Ga0182006_1013977 3300015261 Bacteria 3468
128 Ga0182006_1017585 3300015261 Bacteria 3035
129 Ga0182007_10012959 3300015262 Bacteria 3194
130 Ga0182007_10018219 3300015262 Bacteria 2547
131 Ga0182005_1005690 3300015265 Bacteria 3875
132 Ga0182005_1008456 3300015265 Bacteria 3031
133 Ga0182005_1008628 3300015265 Bacteria 2996
134 Ga0163161_10048991 3300017792 Bacteria 3052
135 Ga0163161_10050044 3300017792 Bacteria 3022
136 Ga0163161_10063375 3300017792 Bacteria 2694
137 Ga0163161_10066150 3300017792 Bacteria 2639
138 Ga0213872_10015263 3300021361 Bacteria 3575
139 Ga0209760_100055 3300025207 Bacteria 100237
140 Ga0209760_100084 3300025207 Bacteria 75138
141 Ga0209784_100015 3300025224 Bacteria 482117
142 Ga0209566_100012 3300025225 Bacteria 482281
143 Ga0209674_100027 3300025226 Bacteria 482281
144 Ga0209147_100019 3300025229 Bacteria 482139
145 Ga0209563_100031 3300025230 Bacteria 482281
146 Ga0207427_100004 3300025231 Bacteria 939600
147 Ga0207427_100007 3300025231 Bacteria 746220
148 Ga0209437_100006 3300025233 Bacteria 1042724
149 Ga0209437_100028 3300025233 Bacteria 540136
150 Ga0209437_101295 3300025233 Bacteria 6721
151 Ga0209258_100296 3300025242 Bacteria 81403
152 Ga0209646_1000213 3300025246 Bacteria 64543
153 Ga0209677_100016 3300025253 Bacteria 482117
154 Ga0209759_1002967 3300025256 Bacteria 7067
155 Ga0209233_1000008 3300025261 Bacteria 1356712
156 Ga0209233_1000059 3300025261 Bacteria 414562
157 Ga0209676_1000006 3300025292 Bacteria 1039588
158 Ga0209676_1000010 3300025292 Bacteria 954025
159 Ga0209676_1000231 3300025292 Bacteria 120750
160 Ga0209676_1000270 3300025292 Bacteria 108368
161 Ga0209676_1015059 3300025292 Bacteria 2868
162 Ga0209050_1000019 3300025298 Bacteria 608757
163 Ga0209050_1000027 3300025298 Bacteria 483261
164 Ga0209050_1000065 3300025298 Bacteria 313668
165 Ga0209050_1008780 3300025298 Bacteria 5310
166 Ga0209051_1000238 3300025303 Bacteria 92629
167 Ga0209051_1000258 3300025303 Bacteria 88383
168 Ga0209051_1000265 3300025303 Bacteria 87617
169 Ga0209257_1000119 3300025304 Bacteria 225893
170 Ga0209257_1009506 3300025304 Bacteria 5179
171 Ga0207656_10000014 3300025321 Bacteria 146941
172 Ga0207696_1000022 3300025711 Bacteria 427529
173 Ga0207696_1000034 3300025711 Bacteria 350426
174 Ga0207696_1000179 3300025711 Bacteria 99732
175 Ga0207696_1000221 3300025711 Bacteria 82620
176 Ga0207696_1014999 3300025711 Bacteria 2639
177 Ga0207655_1000021 3300025728 Bacteria 518596
178 Ga0207655_1000437 3300025728 Bacteria 55747
179 Ga0207655_1001119 3300025728 Bacteria 26209
180 Ga0207655_1002144 3300025728 Bacteria 16449
181 Ga0207655_1002245 3300025728 Bacteria 15983
182 Ga0207655_1003145 3300025728 Bacteria 12481
183 Ga0207655_1004890 3300025728 Bacteria 9296
184 Ga0207655_1009294 3300025728 Bacteria 6121
185 Ga0207655_1011125 3300025728 Bacteria 5386
186 Ga0207655_1018538 3300025728 Bacteria 3685
187 Ga0207655_1019100 3300025728 Bacteria 3602
188 Ga0207655_1019516 3300025728 Bacteria 3537
189 Ga0207655_1026581 3300025728 Bacteria 2777
190 Ga0207713_1000014 3300025735 Bacteria 432450
191 Ga0207713_1000219 3300025735 Bacteria 77126
192 Ga0207713_1000322 3300025735 Bacteria 54257
193 Ga0207713_1000865 3300025735 Bacteria 27710
194 Ga0207713_1002208 3300025735 Bacteria 14420
195 Ga0207713_1002739 3300025735 Bacteria 12529
196 Ga0207713_1003423 3300025735 Bacteria 10836
197 Ga0207713_1018349 3300025735 Bacteria 3467
198 Ga0207713_1018515 3300025735 Bacteria 3445
199 Ga0207713_1024866 3300025735 Bacteria 2779
200 Ga0207713_1024878 3300025735 Bacteria 2778
201 Ga0207710_10005011 3300025900 Bacteria 5736
202 Ga0207671_10000019 3300025914 Bacteria 317781
203 Ga0207657_10017006 3300025919 Bacteria 6996
204 Ga0207649_10000004 3300025920 Bacteria 360726
205 Ga0207681_10003747 3300025923 Bacteria 9450
206 Ga0207650_10000863 3300025925 Bacteria 22996
207 Ga0207650_10001402 3300025925 Bacteria 17379
208 Ga0207706_10002341 3300025933 Bacteria 18506
209 Ga0207706_10020261 3300025933 Bacteria 5978
210 Ga0207709_10000013 3300025935 Bacteria 531977
211 Ga0207709_10001096 3300025935 Bacteria 19859
212 Ga0207709_10018226 3300025935 Bacteria 3928
213 Ga0207670_10002998 3300025936 Bacteria 8912
214 Ga0207704_10002399 3300025938 Bacteria 8419
215 Ga0207661_10008619 3300025944 Bacteria 7286
216 Ga0207679_10000019 3300025945 Bacteria 230270
217 Ga0209281_1000010 3300027111 Bacteria 726106
218 Ga0209281_1000049 3300027111 Bacteria 322274
219 Ga0209389_1000005 3300027296 Bacteria 232255
220 Ga0209371_1000239 3300027312 Bacteria 68842
221 Ga0209371_1000253 3300027312 Bacteria 65388
222 Ga0209995_1002313 3300027471 Bacteria 3007
223 Ga0207428_10053616 3300027907 Bacteria 3215
224 Ga0268266_10001168 3300028379 Bacteria 32486
225 Ga0268266_10043777 3300028379 Bacteria 3826
226 Ga0268266_10044230 3300028379 Bacteria 3806
227 Ga0268265_10020412 3300028380 Bacteria 4624
228 Ga0268264_10052167 3300028381 Bacteria 3410
229 Ga0307517_10089734 3300028786 Bacteria 2528
230 Ga0268256_1000199 3300030500 Bacteria 68849
231 Ga0268256_1000797 3300030500 Bacteria 22655
232 Ga0307511_10059086 3300030521 Bacteria 2954
233 Ga0316177_1066524 3300030731 Bacteria 3395
234 Ga0316179_1027375 3300030734 Bacteria 5590
235 Ga0316178_1076411 3300030735 Bacteria 28643
236 Ga0316181_1090496 3300030744 Bacteria 4262
237 Ga0307509_10120304 3300031507 Bacteria 2605
238 Ga0307408_100000047 3300031548 Bacteria 166310
239 Ga0307408_100008794 3300031548 Bacteria 6667
240 Ga0307408_100046273 3300031548 Bacteria 3111
241 Ga0307408_100050617 3300031548 Bacteria 2988
242 Ga0307408_100104467 3300031548 Bacteria 2164
243 Ga0307405_10002250 3300031731 Bacteria 8446
244 Ga0307405_10003033 3300031731 Bacteria 7607
245 Ga0307413_10015659 3300031824 Bacteria 3893
246 Ga0307406_10025698 3300031901 Bacteria 3527
247 Ga0307407_10022106 3300031903 Bacteria 3293
248 Ga0307412_10006998 3300031911 Bacteria 6402
249 Ga0307412_10010807 3300031911 Bacteria 5268
250 Ga0307412_10021728 3300031911 Bacteria 3924
251 Ga0307409_100043923 3300031995 Bacteria 3361
252 Ga0307414_10024247 3300032004 Bacteria 3865
253 Ga0307414_10047289 3300032004 Bacteria 2960
254 Ga0307411_10009125 3300032005 Bacteria 5192
255 Ga0307510_10062651 3300033180 Bacteria 3798
256 Ga0436364_0471212 3300037853 Bacteria 24075
257 Ga0400485_08592 3300038735 Bacteria 5530
258 Ga0436361_0690852 3300039447 Bacteria 7513
259 Ga0436361_1012736 3300039447 Bacteria 10762
260 Ga0439436_0001961 3300041404 Bacteria 6095
261 Ga0439438_001186 3300041405 Bacteria 11576
262 Ga0439438_001866 3300041405 Bacteria 9220
263 Ga0439438_004459 3300041405 Bacteria 5361
264 Ga0439438_008691 3300041405 Bacteria 3344
265 Ga0439438_009584 3300041405 Bacteria 3125
266 Ga0439438_009756 3300041405 Bacteria 3085
267 Ga0439438_010829 3300041405 Bacteria 2866
268 Ga0439447_006808 3300041407 Bacteria 3674
269 Ga0439466_0001022 3300041411 Bacteria 10767
270 Ga0439466_0002186 3300041411 Bacteria 7667
271 Ga0439466_0004468 3300041411 Bacteria 5381
272 Ga0439466_0016097 3300041411 Bacteria 2707
273 Ga0439432_001773 3300042006 Bacteria 8081
274 Ga0439432_002335 3300042006 Bacteria 7158
275 Ga0439432_002494 3300042006 Bacteria 6935
276 Ga0439432_002665 3300042006 Bacteria 6678
277 Ga0439432_003372 3300042006 Bacteria 5927
278 Ga0439451_001619 3300042009 Bacteria 4465
279 Ga0439451_002915 3300042009 Bacteria 3474
280 Ga0439452_000311 3300042010 Bacteria 31096
281 Ga0439452_001075 3300042010 Bacteria 12056
282 Ga0439452_004203 3300042010 Bacteria 4879
283 Ga0439452_006032 3300042010 Bacteria 3836
284 Ga0439452_007158 3300042010 Bacteria 3435
285 Ga0439456_000798 3300042013 Bacteria 6393
286 Ga0439456_001395 3300042013 Bacteria 4837
287 Ga0439463_000274 3300042016 Bacteria 14223
288 Ga0439463_002176 3300042016 Bacteria 5050
289 Ga0450911_000066 3300042115 Bacteria 43087
290 Ga0450911_001637 3300042115 Bacteria 4984
291 Ga0450911_003031 3300042115 Bacteria 3079
292 Ga0450923_003130 3300042125 Bacteria 2459
293 Ga0450902_000205 3300042137 Bacteria 6903
294 Ga0450903_002144 3300042138 Bacteria 3534
295 Ga0450903_004512 3300042138 Bacteria 2373
296 Ga0450904_000048 3300042139 Bacteria 27569
297 Ga0450904_001720 3300042139 Bacteria 2908
298 Ga0450905_001052 3300042142 Bacteria 3469
299 Ga0450906_002598 3300042145 Bacteria 3936
300 Ga0450907_000017 3300042146 Bacteria 83894
301 Ga0450910_001240 3300042147 Bacteria 3183
302 Ga0439446_0007580 3300042156 Bacteria 2857
303 Ga0439446_0011172 3300042156 Bacteria 2434
304 Ga0439434_0002739 3300042435 Bacteria 5136
305 Ga0439460_0004386 3300042461 Bacteria 3438
306 Ga0466972_0017593 3300044658 Bacteria 3578
307 Ga0453684_0059415 3300044712 Bacteria 4929
308 Ga0495617_004289 3300046452 Bacteria 5202
309 Ga0495617_006066 3300046452 Bacteria 4255
310 Ga0495617_011060 3300046452 Bacteria 3084
311 Ga0495617_013012 3300046452 Bacteria 2835
312 Ga0495617_014114 3300046452 Bacteria 2715
313 Ga0495617_015051 3300046452 Bacteria 2624
314 Ga0495627_000047 3300046453 Bacteria 170068
315 Ga0495627_008983 3300046453 Bacteria 3695
316 Ga0495627_012153 3300046453 Bacteria 3065
317 Ga0495627_020716 3300046453 Bacteria 2189
318 Ga0495627_023940 3300046453 Bacteria 1995
319 Ga0495592_0077085 3300046454 Bacteria 2418
320 Ga0495590_0008218 3300046457 Bacteria 3992
321 Ga0495590_0014644 3300046457 Bacteria 2860
322 Ga0495591_000019 3300046458 Bacteria 223010
323 Ga0495591_000226 3300046458 Bacteria 55990
324 Ga0495591_001090 3300046458 Bacteria 18086
325 Ga0495591_001827 3300046458 Bacteria 12580
326 Ga0495591_003767 3300046458 Bacteria 7671
327 Ga0495591_007755 3300046458 Bacteria 4501
328 Ga0495591_008398 3300046458 Bacteria 4233
329 Ga0495591_009279 3300046458 Bacteria 3925
330 Ga0495591_010510 3300046458 Bacteria 3583
331 Ga0495591_012388 3300046458 Bacteria 3179
332 Ga0495591_013155 3300046458 Bacteria 3043
333 Ga0495591_013246 3300046458 Bacteria 3028
334 Ga0495638_0024191 3300046460 Bacteria 3963
335 Ga0495638_0031234 3300046460 Bacteria 3424
336 Ga0495638_0039113 3300046460 Bacteria 3012
337 Ga0495638_0039262 3300046460 Bacteria 3005
338 Ga0495638_0039614 3300046460 Bacteria 2990
339 Ga0495638_0049146 3300046460 Bacteria 2637
340 Ga0495638_0067905 3300046460 Bacteria 2187
341 Ga0495653_0017574 3300046463 Bacteria 5815
342 Ga0495653_0054783 3300046463 Bacteria 3045
343 Ga0495650_0001450 3300046471 Bacteria 22769
344 Ga0495650_0001813 3300046471 Bacteria 19206
345 Ga0495650_0004844 3300046471 Bacteria 9002
346 Ga0495650_0016000 3300046471 Bacteria 3820
347 Ga0495650_0023168 3300046471 Bacteria 2960
348 Ga0495650_0028406 3300046471 Bacteria 2569
349 Ga0495605_0000016 3300046474 Bacteria 289508
350 Ga0495605_0000777 3300046474 Bacteria 22913
351 Ga0495605_0004046 3300046474 Bacteria 8654
352 Ga0495605_0008479 3300046474 Bacteria 5811
353 Ga0495605_0025995 3300046474 Bacteria 3046
354 Ga0495605_0041482 3300046474 Bacteria 2292
355 Ga0495639_0000070 3300046475 Bacteria 47518
356 Ga0495584_0014286 3300046491 Bacteria 4046
357 Ga0495584_0016726 3300046491 Bacteria 3739
358 Ga0495584_0018656 3300046491 Bacteria 3526
359 Ga0495584_0023881 3300046491 Bacteria 3099
360 Ga0495584_0024138 3300046491 Bacteria 3082
361 Ga0495584_0031098 3300046491 Bacteria 2702
362 Ga0495584_0031646 3300046491 Bacteria 2677
363 Ga0495584_0037181 3300046491 Bacteria 2459
364 Ga0495585_0004440 3300046492 Bacteria 9099
365 Ga0495585_0013778 3300046492 Bacteria 4724
366 Ga0495585_0027478 3300046492 Bacteria 3247
367 Ga0495585_0030514 3300046492 Bacteria 3065
368 Ga0495585_0030685 3300046492 Bacteria 3056
369 Ga0495585_0031930 3300046492 Bacteria 2986
370 Ga0495585_0039729 3300046492 Bacteria 2644
371 Ga0495585_0047438 3300046492 Bacteria 2392
372 Ga0495585_0052582 3300046492 Bacteria 2255
373 Ga0495585_0052698 3300046492 Bacteria 2252
374 Ga0495594_0000837 3300046499 Bacteria 15880
375 Ga0495594_0030349 3300046499 Bacteria 2924
376 Ga0495596_0002692 3300046500 Bacteria 9368
377 Ga0495596_0019628 3300046500 Bacteria 2774
378 Ga0495607_0000204 3300046501 Bacteria 62840
379 Ga0495607_0000573 3300046501 Bacteria 35938
380 Ga0495607_0001298 3300046501 Bacteria 22284
381 Ga0495607_0006581 3300046501 Bacteria 8160
382 Ga0495607_0008637 3300046501 Bacteria 6946
383 Ga0495607_0013688 3300046501 Bacteria 5304
384 Ga0495607_0018774 3300046501 Bacteria 4398
385 Ga0495607_0023427 3300046501 Bacteria 3865
386 Ga0495607_0026251 3300046501 Bacteria 3615
387 Ga0495607_0033681 3300046501 Bacteria 3115
388 Ga0495607_0035991 3300046501 Bacteria 2989
389 Ga0495583_0000819 3300046506 Bacteria 38035
390 Ga0495583_0002361 3300046506 Bacteria 16303
391 Ga0495583_0005593 3300046506 Bacteria 8473
392 Ga0495583_0006065 3300046506 Bacteria 7995
393 Ga0495583_0006950 3300046506 Bacteria 7259
394 Ga0495583_0017172 3300046506 Bacteria 3855
395 Ga0495583_0023932 3300046506 Bacteria 3078
396 Ga0495606_0000567 3300046507 Bacteria 58569
397 Ga0495606_0001124 3300046507 Bacteria 38193
398 Ga0495606_0001172 3300046507 Bacteria 36969
399 Ga0495606_0010245 3300046507 Bacteria 7809
400 Ga0495606_0027985 3300046507 Bacteria 3984
401 Ga0495606_0030072 3300046507 Bacteria 3800
402 Ga0495606_0032211 3300046507 Bacteria 3634
403 Ga0495606_0032296 3300046507 Bacteria 3628
404 Ga0495606_0034421 3300046507 Bacteria 3478
405 Ga0495606_0034592 3300046507 Bacteria 3467
406 Ga0495606_0034618 3300046507 Bacteria 3465
407 Ga0495606_0037921 3300046507 Bacteria 3267
408 Ga0495606_0041559 3300046507 Bacteria 3082
409 Ga0495610_0019353 3300046512 Bacteria 3813
410 Ga0495610_0026723 3300046512 Bacteria 3077
411 Ga0495610_0027144 3300046512 Bacteria 3048
412 Ga0495610_0029881 3300046512 Bacteria 2862
413 Ga0495610_0034836 3300046512 Bacteria 2589
414 Ga0495610_0035785 3300046512 Bacteria 2544
415 Ga0495616_0009067 3300046513 Bacteria 5837
416 Ga0495616_0014588 3300046513 Bacteria 4393
417 Ga0495616_0018151 3300046513 Bacteria 3868
418 Ga0495616_0019211 3300046513 Bacteria 3732
419 Ga0495616_0022493 3300046513 Bacteria 3405
420 Ga0495616_0025885 3300046513 Bacteria 3128
421 Ga0495620_0000013 3300046515 Bacteria 160349
422 Ga0495620_0000230 3300046515 Bacteria 41717
423 Ga0495620_0000463 3300046515 Bacteria 26659
424 Ga0495620_0005401 3300046515 Bacteria 7133
425 Ga0495620_0009905 3300046515 Bacteria 5044
426 Ga0495620_0018127 3300046515 Bacteria 3491
427 Ga0495620_0018392 3300046515 Bacteria 3461
428 Ga0495631_0000817 3300046518 Bacteria 19934
429 Ga0495631_0007145 3300046518 Bacteria 5705
430 Ga0495631_0022139 3300046518 Bacteria 2955
431 Ga0495632_0001080 3300046519 Bacteria 23398
432 Ga0495632_0001889 3300046519 Bacteria 16794
433 Ga0495632_0008466 3300046519 Bacteria 6310
434 Ga0495632_0013149 3300046519 Bacteria 4739
435 Ga0495632_0014175 3300046519 Bacteria 4520
436 Ga0495632_0014766 3300046519 Bacteria 4405
437 Ga0495632_0017841 3300046519 Bacteria 3906
438 Ga0495632_0019871 3300046519 Bacteria 3649
439 Ga0495632_0027027 3300046519 Bacteria 3011
440 Ga0495632_0030253 3300046519 Bacteria 2812
441 Ga0495632_0035658 3300046519 Bacteria 2537
442 Ga0495637_0000252 3300046520 Bacteria 42250
443 Ga0495637_0003456 3300046520 Bacteria 8393
444 Ga0495637_0013531 3300046520 Bacteria 3869
445 Ga0495637_0013717 3300046520 Bacteria 3841
446 Ga0495637_0014017 3300046520 Bacteria 3792
447 Ga0495637_0015810 3300046520 Bacteria 3534
448 Ga0495637_0017701 3300046520 Bacteria 3314
449 Ga0495637_0019871 3300046520 Bacteria 3098
450 Ga0495637_0021017 3300046520 Bacteria 2994
451 Ga0495637_0021079 3300046520 Bacteria 2990
452 Ga0495637_0022326 3300046520 Bacteria 2887
453 Ga0495637_0027075 3300046520 Bacteria 2568
454 Ga0495643_0000684 3300046522 Bacteria 39346
455 Ga0495643_0000830 3300046522 Bacteria 33682
456 Ga0495643_0013635 3300046522 Bacteria 4858
457 Ga0495643_0029268 3300046522 Bacteria 3082
458 Ga0495643_0030715 3300046522 Bacteria 2997
459 Ga0495644_0000921 3300046523 Bacteria 12224
460 Ga0495644_0019105 3300046523 Bacteria 2616
461 Ga0495648_0003089 3300046524 Bacteria 14876
462 Ga0495648_0004745 3300046524 Bacteria 11510
463 Ga0495648_0007885 3300046524 Bacteria 8462
464 Ga0495648_0024516 3300046524 Bacteria 4106
465 Ga0495648_0026355 3300046524 Bacteria 3915
466 Ga0495648_0029048 3300046524 Bacteria 3674
467 Ga0495648_0030971 3300046524 Bacteria 3529
468 Ga0495648_0035148 3300046524 Bacteria 3251
469 Ga0495648_0035794 3300046524 Bacteria 3213
470 Ga0495648_0038042 3300046524 Bacteria 3083
471 Ga0495648_0038974 3300046524 Bacteria 3030
472 Ga0495648_0047702 3300046524 Bacteria 2644
473 Ga0495648_0051342 3300046524 Bacteria 2513
474 Ga0495642_0001881 3300046528 Bacteria 8950
475 Ga0495642_0007894 3300046528 Bacteria 4077
476 Ga0495654_0001564 3300046530 Bacteria 15516
477 Ga0495654_0001684 3300046530 Bacteria 14886
478 Ga0495654_0007896 3300046530 Bacteria 5916
479 Ga0495654_0008686 3300046530 Bacteria 5600
480 Ga0495654_0013298 3300046530 Bacteria 4407
481 Ga0495654_0019502 3300046530 Bacteria 3546
482 Ga0495654_0020877 3300046530 Bacteria 3410
483 Ga0495654_0025380 3300046530 Bacteria 3052
484 Ga0495654_0026285 3300046530 Bacteria 2993
485 Ga0495654_0031179 3300046530 Bacteria 2706
486 Ga0495654_0044747 3300046530 Bacteria 2187
487 Ga0495609_0000070 3300046538 Bacteria 128181
488 Ga0495609_0000197 3300046538 Bacteria 60324
489 Ga0495609_0000707 3300046538 Bacteria 25665
490 Ga0495609_0013552 3300046538 Bacteria 3848
491 Ga0495609_0020115 3300046538 Bacteria 3084
492 Ga0495609_0030703 3300046538 Bacteria 2445
493 Ga0495597_0000010 3300046542 Bacteria 222418
494 Ga0495597_0003921 3300046542 Bacteria 8402
495 Ga0495597_0014114 3300046542 Bacteria 3808
496 Ga0495597_0021003 3300046542 Bacteria 3036
497 Ga0495597_0022478 3300046542 Bacteria 2925
498 Ga0495597_0027850 3300046542 Bacteria 2589
499 Ga0495597_0036148 3300046542 Bacteria 2225
500 Ga0495597_0041212 3300046542 Bacteria 2063
501 Ga0495622_0008343 3300046557 Bacteria 4799
502 Ga0495622_0012637 3300046557 Bacteria 3912
503 Ga0495622_0017017 3300046557 Bacteria 3384
504 Ga0495622_0020701 3300046557 Bacteria 3062
505 Ga0495633_0001527 3300046558 Bacteria 17811
506 Ga0495633_0012320 3300046558 Bacteria 4556
507 Ga0495633_0015599 3300046558 Bacteria 3938
508 Ga0495633_0024573 3300046558 Bacteria 2976
509 Ga0495656_0025268 3300046615 Bacteria 2353
510 Ga0495668_0000102 3300046616 Bacteria 137192
511 Ga0495668_0005367 3300046616 Bacteria 8731
512 Ga0495668_0006716 3300046616 Bacteria 7492
513 Ga0495668_0013510 3300046616 Bacteria 4812
514 Ga0495668_0015789 3300046616 Bacteria 4400
515 Ga0495668_0028248 3300046616 Bacteria 3173
516 Ga0495668_0036800 3300046616 Bacteria 2741
517 Ga0495634_0008019 3300046642 Bacteria 7881
518 Ga0495611_0002696 3300046648 Bacteria 8007
519 Ga0495611_0004966 3300046648 Bacteria 5699
520 Ga0495611_0021284 3300046648 Bacteria 2800
521 Ga0495625_0000354 3300046660 Bacteria 69894
522 Ga0495625_0021002 3300046660 Bacteria 5033
523 Ga0495625_0035765 3300046660 Bacteria 3657
524 Ga0495625_0048467 3300046660 Bacteria 3058
525 Ga0495625_0061054 3300046660 Bacteria 2668
526 Ga0495625_0063776 3300046660 Bacteria 2601
527 Ga0495625_0088802 3300046660 Bacteria 2141
528 Ga0495635_0013908 3300046663 Bacteria 5630
529 Ga0495659_0009675 3300046664 Bacteria 3081
530 Ga0495661_0000185 3300046665 Bacteria 71615
531 Ga0495661_0000329 3300046665 Bacteria 51418
532 Ga0495661_0000875 3300046665 Bacteria 27820
533 Ga0495661_0006179 3300046665 Bacteria 8430
534 Ga0495661_0027613 3300046665 Bacteria 3641
535 Ga0495661_0042076 3300046665 Bacteria 2819
536 Ga0495661_0045270 3300046665 Bacteria 2692
537 Ga0495661_0046877 3300046665 Bacteria 2635
538 Ga0495661_0054279 3300046665 Bacteria 2406
539 Ga0495588_0023759 3300046674 Bacteria 3038
540 Ga0495623_0013516 3300046679 Bacteria 5292
541 Ga0495623_0013934 3300046679 Bacteria 5212
542 Ga0495646_0012272 3300046680 Bacteria 5448
543 Ga0495646_0024614 3300046680 Bacteria 3790
544 Ga0495613_0048971 3300046689 Bacteria 3119
545 Ga0495624_0025535 3300046690 Bacteria 3878
546 Ga0495670_0003514 3300046691 Bacteria 7688
547 Ga0495670_0013746 3300046691 Bacteria 3980
548 Ga0495670_0022757 3300046691 Bacteria 3094
549 Ga0495670_0028476 3300046691 Bacteria 2769
550 Ga0495671_0001087 3300046692 Bacteria 18808
551 Ga0495671_0003824 3300046692 Bacteria 9150
552 Ga0495671_0016167 3300046692 Bacteria 3990
553 Ga0495671_0016777 3300046692 Bacteria 3904
554 Ga0495671_0025511 3300046692 Bacteria 3071
555 Ga0495671_0026078 3300046692 Bacteria 3032
556 Ga0495671_0026390 3300046692 Bacteria 3012
557 Ga0495671_0030656 3300046692 Bacteria 2753
558 Ga0495671_0032512 3300046692 Bacteria 2663
559 Ga0495671_0033113 3300046692 Bacteria 2634
560 Ga0495671_0038474 3300046692 Bacteria 2417
561 Ga0495649_0015223 3300046694 Bacteria 4378
562 Ga0495649_0025836 3300046694 Bacteria 3269
563 Ga0495649_0029287 3300046694 Bacteria 3046
564 Ga0495649_0029516 3300046694 Bacteria 3032
565 Ga0495649_0033712 3300046694 Bacteria 2817
566 Ga0495589_0002046 3300046794 Bacteria 11412
567 Ga0495589_0008932 3300046794 Bacteria 5216
568 Ga0495589_0016896 3300046794 Bacteria 3746
569 Ga0495589_0019754 3300046794 Bacteria 3448
570 Ga0495589_0024555 3300046794 Bacteria 3063
571 Ga0495589_0025402 3300046794 Bacteria 3006
572 Ga0495589_0030977 3300046794 Bacteria 2693
573 Ga0495600_0032163 3300046809 Bacteria 3402
574 Ga0495660_0001329 3300046810 Bacteria 17034
575 Ga0495660_0001815 3300046810 Bacteria 14024
576 Ga0495660_0002558 3300046810 Bacteria 11591
577 Ga0495660_0002643 3300046810 Bacteria 11369
578 Ga0495660_0009743 3300046810 Bacteria 5597
579 Ga0495660_0014666 3300046810 Bacteria 4532
580 Ga0495660_0019932 3300046810 Bacteria 3846
581 Ga0495660_0029277 3300046810 Bacteria 3108
582 Ga0495660_0030377 3300046810 Bacteria 3043
583 Ga0495660_0030681 3300046810 Bacteria 3027
584 Ga0495660_0032426 3300046810 Bacteria 2933
585 Ga0495660_0034972 3300046810 Bacteria 2809
586 Ga0495660_0050491 3300046810 Bacteria 2265
587 Ga0495604_0007388 3300047317 Bacteria 8707
588 Ga0495674_0041032 3300047319 Bacteria 4136
589 Ga0495672_0008936 3300047320 Bacteria 7316
590 Ga0495672_0008970 3300047320 Bacteria 7302
591 Ga0495672_0030800 3300047320 Bacteria 3357
592 Ga0495672_0033749 3300047320 Bacteria 3168
593 Ga0495672_0037045 3300047320 Bacteria 2988
594 Ga0495672_0037577 3300047320 Bacteria 2961
595 Ga0495672_0038553 3300047320 Bacteria 2914
596 Ga0495672_0039685 3300047320 Bacteria 2861
597 Ga0495672_0041440 3300047320 Bacteria 2784
598 Ga0495672_0043449 3300047320 Bacteria 2702
599 Ga0495672_0055233 3300047320 Bacteria 2318
600 Ga0495672_0070934 3300047320 Bacteria 1972
601 Ga0495676_0000081 3300047321 Bacteria 70377
602 Ga0495676_0038465 3300047321 Bacteria 3973
603 Ga0495676_0056133 3300047321 Bacteria 3116
604 Ga0495680_0013118 3300047322 Bacteria 7241
605 Ga0495680_0038945 3300047322 Bacteria 3796
606 Ga0495683_0001164 3300047323 Bacteria 18007
607 Ga0495683_0004135 3300047323 Bacteria 8301
608 Ga0495683_0010986 3300047323 Bacteria 4775
609 Ga0495683_0014129 3300047323 Bacteria 4160
610 Ga0495683_0018831 3300047323 Bacteria 3565
611 Ga0495683_0026962 3300047323 Bacteria 2939
612 Ga0495683_0031784 3300047323 Bacteria 2689
613 Ga0495683_0042993 3300047323 Bacteria 2276
614 Ga0495687_015170 3300047443 Bacteria 3929
615 Ga0495687_026899 3300047443 Bacteria 2699
616 Ga0495679_000186 3300047446 Bacteria 54909
617 Ga0495679_001415 3300047446 Bacteria 13647
618 Ga0495679_011118 3300047446 Bacteria 3494
619 Ga0495679_011313 3300047446 Bacteria 3451
620 Ga0495679_013926 3300047446 Bacteria 2998
621 Ga0495679_016933 3300047446 Bacteria 2621
622 Ga0495679_019871 3300047446 Bacteria 2350
623 Ga0495673_0002766 3300047469 Bacteria 12001
624 Ga0495673_0003770 3300047469 Bacteria 9830
625 Ga0495673_0004143 3300047469 Bacteria 9174
626 Ga0495673_0004983 3300047469 Bacteria 8162
627 Ga0495673_0015545 3300047469 Bacteria 3918
628 Ga0495673_0017336 3300047469 Bacteria 3661
629 Ga0495673_0021427 3300047469 Bacteria 3190
630 Ga0495673_0023430 3300047469 Bacteria 3002
631 Ga0495673_0024205 3300047469 Bacteria 2939
632 Ga0495673_0029484 3300047469 Bacteria 2589
633 Ga0495681_0003446 3300047470 Bacteria 11005
634 Ga0495681_0005569 3300047470 Bacteria 8406
635 Ga0495681_0013167 3300047470 Bacteria 4817
636 Ga0495681_0013239 3300047470 Bacteria 4799
637 Ga0495681_0014821 3300047470 Bacteria 4448
638 Ga0495681_0018271 3300047470 Bacteria 3866
639 Ga0495681_0020983 3300047470 Bacteria 3529
640 Ga0495681_0023901 3300047470 Bacteria 3233
641 Ga0495681_0025061 3300047470 Bacteria 3126
642 Ga0495681_0026051 3300047470 Bacteria 3053
643 Ga0495681_0030272 3300047470 Bacteria 2758
644 Ga0495681_0035455 3300047470 Bacteria 2477
645 Ga0495681_0037113 3300047470 Bacteria 2404
646 Ga0495684_0054293 3300047471 Bacteria 3056
647 Ga0495684_0055286 3300047471 Bacteria 3027
648 Ga0495686_0024039 3300047472 Bacteria 4008
649 Ga0495686_0029994 3300047472 Bacteria 3534
650 Ga0495686_0039727 3300047472 Bacteria 3003
651 Ga0495686_0047434 3300047472 Bacteria 2712
652 Ga0495686_0050001 3300047472 Bacteria 2628
653 Ga0495593_0010845 3300047673 Bacteria 5254
654 Ga0495602_0049015 3300048088 Bacteria 3787
655 Ga0495626_0000256 3300048091 Bacteria 60994
656 Ga0495626_0006620 3300048091 Bacteria 6567
657 Ga0495626_0022412 3300048091 Bacteria 3119
658 Ga0495626_0022847 3300048091 Bacteria 3086
659 Ga0495626_0023047 3300048091 Bacteria 3069
660 Ga0495626_0023143 3300048091 Bacteria 3062
661 Ga0495626_0029320 3300048091 Bacteria 2663
662 Ga0495626_0030483 3300048091 Bacteria 2601
663 Ga0495626_0031168 3300048091 Bacteria 2567
664 Ga0496102_0001116 3300048905 Bacteria 24623
665 Ga0496109_0088342 3300048912 Bacteria 2864
666 Ga0496110_0009288 3300048913 Bacteria 7954
667 Ga0496112_0064287 3300048915 Bacteria 3621
668 Ga0496114_0058865 3300048917 Bacteria 3208
669 Ga0496116_0001203 3300048919 Bacteria 30310
670 Ga0496116_0001581 3300048919 Bacteria 25058
671 Ga0496116_0021622 3300048919 Bacteria 4843
672 Ga0496116_0043131 3300048919 Bacteria 3076
673 Ga0496116_0043471 3300048919 Bacteria 3060
674 Ga0496117_0004257 3300048920 Bacteria 15972
675 Ga0496117_0007639 3300048920 Bacteria 10488
676 Ga0496117_0010279 3300048920 Bacteria 8559
677 Ga0496117_0023547 3300048920 Bacteria 4901
678 Ga0496117_0030347 3300048920 Bacteria 4150
679 Ga0496117_0030654 3300048920 Bacteria 4121
680 Ga0496117_0040041 3300048920 Bacteria 3452
681 Ga0496117_0047654 3300048920 Bacteria 3070
682 Ga0496117_0056878 3300048920 Bacteria 2720
683 Ga0496118_0003568 3300048921 Bacteria 19402
684 Ga0496118_0021945 3300048921 Bacteria 5599
685 Ga0496118_0022407 3300048921 Bacteria 5521
686 Ga0496118_0047692 3300048921 Bacteria 3317
687 Ga0496118_0053893 3300048921 Bacteria 3051
688 Ga0496118_0064422 3300048921 Bacteria 2689
689 Ga0496119_0000112 3300048922 Bacteria 114767
690 Ga0496119_0016434 3300048922 Bacteria 5633
691 Ga0496119_0038704 3300048922 Bacteria 3077
692 Ga0496120_0002916 3300048923 Bacteria 16341
693 Ga0496120_0027834 3300048923 Bacteria 3471
694 Ga0496120_0032211 3300048923 Bacteria 3162
695 Ga0496121_0002692 3300048924 Bacteria 26575
696 Ga0496121_0006107 3300048924 Bacteria 15150
697 Ga0496121_0016312 3300048924 Bacteria 7678
698 Ga0496121_0047549 3300048924 Bacteria 3660
699 Ga0496121_0062498 3300048924 Bacteria 3049
700 Ga0496121_0093954 3300048924 Bacteria 2334
701 Ga0496122_0004361 3300048925 Bacteria 17667
702 Ga0496122_0006408 3300048925 Bacteria 13522
703 Ga0496122_0018557 3300048925 Bacteria 6415
704 Ga0496122_0032232 3300048925 Bacteria 4338
705 Ga0496122_0052318 3300048925 Bacteria 3093
706 Ga0496122_0052827 3300048925 Bacteria 3070
707 Ga0496122_0067740 3300048925 Bacteria 2568
708 Ga0496123_0001624 3300048926 Bacteria 30272
709 Ga0496123_0001754 3300048926 Bacteria 28633
710 Ga0496123_0017632 3300048926 Bacteria 5731
711 Ga0496123_0018313 3300048926 Bacteria 5577
712 Ga0496124_0000222 3300048927 Bacteria 110854
713 Ga0496124_0005215 3300048927 Bacteria 14752
714 Ga0496124_0009753 3300048927 Bacteria 9828
715 Ga0496124_0012097 3300048927 Bacteria 8560
716 Ga0496124_0014447 3300048927 Bacteria 7634
717 Ga0496124_0022917 3300048927 Bacteria 5714
718 Ga0496124_0030541 3300048927 Bacteria 4781
719 Ga0496124_0079571 3300048927 Bacteria 2698
720 Ga0496125_0005002 3300048928 Bacteria 14970
721 Ga0496125_0008731 3300048928 Bacteria 10544
722 Ga0496125_0022704 3300048928 Bacteria 5818
723 Ga0496125_0061609 3300048928 Bacteria 3008
724 Ga0496125_0067505 3300048928 Bacteria 2817
725 Ga0496125_0077983 3300048928 Bacteria 2550
726 Ga0496125_0097696 3300048928 Bacteria 2175
727 Ga0496126_0038532 3300048929 Bacteria 4446
728 Ga0496126_0087683 3300048929 Bacteria 2742
729 Ga0495678_000031 3300049459 Bacteria 215528
730 Ga0495678_000508 3300049459 Bacteria 37991
731 Ga0495678_004164 3300049459 Bacteria 8537
732 Ga0495678_012976 3300049459 Bacteria 3928
733 Ga0495678_014044 3300049459 Bacteria 3736
734 Ga0495678_015906 3300049459 Bacteria 3452
735 Ga0495678_016154 3300049459 Bacteria 3421
736 Ga0495678_019192 3300049459 Bacteria 3055
737 Ga0495678_030980 3300049459 Bacteria 2234
738 Ga0495682_0000300 3300049460 Bacteria 37560
739 Ga0495682_0002873 3300049460 Bacteria 7922
740 Ga0495682_0011018 3300049460 Bacteria 3484
741 Ga0495682_0015154 3300049460 Bacteria 2920
742 Ga0501031_0012138 3300049568 Bacteria 5617
743 Ga0501032_0011897 3300049569 Bacteria 6233
744 Ga0501034_0000020 3300049571 Bacteria 280294
745 Ga0501034_0043201 3300049571 Bacteria 4563
746 Ga0501034_0057341 3300049571 Bacteria 3916
747 Ga0501036_0041298 3300049572 Bacteria 3903
748 Ga0501039_0005790 3300049575 Bacteria 9360
749 Ga0501067_0012697 3300049583 Bacteria 4670
750 Ga0501068_0019968 3300049584 Bacteria 3899
751 Ga0501070_0020222 3300049586 Bacteria 5583
752 Ga0501072_0005999 3300049588 Bacteria 9262
753 Ga0501072_0070726 3300049588 Bacteria 2756
754 Ga0501073_0004730 3300049589 Bacteria 10222
755 Ga0501073_0021468 3300049589 Bacteria 4655
756 Ga0501074_0013174 3300049590 Bacteria 6012
757 Ga0501074_0023761 3300049590 Bacteria 4456
758 Ga0501075_0017465 3300049591 Bacteria 5184
759 Ga0501077_0015602 3300049593 Bacteria 4784
760 Ga0501077_0022996 3300049593 Bacteria 3952
761 Ga0501083_0014595 3300049744 Bacteria 5492
762 Ga0501226_000006 3300049853 Bacteria 259153
763 Ga0500572_004618 3300053111 Bacteria 3123
764 Ga0500659_0036793 3300053135 Bacteria 2665
765 Ga0500577_0001698 3300053142 Bacteria 5630
766 Ga0500634_0005037 3300053161 Bacteria 6219
767 Ga0501084_0057279 3300054114 Bacteria 3261
768 Ga0501082_0017045 3300060353 Bacteria 6257
769 Ga0501082_0094459 3300060353 Bacteria 2584

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048924 Ga0496121_0047549 Ga0496121_0047549_335_2272 560
2 3300046453 Ga0495627_023940 Ga0495627_023940_82_1983 595
3 3300046542 Ga0495597_0041212 Ga0495597_0041212_138_2039 595
4 3300047320 Ga0495672_0037577 Ga0495672_0037577_17_1918 595
5 3300047320 Ga0495672_0070934 Ga0495672_0070934_27_1928 595
6 3300031548 Ga0307408_100000047 Ga0307408_100000047164 627
7 3300039447 Ga0436361_1012736 Ga0436361_1012736_2317_4404 627
8 3300044658 Ga0466972_0017593 Ga0466972_0017593_798_2930 629
9 3300003751 Ga0055538_1000073 Ga0055538_10000736 634
10 3300003752 Ga0055539_1000109 Ga0055539_10001096 634
11 3300003756 Ga0055533_1000117 Ga0055533_10001176 634
12 3300003758 Ga0055532_1000283 Ga0055532_10002837 634
13 3300003759 Ga0055525_1000156 Ga0055525_10001566 634
14 3300003841 Ga0055541_1000074 Ga0055541_10000746 634
15 3300025224 Ga0209784_100015 Ga0209784_10001539 634
16 3300025225 Ga0209566_100012 Ga0209566_10001239 634
17 3300025226 Ga0209674_100027 Ga0209674_10002739 634
18 3300025229 Ga0209147_100019 Ga0209147_10001939 634
19 3300025230 Ga0209563_100031 Ga0209563_10003139 634
20 3300025233 Ga0209437_101295 Ga0209437_1012951 634
21 3300025242 Ga0209258_100296 Ga0209258_10029685 634
22 3300025246 Ga0209646_1000213 Ga0209646_10002136 634
23 3300025253 Ga0209677_100016 Ga0209677_10001639 634
24 3300025256 Ga0209759_1002967 Ga0209759_10029675 634
25 3300042009 Ga0439451_001619 Ga0439451_001619_884_2920 635
26 3300038735 Ga0400485_08592 Ga0400485_08592_1351_3408 636
27 3300048922 Ga0496119_0000112 Ga0496119_0000112_56302_58410 640
28 3300048923 Ga0496120_0002916 Ga0496120_0002916_12441_14549 640
29 3300042013 Ga0439456_000798 Ga0439456_000798_813_2867 641
30 3300046616 Ga0495668_0036800 Ga0495668_0036800_13_2067 641
31 3300009011 Ga0105251_10033226 Ga0105251_100332261 644
32 3300009036 Ga0105244_10023428 Ga0105244_100234283 644
33 3300025728 Ga0207655_1002144 Ga0207655_10021443 644
34 3300025735 Ga0207713_1018515 Ga0207713_10185153 644
35 3300048915 Ga0496112_0064287 Ga0496112_0064287_827_2905 644
36 3300048927 Ga0496124_0012097 Ga0496124_0012097_5207_7315 644
37 3300048928 Ga0496125_0067505 Ga0496125_0067505_216_2324 644
38 3300009148 Ga0105243_10065587 Ga0105243_100655873 648
39 3300046453 Ga0495627_020716 Ga0495627_020716_21_2096 648
40 3300046457 Ga0495590_0014644 Ga0495590_0014644_649_2724 648
41 3300046524 Ga0495648_0029048 Ga0495648_0029048_925_3000 648
42 3300046660 Ga0495625_0088802 Ga0495625_0088802_18_2093 648
43 3300046665 Ga0495661_0045270 Ga0495661_0045270_155_2275 648
44 3300046692 Ga0495671_0038474 Ga0495671_0038474_104_2176 648
45 3300047320 Ga0495672_0038553 Ga0495672_0038553_586_2706 648
46 3300047469 Ga0495673_0015545 Ga0495673_0015545_862_2982 648
47 3300048928 Ga0496125_0097696 Ga0496125_0097696_85_2157 648
48 3300005340 Ga0070689_100002206 Ga0070689_1000022063 649
49 3300009101 Ga0105247_10061324 Ga0105247_100613241 649
50 3300014326 Ga0157380_10059801 Ga0157380_100598012 650
51 3300037853 Ga0436364_0471212 Ga0436364_0471212_10133_12226 650
52 3300046616 Ga0495668_0000102 Ga0495668_0000102_4054_6132 650
53 3300005295 Ga0065707_10100167 Ga0065707_101001672 651
54 3300028380 Ga0268265_10020412 Ga0268265_100204123 651
55 3300053142 Ga0500577_0001698 Ga0500577_0001698_3161_5245 651
56 3300025936 Ga0207670_10002998 Ga0207670_100029982 652
57 3300046501 Ga0495607_0008637 Ga0495607_0008637_3233_5332 653
58 iso_pu_bacteria 2945961074 2945965754 653
59 iso_pu_bacteria 651053060 651176751 653
60 3300005547 Ga0070693_100008503 Ga0070693_1000085031 654
61 3300025900 Ga0207710_10005011 Ga0207710_100050115 654
62 3300046458 Ga0495591_007755 Ga0495591_007755_849_2945 654
63 3300046471 Ga0495650_0023168 Ga0495650_0023168_370_2484 654
64 3300046501 Ga0495607_0006581 Ga0495607_0006581_4560_6656 654
65 3300046507 Ga0495606_0010245 Ga0495606_0010245_4855_6951 654
66 3300046515 Ga0495620_0018392 Ga0495620_0018392_859_2955 654
67 3300046519 Ga0495632_0019871 Ga0495632_0019871_691_2787 654
68 3300046665 Ga0495661_0006179 Ga0495661_0006179_1768_3864 654
69 3300046794 Ga0495589_0016896 Ga0495589_0016896_846_2942 654
70 3300047446 Ga0495679_019871 Ga0495679_019871_89_2185 654
71 3300047470 Ga0495681_0023901 Ga0495681_0023901_443_2539 654
72 3300047470 Ga0495681_0037113 Ga0495681_0037113_228_2324 654
73 3300048920 Ga0496117_0004257 Ga0496117_0004257_13013_15109 654
74 3300048923 Ga0496120_0027834 Ga0496120_0027834_521_2617 654
75 3300048927 Ga0496124_0014447 Ga0496124_0014447_869_2965 654
76 3300048928 Ga0496125_0005002 Ga0496125_0005002_890_2986 654
77 iso_pu_bacteria 640427133 640488702 654
78 iso_pu_bacteria 8011350971 8011356578 654
79 3300021361 Ga0213872_10015263 Ga0213872_100152632 655
80 3300027471 Ga0209995_1002313 Ga0209995_10023132 655
81 3300039447 Ga0436361_0690852 Ga0436361_0690852_325_2457 655
82 iso_pu_bacteria 2511231004 2511254363 655
83 iso_pu_bacteria 2511231006 2511263867 655
84 iso_pu_bacteria 2511231007 2511272241 655
85 iso_pu_bacteria 2511231008 2511275991 655
86 iso_pu_bacteria 2511231010 2511289223 655
87 iso_pu_bacteria 2511231011 2511295404 655
88 iso_pu_bacteria 2511231012 2511299864 655
89 iso_pu_bacteria 2511231014 2511313497 655
90 iso_pu_bacteria 2511231015 2511319949 655
91 iso_pu_bacteria 2511231016 2511326121 655
92 iso_pu_bacteria 2511231017 2511332352 655
93 iso_pu_bacteria 2511231018 2511339943 655
94 iso_pu_bacteria 2511231019 2511342046 655
95 iso_pu_bacteria 2511231020 2511352788 655
96 iso_pu_bacteria 2511231021 2511355028 655
97 iso_pu_bacteria 2511231022 2511361788 655
98 iso_pu_bacteria 2511231023 2511367803 655
99 iso_pu_bacteria 2511231031 2511414767 655
100 iso_pu_bacteria 2511231156 2511826564 655
101 iso_pu_bacteria 2512047018 2512324197 655
102 iso_pu_bacteria 2554235132 2554813784 655
103 iso_pu_bacteria 2554235341 2555671786 655
104 iso_pu_bacteria 2582580891 2583794288 655
105 iso_pu_bacteria 2597489887 2597859876 655
106 iso_pu_bacteria 2597489888 2597862403 655
107 iso_pu_bacteria 2597489889 2597868120 655
108 iso_pu_bacteria 2599185155 2599330147 655
109 iso_pu_bacteria 2599185160 2599354058 655
110 iso_pu_bacteria 2599185161 2599360263 655
111 iso_pu_bacteria 2599185162 2599366585 655
112 iso_pu_bacteria 2599185163 2599373374 655
113 iso_pu_bacteria 2599185164 2599379166 655
114 iso_pu_bacteria 2599185165 2599385856 655
115 iso_pu_bacteria 2599185166 2599392233 655
116 iso_pu_bacteria 2599185167 2599396985 655
117 iso_pu_bacteria 2599185168 2599403999 655
118 iso_pu_bacteria 2599185179 2599448977 655
119 iso_pu_bacteria 2599185181 2599460892 655
120 iso_pu_bacteria 2599185182 2599470439 655
121 iso_pu_bacteria 2599185185 2599482706 655
122 iso_pu_bacteria 2599185186 2599489913 655
123 iso_pu_bacteria 2599185188 2599503521 655
124 iso_pu_bacteria 2599185189 2599508892 655
125 iso_pu_bacteria 2599185190 2599511278 655
126 iso_pu_bacteria 2599185191 2599517795 655
127 iso_pu_bacteria 2599185212 2599613334 655
128 iso_pu_bacteria 2599185248 2599771006 655
129 iso_pu_bacteria 2599185257 2599803571 655
130 iso_pu_bacteria 2599185288 2599879719 655
131 iso_pu_bacteria 2599185289 2599886154 655
132 iso_pu_bacteria 2599185290 2599890652 655
133 iso_pu_bacteria 2599185291 2599897869 655
134 iso_pu_bacteria 2599185300 2599929856 655
135 iso_pu_bacteria 2599185302 2599944734 655
136 iso_pu_bacteria 2599185303 2599948231 655
137 iso_pu_bacteria 2599185304 2599956470 655
138 iso_pu_bacteria 2599185305 2599960183 655
139 iso_pu_bacteria 2599185306 2599969270 655
140 iso_pu_bacteria 2599185307 2599975006 655
141 iso_pu_bacteria 2599185308 2599980583 655
142 iso_pu_bacteria 2599185309 2599983605 655
143 iso_pu_bacteria 2599185310 2599990012 655
144 iso_pu_bacteria 2599185311 2599995850 655
145 iso_pu_bacteria 2599185312 2600000490 655
146 iso_pu_bacteria 2599185313 2600005167 655
147 iso_pu_bacteria 2599185314 2600014464 655
148 iso_pu_bacteria 2599185315 2600017683 655
149 iso_pu_bacteria 2599185316 2600025688 655
150 iso_pu_bacteria 2599185317 2600028674 655
151 iso_pu_bacteria 2599185318 2600033663 655
152 iso_pu_bacteria 2599185319 2600040045 655
153 iso_pu_bacteria 2599185320 2600047678 655
154 iso_pu_bacteria 2599185321 2600053586 655
155 iso_pu_bacteria 2599185322 2600059017 655
156 iso_pu_bacteria 2599185323 2600068566 655
157 iso_pu_bacteria 2599185324 2600070245 655
158 iso_pu_bacteria 2599185325 2600077090 655
159 iso_pu_bacteria 2599185356 2600213507 655
160 iso_pu_bacteria 2600254930 2600357842 655
161 iso_pu_bacteria 2600254931 2600365162 655
162 iso_pu_bacteria 2600254954 2600446999 655
163 iso_pu_bacteria 2600255283 2601625684 655
164 iso_pu_bacteria 2600255296 2601690983 655
165 iso_pu_bacteria 2600255313 2601773674 655
166 iso_pu_bacteria 2600255318 2601796801 655
167 iso_pu_bacteria 2600255389 2602010113 655
168 iso_pu_bacteria 2603880185 2606073951 655
169 iso_pu_bacteria 2603880199 2606126404 655
170 iso_pu_bacteria 2606217733 2608381061 655
171 iso_pu_bacteria 2619619299 2621301469 655
172 iso_pu_bacteria 2623620443 2624482499 655
173 iso_pu_bacteria 2623620446 2624490470 655
174 iso_pu_bacteria 2643221565 2643842442 655
175 iso_pu_bacteria 2643221571 2643868829 655
176 iso_pu_bacteria 2643221589 2643955304 655
177 iso_pu_bacteria 2643221602 2644023656 655
178 iso_pu_bacteria 2643221633 2644187101 655
179 iso_pu_bacteria 2643221650 2644286961 655
180 iso_pu_bacteria 2643221713 2644624086 655
181 iso_pu_bacteria 2651869719 2652546128 655
182 iso_pu_bacteria 2667528170 2671089962 655
183 iso_pu_bacteria 2667528171 2671096640 655
184 iso_pu_bacteria 2667528176 2671125400 655
185 iso_pu_bacteria 2671180172 2671770861 655
186 iso_pu_bacteria 2675903420 2677897571 655
187 iso_pu_bacteria 2675903515 2678264906 655
188 iso_pu_bacteria 2713897148 2715750493 655
189 iso_pu_bacteria 2713897149 2715755107 655
190 iso_pu_bacteria 2718217725 2718635702 655
191 iso_pu_bacteria 2721755607 2723247293 655
192 iso_pu_bacteria 2738541265 2738673690 655
193 iso_pu_bacteria 2738541271 2738691503 655
194 iso_pu_bacteria 2738541282 2738752083 655
195 iso_pu_bacteria 2738541294 2738809176 655
196 iso_pu_bacteria 2738541303 2738861124 655
197 iso_pu_bacteria 2738541309 2738896536 655
198 iso_pu_bacteria 2738543004 2739196602 655
199 iso_pu_bacteria 2738543015 2739257581 655
200 iso_pu_bacteria 2738543016 2739267278 655
201 iso_pu_bacteria 2738543020 2739288289 655
202 iso_pu_bacteria 2738543021 2739293382 655
203 iso_pu_bacteria 2738543025 2739315616 655
204 iso_pu_bacteria 2740892503 2743739417 655
205 iso_pu_bacteria 2744054620 2745005362 655
206 iso_pu_bacteria 2765235841 2765585654 655
207 iso_pu_bacteria 2773857670 2774122982 655
208 iso_pu_bacteria 2773857673 2774133384 655
209 iso_pu_bacteria 2784132063 2784262742 655
210 iso_pu_bacteria 2784132072 2784315340 655
211 iso_pu_bacteria 2791355520 2794595780 655
212 iso_pu_bacteria 2806310737 2807406964 655
213 iso_pu_bacteria 2806310745 2807455296 655
214 iso_pu_bacteria 2808606361 2808854656 655
215 iso_pu_bacteria 2808606373 2808907320 655
216 iso_pu_bacteria 2808606376 2808921701 655
217 iso_pu_bacteria 2808606377 2808930470 655
218 iso_pu_bacteria 2808606378 2808934764 655
219 iso_pu_bacteria 2808606379 2808943658 655
220 iso_pu_bacteria 2808606380 2808943822 655
221 iso_pu_bacteria 2808606381 2808952592 655
222 iso_pu_bacteria 2808606382 2808960507 655
223 iso_pu_bacteria 2808606383 2808963161 655
224 iso_pu_bacteria 2808606385 2808975329 655
225 iso_pu_bacteria 2808606388 2808991032 655
226 iso_pu_bacteria 2808606389 2808998049 655
227 iso_pu_bacteria 2808606445 2809218372 655
228 iso_pu_bacteria 2811994881 2812371000 655
229 iso_pu_bacteria 2816332298 2817489176 655
230 iso_pu_bacteria 2818991456 2819656178 655
231 iso_pu_bacteria 2818991464 2819701733 655
232 iso_pu_bacteria 2823421272 2823422610 655
233 iso_pu_bacteria 2825651385 2825656196 655
234 iso_pu_bacteria 2826581358 2826585796 655
235 iso_pu_bacteria 2834028612 2834029083 655
236 iso_pu_bacteria 2842805378 2842806077 655
237 iso_pu_bacteria 2842815866 2842820694 655
238 iso_pu_bacteria 2842826826 2842828790 655
239 iso_pu_bacteria 2842832357 2842837354 655
240 iso_pu_bacteria 2842843487 2842845146 655
241 iso_pu_bacteria 2842849001 2842853274 655
242 iso_pu_bacteria 2842854478 2842856599 655
243 iso_pu_bacteria 2844665904 2844665945 655
244 iso_pu_bacteria 2852612431 2852615427 655
245 iso_pu_bacteria 2852657418 2852660761 655
246 iso_pu_bacteria 2852667396 2852670395 655
247 iso_pu_bacteria 2860339153 2860341350 655
248 iso_pu_bacteria 2860867994 2860869107 655
249 iso_pu_bacteria 2878029506 2878034427 655
250 iso_pu_bacteria 2880230671 2880235060 655
251 iso_pu_bacteria 2904518522 2904521447 655
252 iso_pu_bacteria 2904550169 2904553099 655
253 iso_pu_bacteria 2908446538 2908447909 655
254 iso_pu_bacteria 2912963787 2912967902 655
255 iso_pu_bacteria 2913036834 2913041507 655
256 iso_pu_bacteria 2917070673 2917075657 655
257 iso_pu_bacteria 2919063839 2919066513 655
258 iso_pu_bacteria 2919155634 2919159316 655
259 iso_pu_bacteria 2919385768 2919388499 655
260 iso_pu_bacteria 2919456309 2919459450 655
261 iso_pu_bacteria 2919481497 2919484440 655
262 iso_pu_bacteria 2919487758 2919490182 655
263 iso_pu_bacteria 2919501602 2919504954 655
264 iso_pu_bacteria 2919697872 2919701665 655
265 iso_pu_bacteria 2923153595 2923158502 655
266 iso_pu_bacteria 2923519811 2923525107 655
267 iso_pu_bacteria 2923586266 2923591323 655
268 iso_pu_bacteria 2926063275 2926066631 655
269 iso_pu_bacteria 2929144301 2929148846 655
270 iso_pu_bacteria 2929189879 2929191102 655
271 iso_pu_bacteria 2931369376 2931373731 655
272 iso_pu_bacteria 2931390751 2931392113 655
273 iso_pu_bacteria 2931396565 2931397088 655
274 iso_pu_bacteria 2935353572 2935356646 655
275 iso_pu_bacteria 2939636861 2939637068 655
276 iso_pu_bacteria 2939651529 2939655998 655
277 iso_pu_bacteria 2945928738 2945929474 655
278 iso_pu_bacteria 2946027586 2946029344 655
279 iso_pu_bacteria 2969304461 2969309203 655
280 iso_pu_bacteria 2974289157 2974289427 655
281 iso_pu_bacteria 2984286254 2984287667 655
282 iso_pu_bacteria 2988728565 2988730423 655
283 iso_pu_bacteria 2990196909 2990200339 655
284 iso_pu_bacteria 2998139840 2998144490 655
285 iso_pu_bacteria 3007252601 3007253671 655
286 iso_pu_bacteria 3007315729 3007317555 655
287 iso_pu_bacteria 3007419365 3007424861 655
288 iso_pu_bacteria 3007511990 3007516280 655
289 iso_pu_bacteria 3007614139 3007618126 655
290 iso_pu_bacteria 3007619802 3007623203 655
291 iso_pu_bacteria 3007718800 3007720207 655
292 iso_pu_bacteria 3007855910 3007858530 655
293 iso_pu_bacteria 3007861166 3007865942 655
294 iso_pu_bacteria 3007866637 3007867809 655
295 iso_pu_bacteria 3007872151 3007874904 655
296 iso_pu_bacteria 637000220 637322197 655
297 iso_pu_bacteria 8015687852 8015692592 655
298 iso_pu_bacteria 8019769354 8019771569 655
299 iso_pu_bacteria 8019775933 8019780797 655
300 iso_pu_bacteria 8029995093 8029996393 655
301 iso_pu_bacteria 8034962539 8034966225 655
302 iso_pu_bacteria 8052494512 8052498851 655
303 iso_pu_bacteria 8054285046 8054286217 655
304 iso_pu_bacteria 8054347763 8054348465 655
305 iso_pu_bacteria 8054503363 8054504692 655
306 iso_pu_bacteria 8054929484 8054933279 655
307 iso_pu_bacteria 8055770955 8055775824 655
308 iso_pu_bacteria 8055817908 8055819134 655
309 iso_pu_bacteria 8055878733 8055884110 655
310 iso_pu_bacteria 8056115690 8056117477 655
311 iso_pu_bacteria 8056120720 8056124824 655
312 iso_pu_bacteria 8056125926 8056130776 655
313 iso_pu_bacteria 8056131705 8056133004 655
314 iso_pu_bacteria 8056137416 8056138619 655
315 iso_pu_bacteria 8056143049 8056144553 655
316 iso_pu_bacteria 8056148874 8056149218 655
317 iso_pu_bacteria 8056155041 8056155466 655
318 iso_pu_bacteria 8056161164 8056166793 655
319 iso_pu_bacteria 8056166840 8056172086 655
320 iso_pu_bacteria 8056172158 8056172759 655
321 iso_pu_bacteria 8056177738 8056183390 655
322 iso_pu_bacteria 8056569372 8056572567 655
323 iso_pu_bacteria 8057798959 8057804675 655
324 3300002737 JGI25162J39368_1000034 JGI25162J39368_1000034162 656
325 3300002771 JGI25163J39215_1001370 JGI25163J39215_10013703 656
326 3300002771 JGI25163J39215_1001449 JGI25163J39215_10014493 656
327 3300002772 JGI25164J39214_1000018 JGI25164J39214_100001818 656
328 3300002772 JGI25164J39214_1000304 JGI25164J39214_100030414 656
329 3300003214 JGI25165J46597_1000123 JGI25165J46597_1000123108 656
330 3300003214 JGI25165J46597_1000575 JGI25165J46597_100057519 656
331 3300003781 Ga0055536_1003129 Ga0055536_10031293 656
332 3300003781 Ga0055536_1012012 Ga0055536_10120122 656
333 3300003781 Ga0055536_1012314 Ga0055536_10123141 656
334 3300003791 Ga0055530_10003450 Ga0055530_100034503 656
335 3300003791 Ga0055530_10009909 Ga0055530_100099091 656
336 3300003792 Ga0055540_1000849 Ga0055540_10008499 656
337 3300003792 Ga0055540_1002831 Ga0055540_10028313 656
338 3300003792 Ga0055540_1008308 Ga0055540_10083081 656
339 3300003794 Ga0055531_10000573 Ga0055531_1000057326 656
340 3300005288 Ga0065714_10065199 Ga0065714_1006519911 656
341 3300005288 Ga0065714_10067505 Ga0065714_100675053 656
342 3300005288 Ga0065714_10072768 Ga0065714_100727683 656
343 3300005288 Ga0065714_10077307 Ga0065714_100773072 656
344 3300005288 Ga0065714_10077484 Ga0065714_100774841 656
345 3300005288 Ga0065714_10081270 Ga0065714_100812701 656
346 3300005289 Ga0065704_10070645 Ga0065704_100706459 656
347 3300005289 Ga0065704_10093716 Ga0065704_100937161 656
348 3300005289 Ga0065704_10093739 Ga0065704_100937391 656
349 3300005290 Ga0065712_10005361 Ga0065712_100053615 656
350 3300005290 Ga0065712_10067808 Ga0065712_1006780811 656
351 3300005293 Ga0065715_10002829 Ga0065715_100028291 656
352 3300005331 Ga0070670_100005001 Ga0070670_1000050016 656
353 3300005353 Ga0070669_100005309 Ga0070669_1000053098 656
354 3300005457 Ga0070662_100002261 Ga0070662_1000022615 656
355 3300005539 Ga0068853_100042334 Ga0068853_1000423343 656
356 3300005548 Ga0070665_100041084 Ga0070665_1000410843 656
357 3300005564 Ga0070664_100002637 Ga0070664_1000026371 656
358 3300005578 Ga0068854_100028702 Ga0068854_1000287025 656
359 3300005834 Ga0068851_10000006 Ga0068851_1000000615 656
360 3300006058 Ga0075432_10007294 Ga0075432_100072943 656
361 3300006058 Ga0075432_10014552 Ga0075432_100145522 656
362 3300006177 Ga0075362_10022416 Ga0075362_100224161 656
363 3300006914 Ga0075436_100058307 Ga0075436_1000583072 656
364 3300006944 Ga0099823_1000052 Ga0099823_100005245 656
365 3300006946 Ga0079104_1000202 Ga0079104_100020274 656
366 3300006946 Ga0079104_1003010 Ga0079104_10030102 656
367 3300006948 Ga0099826_10002165 Ga0099826_1000216511 656
368 3300009011 Ga0105251_10000035 Ga0105251_1000003579 656
369 3300009011 Ga0105251_10001730 Ga0105251_1000173011 656
370 3300009011 Ga0105251_10024190 Ga0105251_100241902 656
371 3300009011 Ga0105251_10029612 Ga0105251_100296121 656
372 3300009011 Ga0105251_10029711 Ga0105251_100297111 656
373 3300009011 Ga0105251_10030994 Ga0105251_100309942 656
374 3300009011 Ga0105251_10041566 Ga0105251_100415661 656
375 3300009036 Ga0105244_10001239 Ga0105244_1000123915 656
376 3300009036 Ga0105244_10017260 Ga0105244_100172603 656
377 3300009036 Ga0105244_10026959 Ga0105244_100269592 656
378 3300009036 Ga0105244_10032621 Ga0105244_100326213 656
379 3300009036 Ga0105244_10034773 Ga0105244_100347731 656
380 3300009036 Ga0105244_10035232 Ga0105244_100352321 656
381 3300009092 Ga0105250_10000056 Ga0105250_10000056106 656
382 3300009092 Ga0105250_10014720 Ga0105250_100147202 656
383 3300009092 Ga0105250_10015060 Ga0105250_100150603 656
384 3300009092 Ga0105250_10015386 Ga0105250_100153863 656
385 3300009092 Ga0105250_10015561 Ga0105250_100155611 656
386 3300009092 Ga0105250_10015844 Ga0105250_100158442 656
387 3300009092 Ga0105250_10028354 Ga0105250_100283541 656
388 3300009148 Ga0105243_10000133 Ga0105243_100001339 656
389 3300009148 Ga0105243_10013241 Ga0105243_100132417 656
390 3300009148 Ga0105243_10055268 Ga0105243_100552683 656
391 3300009148 Ga0105243_10085452 Ga0105243_100854521 656
392 3300009176 Ga0105242_10002285 Ga0105242_100022858 656
393 3300009177 Ga0105248_10035793 Ga0105248_100357932 656
394 3300009545 Ga0105237_10005854 Ga0105237_100058541 656
395 3300011119 Ga0105246_10001386 Ga0105246_1000138614 656
396 3300011119 Ga0105246_10056823 Ga0105246_100568231 656
397 3300012498 Ga0157345_1000466 Ga0157345_10004662 656
398 3300013100 Ga0157373_10058499 Ga0157373_100584992 656
399 3300013100 Ga0157373_10059460 Ga0157373_100594602 656
400 3300013100 Ga0157373_10060687 Ga0157373_100606872 656
401 3300013100 Ga0157373_10064824 Ga0157373_100648241 656
402 3300013100 Ga0157373_10065719 Ga0157373_100657191 656
403 3300013102 Ga0157371_10005665 Ga0157371_100056655 656
404 3300013102 Ga0157371_10035009 Ga0157371_100350092 656
405 3300013104 Ga0157370_10018287 Ga0157370_100182877 656
406 3300013104 Ga0157370_10081418 Ga0157370_100814182 656
407 3300013105 Ga0157369_10098005 Ga0157369_100980052 656
408 3300013105 Ga0157369_10101594 Ga0157369_101015942 656
409 3300013105 Ga0157369_10110445 Ga0157369_101104452 656
410 3300013105 Ga0157369_10121333 Ga0157369_101213333 656
411 3300013105 Ga0157369_10124194 Ga0157369_101241942 656
412 3300013105 Ga0157369_10142667 Ga0157369_101426671 656
413 3300013306 Ga0163162_10062608 Ga0163162_100626083 656
414 3300013306 Ga0163162_10091796 Ga0163162_100917961 656
415 3300013308 Ga0157375_10010253 Ga0157375_100102536 656
416 3300014497 Ga0182008_10009257 Ga0182008_100092575 656
417 3300014497 Ga0182008_10021127 Ga0182008_100211273 656
418 3300014497 Ga0182008_10026059 Ga0182008_100260591 656
419 3300014497 Ga0182008_10029299 Ga0182008_100292991 656
420 3300014497 Ga0182008_10033809 Ga0182008_100338092 656
421 3300015261 Ga0182006_1010175 Ga0182006_10101753 656
422 3300015261 Ga0182006_1013977 Ga0182006_10139773 656
423 3300015261 Ga0182006_1017585 Ga0182006_10175852 656
424 3300015262 Ga0182007_10012959 Ga0182007_100129592 656
425 3300015262 Ga0182007_10018219 Ga0182007_100182191 656
426 3300015265 Ga0182005_1005690 Ga0182005_10056902 656
427 3300015265 Ga0182005_1008456 Ga0182005_10084562 656
428 3300015265 Ga0182005_1008628 Ga0182005_10086282 656
429 3300017792 Ga0163161_10048991 Ga0163161_100489912 656
430 3300017792 Ga0163161_10050044 Ga0163161_100500442 656
431 3300017792 Ga0163161_10063375 Ga0163161_100633751 656
432 3300017792 Ga0163161_10066150 Ga0163161_100661501 656
433 3300025207 Ga0209760_100055 Ga0209760_10005564 656
434 3300025207 Ga0209760_100084 Ga0209760_10008466 656
435 3300025231 Ga0207427_100004 Ga0207427_100004336 656
436 3300025231 Ga0207427_100007 Ga0207427_100007378 656
437 3300025233 Ga0209437_100006 Ga0209437_100006644 656
438 3300025233 Ga0209437_100028 Ga0209437_100028172 656
439 3300025261 Ga0209233_1000008 Ga0209233_1000008883 656
440 3300025261 Ga0209233_1000059 Ga0209233_1000059351 656
441 3300025292 Ga0209676_1000006 Ga0209676_1000006628 656
442 3300025292 Ga0209676_1000010 Ga0209676_1000010632 656
443 3300025292 Ga0209676_1000231 Ga0209676_100023174 656
444 3300025292 Ga0209676_1000270 Ga0209676_10002707 656
445 3300025292 Ga0209676_1015059 Ga0209676_10150591 656
446 3300025298 Ga0209050_1000019 Ga0209050_1000019231 656
447 3300025298 Ga0209050_1000027 Ga0209050_100002748 656
448 3300025298 Ga0209050_1000065 Ga0209050_1000065110 656
449 3300025298 Ga0209050_1008780 Ga0209050_10087802 656
450 3300025303 Ga0209051_1000238 Ga0209051_10002389 656
451 3300025303 Ga0209051_1000258 Ga0209051_100025839 656
452 3300025303 Ga0209051_1000265 Ga0209051_100026579 656
453 3300025304 Ga0209257_1000119 Ga0209257_100011937 656
454 3300025304 Ga0209257_1009506 Ga0209257_10095063 656
455 3300025321 Ga0207656_10000014 Ga0207656_10000014119 656
456 3300025711 Ga0207696_1000022 Ga0207696_100002246 656
457 3300025711 Ga0207696_1000034 Ga0207696_1000034101 656
458 3300025711 Ga0207696_1000179 Ga0207696_100017968 656
459 3300025711 Ga0207696_1000221 Ga0207696_100022166 656
460 3300025711 Ga0207696_1014999 Ga0207696_10149992 656
461 3300025728 Ga0207655_1000021 Ga0207655_1000021327 656
462 3300025728 Ga0207655_1000437 Ga0207655_10004372 656
463 3300025728 Ga0207655_1001119 Ga0207655_10011193 656
464 3300025728 Ga0207655_1002245 Ga0207655_10022451 656
465 3300025728 Ga0207655_1003145 Ga0207655_10031459 656
466 3300025728 Ga0207655_1004890 Ga0207655_10048902 656
467 3300025728 Ga0207655_1009294 Ga0207655_10092941 656
468 3300025728 Ga0207655_1011125 Ga0207655_10111251 656
469 3300025728 Ga0207655_1018538 Ga0207655_10185383 656
470 3300025728 Ga0207655_1019100 Ga0207655_10191003 656
471 3300025728 Ga0207655_1019516 Ga0207655_10195162 656
472 3300025728 Ga0207655_1026581 Ga0207655_10265812 656
473 3300025735 Ga0207713_1000014 Ga0207713_1000014330 656
474 3300025735 Ga0207713_1000219 Ga0207713_100021955 656
475 3300025735 Ga0207713_1000322 Ga0207713_10003229 656
476 3300025735 Ga0207713_1000865 Ga0207713_10008659 656
477 3300025735 Ga0207713_1002208 Ga0207713_10022085 656
478 3300025735 Ga0207713_1002739 Ga0207713_10027397 656
479 3300025735 Ga0207713_1003423 Ga0207713_100342310 656
480 3300025735 Ga0207713_1018349 Ga0207713_10183491 656
481 3300025735 Ga0207713_1024866 Ga0207713_10248662 656
482 3300025735 Ga0207713_1024878 Ga0207713_10248782 656
483 3300025914 Ga0207671_10000019 Ga0207671_10000019160 656
484 3300025920 Ga0207649_10000004 Ga0207649_10000004308 656
485 3300025923 Ga0207681_10003747 Ga0207681_100037477 656
486 3300025925 Ga0207650_10000863 Ga0207650_1000086316 656
487 3300025925 Ga0207650_10001402 Ga0207650_1000140211 656
488 3300025933 Ga0207706_10002341 Ga0207706_100023419 656
489 3300025933 Ga0207706_10020261 Ga0207706_100202615 656
490 3300025935 Ga0207709_10000013 Ga0207709_10000013365 656
491 3300025935 Ga0207709_10001096 Ga0207709_1000109612 656
492 3300025935 Ga0207709_10018226 Ga0207709_100182264 656
493 3300025945 Ga0207679_10000019 Ga0207679_10000019178 656
494 3300027111 Ga0209281_1000010 Ga0209281_1000010343 656
495 3300027111 Ga0209281_1000049 Ga0209281_1000049221 656
496 3300027296 Ga0209389_1000005 Ga0209389_10000059 656
497 3300027312 Ga0209371_1000239 Ga0209371_100023918 656
498 3300027312 Ga0209371_1000253 Ga0209371_100025344 656
499 3300027907 Ga0207428_10053616 Ga0207428_100536162 656
500 3300028379 Ga0268266_10043777 Ga0268266_100437773 656
501 3300028786 Ga0307517_10089734 Ga0307517_100897341 656
502 3300030500 Ga0268256_1000199 Ga0268256_100019950 656
503 3300030500 Ga0268256_1000797 Ga0268256_100079716 656
504 3300030521 Ga0307511_10059086 Ga0307511_100590862 656
505 3300030731 Ga0316177_1066524 Ga0316177_10665243 656
506 3300030734 Ga0316179_1027375 Ga0316179_10273753 656
507 3300030735 Ga0316178_1076411 Ga0316178_107641114 656
508 3300030744 Ga0316181_1090496 Ga0316181_10904962 656
509 3300031507 Ga0307509_10120304 Ga0307509_101203041 656
510 3300031548 Ga0307408_100008794 Ga0307408_1000087943 656
511 3300031548 Ga0307408_100046273 Ga0307408_1000462731 656
512 3300031548 Ga0307408_100050617 Ga0307408_1000506173 656
513 3300031548 Ga0307408_100104467 Ga0307408_1001044671 656
514 3300031731 Ga0307405_10002250 Ga0307405_100022502 656
515 3300031731 Ga0307405_10003033 Ga0307405_100030336 656
516 3300031824 Ga0307413_10015659 Ga0307413_100156592 656
517 3300031901 Ga0307406_10025698 Ga0307406_100256982 656
518 3300031903 Ga0307407_10022106 Ga0307407_100221062 656
519 3300031911 Ga0307412_10006998 Ga0307412_100069985 656
520 3300031911 Ga0307412_10010807 Ga0307412_100108075 656
521 3300031911 Ga0307412_10021728 Ga0307412_100217284 656
522 3300031995 Ga0307409_100043923 Ga0307409_1000439232 656
523 3300032004 Ga0307414_10024247 Ga0307414_100242473 656
524 3300032004 Ga0307414_10047289 Ga0307414_100472891 656
525 3300032005 Ga0307411_10009125 Ga0307411_100091255 656
526 3300033180 Ga0307510_10062651 Ga0307510_100626513 656
527 3300041404 Ga0439436_0001961 Ga0439436_0001961_1378_3486 656
528 3300041405 Ga0439438_001186 Ga0439438_001186_7527_9635 656
529 3300041405 Ga0439438_001866 Ga0439438_001866_3600_5708 656
530 3300041405 Ga0439438_004459 Ga0439438_004459_2353_4458 656
531 3300041405 Ga0439438_008691 Ga0439438_008691_358_2463 656
532 3300041405 Ga0439438_009584 Ga0439438_009584_540_2648 656
533 3300041405 Ga0439438_009756 Ga0439438_009756_858_2963 656
534 3300041405 Ga0439438_010829 Ga0439438_010829_105_2210 656
535 3300041407 Ga0439447_006808 Ga0439447_006808_635_2743 656
536 3300041411 Ga0439466_0001022 Ga0439466_0001022_633_2738 656
537 3300041411 Ga0439466_0002186 Ga0439466_0002186_2951_5059 656
538 3300041411 Ga0439466_0004468 Ga0439466_0004468_1908_4016 656
539 3300041411 Ga0439466_0016097 Ga0439466_0016097_480_2585 656
540 3300042006 Ga0439432_001773 Ga0439432_001773_5643_7751 656
541 3300042006 Ga0439432_002335 Ga0439432_002335_1875_3983 656
542 3300042006 Ga0439432_002494 Ga0439432_002494_206_2314 656
543 3300042006 Ga0439432_002665 Ga0439432_002665_3684_5792 656
544 3300042006 Ga0439432_003372 Ga0439432_003372_764_2872 656
545 3300042009 Ga0439451_002915 Ga0439451_002915_557_2665 656
546 3300042010 Ga0439452_000311 Ga0439452_000311_4100_6208 656
547 3300042010 Ga0439452_001075 Ga0439452_001075_3747_5852 656
548 3300042010 Ga0439452_004203 Ga0439452_004203_884_2989 656
549 3300042010 Ga0439452_006032 Ga0439452_006032_921_3029 656
550 3300042010 Ga0439452_007158 Ga0439452_007158_327_2435 656
551 3300042013 Ga0439456_001395 Ga0439456_001395_881_2986 656
552 3300042016 Ga0439463_000274 Ga0439463_000274_11987_14104 656
553 3300042016 Ga0439463_002176 Ga0439463_002176_1047_3155 656
554 3300042115 Ga0450911_000066 Ga0450911_000066_23140_25248 656
555 3300042115 Ga0450911_001637 Ga0450911_001637_1110_3215 656
556 3300042115 Ga0450911_003031 Ga0450911_003031_184_2292 656
557 3300042125 Ga0450923_003130 Ga0450923_003130_116_2224 656
558 3300042137 Ga0450902_000205 Ga0450902_000205_1006_3114 656
559 3300042138 Ga0450903_002144 Ga0450903_002144_925_3033 656
560 3300042138 Ga0450903_004512 Ga0450903_004512_186_2294 656
561 3300042139 Ga0450904_000048 Ga0450904_000048_17759_19867 656
562 3300042139 Ga0450904_001720 Ga0450904_001720_245_2350 656
563 3300042142 Ga0450905_001052 Ga0450905_001052_248_2356 656
564 3300042145 Ga0450906_002598 Ga0450906_002598_864_2969 656
565 3300042146 Ga0450907_000017 Ga0450907_000017_15095_17200 656
566 3300042147 Ga0450910_001240 Ga0450910_001240_745_2853 656
567 3300042156 Ga0439446_0007580 Ga0439446_0007580_220_2328 656
568 3300042156 Ga0439446_0011172 Ga0439446_0011172_110_2218 656
569 3300042435 Ga0439434_0002739 Ga0439434_0002739_2911_5019 656
570 3300042461 Ga0439460_0004386 Ga0439460_0004386_385_2493 656
571 3300046452 Ga0495617_004289 Ga0495617_004289_2191_4299 656
572 3300046452 Ga0495617_006066 Ga0495617_006066_1308_3413 656
573 3300046452 Ga0495617_011060 Ga0495617_011060_879_2984 656
574 3300046452 Ga0495617_013012 Ga0495617_013012_124_2232 656
575 3300046452 Ga0495617_014114 Ga0495617_014114_132_2240 656
576 3300046452 Ga0495617_015051 Ga0495617_015051_423_2531 656
577 3300046453 Ga0495627_000047 Ga0495627_000047_152641_154761 656
578 3300046453 Ga0495627_008983 Ga0495627_008983_1308_3413 656
579 3300046453 Ga0495627_012153 Ga0495627_012153_851_2956 656
580 3300046454 Ga0495592_0077085 Ga0495592_0077085_56_2161 656
581 3300046457 Ga0495590_0008218 Ga0495590_0008218_953_3061 656
582 3300046458 Ga0495591_000019 Ga0495591_000019_206070_208190 656
583 3300046458 Ga0495591_000226 Ga0495591_000226_168_2288 656
584 3300046458 Ga0495591_001090 Ga0495591_001090_5034_7142 656
585 3300046458 Ga0495591_001827 Ga0495591_001827_438_2543 656
586 3300046458 Ga0495591_003767 Ga0495591_003767_382_2502 656
587 3300046458 Ga0495591_008398 Ga0495591_008398_926_3046 656
588 3300046458 Ga0495591_009279 Ga0495591_009279_970_3075 656
589 3300046458 Ga0495591_010510 Ga0495591_010510_692_2800 656
590 3300046458 Ga0495591_012388 Ga0495591_012388_120_2225 656
591 3300046458 Ga0495591_013155 Ga0495591_013155_119_2224 656
592 3300046458 Ga0495591_013246 Ga0495591_013246_842_2947 656
593 3300046460 Ga0495638_0024191 Ga0495638_0024191_852_2957 656
594 3300046460 Ga0495638_0031234 Ga0495638_0031234_928_3036 656
595 3300046460 Ga0495638_0039113 Ga0495638_0039113_801_2906 656
596 3300046460 Ga0495638_0039262 Ga0495638_0039262_104_2212 656
597 3300046460 Ga0495638_0039614 Ga0495638_0039614_274_2382 656
598 3300046460 Ga0495638_0049146 Ga0495638_0049146_137_2245 656
599 3300046460 Ga0495638_0067905 Ga0495638_0067905_57_2162 656
600 3300046463 Ga0495653_0017574 Ga0495653_0017574_2467_4575 656
601 3300046463 Ga0495653_0054783 Ga0495653_0054783_907_3012 656
602 3300046471 Ga0495650_0001450 Ga0495650_0001450_5819_7939 656
603 3300046471 Ga0495650_0001813 Ga0495650_0001813_12157_14277 656
604 3300046471 Ga0495650_0004844 Ga0495650_0004844_457_2562 656
605 3300046471 Ga0495650_0016000 Ga0495650_0016000_872_2977 656
606 3300046471 Ga0495650_0028406 Ga0495650_0028406_378_2486 656
607 3300046474 Ga0495605_0000016 Ga0495605_0000016_273455_275575 656
608 3300046474 Ga0495605_0000777 Ga0495605_0000777_15745_17865 656
609 3300046474 Ga0495605_0004046 Ga0495605_0004046_1236_3344 656
610 3300046474 Ga0495605_0008479 Ga0495605_0008479_2740_4860 656
611 3300046474 Ga0495605_0025995 Ga0495605_0025995_91_2196 656
612 3300046474 Ga0495605_0041482 Ga0495605_0041482_24_2144 656
613 3300046475 Ga0495639_0000070 Ga0495639_0000070_41266_43374 656
614 3300046491 Ga0495584_0014286 Ga0495584_0014286_904_3012 656
615 3300046491 Ga0495584_0016726 Ga0495584_0016726_856_2961 656
616 3300046491 Ga0495584_0018656 Ga0495584_0018656_529_2634 656
617 3300046491 Ga0495584_0023881 Ga0495584_0023881_844_2952 656
618 3300046491 Ga0495584_0024138 Ga0495584_0024138_843_2948 656
619 3300046491 Ga0495584_0031098 Ga0495584_0031098_465_2573 656
620 3300046491 Ga0495584_0031646 Ga0495584_0031646_443_2551 656
621 3300046491 Ga0495584_0037181 Ga0495584_0037181_107_2212 656
622 3300046492 Ga0495585_0004440 Ga0495585_0004440_2544_4664 656
623 3300046492 Ga0495585_0013778 Ga0495585_0013778_1810_3915 656
624 3300046492 Ga0495585_0027478 Ga0495585_0027478_813_2921 656
625 3300046492 Ga0495585_0030514 Ga0495585_0030514_108_2213 656
626 3300046492 Ga0495585_0030685 Ga0495585_0030685_145_2253 656
627 3300046492 Ga0495585_0031930 Ga0495585_0031930_796_2901 656
628 3300046492 Ga0495585_0039729 Ga0495585_0039729_128_2233 656
629 3300046492 Ga0495585_0047438 Ga0495585_0047438_248_2353 656
630 3300046492 Ga0495585_0052582 Ga0495585_0052582_28_2136 656
631 3300046492 Ga0495585_0052698 Ga0495585_0052698_57_2162 656
632 3300046499 Ga0495594_0000837 Ga0495594_0000837_8642_10762 656
633 3300046499 Ga0495594_0030349 Ga0495594_0030349_573_2786 656
634 3300046500 Ga0495596_0002692 Ga0495596_0002692_6421_8526 656
635 3300046500 Ga0495596_0019628 Ga0495596_0019628_180_2285 656
636 3300046501 Ga0495607_0000204 Ga0495607_0000204_1559_3664 656
637 3300046501 Ga0495607_0000573 Ga0495607_0000573_28401_30521 656
638 3300046501 Ga0495607_0001298 Ga0495607_0001298_18795_20915 656
639 3300046501 Ga0495607_0013688 Ga0495607_0013688_2483_4603 656
640 3300046501 Ga0495607_0018774 Ga0495607_0018774_2103_4223 656
641 3300046501 Ga0495607_0023427 Ga0495607_0023427_843_2948 656
642 3300046501 Ga0495607_0026251 Ga0495607_0026251_1472_3577 656
643 3300046501 Ga0495607_0033681 Ga0495607_0033681_904_3012 656
644 3300046501 Ga0495607_0035991 Ga0495607_0035991_791_2896 656
645 3300046506 Ga0495583_0000819 Ga0495583_0000819_20502_22622 656
646 3300046506 Ga0495583_0002361 Ga0495583_0002361_9165_11285 656
647 3300046506 Ga0495583_0005593 Ga0495583_0005593_1312_3432 656
648 3300046506 Ga0495583_0006065 Ga0495583_0006065_852_2972 656
649 3300046506 Ga0495583_0006950 Ga0495583_0006950_4958_7066 656
650 3300046506 Ga0495583_0017172 Ga0495583_0017172_843_2948 656
651 3300046506 Ga0495583_0023932 Ga0495583_0023932_128_2236 656
652 3300046507 Ga0495606_0000567 Ga0495606_0000567_53383_55503 656
653 3300046507 Ga0495606_0001124 Ga0495606_0001124_197_2317 656
654 3300046507 Ga0495606_0001172 Ga0495606_0001172_1832_3940 656
655 3300046507 Ga0495606_0027985 Ga0495606_0027985_1027_3132 656
656 3300046507 Ga0495606_0030072 Ga0495606_0030072_842_2947 656
657 3300046507 Ga0495606_0032211 Ga0495606_0032211_125_2245 656
658 3300046507 Ga0495606_0032296 Ga0495606_0032296_1012_3120 656
659 3300046507 Ga0495606_0034421 Ga0495606_0034421_1269_3377 656
660 3300046507 Ga0495606_0034592 Ga0495606_0034592_499_2604 656
661 3300046507 Ga0495606_0034618 Ga0495606_0034618_75_2180 656
662 3300046507 Ga0495606_0037921 Ga0495606_0037921_853_2958 656
663 3300046507 Ga0495606_0041559 Ga0495606_0041559_879_2984 656
664 3300046512 Ga0495610_0019353 Ga0495610_0019353_775_2883 656
665 3300046512 Ga0495610_0026723 Ga0495610_0026723_843_2948 656
666 3300046512 Ga0495610_0027144 Ga0495610_0027144_809_2917 656
667 3300046512 Ga0495610_0029881 Ga0495610_0029881_407_2515 656
668 3300046512 Ga0495610_0034836 Ga0495610_0034836_353_2458 656
669 3300046512 Ga0495610_0035785 Ga0495610_0035785_255_2426 656
670 3300046513 Ga0495616_0009067 Ga0495616_0009067_3606_5711 656
671 3300046513 Ga0495616_0014588 Ga0495616_0014588_851_2956 656
672 3300046513 Ga0495616_0018151 Ga0495616_0018151_922_3027 656
673 3300046513 Ga0495616_0019211 Ga0495616_0019211_862_2967 656
674 3300046513 Ga0495616_0022493 Ga0495616_0022493_507_2615 656
675 3300046513 Ga0495616_0025885 Ga0495616_0025885_116_2221 656
676 3300046515 Ga0495620_0000013 Ga0495620_0000013_44840_47065 656
677 3300046515 Ga0495620_0000230 Ga0495620_0000230_5372_7492 656
678 3300046515 Ga0495620_0000463 Ga0495620_0000463_13901_16021 656
679 3300046515 Ga0495620_0005401 Ga0495620_0005401_3561_5681 656
680 3300046515 Ga0495620_0009905 Ga0495620_0009905_835_2940 656
681 3300046515 Ga0495620_0018127 Ga0495620_0018127_424_2532 656
682 3300046518 Ga0495631_0000817 Ga0495631_0000817_2233_4338 656
683 3300046518 Ga0495631_0007145 Ga0495631_0007145_1760_3865 656
684 3300046518 Ga0495631_0022139 Ga0495631_0022139_754_2859 656
685 3300046519 Ga0495632_0001080 Ga0495632_0001080_15386_17611 656
686 3300046519 Ga0495632_0001889 Ga0495632_0001889_4967_7087 656
687 3300046519 Ga0495632_0008466 Ga0495632_0008466_2026_4146 656
688 3300046519 Ga0495632_0013149 Ga0495632_0013149_904_3012 656
689 3300046519 Ga0495632_0014175 Ga0495632_0014175_866_2971 656
690 3300046519 Ga0495632_0014766 Ga0495632_0014766_1458_3563 656
691 3300046519 Ga0495632_0017841 Ga0495632_0017841_1703_3808 656
692 3300046519 Ga0495632_0027027 Ga0495632_0027027_103_2208 656
693 3300046519 Ga0495632_0030253 Ga0495632_0030253_33_2141 656
694 3300046519 Ga0495632_0035658 Ga0495632_0035658_301_2406 656
695 3300046520 Ga0495637_0000252 Ga0495637_0000252_4861_6981 656
696 3300046520 Ga0495637_0003456 Ga0495637_0003456_1512_3632 656
697 3300046520 Ga0495637_0013531 Ga0495637_0013531_836_2941 656
698 3300046520 Ga0495637_0013717 Ga0495637_0013717_939_3047 656
699 3300046520 Ga0495637_0014017 Ga0495637_0014017_808_2913 656
700 3300046520 Ga0495637_0015810 Ga0495637_0015810_462_2570 656
701 3300046520 Ga0495637_0017701 Ga0495637_0017701_322_2430 656
702 3300046520 Ga0495637_0019871 Ga0495637_0019871_847_2952 656
703 3300046520 Ga0495637_0021017 Ga0495637_0021017_55_2160 656
704 3300046520 Ga0495637_0021079 Ga0495637_0021079_839_2944 656
705 3300046520 Ga0495637_0022326 Ga0495637_0022326_598_2718 656
706 3300046520 Ga0495637_0027075 Ga0495637_0027075_438_2543 656
707 3300046522 Ga0495643_0000684 Ga0495643_0000684_4639_6747 656
708 3300046522 Ga0495643_0000830 Ga0495643_0000830_25998_28223 656
709 3300046522 Ga0495643_0013635 Ga0495643_0013635_2337_4475 656
710 3300046522 Ga0495643_0029268 Ga0495643_0029268_843_2948 656
711 3300046522 Ga0495643_0030715 Ga0495643_0030715_18_2123 656
712 3300046523 Ga0495644_0000921 Ga0495644_0000921_107_2212 656
713 3300046523 Ga0495644_0019105 Ga0495644_0019105_438_2546 656
714 3300046524 Ga0495648_0003089 Ga0495648_0003089_11759_13873 656
715 3300046524 Ga0495648_0004745 Ga0495648_0004745_5149_7269 656
716 3300046524 Ga0495648_0007885 Ga0495648_0007885_5526_7751 656
717 3300046524 Ga0495648_0024516 Ga0495648_0024516_1733_3838 656
718 3300046524 Ga0495648_0026355 Ga0495648_0026355_931_3051 656
719 3300046524 Ga0495648_0030971 Ga0495648_0030971_982_3090 656
720 3300046524 Ga0495648_0035148 Ga0495648_0035148_1020_3125 656
721 3300046524 Ga0495648_0035794 Ga0495648_0035794_127_2232 656
722 3300046524 Ga0495648_0038042 Ga0495648_0038042_843_2948 656
723 3300046524 Ga0495648_0038974 Ga0495648_0038974_105_2210 656
724 3300046524 Ga0495648_0047702 Ga0495648_0047702_408_2516 656
725 3300046524 Ga0495648_0051342 Ga0495648_0051342_132_2240 656
726 3300046528 Ga0495642_0001881 Ga0495642_0001881_866_2971 656
727 3300046528 Ga0495642_0007894 Ga0495642_0007894_1042_3150 656
728 3300046530 Ga0495654_0001564 Ga0495654_0001564_5214_7334 656
729 3300046530 Ga0495654_0001684 Ga0495654_0001684_4351_6471 656
730 3300046530 Ga0495654_0007896 Ga0495654_0007896_3677_5785 656
731 3300046530 Ga0495654_0008686 Ga0495654_0008686_106_2277 656
732 3300046530 Ga0495654_0013298 Ga0495654_0013298_333_2453 656
733 3300046530 Ga0495654_0019502 Ga0495654_0019502_843_2948 656
734 3300046530 Ga0495654_0020877 Ga0495654_0020877_937_3045 656
735 3300046530 Ga0495654_0025380 Ga0495654_0025380_816_2921 656
736 3300046530 Ga0495654_0026285 Ga0495654_0026285_146_2254 656
737 3300046530 Ga0495654_0031179 Ga0495654_0031179_153_2261 656
738 3300046530 Ga0495654_0044747 Ga0495654_0044747_57_2162 656
739 3300046538 Ga0495609_0000070 Ga0495609_0000070_15152_17272 656
740 3300046538 Ga0495609_0000197 Ga0495609_0000197_5110_7230 656
741 3300046538 Ga0495609_0000707 Ga0495609_0000707_8126_10246 656
742 3300046538 Ga0495609_0013552 Ga0495609_0013552_864_2969 656
743 3300046538 Ga0495609_0020115 Ga0495609_0020115_871_2976 656
744 3300046538 Ga0495609_0030703 Ga0495609_0030703_225_2330 656
745 3300046542 Ga0495597_0000010 Ga0495597_0000010_205492_207612 656
746 3300046542 Ga0495597_0003921 Ga0495597_0003921_971_3091 656
747 3300046542 Ga0495597_0014114 Ga0495597_0014114_106_2211 656
748 3300046542 Ga0495597_0021003 Ga0495597_0021003_25_2133 656
749 3300046542 Ga0495597_0022478 Ga0495597_0022478_61_2169 656
750 3300046542 Ga0495597_0027850 Ga0495597_0027850_378_2486 656
751 3300046542 Ga0495597_0036148 Ga0495597_0036148_57_2165 656
752 3300046557 Ga0495622_0008343 Ga0495622_0008343_1772_3877 656
753 3300046557 Ga0495622_0012637 Ga0495622_0012637_959_3067 656
754 3300046557 Ga0495622_0017017 Ga0495622_0017017_809_2917 656
755 3300046557 Ga0495622_0020701 Ga0495622_0020701_806_2914 656
756 3300046558 Ga0495633_0001527 Ga0495633_0001527_10522_12642 656
757 3300046558 Ga0495633_0012320 Ga0495633_0012320_1435_3540 656
758 3300046558 Ga0495633_0015599 Ga0495633_0015599_1762_3867 656
759 3300046558 Ga0495633_0024573 Ga0495633_0024573_847_2952 656
760 3300046615 Ga0495656_0025268 Ga0495656_0025268_127_2232 656
761 3300046616 Ga0495668_0005367 Ga0495668_0005367_2907_5027 656
762 3300046616 Ga0495668_0006716 Ga0495668_0006716_4492_6597 656
763 3300046616 Ga0495668_0013510 Ga0495668_0013510_853_2958 656
764 3300046616 Ga0495668_0015789 Ga0495668_0015789_1625_3745 656
765 3300046616 Ga0495668_0028248 Ga0495668_0028248_895_3015 656
766 3300046642 Ga0495634_0008019 Ga0495634_0008019_617_2725 656
767 3300046648 Ga0495611_0002696 Ga0495611_0002696_5560_7680 656
768 3300046648 Ga0495611_0004966 Ga0495611_0004966_1744_3849 656
769 3300046648 Ga0495611_0021284 Ga0495611_0021284_592_2697 656
770 3300046660 Ga0495625_0000354 Ga0495625_0000354_53362_55482 656
771 3300046660 Ga0495625_0021002 Ga0495625_0021002_1078_3183 656
772 3300046660 Ga0495625_0035765 Ga0495625_0035765_1465_3570 656
773 3300046660 Ga0495625_0048467 Ga0495625_0048467_851_2956 656
774 3300046660 Ga0495625_0061054 Ga0495625_0061054_543_2651 656
775 3300046660 Ga0495625_0063776 Ga0495625_0063776_386_2494 656
776 3300046663 Ga0495635_0013908 Ga0495635_0013908_2794_5007 656
777 3300046664 Ga0495659_0009675 Ga0495659_0009675_856_2964 656
778 3300046665 Ga0495661_0000185 Ga0495661_0000185_14407_16527 656
779 3300046665 Ga0495661_0000329 Ga0495661_0000329_14672_16792 656
780 3300046665 Ga0495661_0000875 Ga0495661_0000875_10280_12400 656
781 3300046665 Ga0495661_0027613 Ga0495661_0027613_1311_3431 656
782 3300046665 Ga0495661_0042076 Ga0495661_0042076_576_2684 656
783 3300046665 Ga0495661_0046877 Ga0495661_0046877_424_2532 656
784 3300046665 Ga0495661_0054279 Ga0495661_0054279_250_2355 656
785 3300046674 Ga0495588_0023759 Ga0495588_0023759_909_3017 656
786 3300046679 Ga0495623_0013516 Ga0495623_0013516_2321_4426 656
787 3300046679 Ga0495623_0013934 Ga0495623_0013934_1169_3277 656
788 3300046680 Ga0495646_0012272 Ga0495646_0012272_3097_5205 656
789 3300046680 Ga0495646_0024614 Ga0495646_0024614_879_2984 656
790 3300046689 Ga0495613_0048971 Ga0495613_0048971_133_2238 656
791 3300046690 Ga0495624_0025535 Ga0495624_0025535_815_2920 656
792 3300046691 Ga0495670_0003514 Ga0495670_0003514_445_2553 656
793 3300046691 Ga0495670_0013746 Ga0495670_0013746_999_3104 656
794 3300046691 Ga0495670_0022757 Ga0495670_0022757_856_2964 656
795 3300046691 Ga0495670_0028476 Ga0495670_0028476_122_2230 656
796 3300046692 Ga0495671_0001087 Ga0495671_0001087_4706_6814 656
797 3300046692 Ga0495671_0003824 Ga0495671_0003824_5019_7139 656
798 3300046692 Ga0495671_0016167 Ga0495671_0016167_1082_3190 656
799 3300046692 Ga0495671_0016777 Ga0495671_0016777_948_3053 656
800 3300046692 Ga0495671_0025511 Ga0495671_0025511_124_2229 656
801 3300046692 Ga0495671_0026078 Ga0495671_0026078_834_2939 656
802 3300046692 Ga0495671_0026390 Ga0495671_0026390_801_2906 656
803 3300046692 Ga0495671_0030656 Ga0495671_0030656_513_2621 656
804 3300046692 Ga0495671_0032512 Ga0495671_0032512_424_2532 656
805 3300046692 Ga0495671_0033113 Ga0495671_0033113_423_2528 656
806 3300046694 Ga0495649_0015223 Ga0495649_0015223_334_2442 656
807 3300046694 Ga0495649_0025836 Ga0495649_0025836_415_2520 656
808 3300046694 Ga0495649_0029287 Ga0495649_0029287_834_2939 656
809 3300046694 Ga0495649_0029516 Ga0495649_0029516_141_2249 656
810 3300046694 Ga0495649_0033712 Ga0495649_0033712_564_2672 656
811 3300046794 Ga0495589_0002046 Ga0495589_0002046_4321_6441 656
812 3300046794 Ga0495589_0008932 Ga0495589_0008932_2205_4313 656
813 3300046794 Ga0495589_0019754 Ga0495589_0019754_901_3009 656
814 3300046794 Ga0495589_0024555 Ga0495589_0024555_124_2229 656
815 3300046794 Ga0495589_0025402 Ga0495589_0025402_836_2941 656
816 3300046794 Ga0495589_0030977 Ga0495589_0030977_453_2558 656
817 3300046809 Ga0495600_0032163 Ga0495600_0032163_1153_3258 656
818 3300046810 Ga0495660_0001329 Ga0495660_0001329_11594_13714 656
819 3300046810 Ga0495660_0001815 Ga0495660_0001815_6985_9105 656
820 3300046810 Ga0495660_0002558 Ga0495660_0002558_4714_6834 656
821 3300046810 Ga0495660_0002643 Ga0495660_0002643_4292_6412 656
822 3300046810 Ga0495660_0009743 Ga0495660_0009743_790_2898 656
823 3300046810 Ga0495660_0014666 Ga0495660_0014666_1830_3935 656
824 3300046810 Ga0495660_0019932 Ga0495660_0019932_843_2948 656
825 3300046810 Ga0495660_0029277 Ga0495660_0029277_943_3063 656
826 3300046810 Ga0495660_0030377 Ga0495660_0030377_843_2948 656
827 3300046810 Ga0495660_0030681 Ga0495660_0030681_129_2234 656
828 3300046810 Ga0495660_0032426 Ga0495660_0032426_793_2898 656
829 3300046810 Ga0495660_0034972 Ga0495660_0034972_26_2131 656
830 3300046810 Ga0495660_0050491 Ga0495660_0050491_29_2134 656
831 3300047317 Ga0495604_0007388 Ga0495604_0007388_1157_3265 656
832 3300047319 Ga0495674_0041032 Ga0495674_0041032_1185_3293 656
833 3300047320 Ga0495672_0008936 Ga0495672_0008936_5137_7242 656
834 3300047320 Ga0495672_0008970 Ga0495672_0008970_5123_7228 656
835 3300047320 Ga0495672_0030800 Ga0495672_0030800_255_2363 656
836 3300047320 Ga0495672_0033749 Ga0495672_0033749_884_2989 656
837 3300047320 Ga0495672_0037045 Ga0495672_0037045_443_2548 656
838 3300047320 Ga0495672_0039685 Ga0495672_0039685_521_2626 656
839 3300047320 Ga0495672_0041440 Ga0495672_0041440_544_2652 656
840 3300047320 Ga0495672_0043449 Ga0495672_0043449_50_2155 656
841 3300047320 Ga0495672_0055233 Ga0495672_0055233_136_2244 656
842 3300047321 Ga0495676_0000081 Ga0495676_0000081_53858_55978 656
843 3300047321 Ga0495676_0038465 Ga0495676_0038465_954_3059 656
844 3300047321 Ga0495676_0056133 Ga0495676_0056133_882_2987 656
845 3300047322 Ga0495680_0013118 Ga0495680_0013118_4509_6722 656
846 3300047322 Ga0495680_0038945 Ga0495680_0038945_808_2913 656
847 3300047323 Ga0495683_0001164 Ga0495683_0001164_10718_12838 656
848 3300047323 Ga0495683_0004135 Ga0495683_0004135_793_2898 656
849 3300047323 Ga0495683_0010986 Ga0495683_0010986_1492_3612 656
850 3300047323 Ga0495683_0014129 Ga0495683_0014129_1472_3577 656
851 3300047323 Ga0495683_0018831 Ga0495683_0018831_466_2574 656
852 3300047323 Ga0495683_0026962 Ga0495683_0026962_94_2199 656
853 3300047323 Ga0495683_0031784 Ga0495683_0031784_79_2184 656
854 3300047323 Ga0495683_0042993 Ga0495683_0042993_45_2150 656
855 3300047443 Ga0495687_015170 Ga0495687_015170_893_3001 656
856 3300047443 Ga0495687_026899 Ga0495687_026899_465_2594 656
857 3300047446 Ga0495679_000186 Ga0495679_000186_38466_40586 656
858 3300047446 Ga0495679_001415 Ga0495679_001415_947_3067 656
859 3300047446 Ga0495679_011118 Ga0495679_011118_451_2559 656
860 3300047446 Ga0495679_011313 Ga0495679_011313_1276_3381 656
861 3300047446 Ga0495679_013926 Ga0495679_013926_793_2898 656
862 3300047446 Ga0495679_016933 Ga0495679_016933_439_2547 656
863 3300047469 Ga0495673_0002766 Ga0495673_0002766_748_2868 656
864 3300047469 Ga0495673_0003770 Ga0495673_0003770_2837_4957 656
865 3300047469 Ga0495673_0004143 Ga0495673_0004143_801_2906 656
866 3300047469 Ga0495673_0004983 Ga0495673_0004983_4693_6852 656
867 3300047469 Ga0495673_0017336 Ga0495673_0017336_226_2331 656
868 3300047469 Ga0495673_0021427 Ga0495673_0021427_888_3008 656
869 3300047469 Ga0495673_0023430 Ga0495673_0023430_120_2225 656
870 3300047469 Ga0495673_0024205 Ga0495673_0024205_115_2223 656
871 3300047469 Ga0495673_0029484 Ga0495673_0029484_379_2499 656
872 3300047470 Ga0495681_0003446 Ga0495681_0003446_1168_3273 656
873 3300047470 Ga0495681_0005569 Ga0495681_0005569_1065_3185 656
874 3300047470 Ga0495681_0013167 Ga0495681_0013167_2259_4367 656
875 3300047470 Ga0495681_0013239 Ga0495681_0013239_843_2948 656
876 3300047470 Ga0495681_0014821 Ga0495681_0014821_872_2977 656
877 3300047470 Ga0495681_0018271 Ga0495681_0018271_881_2986 656
878 3300047470 Ga0495681_0020983 Ga0495681_0020983_982_3090 656
879 3300047470 Ga0495681_0025061 Ga0495681_0025061_449_2554 656
880 3300047470 Ga0495681_0026051 Ga0495681_0026051_835_2940 656
881 3300047470 Ga0495681_0030272 Ga0495681_0030272_134_2242 656
882 3300047470 Ga0495681_0035455 Ga0495681_0035455_339_2447 656
883 3300047471 Ga0495684_0054293 Ga0495684_0054293_826_2931 656
884 3300047471 Ga0495684_0055286 Ga0495684_0055286_811_2916 656
885 3300047472 Ga0495686_0024039 Ga0495686_0024039_879_2984 656
886 3300047472 Ga0495686_0029994 Ga0495686_0029994_843_2948 656
887 3300047472 Ga0495686_0039727 Ga0495686_0039727_792_2900 656
888 3300047472 Ga0495686_0047434 Ga0495686_0047434_462_2570 656
889 3300047472 Ga0495686_0050001 Ga0495686_0050001_68_2176 656
890 3300047673 Ga0495593_0010845 Ga0495593_0010845_830_2935 656
891 3300048088 Ga0495602_0049015 Ga0495602_0049015_811_2916 656
892 3300048091 Ga0495626_0000256 Ga0495626_0000256_53778_55898 656
893 3300048091 Ga0495626_0006620 Ga0495626_0006620_4406_6511 656
894 3300048091 Ga0495626_0022412 Ga0495626_0022412_133_2241 656
895 3300048091 Ga0495626_0022847 Ga0495626_0022847_856_2964 656
896 3300048091 Ga0495626_0023047 Ga0495626_0023047_851_2956 656
897 3300048091 Ga0495626_0023143 Ga0495626_0023143_806_2914 656
898 3300048091 Ga0495626_0029320 Ga0495626_0029320_132_2240 656
899 3300048091 Ga0495626_0030483 Ga0495626_0030483_284_2389 656
900 3300048091 Ga0495626_0031168 Ga0495626_0031168_437_2542 656
901 3300048905 Ga0496102_0001116 Ga0496102_0001116_5380_7488 656
902 3300048917 Ga0496114_0058865 Ga0496114_0058865_260_2368 656
903 3300048919 Ga0496116_0001203 Ga0496116_0001203_22308_24416 656
904 3300048919 Ga0496116_0001581 Ga0496116_0001581_4142_6250 656
905 3300048919 Ga0496116_0021622 Ga0496116_0021622_1851_3956 656
906 3300048919 Ga0496116_0043131 Ga0496116_0043131_91_2196 656
907 3300048919 Ga0496116_0043471 Ga0496116_0043471_92_2197 656
908 3300048920 Ga0496117_0007639 Ga0496117_0007639_6134_8242 656
909 3300048920 Ga0496117_0010279 Ga0496117_0010279_2122_4230 656
910 3300048920 Ga0496117_0023547 Ga0496117_0023547_150_2258 656
911 3300048920 Ga0496117_0030347 Ga0496117_0030347_331_2556 656
912 3300048920 Ga0496117_0030654 Ga0496117_0030654_1212_3320 656
913 3300048920 Ga0496117_0040041 Ga0496117_0040041_834_2942 656
914 3300048920 Ga0496117_0047654 Ga0496117_0047654_873_2978 656
915 3300048920 Ga0496117_0056878 Ga0496117_0056878_98_2206 656
916 3300048921 Ga0496118_0003568 Ga0496118_0003568_1921_4029 656
917 3300048921 Ga0496118_0021945 Ga0496118_0021945_1382_3490 656
918 3300048921 Ga0496118_0022407 Ga0496118_0022407_2257_4365 656
919 3300048921 Ga0496118_0047692 Ga0496118_0047692_1064_3172 656
920 3300048921 Ga0496118_0053893 Ga0496118_0053893_66_2171 656
921 3300048921 Ga0496118_0064422 Ga0496118_0064422_22_2130 656
922 3300048922 Ga0496119_0016434 Ga0496119_0016434_3493_5601 656
923 3300048922 Ga0496119_0038704 Ga0496119_0038704_111_2216 656
924 3300048923 Ga0496120_0032211 Ga0496120_0032211_540_2648 656
925 3300048924 Ga0496121_0002692 Ga0496121_0002692_22195_24303 656
926 3300048924 Ga0496121_0006107 Ga0496121_0006107_6054_8174 656
927 3300048924 Ga0496121_0016312 Ga0496121_0016312_425_2545 656
928 3300048924 Ga0496121_0062498 Ga0496121_0062498_875_2980 656
929 3300048924 Ga0496121_0093954 Ga0496121_0093954_168_2276 656
930 3300048925 Ga0496122_0004361 Ga0496122_0004361_3303_5423 656
931 3300048925 Ga0496122_0006408 Ga0496122_0006408_902_3022 656
932 3300048925 Ga0496122_0018557 Ga0496122_0018557_2358_4466 656
933 3300048925 Ga0496122_0032232 Ga0496122_0032232_405_2513 656
934 3300048925 Ga0496122_0052318 Ga0496122_0052318_866_2974 656
935 3300048925 Ga0496122_0052827 Ga0496122_0052827_876_2981 656
936 3300048925 Ga0496122_0067740 Ga0496122_0067740_363_2471 656
937 3300048926 Ga0496123_0001624 Ga0496123_0001624_5709_7829 656
938 3300048926 Ga0496123_0001754 Ga0496123_0001754_3194_5302 656
939 3300048926 Ga0496123_0017632 Ga0496123_0017632_1244_3352 656
940 3300048926 Ga0496123_0018313 Ga0496123_0018313_32_2140 656
941 3300048927 Ga0496124_0000222 Ga0496124_0000222_103255_105363 656
942 3300048927 Ga0496124_0005215 Ga0496124_0005215_12478_14598 656
943 3300048927 Ga0496124_0009753 Ga0496124_0009753_6387_8492 656
944 3300048927 Ga0496124_0022917 Ga0496124_0022917_2090_4315 656
945 3300048927 Ga0496124_0030541 Ga0496124_0030541_2269_4377 656
946 3300048927 Ga0496124_0079571 Ga0496124_0079571_105_2213 656
947 3300048928 Ga0496125_0008731 Ga0496125_0008731_2465_4573 656
948 3300048928 Ga0496125_0022704 Ga0496125_0022704_3603_5711 656
949 3300048928 Ga0496125_0061609 Ga0496125_0061609_793_2901 656
950 3300048928 Ga0496125_0077983 Ga0496125_0077983_74_2182 656
951 3300048929 Ga0496126_0038532 Ga0496126_0038532_1642_3750 656
952 3300048929 Ga0496126_0087683 Ga0496126_0087683_149_2359 656
953 3300049459 Ga0495678_000031 Ga0495678_000031_14249_16369 656
954 3300049459 Ga0495678_000508 Ga0495678_000508_20431_22551 656
955 3300049459 Ga0495678_004164 Ga0495678_004164_757_2862 656
956 3300049459 Ga0495678_012976 Ga0495678_012976_817_2925 656
957 3300049459 Ga0495678_014044 Ga0495678_014044_754_2859 656
958 3300049459 Ga0495678_015906 Ga0495678_015906_441_2549 656
959 3300049459 Ga0495678_016154 Ga0495678_016154_27_2147 656
960 3300049459 Ga0495678_019192 Ga0495678_019192_834_2939 656
961 3300049459 Ga0495678_030980 Ga0495678_030980_53_2158 656
962 3300049460 Ga0495682_0000300 Ga0495682_0000300_34682_36802 656
963 3300049460 Ga0495682_0002873 Ga0495682_0002873_5241_7352 656
964 3300049460 Ga0495682_0011018 Ga0495682_0011018_129_2234 656
965 3300049460 Ga0495682_0015154 Ga0495682_0015154_133_2241 656
966 3300049569 Ga0501032_0011897 Ga0501032_0011897_215_2323 656
967 3300049571 Ga0501034_0000020 Ga0501034_0000020_231963_234071 656
968 3300049853 Ga0501226_000006 Ga0501226_000006_235694_237802 656
969 3300053111 Ga0500572_004618 Ga0500572_004618_74_2179 656
970 3300053135 Ga0500659_0036793 Ga0500659_0036793_185_2293 656
971 3300053161 Ga0500634_0005037 Ga0500634_0005037_3973_6081 656
972 iso_pu_bacteria 2842837860 2842842524 656
973 iso_pu_bacteria 2728369097 2729147679 657
974 3300028379 Ga0268266_10044230 Ga0268266_100442303 658
975 3300049568 Ga0501031_0012138 Ga0501031_0012138_1867_4014 659
976 3300049572 Ga0501036_0041298 Ga0501036_0041298_551_2698 659
977 3300049575 Ga0501039_0005790 Ga0501039_0005790_6947_9094 659
978 3300049588 Ga0501072_0070726 Ga0501072_0070726_522_2669 659
979 3300049591 Ga0501075_0017465 Ga0501075_0017465_2666_4813 659
980 3300049593 Ga0501077_0015602 Ga0501077_0015602_1043_3190 659
981 3300054114 Ga0501084_0057279 Ga0501084_0057279_1038_3185 659
982 3300044712 Ga0453684_0059415 Ga0453684_0059415_483_2633 661
983 3300005327 Ga0070658_10031202 Ga0070658_100312021 664
984 3300005329 Ga0070683_100003158 Ga0070683_10000315810 664
985 3300005339 Ga0070660_100009380 Ga0070660_1000093802 664
986 3300005366 Ga0070659_100018251 Ga0070659_1000182513 664
987 3300005614 Ga0068856_100063831 Ga0068856_1000638313 664
988 3300005843 Ga0068860_100100040 Ga0068860_1001000402 664
989 3300010375 Ga0105239_10008909 Ga0105239_100089093 664
990 3300011119 Ga0105246_10006579 Ga0105246_100065794 664
991 3300013306 Ga0163162_10015613 Ga0163162_100156133 664
992 3300013307 Ga0157372_10128859 Ga0157372_101288592 664
993 3300014325 Ga0163163_10023175 Ga0163163_100231753 664
994 3300025919 Ga0207657_10017006 Ga0207657_100170063 664
995 3300025938 Ga0207704_10002399 Ga0207704_100023993 664
996 3300025944 Ga0207661_10008619 Ga0207661_100086195 664
997 3300028381 Ga0268264_10052167 Ga0268264_100521672 664
998 3300048912 Ga0496109_0088342 Ga0496109_0088342_527_2665 664
999 3300048913 Ga0496110_0009288 Ga0496110_0009288_3925_6063 664
1000 3300049571 Ga0501034_0043201 Ga0501034_0043201_963_3110 664
1001 3300049571 Ga0501034_0057341 Ga0501034_0057341_1616_3763 664
1002 3300049583 Ga0501067_0012697 Ga0501067_0012697_943_3090 664
1003 3300049584 Ga0501068_0019968 Ga0501068_0019968_1184_3331 664
1004 3300049586 Ga0501070_0020222 Ga0501070_0020222_2895_5042 664
1005 3300049588 Ga0501072_0005999 Ga0501072_0005999_2642_4789 664
1006 3300049589 Ga0501073_0004730 Ga0501073_0004730_1671_3818 664
1007 3300049589 Ga0501073_0021468 Ga0501073_0021468_2020_4167 664
1008 3300049590 Ga0501074_0013174 Ga0501074_0013174_1670_3817 664
1009 3300049590 Ga0501074_0023761 Ga0501074_0023761_643_2790 664
1010 3300049593 Ga0501077_0022996 Ga0501077_0022996_1072_3219 664
1011 3300049744 Ga0501083_0014595 Ga0501083_0014595_1363_3510 664
1012 3300060353 Ga0501082_0017045 Ga0501082_0017045_1866_4013 664
1013 3300060353 Ga0501082_0094459 Ga0501082_0094459_330_2477 664
1014 3300005548 Ga0070665_100000865 Ga0070665_10000086544 665
1015 3300028379 Ga0268266_10001168 Ga0268266_100011688 665
1016 3300001990 JGI24737J22298_10001313 JGI24737J22298_100013137 666
1017 3300005331 Ga0070670_100094465 Ga0070670_1000944652 666

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01568

Molydop_binding

Molydopterin dinucleotide binding domain

665

784

0.96

PF04879

Molybdop_Fe4S4

Molybdopterin oxidoreductase Fe4S4 domain

97

151

0.9

PF00384

Molybdopterin

Molybdopterin oxidoreductase

154

572

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tm7-assembly1.cif.gz_B processed aspartate decarboxylase mutant with asn72 mutated to ala 0.9217 571 604
4d7z-assembly1.cif.gz_B e. coli l-aspartate-alpha-decarboxylase mutant n72q to a resolution of 1.9 angstroms 0.9203 571 604
3plx-assembly1.cif.gz_B the crystal structure of aspartate alpha-decarboxylase from campylobacter jejuni subsp. jejuni nctc 11168 0.9173 571 604
5ls7-assembly1.cif.gz_D complex of wild type e. coli alpha aspartate decarboxylase with its processing factor panz 0.9133 571 604
1uhe-assembly1.cif.gz_A crystal structure of aspartate decarboxylase, isoaspargine complex 0.888 571 604
ID Description Score Start End Superfamily
3plxB00 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.9173 571 604 2.40.40.20
2v45A01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;ADC-like domains 0.9032 2 56 2.20.25.90
af_P96281_14_94_2.40.40.20 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.8991 570 615 2.40.40.20
af_L0T2Z1_2_58_2.20.25.90 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;ADC-like domains 0.8979 2 55 2.20.25.90
2vpzE01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;ADC-like domains 0.895 2 59 2.20.25.90
ID Description Score Start End GO Terms
AF-A0A3B8LFW2-F1-model_v4 Dehydrogenase 0.9799 2 418 GO:0016491
GO:0046872
GO:0051539
AF-A0A5C7W6B1-F1-model_v4 Molybdopterin oxidoreductase family protein 0.9799 2 414 GO:0016491
GO:0046872
GO:0051539
AF-A0A2N1WK21-F1-model_v4 deleted 0.9786 44 387
AF-S6UTW2-F1-model_v4 Oxidoreductase, molybdopterin-binding protein 0.9718 2 478 GO:0016491
GO:0046872
GO:0051539
AF-A0A356VIE5-F1-model_v4 deleted 0.9702 2 318

Feature Viewer

pLDDT pTM Quality
88.94 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map