F488225

General Info

Members Datasets Scaffolds Average Seq Length
1014 339 2028 116

Family's Representative Sequence

Representative Sequence 3300047317|Ga0495604_0158686|Ga0495604_0158686_14_385
Length 123
Sequence MSRHPLARVELLQGTLDLLILRTLLSGPTHGYAIAKHIQRTSEELLQVETGSLYPALHRLEAKGWIAATWELSDKGKRARYYRLTALGRRHLASEQSKWETFARAMGLVLKPVDLKPLDQEGQ

Samples

Sample ID Description Type Environment
1 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
197 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
198 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
201 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
204 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
205 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
208 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
209 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
210 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
211 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
212 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
213 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
223 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
224 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
225 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
226 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
227 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
228 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
229 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
230 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
231 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
232 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
233 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
234 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
235 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
236 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
237 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
238 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
239 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
240 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
241 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
242 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
243 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
244 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
245 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
246 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
247 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
248 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
251 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
252 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
253 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
256 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
257 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
258 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
259 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
260 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
261 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
262 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
263 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
264 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
268 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
269 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
270 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
271 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
272 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
278 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
279 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
280 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
287 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
303 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
304 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
305 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
306 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
307 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
308 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
309 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
310 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
311 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
312 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
313 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
314 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
315 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
316 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
317 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
318 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
319 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
320 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
321 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
322 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
323 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
324 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
328 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
329 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
330 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
331 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
332 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
333 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
334 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
335 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
336 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
337 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
338 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
339 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.1
Nodule 0
Rhizoplane 2.76
Rhizosphere 95.86
Stem 0
Stem Tuber 0
Unclassified 38.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495604_0158686 3300047317 Bacteria 1600
2 MRS1b_contig_859378 2162886011 Unclassified 980
3 MBSR1b_contig_7011003 2162886012 Bacteria 2745
4 JGI24746J21847_1061961 3300001977 Unclassified 536
5 rootL2_10290371 3300003322 Bacteria 2041
6 Ga0065714_10093497 3300005288 Unclassified 1845
7 Ga0065712_10068524 3300005290 Bacteria 10090
8 Ga0065712_10155246 3300005290 Bacteria 1339
9 Ga0065715_10000764 3300005293 Bacteria 8500
10 Ga0065715_10010704 3300005293 Bacteria 2411
11 Ga0065715_10102144 3300005293 Unclassified 3140
12 Ga0065715_10263235 3300005293 Bacteria 1132
13 Ga0065715_10579907 3300005293 Bacteria 715
14 Ga0065707_10611075 3300005295 Bacteria 684
15 Ga0070683_100000007 3300005329 Bacteria 342155
16 Ga0070683_100006724 3300005329 Bacteria 9658
17 Ga0070683_100057841 3300005329 Unclassified 3602
18 Ga0070683_100085965 3300005329 Bacteria 2949
19 Ga0070683_100263642 3300005329 Unclassified 1639
20 Ga0070683_100293257 3300005329 Unclassified 1547
21 Ga0070683_100452810 3300005329 Bacteria 1224
22 Ga0070683_101641109 3300005329 Unclassified 618
23 Ga0070690_100994722 3300005330 Unclassified 660
24 Ga0070670_100003509 3300005331 Bacteria 13034
25 Ga0070670_100016481 3300005331 Bacteria 6345
26 Ga0070670_100067873 3300005331 Unclassified 3060
27 Ga0070670_100692847 3300005331 Bacteria 916
28 Ga0070670_101032422 3300005331 Unclassified 748
29 Ga0068869_101501883 3300005334 Unclassified 598
30 Ga0070666_10104359 3300005335 Unclassified 1956
31 Ga0070666_10690658 3300005335 Unclassified 748
32 Ga0070666_10744481 3300005335 Unclassified 720
33 Ga0070680_100314085 3300005336 Bacteria 1330
34 Ga0070680_100339272 3300005336 Unclassified 1277
35 Ga0070682_100495725 3300005337 Unclassified 945
36 Ga0068868_100043863 3300005338 Unclassified 3494
37 Ga0068868_101119161 3300005338 Unclassified 725
38 Ga0070660_100022349 3300005339 Unclassified 4676
39 Ga0070689_100038889 3300005340 Unclassified 3640
40 Ga0070689_101462113 3300005340 Bacteria 618
41 Ga0070661_100025307 3300005344 Bacteria 4264
42 Ga0070661_100340881 3300005344 Bacteria 1174
43 Ga0070661_100506628 3300005344 Bacteria 967
44 Ga0070661_100550282 3300005344 Unclassified 928
45 Ga0070668_101260834 3300005347 Unclassified 671
46 Ga0070669_100048316 3300005353 Bacteria 3106
47 Ga0070669_101357673 3300005353 Bacteria 616
48 Ga0070675_100049409 3300005354 Bacteria 3452
49 Ga0070671_100223299 3300005355 Unclassified 1598
50 Ga0070671_101342205 3300005355 Bacteria 631
51 Ga0070674_100132709 3300005356 Bacteria 1859
52 Ga0070674_100423297 3300005356 Bacteria 1093
53 Ga0070674_100727370 3300005356 Bacteria 851
54 Ga0070674_100891270 3300005356 Bacteria 774
55 Ga0070673_100047885 3300005364 Bacteria 3329
56 Ga0070688_100254387 3300005365 Unclassified 1252
57 Ga0070688_100349915 3300005365 Unclassified 1081
58 Ga0070688_101582768 3300005365 Unclassified 535
59 Ga0070659_100596368 3300005366 Unclassified 949
60 Ga0070667_100020834 3300005367 Bacteria 5445
61 Ga0070709_10665594 3300005434 Bacteria 807
62 Ga0070714_100006091 3300005435 Bacteria 9264
63 Ga0070714_100253396 3300005435 Bacteria 1628
64 Ga0070714_100874366 3300005435 Bacteria 872
65 Ga0070713_100060888 3300005436 Unclassified 3157
66 Ga0070713_100291892 3300005436 Bacteria 1499
67 Ga0070710_10757645 3300005437 Bacteria 690
68 Ga0070710_10940918 3300005437 Bacteria 626
69 Ga0070701_10707919 3300005438 Bacteria 678
70 Ga0070711_100003224 3300005439 Bacteria 9474
71 Ga0070711_100343944 3300005439 Bacteria 1197
72 Ga0070711_100461961 3300005439 Unclassified 1041
73 Ga0070711_100744828 3300005439 Unclassified 828
74 Ga0070711_100782188 3300005439 Unclassified 808
75 Ga0070705_100715912 3300005440 Unclassified 788
76 Ga0070705_100944396 3300005440 Bacteria 696
77 Ga0070700_100348358 3300005441 Bacteria 1097
78 Ga0070700_100356234 3300005441 Unclassified 1086
79 Ga0070700_100814277 3300005441 Unclassified 753
80 Ga0070700_101341330 3300005441 Bacteria 602
81 Ga0070694_100859644 3300005444 Unclassified 747
82 Ga0070694_101880571 3300005444 Unclassified 511
83 Ga0070708_101710392 3300005445 Unclassified 585
84 Ga0070708_101894024 3300005445 Unclassified 553
85 Ga0070663_100193262 3300005455 Bacteria 1585
86 Ga0070663_101649687 3300005455 Unclassified 572
87 Ga0070678_100169839 3300005456 Bacteria 1775
88 Ga0070678_100351726 3300005456 Unclassified 1267
89 Ga0070678_100519667 3300005456 Unclassified 1053
90 Ga0070678_101959659 3300005456 Unclassified 554
91 Ga0070662_100031737 3300005457 Bacteria 3710
92 Ga0070662_100147763 3300005457 Unclassified 1827
93 Ga0070662_100201550 3300005457 Bacteria 1579
94 Ga0070662_100834910 3300005457 Unclassified 784
95 Ga0070662_100863009 3300005457 Bacteria 771
96 Ga0070681_10021785 3300005458 Bacteria 6426
97 Ga0070681_10062901 3300005458 Unclassified 3684
98 Ga0070681_10325745 3300005458 Bacteria 1446
99 Ga0070681_11197847 3300005458 Unclassified 681
100 Ga0070685_10009435 3300005466 Bacteria 5042
101 Ga0070685_10775041 3300005466 Unclassified 705
102 Ga0070685_11054178 3300005466 Unclassified 612
103 Ga0070706_100027769 3300005467 Bacteria 5205
104 Ga0070706_100143285 3300005467 Bacteria 2231
105 Ga0070706_100410628 3300005467 Bacteria 1260
106 Ga0070706_100856636 3300005467 Unclassified 840
107 Ga0070707_100007173 3300005468 Bacteria 10336
108 Ga0070707_100014596 3300005468 Bacteria 7366
109 Ga0070707_100251616 3300005468 Bacteria 1719
110 Ga0070707_101377295 3300005468 Unclassified 672
111 Ga0070698_100010349 3300005471 Bacteria 9960
112 Ga0070698_100402081 3300005471 Bacteria 1303
113 Ga0070698_100794794 3300005471 Bacteria 890
114 Ga0070698_100951962 3300005471 Bacteria 805
115 Ga0070699_100156279 3300005518 Bacteria 2018
116 Ga0070699_100210167 3300005518 Unclassified 1732
117 Ga0070699_101037458 3300005518 Unclassified 752
118 Ga0070699_102085164 3300005518 Bacteria 518
119 Ga0070679_100092789 3300005530 Bacteria 3006
120 Ga0070679_100389512 3300005530 Bacteria 1340
121 Ga0070679_100417362 3300005530 Bacteria 1287
122 Ga0070684_100000054 3300005535 Bacteria 76916
123 Ga0070684_100136825 3300005535 Unclassified 2213
124 Ga0070684_100388699 3300005535 Bacteria 1286
125 Ga0070684_100455953 3300005535 Unclassified 1182
126 Ga0070684_100592991 3300005535 Viruses 1030
127 Ga0070684_100665544 3300005535 Bacteria 970
128 Ga0070684_100716497 3300005535 Unclassified 933
129 Ga0070697_100009880 3300005536 Bacteria 7441
130 Ga0070697_100028395 3300005536 Unclassified 4480
131 Ga0070697_100357229 3300005536 Bacteria 1263
132 Ga0070697_100370898 3300005536 Bacteria 1238
133 Ga0068853_100023327 3300005539 Bacteria 5178
134 Ga0068853_100114516 3300005539 Bacteria 2399
135 Ga0068853_100206206 3300005539 Unclassified 1790
136 Ga0070672_100245143 3300005543 Unclassified 1508
137 Ga0070672_101075883 3300005543 Bacteria 714
138 Ga0070672_101401315 3300005543 Bacteria 625
139 Ga0070686_100012274 3300005544 Bacteria 4874
140 Ga0070686_100880303 3300005544 Unclassified 727
141 Ga0070696_100531235 3300005546 Unclassified 940
142 Ga0070693_100767359 3300005547 Unclassified 712
143 Ga0070693_101114091 3300005547 Unclassified 602
144 Ga0070665_100008511 3300005548 Bacteria 10376
145 Ga0070665_100094352 3300005548 Unclassified 2997
146 Ga0070665_100438693 3300005548 Unclassified 1315
147 Ga0070665_100921690 3300005548 Bacteria 886
148 Ga0070665_101048599 3300005548 Unclassified 827
149 Ga0070704_100242669 3300005549 Bacteria 1475
150 Ga0070704_100778257 3300005549 Unclassified 854
151 Ga0070704_101193586 3300005549 Unclassified 694
152 Ga0070704_101266580 3300005549 Unclassified 674
153 Ga0070704_101990699 3300005549 Unclassified 539
154 Ga0068855_100073361 3300005563 Bacteria 3976
155 Ga0068855_100198801 3300005563 Bacteria 2258
156 Ga0068855_100359009 3300005563 Bacteria 1604
157 Ga0070664_100000429 3300005564 Bacteria 31437
158 Ga0070664_100069193 3300005564 Bacteria 3020
159 Ga0070664_100104376 3300005564 Unclassified 2468
160 Ga0070664_100109619 3300005564 Bacteria 2408
161 Ga0070664_101658014 3300005564 Bacteria 606
162 Ga0070664_101682841 3300005564 Bacteria 601
163 Ga0070664_102185810 3300005564 Bacteria 525
164 Ga0068857_100277991 3300005577 Bacteria 1539
165 Ga0068857_101733891 3300005577 Unclassified 611
166 Ga0068854_101176085 3300005578 Unclassified 686
167 Ga0068856_100010994 3300005614 Bacteria 8789
168 Ga0068856_100129963 3300005614 Plasmid 2523
169 Ga0068856_100242484 3300005614 Bacteria 1818
170 Ga0068856_100270945 3300005614 Bacteria 1714
171 Ga0068856_100917688 3300005614 Unclassified 894
172 Ga0070702_101012174 3300005615 Bacteria 658
173 Ga0068852_100005439 3300005616 Bacteria 9105
174 Ga0068852_100064608 3300005616 Bacteria 3191
175 Ga0068852_100597041 3300005616 Unclassified 1108
176 Ga0068852_100608984 3300005616 Unclassified 1097
177 Ga0068852_102087248 3300005616 Unclassified 589
178 Ga0068859_100130119 3300005617 Bacteria 2588
179 Ga0068859_100904244 3300005617 Bacteria 967
180 Ga0068859_100921090 3300005617 Unclassified 958
181 Ga0068859_100954886 3300005617 Unclassified 940
182 Ga0068859_101901834 3300005617 Unclassified 657
183 Ga0068859_101998400 3300005617 Unclassified 640
184 Ga0068864_100028205 3300005618 Bacteria 4743
185 Ga0068864_100237934 3300005618 Unclassified 1686
186 Ga0068864_101155019 3300005618 Unclassified 772
187 Ga0068864_101337500 3300005618 Unclassified 717
188 Ga0068866_10377416 3300005718 Unclassified 908
189 Ga0068866_10466148 3300005718 Unclassified 829
190 Ga0068866_10614773 3300005718 Bacteria 735
191 Ga0068861_100038986 3300005719 Bacteria 3544
192 Ga0068861_100119391 3300005719 Bacteria 2125
193 Ga0068861_101613322 3300005719 Unclassified 639
194 Ga0068851_10244281 3300005834 Unclassified 1016
195 Ga0068870_10913108 3300005840 Unclassified 621
196 Ga0068863_100061832 3300005841 Unclassified 3541
197 Ga0068863_100128062 3300005841 Bacteria 2423
198 Ga0068863_100246980 3300005841 Bacteria 1723
199 Ga0068863_100307574 3300005841 Unclassified 1538
200 Ga0068863_100947194 3300005841 Unclassified 862
201 Ga0068858_100073050 3300005842 Unclassified 3184
202 Ga0068858_100177003 3300005842 Archaea 2013
203 Ga0068858_100215999 3300005842 Bacteria 1815
204 Ga0068858_100497062 3300005842 Bacteria 1178
205 Ga0068858_100736135 3300005842 Unclassified 960
206 Ga0068858_101557522 3300005842 Unclassified 652
207 Ga0068858_101623579 3300005842 Bacteria 638
208 Ga0068860_100099512 3300005843 Bacteria 2773
209 Ga0068860_100204041 3300005843 Bacteria 1917
210 Ga0068862_100006466 3300005844 Bacteria 9732
211 Ga0068862_101430546 3300005844 Bacteria 695
212 Ga0081455_10098481 3300005937 Bacteria 2353
213 Ga0081540_1057212 3300005983 Bacteria 1887
214 Ga0070717_10111222 3300006028 Bacteria 2337
215 Ga0075432_10054280 3300006058 Unclassified 1419
216 Ga0070715_10419075 3300006163 Unclassified 749
217 Ga0070715_10487328 3300006163 Unclassified 703
218 Ga0070716_100135127 3300006173 Unclassified 1565
219 Ga0070716_100341716 3300006173 Bacteria 1056
220 Ga0070716_100879235 3300006173 Unclassified 700
221 Ga0070712_100137726 3300006175 Bacteria 1858
222 Ga0070712_100361168 3300006175 Unclassified 1191
223 Ga0070712_100423952 3300006175 Unclassified 1103
224 Ga0070712_100736079 3300006175 Unclassified 843
225 Ga0070712_100888122 3300006175 Unclassified 768
226 Ga0075427_10047844 3300006194 Bacteria 732
227 Ga0097621_100176822 3300006237 Bacteria 1843
228 Ga0097621_100297807 3300006237 Bacteria 1424
229 Ga0068871_100064651 3300006358 Bacteria 2995
230 Ga0068871_100136514 3300006358 Unclassified 2083
231 Ga0068871_100204734 3300006358 Bacteria 1705
232 Ga0068871_100321774 3300006358 Bacteria 1362
233 Ga0068871_101381673 3300006358 Unclassified 664
234 Ga0068871_101583694 3300006358 Bacteria 620
235 Ga0075428_100006969 3300006844 Bacteria 12539
236 Ga0075428_100011058 3300006844 Bacteria 10039
237 Ga0075428_100066811 3300006844 Bacteria 3937
238 Ga0075428_100080785 3300006844 Bacteria 3548
239 Ga0075428_100113991 3300006844 Unclassified 2945
240 Ga0075428_101036352 3300006844 Bacteria 868
241 Ga0075428_101340096 3300006844 Bacteria 752
242 Ga0075430_100020197 3300006846 Bacteria 5668
243 Ga0075430_100040478 3300006846 Bacteria 3945
244 Ga0075430_100055472 3300006846 Bacteria 3332
245 Ga0075430_100405334 3300006846 Bacteria 1125
246 Ga0075430_100897739 3300006846 Unclassified 730
247 Ga0075431_100016283 3300006847 Bacteria 7543
248 Ga0075431_100047196 3300006847 Bacteria 4440
249 Ga0075431_100142497 3300006847 Bacteria 2471
250 Ga0075431_100148788 3300006847 Bacteria 2412
251 Ga0075431_100186537 3300006847 Unclassified 2127
252 Ga0075431_100220189 3300006847 Bacteria 1936
253 Ga0075431_101049218 3300006847 Bacteria 781
254 Ga0075431_101288169 3300006847 Unclassified 692
255 Ga0075433_10049848 3300006852 Bacteria 3643
256 Ga0075433_10052858 3300006852 Bacteria 3540
257 Ga0075433_10353727 3300006852 Unclassified 1298
258 Ga0075433_10579015 3300006852 Bacteria 986
259 Ga0075433_11097116 3300006852 Bacteria 692
260 Ga0075433_11207419 3300006852 Unclassified 656
261 Ga0075433_11668255 3300006852 Unclassified 549
262 Ga0075433_11904649 3300006852 Bacteria 510
263 Ga0075434_100002206 3300006871 Bacteria 16975
264 Ga0075434_100006938 3300006871 Bacteria 10440
265 Ga0075434_100017597 3300006871 Bacteria 6890
266 Ga0075434_100116157 3300006871 Bacteria 2689
267 Ga0075434_100226063 3300006871 Unclassified 1891
268 Ga0075434_100227931 3300006871 Unclassified 1883
269 Ga0075434_100428246 3300006871 Bacteria 1344
270 Ga0075434_100993264 3300006871 Bacteria 853
271 Ga0075434_101184433 3300006871 Bacteria 776
272 Ga0075429_100000755 3300006880 Bacteria 25405
273 Ga0075429_100238244 3300006880 Bacteria 1594
274 Ga0075429_100321390 3300006880 Unclassified 1355
275 Ga0075429_100722214 3300006880 Unclassified 873
276 Ga0075429_101119836 3300006880 Bacteria 687
277 Ga0068865_100417556 3300006881 Bacteria 1102
278 Ga0068865_100447892 3300006881 Bacteria 1067
279 Ga0068865_100870328 3300006881 Bacteria 782
280 Ga0075436_100002140 3300006914 Bacteria 13606
281 Ga0075436_100005842 3300006914 Bacteria 8452
282 Ga0075436_100008477 3300006914 Bacteria 7028
283 Ga0075436_100012163 3300006914 Bacteria 5896
284 Ga0075436_100025764 3300006914 Bacteria 4047
285 Ga0075436_100074663 3300006914 Bacteria 2347
286 Ga0075436_100076220 3300006914 Unclassified 2322
287 Ga0075436_101377117 3300006914 Unclassified 534
288 Ga0097620_100130124 3300006931 Bacteria 2588
289 Ga0097620_100904254 3300006931 Bacteria 967
290 Ga0097620_100920981 3300006931 Unclassified 958
291 Ga0097620_100954867 3300006931 Unclassified 940
292 Ga0097620_101901806 3300006931 Unclassified 657
293 Ga0097620_101998792 3300006931 Unclassified 640
294 Ga0075435_100000818 3300007076 Bacteria 19378
295 Ga0075435_100029136 3300007076 Bacteria 4332
296 Ga0075435_100153700 3300007076 Unclassified 1936
297 Ga0075435_100193164 3300007076 Unclassified 1723
298 Ga0075435_100498910 3300007076 Bacteria 1052
299 Ga0099794_10589745 3300007265 Unclassified 588
300 Ga0099795_10044068 3300007788 Bacteria 1599
301 Ga0105240_10023146 3300009093 Bacteria 8225
302 Ga0105240_10024118 3300009093 Bacteria 8029
303 Ga0105240_10167204 3300009093 Bacteria 2608
304 Ga0105240_10337558 3300009093 Bacteria 1713
305 Ga0105240_10390858 3300009093 Unclassified 1569
306 Ga0105240_10570475 3300009093 Bacteria 1249
307 Ga0105240_10694611 3300009093 Bacteria 1111
308 Ga0105240_11499492 3300009093 Bacteria 707
309 Ga0105240_11811546 3300009093 Bacteria 636
310 Ga0111539_10041453 3300009094 Bacteria 5536
311 Ga0111539_10094245 3300009094 Bacteria 3517
312 Ga0111539_10199880 3300009094 Bacteria 2331
313 Ga0111539_10411544 3300009094 Bacteria 1575
314 Ga0105245_10076950 3300009098 Unclassified 3041
315 Ga0105245_10160703 3300009098 Archaea 2131
316 Ga0105245_10178116 3300009098 Unclassified 2029
317 Ga0105245_10217542 3300009098 Bacteria 1841
318 Ga0105245_11159008 3300009098 Bacteria 820
319 Ga0105245_12331805 3300009098 Unclassified 589
320 Ga0105245_12708008 3300009098 Bacteria 549
321 Ga0105245_12871018 3300009098 Unclassified 534
322 Ga0105247_10258550 3300009101 Unclassified 1193
323 Ga0105247_10626215 3300009101 Unclassified 801
324 Ga0114129_10027137 3300009147 Bacteria 8107
325 Ga0114129_10103464 3300009147 Bacteria 3937
326 Ga0114129_10112953 3300009147 Bacteria 3746
327 Ga0114129_10125339 3300009147 Bacteria 3532
328 Ga0114129_10494631 3300009147 Bacteria 1598
329 Ga0114129_10498130 3300009147 Bacteria 1591
330 Ga0114129_10668681 3300009147 Unclassified 1338
331 Ga0114129_10692176 3300009147 Unclassified 1311
332 Ga0114129_10737408 3300009147 Unclassified 1262
333 Ga0114129_10776111 3300009147 Bacteria 1225
334 Ga0114129_11040261 3300009147 Bacteria 1029
335 Ga0114129_11172062 3300009147 Bacteria 958
336 Ga0114129_12385171 3300009147 Unclassified 634
337 Ga0105243_10434156 3300009148 Bacteria 1228
338 Ga0105243_11593046 3300009148 Unclassified 679
339 Ga0105241_10269721 3300009174 Unclassified 1449
340 Ga0105241_10292895 3300009174 Bacteria 1394
341 Ga0105241_10321449 3300009174 Bacteria 1335
342 Ga0105241_10344608 3300009174 Bacteria 1292
343 Ga0105241_11207800 3300009174 Unclassified 716
344 Ga0105241_11276604 3300009174 Bacteria 698
345 Ga0105242_10032979 3300009176 Bacteria 4144
346 Ga0105242_10363364 3300009176 Unclassified 1340
347 Ga0105242_10998914 3300009176 Bacteria 844
348 Ga0105242_11183154 3300009176 Unclassified 783
349 Ga0105242_12588244 3300009176 Unclassified 556
350 Ga0105248_10008930 3300009177 Bacteria 11020
351 Ga0105248_10023512 3300009177 Bacteria 6845
352 Ga0105248_10026910 3300009177 Bacteria 6396
353 Ga0105248_10028027 3300009177 Bacteria 6274
354 Ga0105248_10108561 3300009177 Bacteria 3129
355 Ga0105248_10157658 3300009177 Unclassified 2561
356 Ga0105248_10311351 3300009177 Bacteria 1773
357 Ga0105248_10363950 3300009177 Bacteria 1628
358 Ga0105248_10435918 3300009177 Bacteria 1476
359 Ga0105248_11093256 3300009177 Bacteria 901
360 Ga0105248_13443543 3300009177 Unclassified 502
361 Ga0105237_10006068 3300009545 Bacteria 13516
362 Ga0105237_10642128 3300009545 Unclassified 1068
363 Ga0105237_12396420 3300009545 Unclassified 538
364 Ga0105238_10119937 3300009551 Bacteria 2610
365 Ga0105238_10160188 3300009551 Bacteria 2226
366 Ga0105238_10689625 3300009551 Bacteria 1033
367 Ga0105238_11034181 3300009551 Bacteria 843
368 Ga0105238_11434234 3300009551 Unclassified 718
369 Ga0105238_11881687 3300009551 Unclassified 631
370 Ga0105238_12516255 3300009551 Unclassified 551
371 Ga0105249_10030842 3300009553 Bacteria 4846
372 Ga0105249_10150091 3300009553 Unclassified 2243
373 Ga0105249_10171360 3300009553 Bacteria 2105
374 Ga0105249_10943496 3300009553 Bacteria 931
375 Ga0105249_13307597 3300009553 Unclassified 519
376 Ga0099796_10167549 3300010159 Bacteria 875
377 Ga0105239_10002868 3300010375 Bacteria 21560
378 Ga0105239_10034331 3300010375 Bacteria 5570
379 Ga0105239_10068903 3300010375 Unclassified 3888
380 Ga0105239_10087446 3300010375 Bacteria 3436
381 Ga0105239_10208975 3300010375 Unclassified 2187
382 Ga0105239_10564483 3300010375 Bacteria 1297
383 Ga0105239_10729011 3300010375 Bacteria 1134
384 Ga0105239_11010919 3300010375 Unclassified 956
385 Ga0105239_11713235 3300010375 Bacteria 728
386 Ga0105239_12697274 3300010375 Unclassified 580
387 Ga0105246_10134818 3300011119 Unclassified 1849
388 Ga0105246_11055761 3300011119 Unclassified 739
389 Ga0105246_11214746 3300011119 Unclassified 694
390 Ga0157373_10752718 3300013100 Unclassified 716
391 Ga0157373_11392305 3300013100 Unclassified 533
392 Ga0157371_10017063 3300013102 Bacteria 5401
393 Ga0157371_10150294 3300013102 Bacteria 1661
394 Ga0157370_10147985 3300013104 Bacteria 2186
395 Ga0157370_10300527 3300013104 Unclassified 1482
396 Ga0157370_10331947 3300013104 Bacteria 1402
397 Ga0157370_10492740 3300013104 Unclassified 1126
398 Ga0157370_10674049 3300013104 Unclassified 944
399 Ga0157369_10003263 3300013105 Bacteria 19311
400 Ga0157369_10008271 3300013105 Bacteria 11924
401 Ga0157369_10104798 3300013105 Bacteria 3011
402 Ga0157369_10110505 3300013105 Bacteria 2922
403 Ga0157369_10587580 3300013105 Unclassified 1150
404 Ga0157369_10642222 3300013105 Bacteria 1095
405 Ga0157374_10029367 3300013296 Bacteria 4978
406 Ga0157374_10064449 3300013296 Bacteria 3438
407 Ga0157374_10070096 3300013296 Unclassified 3302
408 Ga0157374_10116110 3300013296 Bacteria 2579
409 Ga0157374_10487174 3300013296 Bacteria 1237
410 Ga0157374_11030440 3300013296 Unclassified 842
411 Ga0157374_11458237 3300013296 Unclassified 707
412 Ga0157374_11473907 3300013296 Bacteria 704
413 Ga0157378_10030859 3300013297 Bacteria 4732
414 Ga0157378_10401954 3300013297 Bacteria 1350
415 Ga0157378_10633784 3300013297 Bacteria 1083
416 Ga0157378_11603301 3300013297 Bacteria 697
417 Ga0157378_12845562 3300013297 Unclassified 536
418 Ga0157378_13230333 3300013297 Unclassified 506
419 Ga0163162_10087793 3300013306 Unclassified 3189
420 Ga0163162_10230897 3300013306 Bacteria 1981
421 Ga0163162_11273280 3300013306 Unclassified 835
422 Ga0163162_12384734 3300013306 Unclassified 608
423 Ga0157372_10005353 3300013307 Bacteria 13633
424 Ga0157372_10058201 3300013307 Bacteria 4319
425 Ga0157372_10240476 3300013307 Bacteria 2101
426 Ga0157372_10487074 3300013307 Bacteria 1438
427 Ga0157372_10503268 3300013307 Bacteria 1413
428 Ga0157372_10632388 3300013307 Bacteria 1247
429 Ga0157375_10142181 3300013308 Unclassified 2528
430 Ga0157375_10436595 3300013308 Bacteria 1475
431 Ga0157375_10460530 3300013308 Unclassified 1437
432 Ga0157375_12026705 3300013308 Unclassified 684
433 Ga0157375_12700265 3300013308 Unclassified 594
434 Ga0163163_10004648 3300014325 Bacteria 11734
435 Ga0163163_10009250 3300014325 Bacteria 8790
436 Ga0163163_10058764 3300014325 Bacteria 3803
437 Ga0163163_10112229 3300014325 Bacteria 2755
438 Ga0163163_10168736 3300014325 Bacteria 2235
439 Ga0163163_10171136 3300014325 Unclassified 2219
440 Ga0163163_10328780 3300014325 Bacteria 1583
441 Ga0163163_10589023 3300014325 Bacteria 1175
442 Ga0163163_10836591 3300014325 Unclassified 984
443 Ga0157380_10037297 3300014326 Bacteria 3765
444 Ga0157380_10617657 3300014326 Unclassified 1075
445 Ga0157380_11474812 3300014326 Bacteria 733
446 Ga0157380_12453515 3300014326 Unclassified 587
447 Ga0157379_10002406 3300014968 Bacteria 15634
448 Ga0157379_10071438 3300014968 Unclassified 3105
449 Ga0157379_10612218 3300014968 Bacteria 1017
450 Ga0157376_10052985 3300014969 Unclassified 3376
451 Ga0157376_10134207 3300014969 Bacteria 2213
452 Ga0157376_11068689 3300014969 Bacteria 832
453 Ga0157376_11411770 3300014969 Unclassified 728
454 Ga0163161_10814537 3300017792 Bacteria 786
455 Ga0163161_11196058 3300017792 Unclassified 657
456 Ga0163161_11443026 3300017792 Bacteria 602
457 Ga0213876_10015860 3300021384 Bacteria 3987
458 Ga0213876_10147482 3300021384 Bacteria 1251
459 Ga0213875_10012717 3300021388 Bacteria 4144
460 Ga0213875_10095566 3300021388 Bacteria 1386
461 Ga0207697_10198365 3300025315 Unclassified 882
462 Ga0207697_10214383 3300025315 Bacteria 849
463 Ga0207692_10162571 3300025898 Unclassified 1288
464 Ga0207642_10270533 3300025899 Bacteria 973
465 Ga0207642_10286090 3300025899 Unclassified 950
466 Ga0207710_10408713 3300025900 Unclassified 697
467 Ga0207688_10070886 3300025901 Unclassified 1977
468 Ga0207680_10191820 3300025903 Unclassified 1388
469 Ga0207680_10371992 3300025903 Bacteria 1006
470 Ga0207680_10764389 3300025903 Unclassified 693
471 Ga0207647_10244577 3300025904 Unclassified 1030
472 Ga0207699_10077514 3300025906 Bacteria 2051
473 Ga0207699_10158020 3300025906 Bacteria 1506
474 Ga0207699_10182138 3300025906 Bacteria 1413
475 Ga0207699_10781293 3300025906 Unclassified 701
476 Ga0207645_10060604 3300025907 Unclassified 2416
477 Ga0207645_10280313 3300025907 Bacteria 1107
478 Ga0207705_10656434 3300025909 Unclassified 816
479 Ga0207684_10013488 3300025910 Bacteria 7068
480 Ga0207684_10120833 3300025910 Bacteria 2246
481 Ga0207684_10371371 3300025910 Unclassified 1230
482 Ga0207654_10427248 3300025911 Bacteria 925
483 Ga0207654_10437115 3300025911 Bacteria 915
484 Ga0207654_11070495 3300025911 Unclassified 587
485 Ga0207654_11271248 3300025911 Bacteria 536
486 Ga0207707_10001181 3300025912 Bacteria 24586
487 Ga0207707_10024626 3300025912 Bacteria 5268
488 Ga0207707_10048678 3300025912 Bacteria 3692
489 Ga0207707_11435172 3300025912 Unclassified 549
490 Ga0207707_11445500 3300025912 Unclassified 547
491 Ga0207695_10189608 3300025913 Bacteria 1974
492 Ga0207695_10725961 3300025913 Unclassified 874
493 Ga0207695_10741101 3300025913 Unclassified 863
494 Ga0207695_11565023 3300025913 Unclassified 540
495 Ga0207671_10019297 3300025914 Bacteria 5214
496 Ga0207671_10199060 3300025914 Bacteria 1564
497 Ga0207671_11130037 3300025914 Unclassified 615
498 Ga0207693_10021001 3300025915 Bacteria 5191
499 Ga0207693_10278693 3300025915 Unclassified 1310
500 Ga0207693_10404578 3300025915 Unclassified 1067
501 Ga0207663_10003342 3300025916 Bacteria 7832
502 Ga0207663_10217587 3300025916 Unclassified 1388
503 Ga0207663_10636971 3300025916 Unclassified 840
504 Ga0207663_10680851 3300025916 Unclassified 813
505 Ga0207663_11098784 3300025916 Unclassified 639
506 Ga0207660_10477433 3300025917 Unclassified 1010
507 Ga0207660_10519667 3300025917 Unclassified 967
508 Ga0207662_11374064 3300025918 Bacteria 502
509 Ga0207657_10021795 3300025919 Bacteria 6019
510 Ga0207657_10119922 3300025919 Bacteria 2165
511 Ga0207649_10054600 3300025920 Unclassified 2487
512 Ga0207649_11285295 3300025920 Unclassified 579
513 Ga0207652_10032917 3300025921 Bacteria 4363
514 Ga0207652_10118922 3300025921 Bacteria 2349
515 Ga0207652_10879950 3300025921 Unclassified 792
516 Ga0207646_10003444 3300025922 Bacteria 17864
517 Ga0207646_10060644 3300025922 Bacteria 3377
518 Ga0207646_10307857 3300025922 Bacteria 1431
519 Ga0207646_10703524 3300025922 Unclassified 903
520 Ga0207646_11249092 3300025922 Unclassified 650
521 Ga0207694_10001610 3300025924 Bacteria 19042
522 Ga0207694_10080599 3300025924 Bacteria 2555
523 Ga0207694_10103409 3300025924 Bacteria 2259
524 Ga0207694_11486593 3300025924 Unclassified 572
525 Ga0207650_10023277 3300025925 Bacteria 4391
526 Ga0207650_10027993 3300025925 Unclassified 4038
527 Ga0207659_10214675 3300025926 Bacteria 1544
528 Ga0207659_10240316 3300025926 Unclassified 1465
529 Ga0207659_10599154 3300025926 Unclassified 939
530 Ga0207659_10772720 3300025926 Bacteria 825
531 Ga0207687_10234748 3300025927 Bacteria 1450
532 Ga0207687_10599487 3300025927 Bacteria 928
533 Ga0207687_11454843 3300025927 Bacteria 589
534 Ga0207700_10004781 3300025928 Bacteria 8034
535 Ga0207700_10010761 3300025928 Bacteria 5796
536 Ga0207700_10043541 3300025928 Bacteria 3298
537 Ga0207700_10406603 3300025928 Unclassified 1194
538 Ga0207700_10941408 3300025928 Unclassified 773
539 Ga0207700_11696680 3300025928 Bacteria 557
540 Ga0207664_10018371 3300025929 Bacteria 5145
541 Ga0207664_10153069 3300025929 Bacteria 1960
542 Ga0207664_10412305 3300025929 Bacteria 1203
543 Ga0207664_11656346 3300025929 Bacteria 562
544 Ga0207644_10161713 3300025931 Bacteria 1741
545 Ga0207690_10749246 3300025932 Unclassified 805
546 Ga0207706_10181762 3300025933 Bacteria 1847
547 Ga0207706_10198275 3300025933 Bacteria 1761
548 Ga0207706_10271530 3300025933 Bacteria 1480
549 Ga0207686_10046439 3300025934 Unclassified 2679
550 Ga0207686_10361601 3300025934 Unclassified 1096
551 Ga0207686_10621545 3300025934 Bacteria 852
552 Ga0207709_10273146 3300025935 Bacteria 1245
553 Ga0207670_11224636 3300025936 Bacteria 636
554 Ga0207669_10040467 3300025937 Bacteria 2704
555 Ga0207669_10353121 3300025937 Bacteria 1137
556 Ga0207669_10522728 3300025937 Bacteria 953
557 Ga0207704_10372271 3300025938 Bacteria 1119
558 Ga0207704_11315397 3300025938 Bacteria 618
559 Ga0207704_11881185 3300025938 Unclassified 515
560 Ga0207665_10069172 3300025939 Bacteria 2407
561 Ga0207665_10475706 3300025939 Bacteria 962
562 Ga0207665_10574221 3300025939 Bacteria 878
563 Ga0207665_10632679 3300025939 Unclassified 837
564 Ga0207665_10876525 3300025939 Bacteria 711
565 Ga0207665_11255119 3300025939 Unclassified 591
566 Ga0207691_10047571 3300025940 Bacteria 3936
567 Ga0207691_10723356 3300025940 Unclassified 839
568 Ga0207711_10018002 3300025941 Bacteria 5872
569 Ga0207711_10027298 3300025941 Bacteria 4795
570 Ga0207711_10048463 3300025941 Bacteria 3634
571 Ga0207711_10082109 3300025941 Unclassified 2817
572 Ga0207711_10172931 3300025941 Unclassified 1961
573 Ga0207711_10213137 3300025941 Bacteria 1765
574 Ga0207711_10258724 3300025941 Unclassified 1599
575 Ga0207711_10286441 3300025941 Unclassified 1518
576 Ga0207711_10322802 3300025941 Bacteria 1427
577 Ga0207711_10492133 3300025941 Unclassified 1143
578 Ga0207711_10683166 3300025941 Unclassified 957
579 Ga0207711_11256362 3300025941 Unclassified 682
580 Ga0207689_11693903 3300025942 Bacteria 524
581 Ga0207661_10000010 3300025944 Bacteria 375338
582 Ga0207661_10012391 3300025944 Bacteria 6194
583 Ga0207661_10028897 3300025944 Bacteria 4251
584 Ga0207661_10184472 3300025944 Unclassified 1825
585 Ga0207661_10227028 3300025944 Unclassified 1652
586 Ga0207661_10478684 3300025944 Bacteria 1136
587 Ga0207661_12040114 3300025944 Unclassified 519
588 Ga0207679_10010245 3300025945 Bacteria 6029
589 Ga0207679_10264212 3300025945 Unclassified 1469
590 Ga0207679_10355022 3300025945 Unclassified 1279
591 Ga0207679_10510667 3300025945 Unclassified 1074
592 Ga0207667_10012725 3300025949 Bacteria 9665
593 Ga0207667_10130145 3300025949 Bacteria 2592
594 Ga0207667_10158095 3300025949 Bacteria 2332
595 Ga0207667_10416459 3300025949 Bacteria 1367
596 Ga0207712_10031792 3300025961 Unclassified 3558
597 Ga0207712_10326261 3300025961 Unclassified 1268
598 Ga0207712_10399305 3300025961 Bacteria 1155
599 Ga0207712_10722541 3300025961 Unclassified 871
600 Ga0207668_10070147 3300025972 Unclassified 2498
601 Ga0207668_10155136 3300025972 Bacteria 1778
602 Ga0207668_10287646 3300025972 Bacteria 1351
603 Ga0207640_11246048 3300025981 Unclassified 663
604 Ga0207640_11389366 3300025981 Unclassified 629
605 Ga0207640_11595738 3300025981 Unclassified 588
606 Ga0207658_10013205 3300025986 Bacteria 5640
607 Ga0207677_10091894 3300026023 Unclassified 2209
608 Ga0207677_10907064 3300026023 Unclassified 795
609 Ga0207703_10394772 3300026035 Unclassified 1282
610 Ga0207703_10400235 3300026035 Bacteria 1274
611 Ga0207703_11180974 3300026035 Unclassified 736
612 Ga0207703_11422815 3300026035 Unclassified 667
613 Ga0207703_11929476 3300026035 Bacteria 567
614 Ga0207639_10025964 3300026041 Unclassified 4252
615 Ga0207639_10206817 3300026041 Bacteria 1687
616 Ga0207639_10393897 3300026041 Bacteria 1246
617 Ga0207639_10398004 3300026041 Bacteria 1240
618 Ga0207639_10769490 3300026041 Unclassified 896
619 Ga0207639_10865840 3300026041 Unclassified 844
620 Ga0207639_11569980 3300026041 Bacteria 617
621 Ga0207678_10108885 3300026067 Bacteria 2363
622 Ga0207678_10466975 3300026067 Unclassified 1098
623 Ga0207708_10172526 3300026075 Unclassified 1714
624 Ga0207708_10541482 3300026075 Bacteria 981
625 Ga0207708_10867249 3300026075 Unclassified 780
626 Ga0207702_10020562 3300026078 Bacteria 5464
627 Ga0207702_10100039 3300026078 Bacteria 2557
628 Ga0207702_11165730 3300026078 Bacteria 765
629 Ga0207702_12453929 3300026078 Unclassified 508
630 Ga0207641_10039620 3300026088 Bacteria 3942
631 Ga0207641_10049845 3300026088 Unclassified 3540
632 Ga0207641_10294787 3300026088 Bacteria 1530
633 Ga0207641_10597919 3300026088 Bacteria 1080
634 Ga0207648_10582968 3300026089 Bacteria 1030
635 Ga0207648_11142081 3300026089 Bacteria 731
636 Ga0207676_10026037 3300026095 Bacteria 4345
637 Ga0207676_10158346 3300026095 Unclassified 1959
638 Ga0207676_10236302 3300026095 Bacteria 1637
639 Ga0207676_10731947 3300026095 Unclassified 961
640 Ga0207676_11080145 3300026095 Unclassified 793
641 Ga0207676_11178826 3300026095 Unclassified 759
642 Ga0207674_10011373 3300026116 Bacteria 10002
643 Ga0207674_11178701 3300026116 Unclassified 735
644 Ga0207675_100012198 3300026118 Bacteria 8027
645 Ga0207675_100029143 3300026118 Bacteria 5145
646 Ga0207675_100144971 3300026118 Unclassified 2257
647 Ga0207675_100460974 3300026118 Bacteria 1261
648 Ga0207683_10099986 3300026121 Bacteria 2589
649 Ga0207683_10155544 3300026121 Unclassified 2065
650 Ga0207683_10283445 3300026121 Bacteria 1514
651 Ga0207683_10870965 3300026121 Unclassified 836
652 Ga0207683_10966538 3300026121 Unclassified 791
653 Ga0207683_11224872 3300026121 Bacteria 695
654 Ga0207683_11370538 3300026121 Bacteria 654
655 Ga0207698_10213940 3300026142 Bacteria 1736
656 Ga0207698_10643476 3300026142 Unclassified 1049
657 Ga0207698_10714014 3300026142 Bacteria 998
658 Ga0207428_10001006 3300027907 Bacteria 31269
659 Ga0207428_10248757 3300027907 Bacteria 1326
660 Ga0268266_10072808 3300028379 Unclassified 2981
661 Ga0268266_10092909 3300028379 Bacteria 2648
662 Ga0268265_10133788 3300028380 Unclassified 2065
663 Ga0268265_10468815 3300028380 Bacteria 1180
664 Ga0268265_11710056 3300028380 Unclassified 635
665 Ga0268264_10201566 3300028381 Bacteria 1821
666 Ga0268264_10768611 3300028381 Unclassified 961
667 Ga0268264_11676659 3300028381 Unclassified 646
668 Ga0265762_1093827 3300030760 Unclassified 658
669 Ga0265760_10197460 3300031090 Unclassified 678
670 Ga0265332_10009769 3300031238 Bacteria 4282
671 Ga0265325_10026577 3300031241 Unclassified 3134
672 Ga0265331_10099545 3300031250 Unclassified 1339
673 Ga0265316_10220670 3300031344 Bacteria 1399
674 Ga0265314_10037637 3300031711 Unclassified 3504
675 Ga0265342_10105690 3300031712 Unclassified 1598
676 Ga0307414_11803115 3300032004 Unclassified 571
677 Ga0373926_0007028 3300035083 Unclassified 3743
678 Ga0373926_0202018 3300035083 Unclassified 765
679 Ga0373926_0311775 3300035083 Unclassified 615
680 Ga0373934_0375175 3300035086 Bacteria 593
681 Ga0373923_0009317 3300035111 Bacteria 3540
682 Ga0373936_0016123 3300035113 Unclassified 2871
683 Ga0373941_0308209 3300035115 Unclassified 634
684 Ga0373945_0043915 3300035116 Bacteria 1623
685 Ga0373945_0126345 3300035116 Bacteria 1021
686 Ga0373945_0238988 3300035116 Unclassified 764
687 Ga0373954_0293087 3300035118 Unclassified 802
688 Ga0373954_0358536 3300035118 Unclassified 720
689 Ga0373954_0395252 3300035118 Bacteria 684
690 Ga0373943_0003012 3300035170 Bacteria 7650
691 Ga0373943_0031491 3300035170 Unclassified 2517
692 Ga0373943_0044802 3300035170 Bacteria 2154
693 Ga0373943_0214327 3300035170 Bacteria 1070
694 Ga0373946_0003104 3300035171 Bacteria 5887
695 Ga0373946_0025505 3300035171 Unclassified 2325
696 Ga0373946_0035666 3300035171 Bacteria 2014
697 Ga0373955_0073387 3300035172 Unclassified 1918
698 Ga0373955_0517892 3300035172 Unclassified 729
699 Ga0373955_0590059 3300035172 Unclassified 680
700 Ga0373924_0216248 3300035410 Bacteria 846
701 Ga0373935_0011813 3300035692 Bacteria 5247
702 Ga0373935_0057743 3300035692 Unclassified 2476
703 Ga0373935_0179529 3300035692 Bacteria 1453
704 Ga0373935_0774046 3300035692 Bacteria 708
705 Ga0373927_0003854 3300035695 Bacteria 10647
706 Ga0373927_0748048 3300035695 Bacteria 646
707 Ga0373927_0768522 3300035695 Unclassified 636
708 Ga0373927_1175678 3300035695 Unclassified 506
709 Ga0373947_0018436 3300035725 Bacteria 4016
710 Ga0373947_0030921 3300035725 Unclassified 3148
711 Ga0373947_0094595 3300035725 Bacteria 1869
712 Ga0373947_0588915 3300035725 Bacteria 758
713 Ga0373937_1379667 3300036401 Unclassified 652
714 Ga0373937_1838533 3300036401 Unclassified 552
715 Ga0373925_0002700 3300037068 Bacteria 14065
716 Ga0373925_0005483 3300037068 Bacteria 9442
717 Ga0373925_0013538 3300037068 Bacteria 5906
718 Ga0373925_0095111 3300037068 Bacteria 2282
719 Ga0373925_0510655 3300037068 Unclassified 987
720 Ga0373925_0584680 3300037068 Unclassified 919
721 Ga0395898_0426842 3300037466 Bacteria 1263
722 Ga0436364_0610209 3300037853 Bacteria 11100
723 Ga0436364_0723473 3300037853 Unclassified 775
724 Ga0436364_1510264 3300037853 Bacteria 1951
725 Ga0436365_0125216 3300039437 Unclassified 760
726 Ga0436365_0638243 3300039437 Bacteria 13372
727 Ga0436365_0702324 3300039437 Bacteria 1464
728 Ga0436365_0943435 3300039437 Bacteria 804
729 Ga0436363_0790301 3300039450 Unclassified 521
730 Ga0436362_0362587 3300039453 Unclassified 593
731 Ga0436362_0722225 3300039453 Unclassified 770
732 Ga0436362_1283006 3300039453 Bacteria 1590
733 Ga0439453_0021268 3300041408 Bacteria 1169
734 Ga0439453_0092611 3300041408 Unclassified 665
735 Ga0451802_1996443 3300041460 Bacteria 614
736 Ga0439435_0015772 3300042436 Unclassified 1885
737 Ga0439435_0061084 3300042436 Bacteria 1098
738 Ga0439444_0120426 3300042437 Bacteria 612
739 Ga0439464_0032708 3300042439 Bacteria 1462
740 Ga0439464_0070956 3300042439 Bacteria 1031
741 Ga0439460_0139028 3300042461 Bacteria 804
742 Ga0439460_0277344 3300042461 Unclassified 583
743 Ga0450916_091990 3300042530 Unclassified 529
744 Ga0451577_0017419 3300042876 Bacteria 6639
745 Ga0451577_1019402 3300042876 Bacteria 743
746 Ga0439440_0125780 3300042993 Bacteria 717
747 Ga0453683_1078637 3300044673 Unclassified 535
748 Ga0466961_0199808 3300044693 Bacteria 1237
749 Ga0466961_0986456 3300044693 Unclassified 501
750 Ga0466963_0284189 3300044694 Unclassified 1163
751 Ga0466971_0211668 3300044719 Unclassified 917
752 Ga0451576_0215981 3300045051 Bacteria 2002
753 Ga0451576_2663837 3300045051 Bacteria 509
754 Ga0466958_0440668 3300045836 Unclassified 843
755 Ga0466967_0161446 3300045976 Bacteria 2104
756 Ga0495592_0313965 3300046454 Unclassified 1015
757 Ga0495651_0192992 3300046462 Unclassified 1432
758 Ga0495580_0012488 3300046472 Bacteria 6511
759 Ga0495580_0178600 3300046472 Bacteria 1466
760 Ga0495580_0229175 3300046472 Bacteria 1276
761 Ga0495580_0325673 3300046472 Bacteria 1044
762 Ga0495580_0656215 3300046472 Bacteria 690
763 Ga0495580_0754513 3300046472 Unclassified 634
764 Ga0495582_0005784 3300046473 Bacteria 6887
765 Ga0495639_0123086 3300046475 Bacteria 1238
766 Ga0495664_0320398 3300046477 Bacteria 935
767 Ga0495594_0014437 3300046499 Bacteria 4140
768 Ga0495608_0765985 3300046511 Unclassified 571
769 Ga0495628_0129961 3300046516 Unclassified 1927
770 Ga0495630_0020273 3300046517 Bacteria 4901
771 Ga0495630_0629313 3300046517 Unclassified 822
772 Ga0495643_0005221 3300046522 Bacteria 8844
773 Ga0495666_0376483 3300046526 Bacteria 639
774 Ga0495665_0200204 3300046531 Bacteria 1035
775 Ga0495640_0252757 3300046533 Bacteria 1103
776 Ga0495586_0224920 3300046535 Unclassified 1067
777 Ga0495586_0446981 3300046535 Bacteria 745
778 Ga0495587_0064353 3300046536 Unclassified 2143
779 Ga0495587_0438294 3300046536 Unclassified 724
780 Ga0495587_0642001 3300046536 Unclassified 583
781 Ga0495667_0167486 3300046559 Bacteria 1412
782 Ga0495667_0679124 3300046559 Bacteria 639
783 Ga0495667_0883091 3300046559 Unclassified 549
784 Ga0495634_0406922 3300046642 Unclassified 807
785 Ga0495635_0306302 3300046663 Bacteria 1065
786 Ga0495635_0654709 3300046663 Bacteria 683
787 Ga0495659_0524157 3300046664 Unclassified 521
788 Ga0495599_0300308 3300046678 Bacteria 969
789 Ga0495599_0770207 3300046678 Unclassified 551
790 Ga0495623_0377351 3300046679 Unclassified 767
791 Ga0495647_0384112 3300046681 Unclassified 643
792 Ga0495658_0149357 3300046683 Bacteria 1434
793 Ga0495658_0428033 3300046683 Unclassified 844
794 Ga0495624_0294304 3300046690 Bacteria 979
795 Ga0495581_0220685 3300047315 Bacteria 1108
796 Ga0495604_0062019 3300047317 Unclassified 2858
797 Ga0495674_0354884 3300047319 Bacteria 1190
798 Ga0495674_1194235 3300047319 Bacteria 575
799 Ga0495676_0402495 3300047321 Unclassified 908
800 Ga0495675_0281183 3300047444 Bacteria 992
801 Ga0495684_0194558 3300047471 Bacteria 1497
802 Ga0495684_0197155 3300047471 Bacteria 1486
803 Ga0495684_0737969 3300047471 Bacteria 649
804 Ga0495602_0165155 3300048088 Unclassified 1724
805 Ga0495602_0392321 3300048088 Unclassified 992
806 Ga0495602_0527236 3300048088 Bacteria 822
807 Ga0495614_0223622 3300048089 Unclassified 856
808 Ga0496100_0067158 3300048903 Unclassified 2381
809 Ga0496101_0810119 3300048904 Bacteria 738
810 Ga0496103_0300988 3300048906 Unclassified 1032
811 Ga0496104_0024493 3300048907 Bacteria 5552
812 Ga0496104_0296366 3300048907 Unclassified 1530
813 Ga0496104_1205653 3300048907 Unclassified 660
814 Ga0496104_1284075 3300048907 Bacteria 635
815 Ga0496105_0117039 3300048908 Bacteria 2198
816 Ga0496105_0492050 3300048908 Bacteria 964
817 Ga0496106_0110862 3300048909 Bacteria 2136
818 Ga0496106_0618422 3300048909 Bacteria 867
819 Ga0496106_1342968 3300048909 Unclassified 554
820 Ga0496107_0114092 3300048910 Unclassified 1988
821 Ga0496108_0001958 3300048911 Bacteria 16495
822 Ga0496108_0437881 3300048911 Unclassified 1142
823 Ga0496109_0044494 3300048912 Bacteria 4027
824 Ga0496111_0006232 3300048914 Bacteria 7729
825 Ga0496111_0107477 3300048914 Unclassified 2054
826 Ga0496112_0019877 3300048915 Bacteria 6355
827 Ga0496112_0310483 3300048915 Bacteria 1522
828 Ga0496112_0491064 3300048915 Bacteria 1164
829 Ga0496113_0106054 3300048916 Unclassified 2182
830 Ga0496113_0193151 3300048916 Unclassified 1616
831 Ga0496114_0207199 3300048917 Bacteria 1719
832 Ga0496115_0020025 3300048918 Bacteria 5155
833 Ga0496115_0154592 3300048918 Bacteria 1895
834 Ga0496115_0549015 3300048918 Unclassified 924
835 Ga0501290_057026 3300049513 Unclassified 621
836 Ga0501031_0001424 3300049568 Bacteria 14810
837 Ga0501031_0006360 3300049568 Bacteria 7703
838 Ga0501032_0004150 3300049569 Bacteria 10977
839 Ga0501032_0035204 3300049569 Unclassified 3425
840 Ga0501032_0041737 3300049569 Bacteria 3114
841 Ga0501032_0161476 3300049569 Bacteria 1471
842 Ga0501033_0000613 3300049570 Bacteria 33033
843 Ga0501033_0010819 3300049570 Bacteria 6996
844 Ga0501033_0019393 3300049570 Bacteria 5141
845 Ga0501033_0024950 3300049570 Bacteria 4505
846 Ga0501034_0039838 3300049571 Bacteria 4758
847 Ga0501034_0054158 3300049571 Unclassified 4038
848 Ga0501034_0105861 3300049571 Bacteria 2805
849 Ga0501034_0237316 3300049571 Bacteria 1770
850 Ga0501036_0000820 3300049572 Bacteria 23060
851 Ga0501036_0038464 3300049572 Bacteria 4049
852 Ga0501036_0042429 3300049572 Unclassified 3851
853 Ga0501036_0143920 3300049572 Bacteria 2011
854 Ga0501037_0003364 3300049573 Bacteria 11624
855 Ga0501037_0004775 3300049573 Bacteria 9852
856 Ga0501037_0008586 3300049573 Bacteria 7496
857 Ga0501037_0331711 3300049573 Bacteria 1052
858 Ga0501038_0001876 3300049574 Bacteria 19413
859 Ga0501038_0035608 3300049574 Bacteria 4369
860 Ga0501038_0132536 3300049574 Bacteria 2044
861 Ga0501038_0233016 3300049574 Bacteria 1464
862 Ga0501039_1211309 3300049575 Unclassified 584
863 Ga0501040_0483030 3300049576 Unclassified 893
864 Ga0501041_0066292 3300049577 Bacteria 2212
865 Ga0501042_0021800 3300049578 Bacteria 4469
866 Ga0501043_0002642 3300049579 Bacteria 15067
867 Ga0501043_0008095 3300049579 Bacteria 8294
868 Ga0501043_0010081 3300049579 Bacteria 7409
869 Ga0501043_0010169 3300049579 Bacteria 7375
870 Ga0501046_0015105 3300049580 Bacteria 6492
871 Ga0501046_0056805 3300049580 Bacteria 3070
872 Ga0501046_0065339 3300049580 Unclassified 2838
873 Ga0501047_0019870 3300049581 Bacteria 6448
874 Ga0501047_0040581 3300049581 Bacteria 4500
875 Ga0501047_0053635 3300049581 Bacteria 3899
876 Ga0501047_0322025 3300049581 Unclassified 1385
877 Ga0501048_0050907 3300049582 Bacteria 2949
878 Ga0501048_0060886 3300049582 Bacteria 2674
879 Ga0501048_0368305 3300049582 Bacteria 1025
880 Ga0501067_0000638 3300049583 Bacteria 18831
881 Ga0501067_0024116 3300049583 Bacteria 3373
882 Ga0501068_0001033 3300049584 Bacteria 14713
883 Ga0501068_0005356 3300049584 Bacteria 7012
884 Ga0501068_0009482 3300049584 Bacteria 5450
885 Ga0501069_0012380 3300049585 Bacteria 4534
886 Ga0501069_0016210 3300049585 Bacteria 3998
887 Ga0501069_0086510 3300049585 Unclassified 1769
888 Ga0501070_0003990 3300049586 Bacteria 12687
889 Ga0501070_0011406 3300049586 Bacteria 7511
890 Ga0501070_0013460 3300049586 Bacteria 6895
891 Ga0501070_0136681 3300049586 Bacteria 2023
892 Ga0501071_0082233 3300049587 Bacteria 2358
893 Ga0501071_0173908 3300049587 Bacteria 1613
894 Ga0501071_1574114 3300049587 Unclassified 507
895 Ga0501072_0389358 3300049588 Unclassified 1106
896 Ga0501072_1161108 3300049588 Bacteria 600
897 Ga0501073_0001003 3300049589 Bacteria 20354
898 Ga0501073_0016244 3300049589 Bacteria 5395
899 Ga0501073_0044287 3300049589 Bacteria 3136
900 Ga0501073_0243672 3300049589 Bacteria 1241
901 Ga0501074_0003949 3300049590 Bacteria 10564
902 Ga0501074_0007234 3300049590 Bacteria 8018
903 Ga0501075_0273382 3300049591 Bacteria 1287
904 Ga0501075_0609373 3300049591 Bacteria 833
905 Ga0501076_0000623 3300049592 Bacteria 22644
906 Ga0501076_0035267 3300049592 Bacteria 3915
907 Ga0501217_270203 3300049661 Unclassified 554
908 Ga0501230_102518 3300049667 Unclassified 618
909 Ga0501243_124551 3300049675 Unclassified 535
910 Ga0501249_008075 3300049679 Bacteria 2184
911 Ga0501221_007321 3300049704 Bacteria 1891
912 Ga0501234_036912 3300049707 Bacteria 795
913 Ga0501079_0002604 3300049741 Bacteria 13117
914 Ga0501079_0018156 3300049741 Bacteria 5372
915 Ga0501079_0023004 3300049741 Bacteria 4786
916 Ga0501079_0126922 3300049741 Unclassified 1984
917 Ga0501080_0014127 3300049742 Bacteria 7348
918 Ga0501080_0015677 3300049742 Bacteria 6987
919 Ga0501080_0073946 3300049742 Bacteria 3170
920 Ga0501080_0264975 3300049742 Bacteria 1564
921 Ga0501080_0576533 3300049742 Bacteria 1000
922 Ga0501081_0007300 3300049743 Bacteria 7176
923 Ga0501083_0041932 3300049744 Bacteria 3103
924 Ga0501083_0283044 3300049744 Unclassified 1078
925 Ga0501265_049265 3300049762 Unclassified 659
926 Ga0501268_015624 3300049765 Bacteria 1250
927 Ga0501270_019776 3300049767 Bacteria 1012
928 Ga0501035_0022213 3300049822 Bacteria 5828
929 Ga0501035_0023213 3300049822 Bacteria 5690
930 Ga0501035_0047013 3300049822 Bacteria 3877
931 Ga0501035_0159342 3300049822 Unclassified 1954
932 Ga0501044_0018629 3300049823 Bacteria 7435
933 Ga0501044_0086278 3300049823 Bacteria 3170
934 Ga0501044_0086397 3300049823 Unclassified 3168
935 Ga0501044_0305192 3300049823 Unclassified 1519
936 Ga0501044_0944580 3300049823 Bacteria 735
937 Ga0501045_0041337 3300049824 Bacteria 3355
938 Ga0501045_0563734 3300049824 Bacteria 844
939 Ga0501045_1163247 3300049824 Unclassified 563
940 nmdc:mga05p37_112411_c1 3300050507 Bacteria 3349
941 nmdc:mga05p37_1552876_c1 3300050507 Bacteria 655
942 nmdc:mga05p37_243147_c1 3300050507 Unclassified 2163
943 nmdc:mga05p37_287208_c1 3300050507 Unclassified 1959
944 nmdc:mga05p37_294097_c1 3300050507 Bacteria 1932
945 nmdc:mga05p37_328625_c1 3300050507 Bacteria 1807
946 nmdc:mga05p37_463609_c1 3300050507 Unclassified 1463
947 nmdc:mga05p37_611370_c1 3300050507 Bacteria 1228
948 nmdc:mga05p37_690180_c1 3300050507 Unclassified 1136
949 nmdc:mga05p37_779008_c1 3300050507 Bacteria 1050
950 nmdc:mga05p37_94860_c1 3300050507 Bacteria 3676
951 nmdc:mga09592_1223_c1 3300050508 Bacteria 20578
952 nmdc:mga09592_18963_c1 3300050508 Bacteria 5645
953 nmdc:mga09592_219372_c1 3300050508 Bacteria 1648
954 nmdc:mga09592_289129_c1 3300050508 Bacteria 1421
955 nmdc:mga09592_385820_c1 3300050508 Bacteria 1211
956 nmdc:mga09592_408647_c1 3300050508 Unclassified 1173
957 nmdc:mga09592_889224_c1 3300050508 Bacteria 749
958 nmdc:mga0qj67_101801_c1 3300050509 Bacteria 2316
959 nmdc:mga0qj67_1088088_c1 3300050509 Bacteria 625
960 nmdc:mga0qj67_513931_c1 3300050509 Bacteria 962
961 nmdc:mga0qj67_52233_c1 3300050509 Bacteria 3234
962 nmdc:mga0qj67_73680_c1 3300050509 Bacteria 2727
963 nmdc:mga0qj67_76574_c1 3300050509 Unclassified 2676
964 nmdc:mga06r32_116400_c1 3300050510 Bacteria 2633
965 nmdc:mga06r32_123463_c1 3300050510 Bacteria 2556
966 nmdc:mga06r32_1240330_c1 3300050510 Unclassified 691
967 nmdc:mga06r32_188535_c1 3300050510 Bacteria 2049
968 nmdc:mga06r32_200840_c1 3300050510 Unclassified 1982
969 nmdc:mga06r32_21774_c1 3300050510 Bacteria 5917
970 nmdc:mga06r32_23037_c1 3300050510 Bacteria 5760
971 nmdc:mga06r32_380091_c1 3300050510 Bacteria 1395
972 nmdc:mga06r32_548106_c1 3300050510 Bacteria 1131
973 nmdc:mga06r32_646060_c1 3300050510 Unclassified 1026
974 nmdc:mga06r32_68404_c1 3300050510 Bacteria 3431
975 nmdc:mga08y16_340126_c1 3300050511 Bacteria 1543
976 nmdc:mga08y16_374030_c1 3300050511 Bacteria 1461
977 nmdc:mga08y16_4391_c1 3300050511 Bacteria 14743
978 nmdc:mga08y16_716440_c1 3300050511 Unclassified 999
979 nmdc:mga0n895_1451010_c1 3300050512 Unclassified 654
980 nmdc:mga0n895_21637_c1 3300050512 Bacteria 6018
981 nmdc:mga0n895_245362_c1 3300050512 Bacteria 1818
982 nmdc:mga0n895_255170_c1 3300050512 Unclassified 1779
983 nmdc:mga0n895_3216_c1 3300050512 Bacteria 13078
984 nmdc:mga0n895_398756_c1 3300050512 Bacteria 1391
985 nmdc:mga0n895_846680_c1 3300050512 Bacteria 903
986 nmdc:mga0n895_963_c1 3300050512 Bacteria 20861
987 nmdc:mga0rr50_104743_c1 3300050513 Bacteria 2229
988 nmdc:mga0rr50_1095239_c1 3300050513 Unclassified 678
989 nmdc:mga0rr50_192501_c1 3300050513 Bacteria 1672
990 nmdc:mga0rr50_203_c1 3300050513 Bacteria 32093
991 nmdc:mga0rr50_28685_c1 3300050513 Bacteria 3916
992 nmdc:mga0rr50_44121_c1 3300050513 Bacteria 3268
993 nmdc:mga08x19_115673_c1 3300050514 Bacteria 1793
994 nmdc:mga08x19_19068_c1 3300050514 Bacteria 4207
995 nmdc:mga08x19_329_c1 3300050514 Bacteria 34297
996 nmdc:mga08x19_5733_c1 3300050514 Bacteria 7342
997 nmdc:mga08x19_69367_c1 3300050514 Bacteria 2296
998 nmdc:mga08x19_8576_c1 3300050514 Bacteria 6091
999 nmdc:mga0a205_1029577_c1 3300050515 Bacteria 670
1000 nmdc:mga0a205_12285_c2 3300050515 Bacteria 2491
1001 nmdc:mga0a205_14411_c1 3300050515 Bacteria 7375
1002 nmdc:mga0a205_58173_c1 3300050515 Bacteria 3733
1003 nmdc:mga0a205_78048_c1 3300050515 Bacteria 3199
1004 Ga0500646_0022798 3300053090 Unclassified 1676
1005 Ga0501084_0009701 3300054114 Bacteria 7962
1006 Ga0501084_0021475 3300054114 Bacteria 5381
1007 Ga0501084_0663205 3300054114 Unclassified 880
1008 Ga0501084_0745348 3300054114 Bacteria 825
1009 Ga0501084_0991592 3300054114 Bacteria 706
1010 Ga0501082_0000433 3300060353 Bacteria 37136
1011 Ga0501082_0008898 3300060353 Bacteria 8660
1012 Ga0501082_0017814 3300060353 Bacteria 6119
1013 Ga0501082_0084903 3300060353 Bacteria 2730
1014 Ga0501082_0285419 3300060353 Bacteria 1437
1015 Ga0495604_0158686
1016 MRS1b_contig_859378
1017 MBSR1b_contig_7011003
1018 JGI24746J21847_1061961
1019 rootL2_10290371
1020 Ga0065714_10093497
1021 Ga0065712_10068524
1022 Ga0065712_10155246
1023 Ga0065715_10000764
1024 Ga0065715_10010704
1025 Ga0065715_10102144
1026 Ga0065715_10263235
1027 Ga0065715_10579907
1028 Ga0065707_10611075
1029 Ga0070683_100000007
1030 Ga0070683_100006724
1031 Ga0070683_100057841
1032 Ga0070683_100085965
1033 Ga0070683_100263642
1034 Ga0070683_100293257
1035 Ga0070683_100452810
1036 Ga0070683_101641109
1037 Ga0070690_100994722
1038 Ga0070670_100003509
1039 Ga0070670_100016481
1040 Ga0070670_100067873
1041 Ga0070670_100692847
1042 Ga0070670_101032422
1043 Ga0068869_101501883
1044 Ga0070666_10104359
1045 Ga0070666_10690658
1046 Ga0070666_10744481
1047 Ga0070680_100314085
1048 Ga0070680_100339272
1049 Ga0070682_100495725
1050 Ga0068868_100043863
1051 Ga0068868_101119161
1052 Ga0070660_100022349
1053 Ga0070689_100038889
1054 Ga0070689_101462113
1055 Ga0070661_100025307
1056 Ga0070661_100340881
1057 Ga0070661_100506628
1058 Ga0070661_100550282
1059 Ga0070668_101260834
1060 Ga0070669_100048316
1061 Ga0070669_101357673
1062 Ga0070675_100049409
1063 Ga0070671_100223299
1064 Ga0070671_101342205
1065 Ga0070674_100132709
1066 Ga0070674_100423297
1067 Ga0070674_100727370
1068 Ga0070674_100891270
1069 Ga0070673_100047885
1070 Ga0070688_100254387
1071 Ga0070688_100349915
1072 Ga0070688_101582768
1073 Ga0070659_100596368
1074 Ga0070667_100020834
1075 Ga0070709_10665594
1076 Ga0070714_100006091
1077 Ga0070714_100253396
1078 Ga0070714_100874366
1079 Ga0070713_100060888
1080 Ga0070713_100291892
1081 Ga0070710_10757645
1082 Ga0070710_10940918
1083 Ga0070701_10707919
1084 Ga0070711_100003224
1085 Ga0070711_100343944
1086 Ga0070711_100461961
1087 Ga0070711_100744828
1088 Ga0070711_100782188
1089 Ga0070705_100715912
1090 Ga0070705_100944396
1091 Ga0070700_100348358
1092 Ga0070700_100356234
1093 Ga0070700_100814277
1094 Ga0070700_101341330
1095 Ga0070694_100859644
1096 Ga0070694_101880571
1097 Ga0070708_101710392
1098 Ga0070708_101894024
1099 Ga0070663_100193262
1100 Ga0070663_101649687
1101 Ga0070678_100169839
1102 Ga0070678_100351726
1103 Ga0070678_100519667
1104 Ga0070678_101959659
1105 Ga0070662_100031737
1106 Ga0070662_100147763
1107 Ga0070662_100201550
1108 Ga0070662_100834910
1109 Ga0070662_100863009
1110 Ga0070681_10021785
1111 Ga0070681_10062901
1112 Ga0070681_10325745
1113 Ga0070681_11197847
1114 Ga0070685_10009435
1115 Ga0070685_10775041
1116 Ga0070685_11054178
1117 Ga0070706_100027769
1118 Ga0070706_100143285
1119 Ga0070706_100410628
1120 Ga0070706_100856636
1121 Ga0070707_100007173
1122 Ga0070707_100014596
1123 Ga0070707_100251616
1124 Ga0070707_101377295
1125 Ga0070698_100010349
1126 Ga0070698_100402081
1127 Ga0070698_100794794
1128 Ga0070698_100951962
1129 Ga0070699_100156279
1130 Ga0070699_100210167
1131 Ga0070699_101037458
1132 Ga0070699_102085164
1133 Ga0070679_100092789
1134 Ga0070679_100389512
1135 Ga0070679_100417362
1136 Ga0070684_100000054
1137 Ga0070684_100136825
1138 Ga0070684_100388699
1139 Ga0070684_100455953
1140 Ga0070684_100592991
1141 Ga0070684_100665544
1142 Ga0070684_100716497
1143 Ga0070697_100009880
1144 Ga0070697_100028395
1145 Ga0070697_100357229
1146 Ga0070697_100370898
1147 Ga0068853_100023327
1148 Ga0068853_100114516
1149 Ga0068853_100206206
1150 Ga0070672_100245143
1151 Ga0070672_101075883
1152 Ga0070672_101401315
1153 Ga0070686_100012274
1154 Ga0070686_100880303
1155 Ga0070696_100531235
1156 Ga0070693_100767359
1157 Ga0070693_101114091
1158 Ga0070665_100008511
1159 Ga0070665_100094352
1160 Ga0070665_100438693
1161 Ga0070665_100921690
1162 Ga0070665_101048599
1163 Ga0070704_100242669
1164 Ga0070704_100778257
1165 Ga0070704_101193586
1166 Ga0070704_101266580
1167 Ga0070704_101990699
1168 Ga0068855_100073361
1169 Ga0068855_100198801
1170 Ga0068855_100359009
1171 Ga0070664_100000429
1172 Ga0070664_100069193
1173 Ga0070664_100104376
1174 Ga0070664_100109619
1175 Ga0070664_101658014
1176 Ga0070664_101682841
1177 Ga0070664_102185810
1178 Ga0068857_100277991
1179 Ga0068857_101733891
1180 Ga0068854_101176085
1181 Ga0068856_100010994
1182 Ga0068856_100129963
1183 Ga0068856_100242484
1184 Ga0068856_100270945
1185 Ga0068856_100917688
1186 Ga0070702_101012174
1187 Ga0068852_100005439
1188 Ga0068852_100064608
1189 Ga0068852_100597041
1190 Ga0068852_100608984
1191 Ga0068852_102087248
1192 Ga0068859_100130119
1193 Ga0068859_100904244
1194 Ga0068859_100921090
1195 Ga0068859_100954886
1196 Ga0068859_101901834
1197 Ga0068859_101998400
1198 Ga0068864_100028205
1199 Ga0068864_100237934
1200 Ga0068864_101155019
1201 Ga0068864_101337500
1202 Ga0068866_10377416
1203 Ga0068866_10466148
1204 Ga0068866_10614773
1205 Ga0068861_100038986
1206 Ga0068861_100119391
1207 Ga0068861_101613322
1208 Ga0068851_10244281
1209 Ga0068870_10913108
1210 Ga0068863_100061832
1211 Ga0068863_100128062
1212 Ga0068863_100246980
1213 Ga0068863_100307574
1214 Ga0068863_100947194
1215 Ga0068858_100073050
1216 Ga0068858_100177003
1217 Ga0068858_100215999
1218 Ga0068858_100497062
1219 Ga0068858_100736135
1220 Ga0068858_101557522
1221 Ga0068858_101623579
1222 Ga0068860_100099512
1223 Ga0068860_100204041
1224 Ga0068862_100006466
1225 Ga0068862_101430546
1226 Ga0081455_10098481
1227 Ga0081540_1057212
1228 Ga0070717_10111222
1229 Ga0075432_10054280
1230 Ga0070715_10419075
1231 Ga0070715_10487328
1232 Ga0070716_100135127
1233 Ga0070716_100341716
1234 Ga0070716_100879235
1235 Ga0070712_100137726
1236 Ga0070712_100361168
1237 Ga0070712_100423952
1238 Ga0070712_100736079
1239 Ga0070712_100888122
1240 Ga0075427_10047844
1241 Ga0097621_100176822
1242 Ga0097621_100297807
1243 Ga0068871_100064651
1244 Ga0068871_100136514
1245 Ga0068871_100204734
1246 Ga0068871_100321774
1247 Ga0068871_101381673
1248 Ga0068871_101583694
1249 Ga0075428_100006969
1250 Ga0075428_100011058
1251 Ga0075428_100066811
1252 Ga0075428_100080785
1253 Ga0075428_100113991
1254 Ga0075428_101036352
1255 Ga0075428_101340096
1256 Ga0075430_100020197
1257 Ga0075430_100040478
1258 Ga0075430_100055472
1259 Ga0075430_100405334
1260 Ga0075430_100897739
1261 Ga0075431_100016283
1262 Ga0075431_100047196
1263 Ga0075431_100142497
1264 Ga0075431_100148788
1265 Ga0075431_100186537
1266 Ga0075431_100220189
1267 Ga0075431_101049218
1268 Ga0075431_101288169
1269 Ga0075433_10049848
1270 Ga0075433_10052858
1271 Ga0075433_10353727
1272 Ga0075433_10579015
1273 Ga0075433_11097116
1274 Ga0075433_11207419
1275 Ga0075433_11668255
1276 Ga0075433_11904649
1277 Ga0075434_100002206
1278 Ga0075434_100006938
1279 Ga0075434_100017597
1280 Ga0075434_100116157
1281 Ga0075434_100226063
1282 Ga0075434_100227931
1283 Ga0075434_100428246
1284 Ga0075434_100993264
1285 Ga0075434_101184433
1286 Ga0075429_100000755
1287 Ga0075429_100238244
1288 Ga0075429_100321390
1289 Ga0075429_100722214
1290 Ga0075429_101119836
1291 Ga0068865_100417556
1292 Ga0068865_100447892
1293 Ga0068865_100870328
1294 Ga0075436_100002140
1295 Ga0075436_100005842
1296 Ga0075436_100008477
1297 Ga0075436_100012163
1298 Ga0075436_100025764
1299 Ga0075436_100074663
1300 Ga0075436_100076220
1301 Ga0075436_101377117
1302 Ga0097620_100130124
1303 Ga0097620_100904254
1304 Ga0097620_100920981
1305 Ga0097620_100954867
1306 Ga0097620_101901806
1307 Ga0097620_101998792
1308 Ga0075435_100000818
1309 Ga0075435_100029136
1310 Ga0075435_100153700
1311 Ga0075435_100193164
1312 Ga0075435_100498910
1313 Ga0099794_10589745
1314 Ga0099795_10044068
1315 Ga0105240_10023146
1316 Ga0105240_10024118
1317 Ga0105240_10167204
1318 Ga0105240_10337558
1319 Ga0105240_10390858
1320 Ga0105240_10570475
1321 Ga0105240_10694611
1322 Ga0105240_11499492
1323 Ga0105240_11811546
1324 Ga0111539_10041453
1325 Ga0111539_10094245
1326 Ga0111539_10199880
1327 Ga0111539_10411544
1328 Ga0105245_10076950
1329 Ga0105245_10160703
1330 Ga0105245_10178116
1331 Ga0105245_10217542
1332 Ga0105245_11159008
1333 Ga0105245_12331805
1334 Ga0105245_12708008
1335 Ga0105245_12871018
1336 Ga0105247_10258550
1337 Ga0105247_10626215
1338 Ga0114129_10027137
1339 Ga0114129_10103464
1340 Ga0114129_10112953
1341 Ga0114129_10125339
1342 Ga0114129_10494631
1343 Ga0114129_10498130
1344 Ga0114129_10668681
1345 Ga0114129_10692176
1346 Ga0114129_10737408
1347 Ga0114129_10776111
1348 Ga0114129_11040261
1349 Ga0114129_11172062
1350 Ga0114129_12385171
1351 Ga0105243_10434156
1352 Ga0105243_11593046
1353 Ga0105241_10269721
1354 Ga0105241_10292895
1355 Ga0105241_10321449
1356 Ga0105241_10344608
1357 Ga0105241_11207800
1358 Ga0105241_11276604
1359 Ga0105242_10032979
1360 Ga0105242_10363364
1361 Ga0105242_10998914
1362 Ga0105242_11183154
1363 Ga0105242_12588244
1364 Ga0105248_10008930
1365 Ga0105248_10023512
1366 Ga0105248_10026910
1367 Ga0105248_10028027
1368 Ga0105248_10108561
1369 Ga0105248_10157658
1370 Ga0105248_10311351
1371 Ga0105248_10363950
1372 Ga0105248_10435918
1373 Ga0105248_11093256
1374 Ga0105248_13443543
1375 Ga0105237_10006068
1376 Ga0105237_10642128
1377 Ga0105237_12396420
1378 Ga0105238_10119937
1379 Ga0105238_10160188
1380 Ga0105238_10689625
1381 Ga0105238_11034181
1382 Ga0105238_11434234
1383 Ga0105238_11881687
1384 Ga0105238_12516255
1385 Ga0105249_10030842
1386 Ga0105249_10150091
1387 Ga0105249_10171360
1388 Ga0105249_10943496
1389 Ga0105249_13307597
1390 Ga0099796_10167549
1391 Ga0105239_10002868
1392 Ga0105239_10034331
1393 Ga0105239_10068903
1394 Ga0105239_10087446
1395 Ga0105239_10208975
1396 Ga0105239_10564483
1397 Ga0105239_10729011
1398 Ga0105239_11010919
1399 Ga0105239_11713235
1400 Ga0105239_12697274
1401 Ga0105246_10134818
1402 Ga0105246_11055761
1403 Ga0105246_11214746
1404 Ga0157373_10752718
1405 Ga0157373_11392305
1406 Ga0157371_10017063
1407 Ga0157371_10150294
1408 Ga0157370_10147985
1409 Ga0157370_10300527
1410 Ga0157370_10331947
1411 Ga0157370_10492740
1412 Ga0157370_10674049
1413 Ga0157369_10003263
1414 Ga0157369_10008271
1415 Ga0157369_10104798
1416 Ga0157369_10110505
1417 Ga0157369_10587580
1418 Ga0157369_10642222
1419 Ga0157374_10029367
1420 Ga0157374_10064449
1421 Ga0157374_10070096
1422 Ga0157374_10116110
1423 Ga0157374_10487174
1424 Ga0157374_11030440
1425 Ga0157374_11458237
1426 Ga0157374_11473907
1427 Ga0157378_10030859
1428 Ga0157378_10401954
1429 Ga0157378_10633784
1430 Ga0157378_11603301
1431 Ga0157378_12845562
1432 Ga0157378_13230333
1433 Ga0163162_10087793
1434 Ga0163162_10230897
1435 Ga0163162_11273280
1436 Ga0163162_12384734
1437 Ga0157372_10005353
1438 Ga0157372_10058201
1439 Ga0157372_10240476
1440 Ga0157372_10487074
1441 Ga0157372_10503268
1442 Ga0157372_10632388
1443 Ga0157375_10142181
1444 Ga0157375_10436595
1445 Ga0157375_10460530
1446 Ga0157375_12026705
1447 Ga0157375_12700265
1448 Ga0163163_10004648
1449 Ga0163163_10009250
1450 Ga0163163_10058764
1451 Ga0163163_10112229
1452 Ga0163163_10168736
1453 Ga0163163_10171136
1454 Ga0163163_10328780
1455 Ga0163163_10589023
1456 Ga0163163_10836591
1457 Ga0157380_10037297
1458 Ga0157380_10617657
1459 Ga0157380_11474812
1460 Ga0157380_12453515
1461 Ga0157379_10002406
1462 Ga0157379_10071438
1463 Ga0157379_10612218
1464 Ga0157376_10052985
1465 Ga0157376_10134207
1466 Ga0157376_11068689
1467 Ga0157376_11411770
1468 Ga0163161_10814537
1469 Ga0163161_11196058
1470 Ga0163161_11443026
1471 Ga0213876_10015860
1472 Ga0213876_10147482
1473 Ga0213875_10012717
1474 Ga0213875_10095566
1475 Ga0207697_10198365
1476 Ga0207697_10214383
1477 Ga0207692_10162571
1478 Ga0207642_10270533
1479 Ga0207642_10286090
1480 Ga0207710_10408713
1481 Ga0207688_10070886
1482 Ga0207680_10191820
1483 Ga0207680_10371992
1484 Ga0207680_10764389
1485 Ga0207647_10244577
1486 Ga0207699_10077514
1487 Ga0207699_10158020
1488 Ga0207699_10182138
1489 Ga0207699_10781293
1490 Ga0207645_10060604
1491 Ga0207645_10280313
1492 Ga0207705_10656434
1493 Ga0207684_10013488
1494 Ga0207684_10120833
1495 Ga0207684_10371371
1496 Ga0207654_10427248
1497 Ga0207654_10437115
1498 Ga0207654_11070495
1499 Ga0207654_11271248
1500 Ga0207707_10001181
1501 Ga0207707_10024626
1502 Ga0207707_10048678
1503 Ga0207707_11435172
1504 Ga0207707_11445500
1505 Ga0207695_10189608
1506 Ga0207695_10725961
1507 Ga0207695_10741101
1508 Ga0207695_11565023
1509 Ga0207671_10019297
1510 Ga0207671_10199060
1511 Ga0207671_11130037
1512 Ga0207693_10021001
1513 Ga0207693_10278693
1514 Ga0207693_10404578
1515 Ga0207663_10003342
1516 Ga0207663_10217587
1517 Ga0207663_10636971
1518 Ga0207663_10680851
1519 Ga0207663_11098784
1520 Ga0207660_10477433
1521 Ga0207660_10519667
1522 Ga0207662_11374064
1523 Ga0207657_10021795
1524 Ga0207657_10119922
1525 Ga0207649_10054600
1526 Ga0207649_11285295
1527 Ga0207652_10032917
1528 Ga0207652_10118922
1529 Ga0207652_10879950
1530 Ga0207646_10003444
1531 Ga0207646_10060644
1532 Ga0207646_10307857
1533 Ga0207646_10703524
1534 Ga0207646_11249092
1535 Ga0207694_10001610
1536 Ga0207694_10080599
1537 Ga0207694_10103409
1538 Ga0207694_11486593
1539 Ga0207650_10023277
1540 Ga0207650_10027993
1541 Ga0207659_10214675
1542 Ga0207659_10240316
1543 Ga0207659_10599154
1544 Ga0207659_10772720
1545 Ga0207687_10234748
1546 Ga0207687_10599487
1547 Ga0207687_11454843
1548 Ga0207700_10004781
1549 Ga0207700_10010761
1550 Ga0207700_10043541
1551 Ga0207700_10406603
1552 Ga0207700_10941408
1553 Ga0207700_11696680
1554 Ga0207664_10018371
1555 Ga0207664_10153069
1556 Ga0207664_10412305
1557 Ga0207664_11656346
1558 Ga0207644_10161713
1559 Ga0207690_10749246
1560 Ga0207706_10181762
1561 Ga0207706_10198275
1562 Ga0207706_10271530
1563 Ga0207686_10046439
1564 Ga0207686_10361601
1565 Ga0207686_10621545
1566 Ga0207709_10273146
1567 Ga0207670_11224636
1568 Ga0207669_10040467
1569 Ga0207669_10353121
1570 Ga0207669_10522728
1571 Ga0207704_10372271
1572 Ga0207704_11315397
1573 Ga0207704_11881185
1574 Ga0207665_10069172
1575 Ga0207665_10475706
1576 Ga0207665_10574221
1577 Ga0207665_10632679
1578 Ga0207665_10876525
1579 Ga0207665_11255119
1580 Ga0207691_10047571
1581 Ga0207691_10723356
1582 Ga0207711_10018002
1583 Ga0207711_10027298
1584 Ga0207711_10048463
1585 Ga0207711_10082109
1586 Ga0207711_10172931
1587 Ga0207711_10213137
1588 Ga0207711_10258724
1589 Ga0207711_10286441
1590 Ga0207711_10322802
1591 Ga0207711_10492133
1592 Ga0207711_10683166
1593 Ga0207711_11256362
1594 Ga0207689_11693903
1595 Ga0207661_10000010
1596 Ga0207661_10012391
1597 Ga0207661_10028897
1598 Ga0207661_10184472
1599 Ga0207661_10227028
1600 Ga0207661_10478684
1601 Ga0207661_12040114
1602 Ga0207679_10010245
1603 Ga0207679_10264212
1604 Ga0207679_10355022
1605 Ga0207679_10510667
1606 Ga0207667_10012725
1607 Ga0207667_10130145
1608 Ga0207667_10158095
1609 Ga0207667_10416459
1610 Ga0207712_10031792
1611 Ga0207712_10326261
1612 Ga0207712_10399305
1613 Ga0207712_10722541
1614 Ga0207668_10070147
1615 Ga0207668_10155136
1616 Ga0207668_10287646
1617 Ga0207640_11246048
1618 Ga0207640_11389366
1619 Ga0207640_11595738
1620 Ga0207658_10013205
1621 Ga0207677_10091894
1622 Ga0207677_10907064
1623 Ga0207703_10394772
1624 Ga0207703_10400235
1625 Ga0207703_11180974
1626 Ga0207703_11422815
1627 Ga0207703_11929476
1628 Ga0207639_10025964
1629 Ga0207639_10206817
1630 Ga0207639_10393897
1631 Ga0207639_10398004
1632 Ga0207639_10769490
1633 Ga0207639_10865840
1634 Ga0207639_11569980
1635 Ga0207678_10108885
1636 Ga0207678_10466975
1637 Ga0207708_10172526
1638 Ga0207708_10541482
1639 Ga0207708_10867249
1640 Ga0207702_10020562
1641 Ga0207702_10100039
1642 Ga0207702_11165730
1643 Ga0207702_12453929
1644 Ga0207641_10039620
1645 Ga0207641_10049845
1646 Ga0207641_10294787
1647 Ga0207641_10597919
1648 Ga0207648_10582968
1649 Ga0207648_11142081
1650 Ga0207676_10026037
1651 Ga0207676_10158346
1652 Ga0207676_10236302
1653 Ga0207676_10731947
1654 Ga0207676_11080145
1655 Ga0207676_11178826
1656 Ga0207674_10011373
1657 Ga0207674_11178701
1658 Ga0207675_100012198
1659 Ga0207675_100029143
1660 Ga0207675_100144971
1661 Ga0207675_100460974
1662 Ga0207683_10099986
1663 Ga0207683_10155544
1664 Ga0207683_10283445
1665 Ga0207683_10870965
1666 Ga0207683_10966538
1667 Ga0207683_11224872
1668 Ga0207683_11370538
1669 Ga0207698_10213940
1670 Ga0207698_10643476
1671 Ga0207698_10714014
1672 Ga0207428_10001006
1673 Ga0207428_10248757
1674 Ga0268266_10072808
1675 Ga0268266_10092909
1676 Ga0268265_10133788
1677 Ga0268265_10468815
1678 Ga0268265_11710056
1679 Ga0268264_10201566
1680 Ga0268264_10768611
1681 Ga0268264_11676659
1682 Ga0265762_1093827
1683 Ga0265760_10197460
1684 Ga0265332_10009769
1685 Ga0265325_10026577
1686 Ga0265331_10099545
1687 Ga0265316_10220670
1688 Ga0265314_10037637
1689 Ga0265342_10105690
1690 Ga0307414_11803115
1691 Ga0373926_0007028
1692 Ga0373926_0202018
1693 Ga0373926_0311775
1694 Ga0373934_0375175
1695 Ga0373923_0009317
1696 Ga0373936_0016123
1697 Ga0373941_0308209
1698 Ga0373945_0043915
1699 Ga0373945_0126345
1700 Ga0373945_0238988
1701 Ga0373954_0293087
1702 Ga0373954_0358536
1703 Ga0373954_0395252
1704 Ga0373943_0003012
1705 Ga0373943_0031491
1706 Ga0373943_0044802
1707 Ga0373943_0214327
1708 Ga0373946_0003104
1709 Ga0373946_0025505
1710 Ga0373946_0035666
1711 Ga0373955_0073387
1712 Ga0373955_0517892
1713 Ga0373955_0590059
1714 Ga0373924_0216248
1715 Ga0373935_0011813
1716 Ga0373935_0057743
1717 Ga0373935_0179529
1718 Ga0373935_0774046
1719 Ga0373927_0003854
1720 Ga0373927_0748048
1721 Ga0373927_0768522
1722 Ga0373927_1175678
1723 Ga0373947_0018436
1724 Ga0373947_0030921
1725 Ga0373947_0094595
1726 Ga0373947_0588915
1727 Ga0373937_1379667
1728 Ga0373937_1838533
1729 Ga0373925_0002700
1730 Ga0373925_0005483
1731 Ga0373925_0013538
1732 Ga0373925_0095111
1733 Ga0373925_0510655
1734 Ga0373925_0584680
1735 Ga0395898_0426842
1736 Ga0436364_0610209
1737 Ga0436364_0723473
1738 Ga0436364_1510264
1739 Ga0436365_0125216
1740 Ga0436365_0638243
1741 Ga0436365_0702324
1742 Ga0436365_0943435
1743 Ga0436363_0790301
1744 Ga0436362_0362587
1745 Ga0436362_0722225
1746 Ga0436362_1283006
1747 Ga0439453_0021268
1748 Ga0439453_0092611
1749 Ga0451802_1996443
1750 Ga0439435_0015772
1751 Ga0439435_0061084
1752 Ga0439444_0120426
1753 Ga0439464_0032708
1754 Ga0439464_0070956
1755 Ga0439460_0139028
1756 Ga0439460_0277344
1757 Ga0450916_091990
1758 Ga0451577_0017419
1759 Ga0451577_1019402
1760 Ga0439440_0125780
1761 Ga0453683_1078637
1762 Ga0466961_0199808
1763 Ga0466961_0986456
1764 Ga0466963_0284189
1765 Ga0466971_0211668
1766 Ga0451576_0215981
1767 Ga0451576_2663837
1768 Ga0466958_0440668
1769 Ga0466967_0161446
1770 Ga0495592_0313965
1771 Ga0495651_0192992
1772 Ga0495580_0012488
1773 Ga0495580_0178600
1774 Ga0495580_0229175
1775 Ga0495580_0325673
1776 Ga0495580_0656215
1777 Ga0495580_0754513
1778 Ga0495582_0005784
1779 Ga0495639_0123086
1780 Ga0495664_0320398
1781 Ga0495594_0014437
1782 Ga0495608_0765985
1783 Ga0495628_0129961
1784 Ga0495630_0020273
1785 Ga0495630_0629313
1786 Ga0495643_0005221
1787 Ga0495666_0376483
1788 Ga0495665_0200204
1789 Ga0495640_0252757
1790 Ga0495586_0224920
1791 Ga0495586_0446981
1792 Ga0495587_0064353
1793 Ga0495587_0438294
1794 Ga0495587_0642001
1795 Ga0495667_0167486
1796 Ga0495667_0679124
1797 Ga0495667_0883091
1798 Ga0495634_0406922
1799 Ga0495635_0306302
1800 Ga0495635_0654709
1801 Ga0495659_0524157
1802 Ga0495599_0300308
1803 Ga0495599_0770207
1804 Ga0495623_0377351
1805 Ga0495647_0384112
1806 Ga0495658_0149357
1807 Ga0495658_0428033
1808 Ga0495624_0294304
1809 Ga0495581_0220685
1810 Ga0495604_0062019
1811 Ga0495674_0354884
1812 Ga0495674_1194235
1813 Ga0495676_0402495
1814 Ga0495675_0281183
1815 Ga0495684_0194558
1816 Ga0495684_0197155
1817 Ga0495684_0737969
1818 Ga0495602_0165155
1819 Ga0495602_0392321
1820 Ga0495602_0527236
1821 Ga0495614_0223622
1822 Ga0496100_0067158
1823 Ga0496101_0810119
1824 Ga0496103_0300988
1825 Ga0496104_0024493
1826 Ga0496104_0296366
1827 Ga0496104_1205653
1828 Ga0496104_1284075
1829 Ga0496105_0117039
1830 Ga0496105_0492050
1831 Ga0496106_0110862
1832 Ga0496106_0618422
1833 Ga0496106_1342968
1834 Ga0496107_0114092
1835 Ga0496108_0001958
1836 Ga0496108_0437881
1837 Ga0496109_0044494
1838 Ga0496111_0006232
1839 Ga0496111_0107477
1840 Ga0496112_0019877
1841 Ga0496112_0310483
1842 Ga0496112_0491064
1843 Ga0496113_0106054
1844 Ga0496113_0193151
1845 Ga0496114_0207199
1846 Ga0496115_0020025
1847 Ga0496115_0154592
1848 Ga0496115_0549015
1849 Ga0501290_057026
1850 Ga0501031_0001424
1851 Ga0501031_0006360
1852 Ga0501032_0004150
1853 Ga0501032_0035204
1854 Ga0501032_0041737
1855 Ga0501032_0161476
1856 Ga0501033_0000613
1857 Ga0501033_0010819
1858 Ga0501033_0019393
1859 Ga0501033_0024950
1860 Ga0501034_0039838
1861 Ga0501034_0054158
1862 Ga0501034_0105861
1863 Ga0501034_0237316
1864 Ga0501036_0000820
1865 Ga0501036_0038464
1866 Ga0501036_0042429
1867 Ga0501036_0143920
1868 Ga0501037_0003364
1869 Ga0501037_0004775
1870 Ga0501037_0008586
1871 Ga0501037_0331711
1872 Ga0501038_0001876
1873 Ga0501038_0035608
1874 Ga0501038_0132536
1875 Ga0501038_0233016
1876 Ga0501039_1211309
1877 Ga0501040_0483030
1878 Ga0501041_0066292
1879 Ga0501042_0021800
1880 Ga0501043_0002642
1881 Ga0501043_0008095
1882 Ga0501043_0010081
1883 Ga0501043_0010169
1884 Ga0501046_0015105
1885 Ga0501046_0056805
1886 Ga0501046_0065339
1887 Ga0501047_0019870
1888 Ga0501047_0040581
1889 Ga0501047_0053635
1890 Ga0501047_0322025
1891 Ga0501048_0050907
1892 Ga0501048_0060886
1893 Ga0501048_0368305
1894 Ga0501067_0000638
1895 Ga0501067_0024116
1896 Ga0501068_0001033
1897 Ga0501068_0005356
1898 Ga0501068_0009482
1899 Ga0501069_0012380
1900 Ga0501069_0016210
1901 Ga0501069_0086510
1902 Ga0501070_0003990
1903 Ga0501070_0011406
1904 Ga0501070_0013460
1905 Ga0501070_0136681
1906 Ga0501071_0082233
1907 Ga0501071_0173908
1908 Ga0501071_1574114
1909 Ga0501072_0389358
1910 Ga0501072_1161108
1911 Ga0501073_0001003
1912 Ga0501073_0016244
1913 Ga0501073_0044287
1914 Ga0501073_0243672
1915 Ga0501074_0003949
1916 Ga0501074_0007234
1917 Ga0501075_0273382
1918 Ga0501075_0609373
1919 Ga0501076_0000623
1920 Ga0501076_0035267
1921 Ga0501217_270203
1922 Ga0501230_102518
1923 Ga0501243_124551
1924 Ga0501249_008075
1925 Ga0501221_007321
1926 Ga0501234_036912
1927 Ga0501079_0002604
1928 Ga0501079_0018156
1929 Ga0501079_0023004
1930 Ga0501079_0126922
1931 Ga0501080_0014127
1932 Ga0501080_0015677
1933 Ga0501080_0073946
1934 Ga0501080_0264975
1935 Ga0501080_0576533
1936 Ga0501081_0007300
1937 Ga0501083_0041932
1938 Ga0501083_0283044
1939 Ga0501265_049265
1940 Ga0501268_015624
1941 Ga0501270_019776
1942 Ga0501035_0022213
1943 Ga0501035_0023213
1944 Ga0501035_0047013
1945 Ga0501035_0159342
1946 Ga0501044_0018629
1947 Ga0501044_0086278
1948 Ga0501044_0086397
1949 Ga0501044_0305192
1950 Ga0501044_0944580
1951 Ga0501045_0041337
1952 Ga0501045_0563734
1953 Ga0501045_1163247
1954 nmdc:mga05p37_112411_c1
1955 nmdc:mga05p37_1552876_c1
1956 nmdc:mga05p37_243147_c1
1957 nmdc:mga05p37_287208_c1
1958 nmdc:mga05p37_294097_c1
1959 nmdc:mga05p37_328625_c1
1960 nmdc:mga05p37_463609_c1
1961 nmdc:mga05p37_611370_c1
1962 nmdc:mga05p37_690180_c1
1963 nmdc:mga05p37_779008_c1
1964 nmdc:mga05p37_94860_c1
1965 nmdc:mga09592_1223_c1
1966 nmdc:mga09592_18963_c1
1967 nmdc:mga09592_219372_c1
1968 nmdc:mga09592_289129_c1
1969 nmdc:mga09592_385820_c1
1970 nmdc:mga09592_408647_c1
1971 nmdc:mga09592_889224_c1
1972 nmdc:mga0qj67_101801_c1
1973 nmdc:mga0qj67_1088088_c1
1974 nmdc:mga0qj67_513931_c1
1975 nmdc:mga0qj67_52233_c1
1976 nmdc:mga0qj67_73680_c1
1977 nmdc:mga0qj67_76574_c1
1978 nmdc:mga06r32_116400_c1
1979 nmdc:mga06r32_123463_c1
1980 nmdc:mga06r32_1240330_c1
1981 nmdc:mga06r32_188535_c1
1982 nmdc:mga06r32_200840_c1
1983 nmdc:mga06r32_21774_c1
1984 nmdc:mga06r32_23037_c1
1985 nmdc:mga06r32_380091_c1
1986 nmdc:mga06r32_548106_c1
1987 nmdc:mga06r32_646060_c1
1988 nmdc:mga06r32_68404_c1
1989 nmdc:mga08y16_340126_c1
1990 nmdc:mga08y16_374030_c1
1991 nmdc:mga08y16_4391_c1
1992 nmdc:mga08y16_716440_c1
1993 nmdc:mga0n895_1451010_c1
1994 nmdc:mga0n895_21637_c1
1995 nmdc:mga0n895_245362_c1
1996 nmdc:mga0n895_255170_c1
1997 nmdc:mga0n895_3216_c1
1998 nmdc:mga0n895_398756_c1
1999 nmdc:mga0n895_846680_c1
2000 nmdc:mga0n895_963_c1
2001 nmdc:mga0rr50_104743_c1
2002 nmdc:mga0rr50_1095239_c1
2003 nmdc:mga0rr50_192501_c1
2004 nmdc:mga0rr50_203_c1
2005 nmdc:mga0rr50_28685_c1
2006 nmdc:mga0rr50_44121_c1
2007 nmdc:mga08x19_115673_c1
2008 nmdc:mga08x19_19068_c1
2009 nmdc:mga08x19_329_c1
2010 nmdc:mga08x19_5733_c1
2011 nmdc:mga08x19_69367_c1
2012 nmdc:mga08x19_8576_c1
2013 nmdc:mga0a205_1029577_c1
2014 nmdc:mga0a205_12285_c2
2015 nmdc:mga0a205_14411_c1
2016 nmdc:mga0a205_58173_c1
2017 nmdc:mga0a205_78048_c1
2018 Ga0500646_0022798
2019 Ga0501084_0009701
2020 Ga0501084_0021475
2021 Ga0501084_0663205
2022 Ga0501084_0745348
2023 Ga0501084_0991592
2024 Ga0501082_0000433
2025 Ga0501082_0008898
2026 Ga0501082_0017814
2027 Ga0501082_0084903
2028 Ga0501082_0285419

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

20

94

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9553 11 106
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.927 9 106
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9245 6 108
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9237 9 108
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9149 10 104
ID Description Score Start End Superfamily
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9085 13 82 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9056 10 104 1.10.10.10
5dymA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9027 11 107 1.10.10.10
4esbA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9017 9 107 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9009 6 106 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2N9MU15-F1-model_v4 Transcriptional regulator, PadR family 0.9826 16 108
AF-A0A2V8J1R4-F1-model_v4 PadR family transcriptional regulator 0.9821 10 108
AF-A0A416EI77-F1-model_v4 PadR family transcriptional regulator 0.9793 10 108
AF-A0A2E8EBH7-F1-model_v4 PadR family transcriptional regulator 0.9788 10 107
AF-A0A844J8G6-F1-model_v4 deleted 0.9781 10 108

Map