F488225
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1014 | 339 | 2028 | 116 |
Family's Representative Sequence
| Representative Sequence | 3300047317|Ga0495604_0158686|Ga0495604_0158686_14_385 |
| Length | 123 |
| Sequence | MSRHPLARVELLQGTLDLLILRTLLSGPTHGYAIAKHIQRTSEELLQVETGSLYPALHRLEAKGWIAATWELSDKGKRARYYRLTALGRRHLASEQSKWETFARAMGLVLKPVDLKPLDQEGQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 97 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 128 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 198 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 203 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 204 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 207 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 216 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 217 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 220 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 221 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 222 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 223 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 224 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 225 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 226 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 227 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 228 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 229 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 230 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 231 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 232 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 233 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 234 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 235 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 236 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 237 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 238 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 239 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 240 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 275 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 276 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 277 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 278 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 279 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 282 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 283 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 284 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 285 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 286 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 287 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 313 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 314 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 315 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 316 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 317 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 318 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 323 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 324 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 325 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 338 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.8 |
| Metatranscriptomes | 0.2 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.1 |
| Nodule | 0 |
| Rhizoplane | 2.76 |
| Rhizosphere | 95.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 38.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495604_0158686 | 3300047317 | Bacteria | 1600 |
| 2 | MRS1b_contig_859378 | 2162886011 | Unclassified | 980 |
| 3 | MBSR1b_contig_7011003 | 2162886012 | Bacteria | 2745 |
| 4 | JGI24746J21847_1061961 | 3300001977 | Unclassified | 536 |
| 5 | rootL2_10290371 | 3300003322 | Bacteria | 2041 |
| 6 | Ga0065714_10093497 | 3300005288 | Unclassified | 1845 |
| 7 | Ga0065712_10068524 | 3300005290 | Bacteria | 10090 |
| 8 | Ga0065712_10155246 | 3300005290 | Bacteria | 1339 |
| 9 | Ga0065715_10000764 | 3300005293 | Bacteria | 8500 |
| 10 | Ga0065715_10010704 | 3300005293 | Bacteria | 2411 |
| 11 | Ga0065715_10102144 | 3300005293 | Unclassified | 3140 |
| 12 | Ga0065715_10263235 | 3300005293 | Bacteria | 1132 |
| 13 | Ga0065715_10579907 | 3300005293 | Bacteria | 715 |
| 14 | Ga0065707_10611075 | 3300005295 | Bacteria | 684 |
| 15 | Ga0070683_100000007 | 3300005329 | Bacteria | 342155 |
| 16 | Ga0070683_100006724 | 3300005329 | Bacteria | 9658 |
| 17 | Ga0070683_100057841 | 3300005329 | Unclassified | 3602 |
| 18 | Ga0070683_100085965 | 3300005329 | Bacteria | 2949 |
| 19 | Ga0070683_100263642 | 3300005329 | Unclassified | 1639 |
| 20 | Ga0070683_100293257 | 3300005329 | Unclassified | 1547 |
| 21 | Ga0070683_100452810 | 3300005329 | Bacteria | 1224 |
| 22 | Ga0070683_101641109 | 3300005329 | Unclassified | 618 |
| 23 | Ga0070690_100994722 | 3300005330 | Unclassified | 660 |
| 24 | Ga0070670_100003509 | 3300005331 | Bacteria | 13034 |
| 25 | Ga0070670_100016481 | 3300005331 | Bacteria | 6345 |
| 26 | Ga0070670_100067873 | 3300005331 | Unclassified | 3060 |
| 27 | Ga0070670_100692847 | 3300005331 | Bacteria | 916 |
| 28 | Ga0070670_101032422 | 3300005331 | Unclassified | 748 |
| 29 | Ga0068869_101501883 | 3300005334 | Unclassified | 598 |
| 30 | Ga0070666_10104359 | 3300005335 | Unclassified | 1956 |
| 31 | Ga0070666_10690658 | 3300005335 | Unclassified | 748 |
| 32 | Ga0070666_10744481 | 3300005335 | Unclassified | 720 |
| 33 | Ga0070680_100314085 | 3300005336 | Bacteria | 1330 |
| 34 | Ga0070680_100339272 | 3300005336 | Unclassified | 1277 |
| 35 | Ga0070682_100495725 | 3300005337 | Unclassified | 945 |
| 36 | Ga0068868_100043863 | 3300005338 | Unclassified | 3494 |
| 37 | Ga0068868_101119161 | 3300005338 | Unclassified | 725 |
| 38 | Ga0070660_100022349 | 3300005339 | Unclassified | 4676 |
| 39 | Ga0070689_100038889 | 3300005340 | Unclassified | 3640 |
| 40 | Ga0070689_101462113 | 3300005340 | Bacteria | 618 |
| 41 | Ga0070661_100025307 | 3300005344 | Bacteria | 4264 |
| 42 | Ga0070661_100340881 | 3300005344 | Bacteria | 1174 |
| 43 | Ga0070661_100506628 | 3300005344 | Bacteria | 967 |
| 44 | Ga0070661_100550282 | 3300005344 | Unclassified | 928 |
| 45 | Ga0070668_101260834 | 3300005347 | Unclassified | 671 |
| 46 | Ga0070669_100048316 | 3300005353 | Bacteria | 3106 |
| 47 | Ga0070669_101357673 | 3300005353 | Bacteria | 616 |
| 48 | Ga0070675_100049409 | 3300005354 | Bacteria | 3452 |
| 49 | Ga0070671_100223299 | 3300005355 | Unclassified | 1598 |
| 50 | Ga0070671_101342205 | 3300005355 | Bacteria | 631 |
| 51 | Ga0070674_100132709 | 3300005356 | Bacteria | 1859 |
| 52 | Ga0070674_100423297 | 3300005356 | Bacteria | 1093 |
| 53 | Ga0070674_100727370 | 3300005356 | Bacteria | 851 |
| 54 | Ga0070674_100891270 | 3300005356 | Bacteria | 774 |
| 55 | Ga0070673_100047885 | 3300005364 | Bacteria | 3329 |
| 56 | Ga0070688_100254387 | 3300005365 | Unclassified | 1252 |
| 57 | Ga0070688_100349915 | 3300005365 | Unclassified | 1081 |
| 58 | Ga0070688_101582768 | 3300005365 | Unclassified | 535 |
| 59 | Ga0070659_100596368 | 3300005366 | Unclassified | 949 |
| 60 | Ga0070667_100020834 | 3300005367 | Bacteria | 5445 |
| 61 | Ga0070709_10665594 | 3300005434 | Bacteria | 807 |
| 62 | Ga0070714_100006091 | 3300005435 | Bacteria | 9264 |
| 63 | Ga0070714_100253396 | 3300005435 | Bacteria | 1628 |
| 64 | Ga0070714_100874366 | 3300005435 | Bacteria | 872 |
| 65 | Ga0070713_100060888 | 3300005436 | Unclassified | 3157 |
| 66 | Ga0070713_100291892 | 3300005436 | Bacteria | 1499 |
| 67 | Ga0070710_10757645 | 3300005437 | Bacteria | 690 |
| 68 | Ga0070710_10940918 | 3300005437 | Bacteria | 626 |
| 69 | Ga0070701_10707919 | 3300005438 | Bacteria | 678 |
| 70 | Ga0070711_100003224 | 3300005439 | Bacteria | 9474 |
| 71 | Ga0070711_100343944 | 3300005439 | Bacteria | 1197 |
| 72 | Ga0070711_100461961 | 3300005439 | Unclassified | 1041 |
| 73 | Ga0070711_100744828 | 3300005439 | Unclassified | 828 |
| 74 | Ga0070711_100782188 | 3300005439 | Unclassified | 808 |
| 75 | Ga0070705_100715912 | 3300005440 | Unclassified | 788 |
| 76 | Ga0070705_100944396 | 3300005440 | Bacteria | 696 |
| 77 | Ga0070700_100348358 | 3300005441 | Bacteria | 1097 |
| 78 | Ga0070700_100356234 | 3300005441 | Unclassified | 1086 |
| 79 | Ga0070700_100814277 | 3300005441 | Unclassified | 753 |
| 80 | Ga0070700_101341330 | 3300005441 | Bacteria | 602 |
| 81 | Ga0070694_100859644 | 3300005444 | Unclassified | 747 |
| 82 | Ga0070694_101880571 | 3300005444 | Unclassified | 511 |
| 83 | Ga0070708_101710392 | 3300005445 | Unclassified | 585 |
| 84 | Ga0070708_101894024 | 3300005445 | Unclassified | 553 |
| 85 | Ga0070663_100193262 | 3300005455 | Bacteria | 1585 |
| 86 | Ga0070663_101649687 | 3300005455 | Unclassified | 572 |
| 87 | Ga0070678_100169839 | 3300005456 | Bacteria | 1775 |
| 88 | Ga0070678_100351726 | 3300005456 | Unclassified | 1267 |
| 89 | Ga0070678_100519667 | 3300005456 | Unclassified | 1053 |
| 90 | Ga0070678_101959659 | 3300005456 | Unclassified | 554 |
| 91 | Ga0070662_100031737 | 3300005457 | Bacteria | 3710 |
| 92 | Ga0070662_100147763 | 3300005457 | Unclassified | 1827 |
| 93 | Ga0070662_100201550 | 3300005457 | Bacteria | 1579 |
| 94 | Ga0070662_100834910 | 3300005457 | Unclassified | 784 |
| 95 | Ga0070662_100863009 | 3300005457 | Bacteria | 771 |
| 96 | Ga0070681_10021785 | 3300005458 | Bacteria | 6426 |
| 97 | Ga0070681_10062901 | 3300005458 | Unclassified | 3684 |
| 98 | Ga0070681_10325745 | 3300005458 | Bacteria | 1446 |
| 99 | Ga0070681_11197847 | 3300005458 | Unclassified | 681 |
| 100 | Ga0070685_10009435 | 3300005466 | Bacteria | 5042 |
| 101 | Ga0070685_10775041 | 3300005466 | Unclassified | 705 |
| 102 | Ga0070685_11054178 | 3300005466 | Unclassified | 612 |
| 103 | Ga0070706_100027769 | 3300005467 | Bacteria | 5205 |
| 104 | Ga0070706_100143285 | 3300005467 | Bacteria | 2231 |
| 105 | Ga0070706_100410628 | 3300005467 | Bacteria | 1260 |
| 106 | Ga0070706_100856636 | 3300005467 | Unclassified | 840 |
| 107 | Ga0070707_100007173 | 3300005468 | Bacteria | 10336 |
| 108 | Ga0070707_100014596 | 3300005468 | Bacteria | 7366 |
| 109 | Ga0070707_100251616 | 3300005468 | Bacteria | 1719 |
| 110 | Ga0070707_101377295 | 3300005468 | Unclassified | 672 |
| 111 | Ga0070698_100010349 | 3300005471 | Bacteria | 9960 |
| 112 | Ga0070698_100402081 | 3300005471 | Bacteria | 1303 |
| 113 | Ga0070698_100794794 | 3300005471 | Bacteria | 890 |
| 114 | Ga0070698_100951962 | 3300005471 | Bacteria | 805 |
| 115 | Ga0070699_100156279 | 3300005518 | Bacteria | 2018 |
| 116 | Ga0070699_100210167 | 3300005518 | Unclassified | 1732 |
| 117 | Ga0070699_101037458 | 3300005518 | Unclassified | 752 |
| 118 | Ga0070699_102085164 | 3300005518 | Bacteria | 518 |
| 119 | Ga0070679_100092789 | 3300005530 | Bacteria | 3006 |
| 120 | Ga0070679_100389512 | 3300005530 | Bacteria | 1340 |
| 121 | Ga0070679_100417362 | 3300005530 | Bacteria | 1287 |
| 122 | Ga0070684_100000054 | 3300005535 | Bacteria | 76916 |
| 123 | Ga0070684_100136825 | 3300005535 | Unclassified | 2213 |
| 124 | Ga0070684_100388699 | 3300005535 | Bacteria | 1286 |
| 125 | Ga0070684_100455953 | 3300005535 | Unclassified | 1182 |
| 126 | Ga0070684_100592991 | 3300005535 | Viruses | 1030 |
| 127 | Ga0070684_100665544 | 3300005535 | Bacteria | 970 |
| 128 | Ga0070684_100716497 | 3300005535 | Unclassified | 933 |
| 129 | Ga0070697_100009880 | 3300005536 | Bacteria | 7441 |
| 130 | Ga0070697_100028395 | 3300005536 | Unclassified | 4480 |
| 131 | Ga0070697_100357229 | 3300005536 | Bacteria | 1263 |
| 132 | Ga0070697_100370898 | 3300005536 | Bacteria | 1238 |
| 133 | Ga0068853_100023327 | 3300005539 | Bacteria | 5178 |
| 134 | Ga0068853_100114516 | 3300005539 | Bacteria | 2399 |
| 135 | Ga0068853_100206206 | 3300005539 | Unclassified | 1790 |
| 136 | Ga0070672_100245143 | 3300005543 | Unclassified | 1508 |
| 137 | Ga0070672_101075883 | 3300005543 | Bacteria | 714 |
| 138 | Ga0070672_101401315 | 3300005543 | Bacteria | 625 |
| 139 | Ga0070686_100012274 | 3300005544 | Bacteria | 4874 |
| 140 | Ga0070686_100880303 | 3300005544 | Unclassified | 727 |
| 141 | Ga0070696_100531235 | 3300005546 | Unclassified | 940 |
| 142 | Ga0070693_100767359 | 3300005547 | Unclassified | 712 |
| 143 | Ga0070693_101114091 | 3300005547 | Unclassified | 602 |
| 144 | Ga0070665_100008511 | 3300005548 | Bacteria | 10376 |
| 145 | Ga0070665_100094352 | 3300005548 | Unclassified | 2997 |
| 146 | Ga0070665_100438693 | 3300005548 | Unclassified | 1315 |
| 147 | Ga0070665_100921690 | 3300005548 | Bacteria | 886 |
| 148 | Ga0070665_101048599 | 3300005548 | Unclassified | 827 |
| 149 | Ga0070704_100242669 | 3300005549 | Bacteria | 1475 |
| 150 | Ga0070704_100778257 | 3300005549 | Unclassified | 854 |
| 151 | Ga0070704_101193586 | 3300005549 | Unclassified | 694 |
| 152 | Ga0070704_101266580 | 3300005549 | Unclassified | 674 |
| 153 | Ga0070704_101990699 | 3300005549 | Unclassified | 539 |
| 154 | Ga0068855_100073361 | 3300005563 | Bacteria | 3976 |
| 155 | Ga0068855_100198801 | 3300005563 | Bacteria | 2258 |
| 156 | Ga0068855_100359009 | 3300005563 | Bacteria | 1604 |
| 157 | Ga0070664_100000429 | 3300005564 | Bacteria | 31437 |
| 158 | Ga0070664_100069193 | 3300005564 | Bacteria | 3020 |
| 159 | Ga0070664_100104376 | 3300005564 | Unclassified | 2468 |
| 160 | Ga0070664_100109619 | 3300005564 | Bacteria | 2408 |
| 161 | Ga0070664_101658014 | 3300005564 | Bacteria | 606 |
| 162 | Ga0070664_101682841 | 3300005564 | Bacteria | 601 |
| 163 | Ga0070664_102185810 | 3300005564 | Bacteria | 525 |
| 164 | Ga0068857_100277991 | 3300005577 | Bacteria | 1539 |
| 165 | Ga0068857_101733891 | 3300005577 | Unclassified | 611 |
| 166 | Ga0068854_101176085 | 3300005578 | Unclassified | 686 |
| 167 | Ga0068856_100010994 | 3300005614 | Bacteria | 8789 |
| 168 | Ga0068856_100129963 | 3300005614 | Plasmid | 2523 |
| 169 | Ga0068856_100242484 | 3300005614 | Bacteria | 1818 |
| 170 | Ga0068856_100270945 | 3300005614 | Bacteria | 1714 |
| 171 | Ga0068856_100917688 | 3300005614 | Unclassified | 894 |
| 172 | Ga0070702_101012174 | 3300005615 | Bacteria | 658 |
| 173 | Ga0068852_100005439 | 3300005616 | Bacteria | 9105 |
| 174 | Ga0068852_100064608 | 3300005616 | Bacteria | 3191 |
| 175 | Ga0068852_100597041 | 3300005616 | Unclassified | 1108 |
| 176 | Ga0068852_100608984 | 3300005616 | Unclassified | 1097 |
| 177 | Ga0068852_102087248 | 3300005616 | Unclassified | 589 |
| 178 | Ga0068859_100130119 | 3300005617 | Bacteria | 2588 |
| 179 | Ga0068859_100904244 | 3300005617 | Bacteria | 967 |
| 180 | Ga0068859_100921090 | 3300005617 | Unclassified | 958 |
| 181 | Ga0068859_100954886 | 3300005617 | Unclassified | 940 |
| 182 | Ga0068859_101901834 | 3300005617 | Unclassified | 657 |
| 183 | Ga0068859_101998400 | 3300005617 | Unclassified | 640 |
| 184 | Ga0068864_100028205 | 3300005618 | Bacteria | 4743 |
| 185 | Ga0068864_100237934 | 3300005618 | Unclassified | 1686 |
| 186 | Ga0068864_101155019 | 3300005618 | Unclassified | 772 |
| 187 | Ga0068864_101337500 | 3300005618 | Unclassified | 717 |
| 188 | Ga0068866_10377416 | 3300005718 | Unclassified | 908 |
| 189 | Ga0068866_10466148 | 3300005718 | Unclassified | 829 |
| 190 | Ga0068866_10614773 | 3300005718 | Bacteria | 735 |
| 191 | Ga0068861_100038986 | 3300005719 | Bacteria | 3544 |
| 192 | Ga0068861_100119391 | 3300005719 | Bacteria | 2125 |
| 193 | Ga0068861_101613322 | 3300005719 | Unclassified | 639 |
| 194 | Ga0068851_10244281 | 3300005834 | Unclassified | 1016 |
| 195 | Ga0068870_10913108 | 3300005840 | Unclassified | 621 |
| 196 | Ga0068863_100061832 | 3300005841 | Unclassified | 3541 |
| 197 | Ga0068863_100128062 | 3300005841 | Bacteria | 2423 |
| 198 | Ga0068863_100246980 | 3300005841 | Bacteria | 1723 |
| 199 | Ga0068863_100307574 | 3300005841 | Unclassified | 1538 |
| 200 | Ga0068863_100947194 | 3300005841 | Unclassified | 862 |
| 201 | Ga0068858_100073050 | 3300005842 | Unclassified | 3184 |
| 202 | Ga0068858_100177003 | 3300005842 | Archaea | 2013 |
| 203 | Ga0068858_100215999 | 3300005842 | Bacteria | 1815 |
| 204 | Ga0068858_100497062 | 3300005842 | Bacteria | 1178 |
| 205 | Ga0068858_100736135 | 3300005842 | Unclassified | 960 |
| 206 | Ga0068858_101557522 | 3300005842 | Unclassified | 652 |
| 207 | Ga0068858_101623579 | 3300005842 | Bacteria | 638 |
| 208 | Ga0068860_100099512 | 3300005843 | Bacteria | 2773 |
| 209 | Ga0068860_100204041 | 3300005843 | Bacteria | 1917 |
| 210 | Ga0068862_100006466 | 3300005844 | Bacteria | 9732 |
| 211 | Ga0068862_101430546 | 3300005844 | Bacteria | 695 |
| 212 | Ga0081455_10098481 | 3300005937 | Bacteria | 2353 |
| 213 | Ga0081540_1057212 | 3300005983 | Bacteria | 1887 |
| 214 | Ga0070717_10111222 | 3300006028 | Bacteria | 2337 |
| 215 | Ga0075432_10054280 | 3300006058 | Unclassified | 1419 |
| 216 | Ga0070715_10419075 | 3300006163 | Unclassified | 749 |
| 217 | Ga0070715_10487328 | 3300006163 | Unclassified | 703 |
| 218 | Ga0070716_100135127 | 3300006173 | Unclassified | 1565 |
| 219 | Ga0070716_100341716 | 3300006173 | Bacteria | 1056 |
| 220 | Ga0070716_100879235 | 3300006173 | Unclassified | 700 |
| 221 | Ga0070712_100137726 | 3300006175 | Bacteria | 1858 |
| 222 | Ga0070712_100361168 | 3300006175 | Unclassified | 1191 |
| 223 | Ga0070712_100423952 | 3300006175 | Unclassified | 1103 |
| 224 | Ga0070712_100736079 | 3300006175 | Unclassified | 843 |
| 225 | Ga0070712_100888122 | 3300006175 | Unclassified | 768 |
| 226 | Ga0075427_10047844 | 3300006194 | Bacteria | 732 |
| 227 | Ga0097621_100176822 | 3300006237 | Bacteria | 1843 |
| 228 | Ga0097621_100297807 | 3300006237 | Bacteria | 1424 |
| 229 | Ga0068871_100064651 | 3300006358 | Bacteria | 2995 |
| 230 | Ga0068871_100136514 | 3300006358 | Unclassified | 2083 |
| 231 | Ga0068871_100204734 | 3300006358 | Bacteria | 1705 |
| 232 | Ga0068871_100321774 | 3300006358 | Bacteria | 1362 |
| 233 | Ga0068871_101381673 | 3300006358 | Unclassified | 664 |
| 234 | Ga0068871_101583694 | 3300006358 | Bacteria | 620 |
| 235 | Ga0075428_100006969 | 3300006844 | Bacteria | 12539 |
| 236 | Ga0075428_100011058 | 3300006844 | Bacteria | 10039 |
| 237 | Ga0075428_100066811 | 3300006844 | Bacteria | 3937 |
| 238 | Ga0075428_100080785 | 3300006844 | Bacteria | 3548 |
| 239 | Ga0075428_100113991 | 3300006844 | Unclassified | 2945 |
| 240 | Ga0075428_101036352 | 3300006844 | Bacteria | 868 |
| 241 | Ga0075428_101340096 | 3300006844 | Bacteria | 752 |
| 242 | Ga0075430_100020197 | 3300006846 | Bacteria | 5668 |
| 243 | Ga0075430_100040478 | 3300006846 | Bacteria | 3945 |
| 244 | Ga0075430_100055472 | 3300006846 | Bacteria | 3332 |
| 245 | Ga0075430_100405334 | 3300006846 | Bacteria | 1125 |
| 246 | Ga0075430_100897739 | 3300006846 | Unclassified | 730 |
| 247 | Ga0075431_100016283 | 3300006847 | Bacteria | 7543 |
| 248 | Ga0075431_100047196 | 3300006847 | Bacteria | 4440 |
| 249 | Ga0075431_100142497 | 3300006847 | Bacteria | 2471 |
| 250 | Ga0075431_100148788 | 3300006847 | Bacteria | 2412 |
| 251 | Ga0075431_100186537 | 3300006847 | Unclassified | 2127 |
| 252 | Ga0075431_100220189 | 3300006847 | Bacteria | 1936 |
| 253 | Ga0075431_101049218 | 3300006847 | Bacteria | 781 |
| 254 | Ga0075431_101288169 | 3300006847 | Unclassified | 692 |
| 255 | Ga0075433_10049848 | 3300006852 | Bacteria | 3643 |
| 256 | Ga0075433_10052858 | 3300006852 | Bacteria | 3540 |
| 257 | Ga0075433_10353727 | 3300006852 | Unclassified | 1298 |
| 258 | Ga0075433_10579015 | 3300006852 | Bacteria | 986 |
| 259 | Ga0075433_11097116 | 3300006852 | Bacteria | 692 |
| 260 | Ga0075433_11207419 | 3300006852 | Unclassified | 656 |
| 261 | Ga0075433_11668255 | 3300006852 | Unclassified | 549 |
| 262 | Ga0075433_11904649 | 3300006852 | Bacteria | 510 |
| 263 | Ga0075434_100002206 | 3300006871 | Bacteria | 16975 |
| 264 | Ga0075434_100006938 | 3300006871 | Bacteria | 10440 |
| 265 | Ga0075434_100017597 | 3300006871 | Bacteria | 6890 |
| 266 | Ga0075434_100116157 | 3300006871 | Bacteria | 2689 |
| 267 | Ga0075434_100226063 | 3300006871 | Unclassified | 1891 |
| 268 | Ga0075434_100227931 | 3300006871 | Unclassified | 1883 |
| 269 | Ga0075434_100428246 | 3300006871 | Bacteria | 1344 |
| 270 | Ga0075434_100993264 | 3300006871 | Bacteria | 853 |
| 271 | Ga0075434_101184433 | 3300006871 | Bacteria | 776 |
| 272 | Ga0075429_100000755 | 3300006880 | Bacteria | 25405 |
| 273 | Ga0075429_100238244 | 3300006880 | Bacteria | 1594 |
| 274 | Ga0075429_100321390 | 3300006880 | Unclassified | 1355 |
| 275 | Ga0075429_100722214 | 3300006880 | Unclassified | 873 |
| 276 | Ga0075429_101119836 | 3300006880 | Bacteria | 687 |
| 277 | Ga0068865_100417556 | 3300006881 | Bacteria | 1102 |
| 278 | Ga0068865_100447892 | 3300006881 | Bacteria | 1067 |
| 279 | Ga0068865_100870328 | 3300006881 | Bacteria | 782 |
| 280 | Ga0075436_100002140 | 3300006914 | Bacteria | 13606 |
| 281 | Ga0075436_100005842 | 3300006914 | Bacteria | 8452 |
| 282 | Ga0075436_100008477 | 3300006914 | Bacteria | 7028 |
| 283 | Ga0075436_100012163 | 3300006914 | Bacteria | 5896 |
| 284 | Ga0075436_100025764 | 3300006914 | Bacteria | 4047 |
| 285 | Ga0075436_100074663 | 3300006914 | Bacteria | 2347 |
| 286 | Ga0075436_100076220 | 3300006914 | Unclassified | 2322 |
| 287 | Ga0075436_101377117 | 3300006914 | Unclassified | 534 |
| 288 | Ga0097620_100130124 | 3300006931 | Bacteria | 2588 |
| 289 | Ga0097620_100904254 | 3300006931 | Bacteria | 967 |
| 290 | Ga0097620_100920981 | 3300006931 | Unclassified | 958 |
| 291 | Ga0097620_100954867 | 3300006931 | Unclassified | 940 |
| 292 | Ga0097620_101901806 | 3300006931 | Unclassified | 657 |
| 293 | Ga0097620_101998792 | 3300006931 | Unclassified | 640 |
| 294 | Ga0075435_100000818 | 3300007076 | Bacteria | 19378 |
| 295 | Ga0075435_100029136 | 3300007076 | Bacteria | 4332 |
| 296 | Ga0075435_100153700 | 3300007076 | Unclassified | 1936 |
| 297 | Ga0075435_100193164 | 3300007076 | Unclassified | 1723 |
| 298 | Ga0075435_100498910 | 3300007076 | Bacteria | 1052 |
| 299 | Ga0099794_10589745 | 3300007265 | Unclassified | 588 |
| 300 | Ga0099795_10044068 | 3300007788 | Bacteria | 1599 |
| 301 | Ga0105240_10023146 | 3300009093 | Bacteria | 8225 |
| 302 | Ga0105240_10024118 | 3300009093 | Bacteria | 8029 |
| 303 | Ga0105240_10167204 | 3300009093 | Bacteria | 2608 |
| 304 | Ga0105240_10337558 | 3300009093 | Bacteria | 1713 |
| 305 | Ga0105240_10390858 | 3300009093 | Unclassified | 1569 |
| 306 | Ga0105240_10570475 | 3300009093 | Bacteria | 1249 |
| 307 | Ga0105240_10694611 | 3300009093 | Bacteria | 1111 |
| 308 | Ga0105240_11499492 | 3300009093 | Bacteria | 707 |
| 309 | Ga0105240_11811546 | 3300009093 | Bacteria | 636 |
| 310 | Ga0111539_10041453 | 3300009094 | Bacteria | 5536 |
| 311 | Ga0111539_10094245 | 3300009094 | Bacteria | 3517 |
| 312 | Ga0111539_10199880 | 3300009094 | Bacteria | 2331 |
| 313 | Ga0111539_10411544 | 3300009094 | Bacteria | 1575 |
| 314 | Ga0105245_10076950 | 3300009098 | Unclassified | 3041 |
| 315 | Ga0105245_10160703 | 3300009098 | Archaea | 2131 |
| 316 | Ga0105245_10178116 | 3300009098 | Unclassified | 2029 |
| 317 | Ga0105245_10217542 | 3300009098 | Bacteria | 1841 |
| 318 | Ga0105245_11159008 | 3300009098 | Bacteria | 820 |
| 319 | Ga0105245_12331805 | 3300009098 | Unclassified | 589 |
| 320 | Ga0105245_12708008 | 3300009098 | Bacteria | 549 |
| 321 | Ga0105245_12871018 | 3300009098 | Unclassified | 534 |
| 322 | Ga0105247_10258550 | 3300009101 | Unclassified | 1193 |
| 323 | Ga0105247_10626215 | 3300009101 | Unclassified | 801 |
| 324 | Ga0114129_10027137 | 3300009147 | Bacteria | 8107 |
| 325 | Ga0114129_10103464 | 3300009147 | Bacteria | 3937 |
| 326 | Ga0114129_10112953 | 3300009147 | Bacteria | 3746 |
| 327 | Ga0114129_10125339 | 3300009147 | Bacteria | 3532 |
| 328 | Ga0114129_10494631 | 3300009147 | Bacteria | 1598 |
| 329 | Ga0114129_10498130 | 3300009147 | Bacteria | 1591 |
| 330 | Ga0114129_10668681 | 3300009147 | Unclassified | 1338 |
| 331 | Ga0114129_10692176 | 3300009147 | Unclassified | 1311 |
| 332 | Ga0114129_10737408 | 3300009147 | Unclassified | 1262 |
| 333 | Ga0114129_10776111 | 3300009147 | Bacteria | 1225 |
| 334 | Ga0114129_11040261 | 3300009147 | Bacteria | 1029 |
| 335 | Ga0114129_11172062 | 3300009147 | Bacteria | 958 |
| 336 | Ga0114129_12385171 | 3300009147 | Unclassified | 634 |
| 337 | Ga0105243_10434156 | 3300009148 | Bacteria | 1228 |
| 338 | Ga0105243_11593046 | 3300009148 | Unclassified | 679 |
| 339 | Ga0105241_10269721 | 3300009174 | Unclassified | 1449 |
| 340 | Ga0105241_10292895 | 3300009174 | Bacteria | 1394 |
| 341 | Ga0105241_10321449 | 3300009174 | Bacteria | 1335 |
| 342 | Ga0105241_10344608 | 3300009174 | Bacteria | 1292 |
| 343 | Ga0105241_11207800 | 3300009174 | Unclassified | 716 |
| 344 | Ga0105241_11276604 | 3300009174 | Bacteria | 698 |
| 345 | Ga0105242_10032979 | 3300009176 | Bacteria | 4144 |
| 346 | Ga0105242_10363364 | 3300009176 | Unclassified | 1340 |
| 347 | Ga0105242_10998914 | 3300009176 | Bacteria | 844 |
| 348 | Ga0105242_11183154 | 3300009176 | Unclassified | 783 |
| 349 | Ga0105242_12588244 | 3300009176 | Unclassified | 556 |
| 350 | Ga0105248_10008930 | 3300009177 | Bacteria | 11020 |
| 351 | Ga0105248_10023512 | 3300009177 | Bacteria | 6845 |
| 352 | Ga0105248_10026910 | 3300009177 | Bacteria | 6396 |
| 353 | Ga0105248_10028027 | 3300009177 | Bacteria | 6274 |
| 354 | Ga0105248_10108561 | 3300009177 | Bacteria | 3129 |
| 355 | Ga0105248_10157658 | 3300009177 | Unclassified | 2561 |
| 356 | Ga0105248_10311351 | 3300009177 | Bacteria | 1773 |
| 357 | Ga0105248_10363950 | 3300009177 | Bacteria | 1628 |
| 358 | Ga0105248_10435918 | 3300009177 | Bacteria | 1476 |
| 359 | Ga0105248_11093256 | 3300009177 | Bacteria | 901 |
| 360 | Ga0105248_13443543 | 3300009177 | Unclassified | 502 |
| 361 | Ga0105237_10006068 | 3300009545 | Bacteria | 13516 |
| 362 | Ga0105237_10642128 | 3300009545 | Unclassified | 1068 |
| 363 | Ga0105237_12396420 | 3300009545 | Unclassified | 538 |
| 364 | Ga0105238_10119937 | 3300009551 | Bacteria | 2610 |
| 365 | Ga0105238_10160188 | 3300009551 | Bacteria | 2226 |
| 366 | Ga0105238_10689625 | 3300009551 | Bacteria | 1033 |
| 367 | Ga0105238_11034181 | 3300009551 | Bacteria | 843 |
| 368 | Ga0105238_11434234 | 3300009551 | Unclassified | 718 |
| 369 | Ga0105238_11881687 | 3300009551 | Unclassified | 631 |
| 370 | Ga0105238_12516255 | 3300009551 | Unclassified | 551 |
| 371 | Ga0105249_10030842 | 3300009553 | Bacteria | 4846 |
| 372 | Ga0105249_10150091 | 3300009553 | Unclassified | 2243 |
| 373 | Ga0105249_10171360 | 3300009553 | Bacteria | 2105 |
| 374 | Ga0105249_10943496 | 3300009553 | Bacteria | 931 |
| 375 | Ga0105249_13307597 | 3300009553 | Unclassified | 519 |
| 376 | Ga0099796_10167549 | 3300010159 | Bacteria | 875 |
| 377 | Ga0105239_10002868 | 3300010375 | Bacteria | 21560 |
| 378 | Ga0105239_10034331 | 3300010375 | Bacteria | 5570 |
| 379 | Ga0105239_10068903 | 3300010375 | Unclassified | 3888 |
| 380 | Ga0105239_10087446 | 3300010375 | Bacteria | 3436 |
| 381 | Ga0105239_10208975 | 3300010375 | Unclassified | 2187 |
| 382 | Ga0105239_10564483 | 3300010375 | Bacteria | 1297 |
| 383 | Ga0105239_10729011 | 3300010375 | Bacteria | 1134 |
| 384 | Ga0105239_11010919 | 3300010375 | Unclassified | 956 |
| 385 | Ga0105239_11713235 | 3300010375 | Bacteria | 728 |
| 386 | Ga0105239_12697274 | 3300010375 | Unclassified | 580 |
| 387 | Ga0105246_10134818 | 3300011119 | Unclassified | 1849 |
| 388 | Ga0105246_11055761 | 3300011119 | Unclassified | 739 |
| 389 | Ga0105246_11214746 | 3300011119 | Unclassified | 694 |
| 390 | Ga0157373_10752718 | 3300013100 | Unclassified | 716 |
| 391 | Ga0157373_11392305 | 3300013100 | Unclassified | 533 |
| 392 | Ga0157371_10017063 | 3300013102 | Bacteria | 5401 |
| 393 | Ga0157371_10150294 | 3300013102 | Bacteria | 1661 |
| 394 | Ga0157370_10147985 | 3300013104 | Bacteria | 2186 |
| 395 | Ga0157370_10300527 | 3300013104 | Unclassified | 1482 |
| 396 | Ga0157370_10331947 | 3300013104 | Bacteria | 1402 |
| 397 | Ga0157370_10492740 | 3300013104 | Unclassified | 1126 |
| 398 | Ga0157370_10674049 | 3300013104 | Unclassified | 944 |
| 399 | Ga0157369_10003263 | 3300013105 | Bacteria | 19311 |
| 400 | Ga0157369_10008271 | 3300013105 | Bacteria | 11924 |
| 401 | Ga0157369_10104798 | 3300013105 | Bacteria | 3011 |
| 402 | Ga0157369_10110505 | 3300013105 | Bacteria | 2922 |
| 403 | Ga0157369_10587580 | 3300013105 | Unclassified | 1150 |
| 404 | Ga0157369_10642222 | 3300013105 | Bacteria | 1095 |
| 405 | Ga0157374_10029367 | 3300013296 | Bacteria | 4978 |
| 406 | Ga0157374_10064449 | 3300013296 | Bacteria | 3438 |
| 407 | Ga0157374_10070096 | 3300013296 | Unclassified | 3302 |
| 408 | Ga0157374_10116110 | 3300013296 | Bacteria | 2579 |
| 409 | Ga0157374_10487174 | 3300013296 | Bacteria | 1237 |
| 410 | Ga0157374_11030440 | 3300013296 | Unclassified | 842 |
| 411 | Ga0157374_11458237 | 3300013296 | Unclassified | 707 |
| 412 | Ga0157374_11473907 | 3300013296 | Bacteria | 704 |
| 413 | Ga0157378_10030859 | 3300013297 | Bacteria | 4732 |
| 414 | Ga0157378_10401954 | 3300013297 | Bacteria | 1350 |
| 415 | Ga0157378_10633784 | 3300013297 | Bacteria | 1083 |
| 416 | Ga0157378_11603301 | 3300013297 | Bacteria | 697 |
| 417 | Ga0157378_12845562 | 3300013297 | Unclassified | 536 |
| 418 | Ga0157378_13230333 | 3300013297 | Unclassified | 506 |
| 419 | Ga0163162_10087793 | 3300013306 | Unclassified | 3189 |
| 420 | Ga0163162_10230897 | 3300013306 | Bacteria | 1981 |
| 421 | Ga0163162_11273280 | 3300013306 | Unclassified | 835 |
| 422 | Ga0163162_12384734 | 3300013306 | Unclassified | 608 |
| 423 | Ga0157372_10005353 | 3300013307 | Bacteria | 13633 |
| 424 | Ga0157372_10058201 | 3300013307 | Bacteria | 4319 |
| 425 | Ga0157372_10240476 | 3300013307 | Bacteria | 2101 |
| 426 | Ga0157372_10487074 | 3300013307 | Bacteria | 1438 |
| 427 | Ga0157372_10503268 | 3300013307 | Bacteria | 1413 |
| 428 | Ga0157372_10632388 | 3300013307 | Bacteria | 1247 |
| 429 | Ga0157375_10142181 | 3300013308 | Unclassified | 2528 |
| 430 | Ga0157375_10436595 | 3300013308 | Bacteria | 1475 |
| 431 | Ga0157375_10460530 | 3300013308 | Unclassified | 1437 |
| 432 | Ga0157375_12026705 | 3300013308 | Unclassified | 684 |
| 433 | Ga0157375_12700265 | 3300013308 | Unclassified | 594 |
| 434 | Ga0163163_10004648 | 3300014325 | Bacteria | 11734 |
| 435 | Ga0163163_10009250 | 3300014325 | Bacteria | 8790 |
| 436 | Ga0163163_10058764 | 3300014325 | Bacteria | 3803 |
| 437 | Ga0163163_10112229 | 3300014325 | Bacteria | 2755 |
| 438 | Ga0163163_10168736 | 3300014325 | Bacteria | 2235 |
| 439 | Ga0163163_10171136 | 3300014325 | Unclassified | 2219 |
| 440 | Ga0163163_10328780 | 3300014325 | Bacteria | 1583 |
| 441 | Ga0163163_10589023 | 3300014325 | Bacteria | 1175 |
| 442 | Ga0163163_10836591 | 3300014325 | Unclassified | 984 |
| 443 | Ga0157380_10037297 | 3300014326 | Bacteria | 3765 |
| 444 | Ga0157380_10617657 | 3300014326 | Unclassified | 1075 |
| 445 | Ga0157380_11474812 | 3300014326 | Bacteria | 733 |
| 446 | Ga0157380_12453515 | 3300014326 | Unclassified | 587 |
| 447 | Ga0157379_10002406 | 3300014968 | Bacteria | 15634 |
| 448 | Ga0157379_10071438 | 3300014968 | Unclassified | 3105 |
| 449 | Ga0157379_10612218 | 3300014968 | Bacteria | 1017 |
| 450 | Ga0157376_10052985 | 3300014969 | Unclassified | 3376 |
| 451 | Ga0157376_10134207 | 3300014969 | Bacteria | 2213 |
| 452 | Ga0157376_11068689 | 3300014969 | Bacteria | 832 |
| 453 | Ga0157376_11411770 | 3300014969 | Unclassified | 728 |
| 454 | Ga0163161_10814537 | 3300017792 | Bacteria | 786 |
| 455 | Ga0163161_11196058 | 3300017792 | Unclassified | 657 |
| 456 | Ga0163161_11443026 | 3300017792 | Bacteria | 602 |
| 457 | Ga0213876_10015860 | 3300021384 | Bacteria | 3987 |
| 458 | Ga0213876_10147482 | 3300021384 | Bacteria | 1251 |
| 459 | Ga0213875_10012717 | 3300021388 | Bacteria | 4144 |
| 460 | Ga0213875_10095566 | 3300021388 | Bacteria | 1386 |
| 461 | Ga0207697_10198365 | 3300025315 | Unclassified | 882 |
| 462 | Ga0207697_10214383 | 3300025315 | Bacteria | 849 |
| 463 | Ga0207692_10162571 | 3300025898 | Unclassified | 1288 |
| 464 | Ga0207642_10270533 | 3300025899 | Bacteria | 973 |
| 465 | Ga0207642_10286090 | 3300025899 | Unclassified | 950 |
| 466 | Ga0207710_10408713 | 3300025900 | Unclassified | 697 |
| 467 | Ga0207688_10070886 | 3300025901 | Unclassified | 1977 |
| 468 | Ga0207680_10191820 | 3300025903 | Unclassified | 1388 |
| 469 | Ga0207680_10371992 | 3300025903 | Bacteria | 1006 |
| 470 | Ga0207680_10764389 | 3300025903 | Unclassified | 693 |
| 471 | Ga0207647_10244577 | 3300025904 | Unclassified | 1030 |
| 472 | Ga0207699_10077514 | 3300025906 | Bacteria | 2051 |
| 473 | Ga0207699_10158020 | 3300025906 | Bacteria | 1506 |
| 474 | Ga0207699_10182138 | 3300025906 | Bacteria | 1413 |
| 475 | Ga0207699_10781293 | 3300025906 | Unclassified | 701 |
| 476 | Ga0207645_10060604 | 3300025907 | Unclassified | 2416 |
| 477 | Ga0207645_10280313 | 3300025907 | Bacteria | 1107 |
| 478 | Ga0207705_10656434 | 3300025909 | Unclassified | 816 |
| 479 | Ga0207684_10013488 | 3300025910 | Bacteria | 7068 |
| 480 | Ga0207684_10120833 | 3300025910 | Bacteria | 2246 |
| 481 | Ga0207684_10371371 | 3300025910 | Unclassified | 1230 |
| 482 | Ga0207654_10427248 | 3300025911 | Bacteria | 925 |
| 483 | Ga0207654_10437115 | 3300025911 | Bacteria | 915 |
| 484 | Ga0207654_11070495 | 3300025911 | Unclassified | 587 |
| 485 | Ga0207654_11271248 | 3300025911 | Bacteria | 536 |
| 486 | Ga0207707_10001181 | 3300025912 | Bacteria | 24586 |
| 487 | Ga0207707_10024626 | 3300025912 | Bacteria | 5268 |
| 488 | Ga0207707_10048678 | 3300025912 | Bacteria | 3692 |
| 489 | Ga0207707_11435172 | 3300025912 | Unclassified | 549 |
| 490 | Ga0207707_11445500 | 3300025912 | Unclassified | 547 |
| 491 | Ga0207695_10189608 | 3300025913 | Bacteria | 1974 |
| 492 | Ga0207695_10725961 | 3300025913 | Unclassified | 874 |
| 493 | Ga0207695_10741101 | 3300025913 | Unclassified | 863 |
| 494 | Ga0207695_11565023 | 3300025913 | Unclassified | 540 |
| 495 | Ga0207671_10019297 | 3300025914 | Bacteria | 5214 |
| 496 | Ga0207671_10199060 | 3300025914 | Bacteria | 1564 |
| 497 | Ga0207671_11130037 | 3300025914 | Unclassified | 615 |
| 498 | Ga0207693_10021001 | 3300025915 | Bacteria | 5191 |
| 499 | Ga0207693_10278693 | 3300025915 | Unclassified | 1310 |
| 500 | Ga0207693_10404578 | 3300025915 | Unclassified | 1067 |
| 501 | Ga0207663_10003342 | 3300025916 | Bacteria | 7832 |
| 502 | Ga0207663_10217587 | 3300025916 | Unclassified | 1388 |
| 503 | Ga0207663_10636971 | 3300025916 | Unclassified | 840 |
| 504 | Ga0207663_10680851 | 3300025916 | Unclassified | 813 |
| 505 | Ga0207663_11098784 | 3300025916 | Unclassified | 639 |
| 506 | Ga0207660_10477433 | 3300025917 | Unclassified | 1010 |
| 507 | Ga0207660_10519667 | 3300025917 | Unclassified | 967 |
| 508 | Ga0207662_11374064 | 3300025918 | Bacteria | 502 |
| 509 | Ga0207657_10021795 | 3300025919 | Bacteria | 6019 |
| 510 | Ga0207657_10119922 | 3300025919 | Bacteria | 2165 |
| 511 | Ga0207649_10054600 | 3300025920 | Unclassified | 2487 |
| 512 | Ga0207649_11285295 | 3300025920 | Unclassified | 579 |
| 513 | Ga0207652_10032917 | 3300025921 | Bacteria | 4363 |
| 514 | Ga0207652_10118922 | 3300025921 | Bacteria | 2349 |
| 515 | Ga0207652_10879950 | 3300025921 | Unclassified | 792 |
| 516 | Ga0207646_10003444 | 3300025922 | Bacteria | 17864 |
| 517 | Ga0207646_10060644 | 3300025922 | Bacteria | 3377 |
| 518 | Ga0207646_10307857 | 3300025922 | Bacteria | 1431 |
| 519 | Ga0207646_10703524 | 3300025922 | Unclassified | 903 |
| 520 | Ga0207646_11249092 | 3300025922 | Unclassified | 650 |
| 521 | Ga0207694_10001610 | 3300025924 | Bacteria | 19042 |
| 522 | Ga0207694_10080599 | 3300025924 | Bacteria | 2555 |
| 523 | Ga0207694_10103409 | 3300025924 | Bacteria | 2259 |
| 524 | Ga0207694_11486593 | 3300025924 | Unclassified | 572 |
| 525 | Ga0207650_10023277 | 3300025925 | Bacteria | 4391 |
| 526 | Ga0207650_10027993 | 3300025925 | Unclassified | 4038 |
| 527 | Ga0207659_10214675 | 3300025926 | Bacteria | 1544 |
| 528 | Ga0207659_10240316 | 3300025926 | Unclassified | 1465 |
| 529 | Ga0207659_10599154 | 3300025926 | Unclassified | 939 |
| 530 | Ga0207659_10772720 | 3300025926 | Bacteria | 825 |
| 531 | Ga0207687_10234748 | 3300025927 | Bacteria | 1450 |
| 532 | Ga0207687_10599487 | 3300025927 | Bacteria | 928 |
| 533 | Ga0207687_11454843 | 3300025927 | Bacteria | 589 |
| 534 | Ga0207700_10004781 | 3300025928 | Bacteria | 8034 |
| 535 | Ga0207700_10010761 | 3300025928 | Bacteria | 5796 |
| 536 | Ga0207700_10043541 | 3300025928 | Bacteria | 3298 |
| 537 | Ga0207700_10406603 | 3300025928 | Unclassified | 1194 |
| 538 | Ga0207700_10941408 | 3300025928 | Unclassified | 773 |
| 539 | Ga0207700_11696680 | 3300025928 | Bacteria | 557 |
| 540 | Ga0207664_10018371 | 3300025929 | Bacteria | 5145 |
| 541 | Ga0207664_10153069 | 3300025929 | Bacteria | 1960 |
| 542 | Ga0207664_10412305 | 3300025929 | Bacteria | 1203 |
| 543 | Ga0207664_11656346 | 3300025929 | Bacteria | 562 |
| 544 | Ga0207644_10161713 | 3300025931 | Bacteria | 1741 |
| 545 | Ga0207690_10749246 | 3300025932 | Unclassified | 805 |
| 546 | Ga0207706_10181762 | 3300025933 | Bacteria | 1847 |
| 547 | Ga0207706_10198275 | 3300025933 | Bacteria | 1761 |
| 548 | Ga0207706_10271530 | 3300025933 | Bacteria | 1480 |
| 549 | Ga0207686_10046439 | 3300025934 | Unclassified | 2679 |
| 550 | Ga0207686_10361601 | 3300025934 | Unclassified | 1096 |
| 551 | Ga0207686_10621545 | 3300025934 | Bacteria | 852 |
| 552 | Ga0207709_10273146 | 3300025935 | Bacteria | 1245 |
| 553 | Ga0207670_11224636 | 3300025936 | Bacteria | 636 |
| 554 | Ga0207669_10040467 | 3300025937 | Bacteria | 2704 |
| 555 | Ga0207669_10353121 | 3300025937 | Bacteria | 1137 |
| 556 | Ga0207669_10522728 | 3300025937 | Bacteria | 953 |
| 557 | Ga0207704_10372271 | 3300025938 | Bacteria | 1119 |
| 558 | Ga0207704_11315397 | 3300025938 | Bacteria | 618 |
| 559 | Ga0207704_11881185 | 3300025938 | Unclassified | 515 |
| 560 | Ga0207665_10069172 | 3300025939 | Bacteria | 2407 |
| 561 | Ga0207665_10475706 | 3300025939 | Bacteria | 962 |
| 562 | Ga0207665_10574221 | 3300025939 | Bacteria | 878 |
| 563 | Ga0207665_10632679 | 3300025939 | Unclassified | 837 |
| 564 | Ga0207665_10876525 | 3300025939 | Bacteria | 711 |
| 565 | Ga0207665_11255119 | 3300025939 | Unclassified | 591 |
| 566 | Ga0207691_10047571 | 3300025940 | Bacteria | 3936 |
| 567 | Ga0207691_10723356 | 3300025940 | Unclassified | 839 |
| 568 | Ga0207711_10018002 | 3300025941 | Bacteria | 5872 |
| 569 | Ga0207711_10027298 | 3300025941 | Bacteria | 4795 |
| 570 | Ga0207711_10048463 | 3300025941 | Bacteria | 3634 |
| 571 | Ga0207711_10082109 | 3300025941 | Unclassified | 2817 |
| 572 | Ga0207711_10172931 | 3300025941 | Unclassified | 1961 |
| 573 | Ga0207711_10213137 | 3300025941 | Bacteria | 1765 |
| 574 | Ga0207711_10258724 | 3300025941 | Unclassified | 1599 |
| 575 | Ga0207711_10286441 | 3300025941 | Unclassified | 1518 |
| 576 | Ga0207711_10322802 | 3300025941 | Bacteria | 1427 |
| 577 | Ga0207711_10492133 | 3300025941 | Unclassified | 1143 |
| 578 | Ga0207711_10683166 | 3300025941 | Unclassified | 957 |
| 579 | Ga0207711_11256362 | 3300025941 | Unclassified | 682 |
| 580 | Ga0207689_11693903 | 3300025942 | Bacteria | 524 |
| 581 | Ga0207661_10000010 | 3300025944 | Bacteria | 375338 |
| 582 | Ga0207661_10012391 | 3300025944 | Bacteria | 6194 |
| 583 | Ga0207661_10028897 | 3300025944 | Bacteria | 4251 |
| 584 | Ga0207661_10184472 | 3300025944 | Unclassified | 1825 |
| 585 | Ga0207661_10227028 | 3300025944 | Unclassified | 1652 |
| 586 | Ga0207661_10478684 | 3300025944 | Bacteria | 1136 |
| 587 | Ga0207661_12040114 | 3300025944 | Unclassified | 519 |
| 588 | Ga0207679_10010245 | 3300025945 | Bacteria | 6029 |
| 589 | Ga0207679_10264212 | 3300025945 | Unclassified | 1469 |
| 590 | Ga0207679_10355022 | 3300025945 | Unclassified | 1279 |
| 591 | Ga0207679_10510667 | 3300025945 | Unclassified | 1074 |
| 592 | Ga0207667_10012725 | 3300025949 | Bacteria | 9665 |
| 593 | Ga0207667_10130145 | 3300025949 | Bacteria | 2592 |
| 594 | Ga0207667_10158095 | 3300025949 | Bacteria | 2332 |
| 595 | Ga0207667_10416459 | 3300025949 | Bacteria | 1367 |
| 596 | Ga0207712_10031792 | 3300025961 | Unclassified | 3558 |
| 597 | Ga0207712_10326261 | 3300025961 | Unclassified | 1268 |
| 598 | Ga0207712_10399305 | 3300025961 | Bacteria | 1155 |
| 599 | Ga0207712_10722541 | 3300025961 | Unclassified | 871 |
| 600 | Ga0207668_10070147 | 3300025972 | Unclassified | 2498 |
| 601 | Ga0207668_10155136 | 3300025972 | Bacteria | 1778 |
| 602 | Ga0207668_10287646 | 3300025972 | Bacteria | 1351 |
| 603 | Ga0207640_11246048 | 3300025981 | Unclassified | 663 |
| 604 | Ga0207640_11389366 | 3300025981 | Unclassified | 629 |
| 605 | Ga0207640_11595738 | 3300025981 | Unclassified | 588 |
| 606 | Ga0207658_10013205 | 3300025986 | Bacteria | 5640 |
| 607 | Ga0207677_10091894 | 3300026023 | Unclassified | 2209 |
| 608 | Ga0207677_10907064 | 3300026023 | Unclassified | 795 |
| 609 | Ga0207703_10394772 | 3300026035 | Unclassified | 1282 |
| 610 | Ga0207703_10400235 | 3300026035 | Bacteria | 1274 |
| 611 | Ga0207703_11180974 | 3300026035 | Unclassified | 736 |
| 612 | Ga0207703_11422815 | 3300026035 | Unclassified | 667 |
| 613 | Ga0207703_11929476 | 3300026035 | Bacteria | 567 |
| 614 | Ga0207639_10025964 | 3300026041 | Unclassified | 4252 |
| 615 | Ga0207639_10206817 | 3300026041 | Bacteria | 1687 |
| 616 | Ga0207639_10393897 | 3300026041 | Bacteria | 1246 |
| 617 | Ga0207639_10398004 | 3300026041 | Bacteria | 1240 |
| 618 | Ga0207639_10769490 | 3300026041 | Unclassified | 896 |
| 619 | Ga0207639_10865840 | 3300026041 | Unclassified | 844 |
| 620 | Ga0207639_11569980 | 3300026041 | Bacteria | 617 |
| 621 | Ga0207678_10108885 | 3300026067 | Bacteria | 2363 |
| 622 | Ga0207678_10466975 | 3300026067 | Unclassified | 1098 |
| 623 | Ga0207708_10172526 | 3300026075 | Unclassified | 1714 |
| 624 | Ga0207708_10541482 | 3300026075 | Bacteria | 981 |
| 625 | Ga0207708_10867249 | 3300026075 | Unclassified | 780 |
| 626 | Ga0207702_10020562 | 3300026078 | Bacteria | 5464 |
| 627 | Ga0207702_10100039 | 3300026078 | Bacteria | 2557 |
| 628 | Ga0207702_11165730 | 3300026078 | Bacteria | 765 |
| 629 | Ga0207702_12453929 | 3300026078 | Unclassified | 508 |
| 630 | Ga0207641_10039620 | 3300026088 | Bacteria | 3942 |
| 631 | Ga0207641_10049845 | 3300026088 | Unclassified | 3540 |
| 632 | Ga0207641_10294787 | 3300026088 | Bacteria | 1530 |
| 633 | Ga0207641_10597919 | 3300026088 | Bacteria | 1080 |
| 634 | Ga0207648_10582968 | 3300026089 | Bacteria | 1030 |
| 635 | Ga0207648_11142081 | 3300026089 | Bacteria | 731 |
| 636 | Ga0207676_10026037 | 3300026095 | Bacteria | 4345 |
| 637 | Ga0207676_10158346 | 3300026095 | Unclassified | 1959 |
| 638 | Ga0207676_10236302 | 3300026095 | Bacteria | 1637 |
| 639 | Ga0207676_10731947 | 3300026095 | Unclassified | 961 |
| 640 | Ga0207676_11080145 | 3300026095 | Unclassified | 793 |
| 641 | Ga0207676_11178826 | 3300026095 | Unclassified | 759 |
| 642 | Ga0207674_10011373 | 3300026116 | Bacteria | 10002 |
| 643 | Ga0207674_11178701 | 3300026116 | Unclassified | 735 |
| 644 | Ga0207675_100012198 | 3300026118 | Bacteria | 8027 |
| 645 | Ga0207675_100029143 | 3300026118 | Bacteria | 5145 |
| 646 | Ga0207675_100144971 | 3300026118 | Unclassified | 2257 |
| 647 | Ga0207675_100460974 | 3300026118 | Bacteria | 1261 |
| 648 | Ga0207683_10099986 | 3300026121 | Bacteria | 2589 |
| 649 | Ga0207683_10155544 | 3300026121 | Unclassified | 2065 |
| 650 | Ga0207683_10283445 | 3300026121 | Bacteria | 1514 |
| 651 | Ga0207683_10870965 | 3300026121 | Unclassified | 836 |
| 652 | Ga0207683_10966538 | 3300026121 | Unclassified | 791 |
| 653 | Ga0207683_11224872 | 3300026121 | Bacteria | 695 |
| 654 | Ga0207683_11370538 | 3300026121 | Bacteria | 654 |
| 655 | Ga0207698_10213940 | 3300026142 | Bacteria | 1736 |
| 656 | Ga0207698_10643476 | 3300026142 | Unclassified | 1049 |
| 657 | Ga0207698_10714014 | 3300026142 | Bacteria | 998 |
| 658 | Ga0207428_10001006 | 3300027907 | Bacteria | 31269 |
| 659 | Ga0207428_10248757 | 3300027907 | Bacteria | 1326 |
| 660 | Ga0268266_10072808 | 3300028379 | Unclassified | 2981 |
| 661 | Ga0268266_10092909 | 3300028379 | Bacteria | 2648 |
| 662 | Ga0268265_10133788 | 3300028380 | Unclassified | 2065 |
| 663 | Ga0268265_10468815 | 3300028380 | Bacteria | 1180 |
| 664 | Ga0268265_11710056 | 3300028380 | Unclassified | 635 |
| 665 | Ga0268264_10201566 | 3300028381 | Bacteria | 1821 |
| 666 | Ga0268264_10768611 | 3300028381 | Unclassified | 961 |
| 667 | Ga0268264_11676659 | 3300028381 | Unclassified | 646 |
| 668 | Ga0265762_1093827 | 3300030760 | Unclassified | 658 |
| 669 | Ga0265760_10197460 | 3300031090 | Unclassified | 678 |
| 670 | Ga0265332_10009769 | 3300031238 | Bacteria | 4282 |
| 671 | Ga0265325_10026577 | 3300031241 | Unclassified | 3134 |
| 672 | Ga0265331_10099545 | 3300031250 | Unclassified | 1339 |
| 673 | Ga0265316_10220670 | 3300031344 | Bacteria | 1399 |
| 674 | Ga0265314_10037637 | 3300031711 | Unclassified | 3504 |
| 675 | Ga0265342_10105690 | 3300031712 | Unclassified | 1598 |
| 676 | Ga0307414_11803115 | 3300032004 | Unclassified | 571 |
| 677 | Ga0373926_0007028 | 3300035083 | Unclassified | 3743 |
| 678 | Ga0373926_0202018 | 3300035083 | Unclassified | 765 |
| 679 | Ga0373926_0311775 | 3300035083 | Unclassified | 615 |
| 680 | Ga0373934_0375175 | 3300035086 | Bacteria | 593 |
| 681 | Ga0373923_0009317 | 3300035111 | Bacteria | 3540 |
| 682 | Ga0373936_0016123 | 3300035113 | Unclassified | 2871 |
| 683 | Ga0373941_0308209 | 3300035115 | Unclassified | 634 |
| 684 | Ga0373945_0043915 | 3300035116 | Bacteria | 1623 |
| 685 | Ga0373945_0126345 | 3300035116 | Bacteria | 1021 |
| 686 | Ga0373945_0238988 | 3300035116 | Unclassified | 764 |
| 687 | Ga0373954_0293087 | 3300035118 | Unclassified | 802 |
| 688 | Ga0373954_0358536 | 3300035118 | Unclassified | 720 |
| 689 | Ga0373954_0395252 | 3300035118 | Bacteria | 684 |
| 690 | Ga0373943_0003012 | 3300035170 | Bacteria | 7650 |
| 691 | Ga0373943_0031491 | 3300035170 | Unclassified | 2517 |
| 692 | Ga0373943_0044802 | 3300035170 | Bacteria | 2154 |
| 693 | Ga0373943_0214327 | 3300035170 | Bacteria | 1070 |
| 694 | Ga0373946_0003104 | 3300035171 | Bacteria | 5887 |
| 695 | Ga0373946_0025505 | 3300035171 | Unclassified | 2325 |
| 696 | Ga0373946_0035666 | 3300035171 | Bacteria | 2014 |
| 697 | Ga0373955_0073387 | 3300035172 | Unclassified | 1918 |
| 698 | Ga0373955_0517892 | 3300035172 | Unclassified | 729 |
| 699 | Ga0373955_0590059 | 3300035172 | Unclassified | 680 |
| 700 | Ga0373924_0216248 | 3300035410 | Bacteria | 846 |
| 701 | Ga0373935_0011813 | 3300035692 | Bacteria | 5247 |
| 702 | Ga0373935_0057743 | 3300035692 | Unclassified | 2476 |
| 703 | Ga0373935_0179529 | 3300035692 | Bacteria | 1453 |
| 704 | Ga0373935_0774046 | 3300035692 | Bacteria | 708 |
| 705 | Ga0373927_0003854 | 3300035695 | Bacteria | 10647 |
| 706 | Ga0373927_0748048 | 3300035695 | Bacteria | 646 |
| 707 | Ga0373927_0768522 | 3300035695 | Unclassified | 636 |
| 708 | Ga0373927_1175678 | 3300035695 | Unclassified | 506 |
| 709 | Ga0373947_0018436 | 3300035725 | Bacteria | 4016 |
| 710 | Ga0373947_0030921 | 3300035725 | Unclassified | 3148 |
| 711 | Ga0373947_0094595 | 3300035725 | Bacteria | 1869 |
| 712 | Ga0373947_0588915 | 3300035725 | Bacteria | 758 |
| 713 | Ga0373937_1379667 | 3300036401 | Unclassified | 652 |
| 714 | Ga0373937_1838533 | 3300036401 | Unclassified | 552 |
| 715 | Ga0373925_0002700 | 3300037068 | Bacteria | 14065 |
| 716 | Ga0373925_0005483 | 3300037068 | Bacteria | 9442 |
| 717 | Ga0373925_0013538 | 3300037068 | Bacteria | 5906 |
| 718 | Ga0373925_0095111 | 3300037068 | Bacteria | 2282 |
| 719 | Ga0373925_0510655 | 3300037068 | Unclassified | 987 |
| 720 | Ga0373925_0584680 | 3300037068 | Unclassified | 919 |
| 721 | Ga0395898_0426842 | 3300037466 | Bacteria | 1263 |
| 722 | Ga0436364_0610209 | 3300037853 | Bacteria | 11100 |
| 723 | Ga0436364_0723473 | 3300037853 | Unclassified | 775 |
| 724 | Ga0436364_1510264 | 3300037853 | Bacteria | 1951 |
| 725 | Ga0436365_0125216 | 3300039437 | Unclassified | 760 |
| 726 | Ga0436365_0638243 | 3300039437 | Bacteria | 13372 |
| 727 | Ga0436365_0702324 | 3300039437 | Bacteria | 1464 |
| 728 | Ga0436365_0943435 | 3300039437 | Bacteria | 804 |
| 729 | Ga0436363_0790301 | 3300039450 | Unclassified | 521 |
| 730 | Ga0436362_0362587 | 3300039453 | Unclassified | 593 |
| 731 | Ga0436362_0722225 | 3300039453 | Unclassified | 770 |
| 732 | Ga0436362_1283006 | 3300039453 | Bacteria | 1590 |
| 733 | Ga0439453_0021268 | 3300041408 | Bacteria | 1169 |
| 734 | Ga0439453_0092611 | 3300041408 | Unclassified | 665 |
| 735 | Ga0451802_1996443 | 3300041460 | Bacteria | 614 |
| 736 | Ga0439435_0015772 | 3300042436 | Unclassified | 1885 |
| 737 | Ga0439435_0061084 | 3300042436 | Bacteria | 1098 |
| 738 | Ga0439444_0120426 | 3300042437 | Bacteria | 612 |
| 739 | Ga0439464_0032708 | 3300042439 | Bacteria | 1462 |
| 740 | Ga0439464_0070956 | 3300042439 | Bacteria | 1031 |
| 741 | Ga0439460_0139028 | 3300042461 | Bacteria | 804 |
| 742 | Ga0439460_0277344 | 3300042461 | Unclassified | 583 |
| 743 | Ga0450916_091990 | 3300042530 | Unclassified | 529 |
| 744 | Ga0451577_0017419 | 3300042876 | Bacteria | 6639 |
| 745 | Ga0451577_1019402 | 3300042876 | Bacteria | 743 |
| 746 | Ga0439440_0125780 | 3300042993 | Bacteria | 717 |
| 747 | Ga0453683_1078637 | 3300044673 | Unclassified | 535 |
| 748 | Ga0466961_0199808 | 3300044693 | Bacteria | 1237 |
| 749 | Ga0466961_0986456 | 3300044693 | Unclassified | 501 |
| 750 | Ga0466963_0284189 | 3300044694 | Unclassified | 1163 |
| 751 | Ga0466971_0211668 | 3300044719 | Unclassified | 917 |
| 752 | Ga0451576_0215981 | 3300045051 | Bacteria | 2002 |
| 753 | Ga0451576_2663837 | 3300045051 | Bacteria | 509 |
| 754 | Ga0466958_0440668 | 3300045836 | Unclassified | 843 |
| 755 | Ga0466967_0161446 | 3300045976 | Bacteria | 2104 |
| 756 | Ga0495592_0313965 | 3300046454 | Unclassified | 1015 |
| 757 | Ga0495651_0192992 | 3300046462 | Unclassified | 1432 |
| 758 | Ga0495580_0012488 | 3300046472 | Bacteria | 6511 |
| 759 | Ga0495580_0178600 | 3300046472 | Bacteria | 1466 |
| 760 | Ga0495580_0229175 | 3300046472 | Bacteria | 1276 |
| 761 | Ga0495580_0325673 | 3300046472 | Bacteria | 1044 |
| 762 | Ga0495580_0656215 | 3300046472 | Bacteria | 690 |
| 763 | Ga0495580_0754513 | 3300046472 | Unclassified | 634 |
| 764 | Ga0495582_0005784 | 3300046473 | Bacteria | 6887 |
| 765 | Ga0495639_0123086 | 3300046475 | Bacteria | 1238 |
| 766 | Ga0495664_0320398 | 3300046477 | Bacteria | 935 |
| 767 | Ga0495594_0014437 | 3300046499 | Bacteria | 4140 |
| 768 | Ga0495608_0765985 | 3300046511 | Unclassified | 571 |
| 769 | Ga0495628_0129961 | 3300046516 | Unclassified | 1927 |
| 770 | Ga0495630_0020273 | 3300046517 | Bacteria | 4901 |
| 771 | Ga0495630_0629313 | 3300046517 | Unclassified | 822 |
| 772 | Ga0495643_0005221 | 3300046522 | Bacteria | 8844 |
| 773 | Ga0495666_0376483 | 3300046526 | Bacteria | 639 |
| 774 | Ga0495665_0200204 | 3300046531 | Bacteria | 1035 |
| 775 | Ga0495640_0252757 | 3300046533 | Bacteria | 1103 |
| 776 | Ga0495586_0224920 | 3300046535 | Unclassified | 1067 |
| 777 | Ga0495586_0446981 | 3300046535 | Bacteria | 745 |
| 778 | Ga0495587_0064353 | 3300046536 | Unclassified | 2143 |
| 779 | Ga0495587_0438294 | 3300046536 | Unclassified | 724 |
| 780 | Ga0495587_0642001 | 3300046536 | Unclassified | 583 |
| 781 | Ga0495667_0167486 | 3300046559 | Bacteria | 1412 |
| 782 | Ga0495667_0679124 | 3300046559 | Bacteria | 639 |
| 783 | Ga0495667_0883091 | 3300046559 | Unclassified | 549 |
| 784 | Ga0495634_0406922 | 3300046642 | Unclassified | 807 |
| 785 | Ga0495635_0306302 | 3300046663 | Bacteria | 1065 |
| 786 | Ga0495635_0654709 | 3300046663 | Bacteria | 683 |
| 787 | Ga0495659_0524157 | 3300046664 | Unclassified | 521 |
| 788 | Ga0495599_0300308 | 3300046678 | Bacteria | 969 |
| 789 | Ga0495599_0770207 | 3300046678 | Unclassified | 551 |
| 790 | Ga0495623_0377351 | 3300046679 | Unclassified | 767 |
| 791 | Ga0495647_0384112 | 3300046681 | Unclassified | 643 |
| 792 | Ga0495658_0149357 | 3300046683 | Bacteria | 1434 |
| 793 | Ga0495658_0428033 | 3300046683 | Unclassified | 844 |
| 794 | Ga0495624_0294304 | 3300046690 | Bacteria | 979 |
| 795 | Ga0495581_0220685 | 3300047315 | Bacteria | 1108 |
| 796 | Ga0495604_0062019 | 3300047317 | Unclassified | 2858 |
| 797 | Ga0495674_0354884 | 3300047319 | Bacteria | 1190 |
| 798 | Ga0495674_1194235 | 3300047319 | Bacteria | 575 |
| 799 | Ga0495676_0402495 | 3300047321 | Unclassified | 908 |
| 800 | Ga0495675_0281183 | 3300047444 | Bacteria | 992 |
| 801 | Ga0495684_0194558 | 3300047471 | Bacteria | 1497 |
| 802 | Ga0495684_0197155 | 3300047471 | Bacteria | 1486 |
| 803 | Ga0495684_0737969 | 3300047471 | Bacteria | 649 |
| 804 | Ga0495602_0165155 | 3300048088 | Unclassified | 1724 |
| 805 | Ga0495602_0392321 | 3300048088 | Unclassified | 992 |
| 806 | Ga0495602_0527236 | 3300048088 | Bacteria | 822 |
| 807 | Ga0495614_0223622 | 3300048089 | Unclassified | 856 |
| 808 | Ga0496100_0067158 | 3300048903 | Unclassified | 2381 |
| 809 | Ga0496101_0810119 | 3300048904 | Bacteria | 738 |
| 810 | Ga0496103_0300988 | 3300048906 | Unclassified | 1032 |
| 811 | Ga0496104_0024493 | 3300048907 | Bacteria | 5552 |
| 812 | Ga0496104_0296366 | 3300048907 | Unclassified | 1530 |
| 813 | Ga0496104_1205653 | 3300048907 | Unclassified | 660 |
| 814 | Ga0496104_1284075 | 3300048907 | Bacteria | 635 |
| 815 | Ga0496105_0117039 | 3300048908 | Bacteria | 2198 |
| 816 | Ga0496105_0492050 | 3300048908 | Bacteria | 964 |
| 817 | Ga0496106_0110862 | 3300048909 | Bacteria | 2136 |
| 818 | Ga0496106_0618422 | 3300048909 | Bacteria | 867 |
| 819 | Ga0496106_1342968 | 3300048909 | Unclassified | 554 |
| 820 | Ga0496107_0114092 | 3300048910 | Unclassified | 1988 |
| 821 | Ga0496108_0001958 | 3300048911 | Bacteria | 16495 |
| 822 | Ga0496108_0437881 | 3300048911 | Unclassified | 1142 |
| 823 | Ga0496109_0044494 | 3300048912 | Bacteria | 4027 |
| 824 | Ga0496111_0006232 | 3300048914 | Bacteria | 7729 |
| 825 | Ga0496111_0107477 | 3300048914 | Unclassified | 2054 |
| 826 | Ga0496112_0019877 | 3300048915 | Bacteria | 6355 |
| 827 | Ga0496112_0310483 | 3300048915 | Bacteria | 1522 |
| 828 | Ga0496112_0491064 | 3300048915 | Bacteria | 1164 |
| 829 | Ga0496113_0106054 | 3300048916 | Unclassified | 2182 |
| 830 | Ga0496113_0193151 | 3300048916 | Unclassified | 1616 |
| 831 | Ga0496114_0207199 | 3300048917 | Bacteria | 1719 |
| 832 | Ga0496115_0020025 | 3300048918 | Bacteria | 5155 |
| 833 | Ga0496115_0154592 | 3300048918 | Bacteria | 1895 |
| 834 | Ga0496115_0549015 | 3300048918 | Unclassified | 924 |
| 835 | Ga0501290_057026 | 3300049513 | Unclassified | 621 |
| 836 | Ga0501031_0001424 | 3300049568 | Bacteria | 14810 |
| 837 | Ga0501031_0006360 | 3300049568 | Bacteria | 7703 |
| 838 | Ga0501032_0004150 | 3300049569 | Bacteria | 10977 |
| 839 | Ga0501032_0035204 | 3300049569 | Unclassified | 3425 |
| 840 | Ga0501032_0041737 | 3300049569 | Bacteria | 3114 |
| 841 | Ga0501032_0161476 | 3300049569 | Bacteria | 1471 |
| 842 | Ga0501033_0000613 | 3300049570 | Bacteria | 33033 |
| 843 | Ga0501033_0010819 | 3300049570 | Bacteria | 6996 |
| 844 | Ga0501033_0019393 | 3300049570 | Bacteria | 5141 |
| 845 | Ga0501033_0024950 | 3300049570 | Bacteria | 4505 |
| 846 | Ga0501034_0039838 | 3300049571 | Bacteria | 4758 |
| 847 | Ga0501034_0054158 | 3300049571 | Unclassified | 4038 |
| 848 | Ga0501034_0105861 | 3300049571 | Bacteria | 2805 |
| 849 | Ga0501034_0237316 | 3300049571 | Bacteria | 1770 |
| 850 | Ga0501036_0000820 | 3300049572 | Bacteria | 23060 |
| 851 | Ga0501036_0038464 | 3300049572 | Bacteria | 4049 |
| 852 | Ga0501036_0042429 | 3300049572 | Unclassified | 3851 |
| 853 | Ga0501036_0143920 | 3300049572 | Bacteria | 2011 |
| 854 | Ga0501037_0003364 | 3300049573 | Bacteria | 11624 |
| 855 | Ga0501037_0004775 | 3300049573 | Bacteria | 9852 |
| 856 | Ga0501037_0008586 | 3300049573 | Bacteria | 7496 |
| 857 | Ga0501037_0331711 | 3300049573 | Bacteria | 1052 |
| 858 | Ga0501038_0001876 | 3300049574 | Bacteria | 19413 |
| 859 | Ga0501038_0035608 | 3300049574 | Bacteria | 4369 |
| 860 | Ga0501038_0132536 | 3300049574 | Bacteria | 2044 |
| 861 | Ga0501038_0233016 | 3300049574 | Bacteria | 1464 |
| 862 | Ga0501039_1211309 | 3300049575 | Unclassified | 584 |
| 863 | Ga0501040_0483030 | 3300049576 | Unclassified | 893 |
| 864 | Ga0501041_0066292 | 3300049577 | Bacteria | 2212 |
| 865 | Ga0501042_0021800 | 3300049578 | Bacteria | 4469 |
| 866 | Ga0501043_0002642 | 3300049579 | Bacteria | 15067 |
| 867 | Ga0501043_0008095 | 3300049579 | Bacteria | 8294 |
| 868 | Ga0501043_0010081 | 3300049579 | Bacteria | 7409 |
| 869 | Ga0501043_0010169 | 3300049579 | Bacteria | 7375 |
| 870 | Ga0501046_0015105 | 3300049580 | Bacteria | 6492 |
| 871 | Ga0501046_0056805 | 3300049580 | Bacteria | 3070 |
| 872 | Ga0501046_0065339 | 3300049580 | Unclassified | 2838 |
| 873 | Ga0501047_0019870 | 3300049581 | Bacteria | 6448 |
| 874 | Ga0501047_0040581 | 3300049581 | Bacteria | 4500 |
| 875 | Ga0501047_0053635 | 3300049581 | Bacteria | 3899 |
| 876 | Ga0501047_0322025 | 3300049581 | Unclassified | 1385 |
| 877 | Ga0501048_0050907 | 3300049582 | Bacteria | 2949 |
| 878 | Ga0501048_0060886 | 3300049582 | Bacteria | 2674 |
| 879 | Ga0501048_0368305 | 3300049582 | Bacteria | 1025 |
| 880 | Ga0501067_0000638 | 3300049583 | Bacteria | 18831 |
| 881 | Ga0501067_0024116 | 3300049583 | Bacteria | 3373 |
| 882 | Ga0501068_0001033 | 3300049584 | Bacteria | 14713 |
| 883 | Ga0501068_0005356 | 3300049584 | Bacteria | 7012 |
| 884 | Ga0501068_0009482 | 3300049584 | Bacteria | 5450 |
| 885 | Ga0501069_0012380 | 3300049585 | Bacteria | 4534 |
| 886 | Ga0501069_0016210 | 3300049585 | Bacteria | 3998 |
| 887 | Ga0501069_0086510 | 3300049585 | Unclassified | 1769 |
| 888 | Ga0501070_0003990 | 3300049586 | Bacteria | 12687 |
| 889 | Ga0501070_0011406 | 3300049586 | Bacteria | 7511 |
| 890 | Ga0501070_0013460 | 3300049586 | Bacteria | 6895 |
| 891 | Ga0501070_0136681 | 3300049586 | Bacteria | 2023 |
| 892 | Ga0501071_0082233 | 3300049587 | Bacteria | 2358 |
| 893 | Ga0501071_0173908 | 3300049587 | Bacteria | 1613 |
| 894 | Ga0501071_1574114 | 3300049587 | Unclassified | 507 |
| 895 | Ga0501072_0389358 | 3300049588 | Unclassified | 1106 |
| 896 | Ga0501072_1161108 | 3300049588 | Bacteria | 600 |
| 897 | Ga0501073_0001003 | 3300049589 | Bacteria | 20354 |
| 898 | Ga0501073_0016244 | 3300049589 | Bacteria | 5395 |
| 899 | Ga0501073_0044287 | 3300049589 | Bacteria | 3136 |
| 900 | Ga0501073_0243672 | 3300049589 | Bacteria | 1241 |
| 901 | Ga0501074_0003949 | 3300049590 | Bacteria | 10564 |
| 902 | Ga0501074_0007234 | 3300049590 | Bacteria | 8018 |
| 903 | Ga0501075_0273382 | 3300049591 | Bacteria | 1287 |
| 904 | Ga0501075_0609373 | 3300049591 | Bacteria | 833 |
| 905 | Ga0501076_0000623 | 3300049592 | Bacteria | 22644 |
| 906 | Ga0501076_0035267 | 3300049592 | Bacteria | 3915 |
| 907 | Ga0501217_270203 | 3300049661 | Unclassified | 554 |
| 908 | Ga0501230_102518 | 3300049667 | Unclassified | 618 |
| 909 | Ga0501243_124551 | 3300049675 | Unclassified | 535 |
| 910 | Ga0501249_008075 | 3300049679 | Bacteria | 2184 |
| 911 | Ga0501221_007321 | 3300049704 | Bacteria | 1891 |
| 912 | Ga0501234_036912 | 3300049707 | Bacteria | 795 |
| 913 | Ga0501079_0002604 | 3300049741 | Bacteria | 13117 |
| 914 | Ga0501079_0018156 | 3300049741 | Bacteria | 5372 |
| 915 | Ga0501079_0023004 | 3300049741 | Bacteria | 4786 |
| 916 | Ga0501079_0126922 | 3300049741 | Unclassified | 1984 |
| 917 | Ga0501080_0014127 | 3300049742 | Bacteria | 7348 |
| 918 | Ga0501080_0015677 | 3300049742 | Bacteria | 6987 |
| 919 | Ga0501080_0073946 | 3300049742 | Bacteria | 3170 |
| 920 | Ga0501080_0264975 | 3300049742 | Bacteria | 1564 |
| 921 | Ga0501080_0576533 | 3300049742 | Bacteria | 1000 |
| 922 | Ga0501081_0007300 | 3300049743 | Bacteria | 7176 |
| 923 | Ga0501083_0041932 | 3300049744 | Bacteria | 3103 |
| 924 | Ga0501083_0283044 | 3300049744 | Unclassified | 1078 |
| 925 | Ga0501265_049265 | 3300049762 | Unclassified | 659 |
| 926 | Ga0501268_015624 | 3300049765 | Bacteria | 1250 |
| 927 | Ga0501270_019776 | 3300049767 | Bacteria | 1012 |
| 928 | Ga0501035_0022213 | 3300049822 | Bacteria | 5828 |
| 929 | Ga0501035_0023213 | 3300049822 | Bacteria | 5690 |
| 930 | Ga0501035_0047013 | 3300049822 | Bacteria | 3877 |
| 931 | Ga0501035_0159342 | 3300049822 | Unclassified | 1954 |
| 932 | Ga0501044_0018629 | 3300049823 | Bacteria | 7435 |
| 933 | Ga0501044_0086278 | 3300049823 | Bacteria | 3170 |
| 934 | Ga0501044_0086397 | 3300049823 | Unclassified | 3168 |
| 935 | Ga0501044_0305192 | 3300049823 | Unclassified | 1519 |
| 936 | Ga0501044_0944580 | 3300049823 | Bacteria | 735 |
| 937 | Ga0501045_0041337 | 3300049824 | Bacteria | 3355 |
| 938 | Ga0501045_0563734 | 3300049824 | Bacteria | 844 |
| 939 | Ga0501045_1163247 | 3300049824 | Unclassified | 563 |
| 940 | nmdc:mga05p37_112411_c1 | 3300050507 | Bacteria | 3349 |
| 941 | nmdc:mga05p37_1552876_c1 | 3300050507 | Bacteria | 655 |
| 942 | nmdc:mga05p37_243147_c1 | 3300050507 | Unclassified | 2163 |
| 943 | nmdc:mga05p37_287208_c1 | 3300050507 | Unclassified | 1959 |
| 944 | nmdc:mga05p37_294097_c1 | 3300050507 | Bacteria | 1932 |
| 945 | nmdc:mga05p37_328625_c1 | 3300050507 | Bacteria | 1807 |
| 946 | nmdc:mga05p37_463609_c1 | 3300050507 | Unclassified | 1463 |
| 947 | nmdc:mga05p37_611370_c1 | 3300050507 | Bacteria | 1228 |
| 948 | nmdc:mga05p37_690180_c1 | 3300050507 | Unclassified | 1136 |
| 949 | nmdc:mga05p37_779008_c1 | 3300050507 | Bacteria | 1050 |
| 950 | nmdc:mga05p37_94860_c1 | 3300050507 | Bacteria | 3676 |
| 951 | nmdc:mga09592_1223_c1 | 3300050508 | Bacteria | 20578 |
| 952 | nmdc:mga09592_18963_c1 | 3300050508 | Bacteria | 5645 |
| 953 | nmdc:mga09592_219372_c1 | 3300050508 | Bacteria | 1648 |
| 954 | nmdc:mga09592_289129_c1 | 3300050508 | Bacteria | 1421 |
| 955 | nmdc:mga09592_385820_c1 | 3300050508 | Bacteria | 1211 |
| 956 | nmdc:mga09592_408647_c1 | 3300050508 | Unclassified | 1173 |
| 957 | nmdc:mga09592_889224_c1 | 3300050508 | Bacteria | 749 |
| 958 | nmdc:mga0qj67_101801_c1 | 3300050509 | Bacteria | 2316 |
| 959 | nmdc:mga0qj67_1088088_c1 | 3300050509 | Bacteria | 625 |
| 960 | nmdc:mga0qj67_513931_c1 | 3300050509 | Bacteria | 962 |
| 961 | nmdc:mga0qj67_52233_c1 | 3300050509 | Bacteria | 3234 |
| 962 | nmdc:mga0qj67_73680_c1 | 3300050509 | Bacteria | 2727 |
| 963 | nmdc:mga0qj67_76574_c1 | 3300050509 | Unclassified | 2676 |
| 964 | nmdc:mga06r32_116400_c1 | 3300050510 | Bacteria | 2633 |
| 965 | nmdc:mga06r32_123463_c1 | 3300050510 | Bacteria | 2556 |
| 966 | nmdc:mga06r32_1240330_c1 | 3300050510 | Unclassified | 691 |
| 967 | nmdc:mga06r32_188535_c1 | 3300050510 | Bacteria | 2049 |
| 968 | nmdc:mga06r32_200840_c1 | 3300050510 | Unclassified | 1982 |
| 969 | nmdc:mga06r32_21774_c1 | 3300050510 | Bacteria | 5917 |
| 970 | nmdc:mga06r32_23037_c1 | 3300050510 | Bacteria | 5760 |
| 971 | nmdc:mga06r32_380091_c1 | 3300050510 | Bacteria | 1395 |
| 972 | nmdc:mga06r32_548106_c1 | 3300050510 | Bacteria | 1131 |
| 973 | nmdc:mga06r32_646060_c1 | 3300050510 | Unclassified | 1026 |
| 974 | nmdc:mga06r32_68404_c1 | 3300050510 | Bacteria | 3431 |
| 975 | nmdc:mga08y16_340126_c1 | 3300050511 | Bacteria | 1543 |
| 976 | nmdc:mga08y16_374030_c1 | 3300050511 | Bacteria | 1461 |
| 977 | nmdc:mga08y16_4391_c1 | 3300050511 | Bacteria | 14743 |
| 978 | nmdc:mga08y16_716440_c1 | 3300050511 | Unclassified | 999 |
| 979 | nmdc:mga0n895_1451010_c1 | 3300050512 | Unclassified | 654 |
| 980 | nmdc:mga0n895_21637_c1 | 3300050512 | Bacteria | 6018 |
| 981 | nmdc:mga0n895_245362_c1 | 3300050512 | Bacteria | 1818 |
| 982 | nmdc:mga0n895_255170_c1 | 3300050512 | Unclassified | 1779 |
| 983 | nmdc:mga0n895_3216_c1 | 3300050512 | Bacteria | 13078 |
| 984 | nmdc:mga0n895_398756_c1 | 3300050512 | Bacteria | 1391 |
| 985 | nmdc:mga0n895_846680_c1 | 3300050512 | Bacteria | 903 |
| 986 | nmdc:mga0n895_963_c1 | 3300050512 | Bacteria | 20861 |
| 987 | nmdc:mga0rr50_104743_c1 | 3300050513 | Bacteria | 2229 |
| 988 | nmdc:mga0rr50_1095239_c1 | 3300050513 | Unclassified | 678 |
| 989 | nmdc:mga0rr50_192501_c1 | 3300050513 | Bacteria | 1672 |
| 990 | nmdc:mga0rr50_203_c1 | 3300050513 | Bacteria | 32093 |
| 991 | nmdc:mga0rr50_28685_c1 | 3300050513 | Bacteria | 3916 |
| 992 | nmdc:mga0rr50_44121_c1 | 3300050513 | Bacteria | 3268 |
| 993 | nmdc:mga08x19_115673_c1 | 3300050514 | Bacteria | 1793 |
| 994 | nmdc:mga08x19_19068_c1 | 3300050514 | Bacteria | 4207 |
| 995 | nmdc:mga08x19_329_c1 | 3300050514 | Bacteria | 34297 |
| 996 | nmdc:mga08x19_5733_c1 | 3300050514 | Bacteria | 7342 |
| 997 | nmdc:mga08x19_69367_c1 | 3300050514 | Bacteria | 2296 |
| 998 | nmdc:mga08x19_8576_c1 | 3300050514 | Bacteria | 6091 |
| 999 | nmdc:mga0a205_1029577_c1 | 3300050515 | Bacteria | 670 |
| 1000 | nmdc:mga0a205_12285_c2 | 3300050515 | Bacteria | 2491 |
| 1001 | nmdc:mga0a205_14411_c1 | 3300050515 | Bacteria | 7375 |
| 1002 | nmdc:mga0a205_58173_c1 | 3300050515 | Bacteria | 3733 |
| 1003 | nmdc:mga0a205_78048_c1 | 3300050515 | Bacteria | 3199 |
| 1004 | Ga0500646_0022798 | 3300053090 | Unclassified | 1676 |
| 1005 | Ga0501084_0009701 | 3300054114 | Bacteria | 7962 |
| 1006 | Ga0501084_0021475 | 3300054114 | Bacteria | 5381 |
| 1007 | Ga0501084_0663205 | 3300054114 | Unclassified | 880 |
| 1008 | Ga0501084_0745348 | 3300054114 | Bacteria | 825 |
| 1009 | Ga0501084_0991592 | 3300054114 | Bacteria | 706 |
| 1010 | Ga0501082_0000433 | 3300060353 | Bacteria | 37136 |
| 1011 | Ga0501082_0008898 | 3300060353 | Bacteria | 8660 |
| 1012 | Ga0501082_0017814 | 3300060353 | Bacteria | 6119 |
| 1013 | Ga0501082_0084903 | 3300060353 | Bacteria | 2730 |
| 1014 | Ga0501082_0285419 | 3300060353 | Bacteria | 1437 |
| 1015 | Ga0495604_0158686 | |||
| 1016 | MRS1b_contig_859378 | |||
| 1017 | MBSR1b_contig_7011003 | |||
| 1018 | JGI24746J21847_1061961 | |||
| 1019 | rootL2_10290371 | |||
| 1020 | Ga0065714_10093497 | |||
| 1021 | Ga0065712_10068524 | |||
| 1022 | Ga0065712_10155246 | |||
| 1023 | Ga0065715_10000764 | |||
| 1024 | Ga0065715_10010704 | |||
| 1025 | Ga0065715_10102144 | |||
| 1026 | Ga0065715_10263235 | |||
| 1027 | Ga0065715_10579907 | |||
| 1028 | Ga0065707_10611075 | |||
| 1029 | Ga0070683_100000007 | |||
| 1030 | Ga0070683_100006724 | |||
| 1031 | Ga0070683_100057841 | |||
| 1032 | Ga0070683_100085965 | |||
| 1033 | Ga0070683_100263642 | |||
| 1034 | Ga0070683_100293257 | |||
| 1035 | Ga0070683_100452810 | |||
| 1036 | Ga0070683_101641109 | |||
| 1037 | Ga0070690_100994722 | |||
| 1038 | Ga0070670_100003509 | |||
| 1039 | Ga0070670_100016481 | |||
| 1040 | Ga0070670_100067873 | |||
| 1041 | Ga0070670_100692847 | |||
| 1042 | Ga0070670_101032422 | |||
| 1043 | Ga0068869_101501883 | |||
| 1044 | Ga0070666_10104359 | |||
| 1045 | Ga0070666_10690658 | |||
| 1046 | Ga0070666_10744481 | |||
| 1047 | Ga0070680_100314085 | |||
| 1048 | Ga0070680_100339272 | |||
| 1049 | Ga0070682_100495725 | |||
| 1050 | Ga0068868_100043863 | |||
| 1051 | Ga0068868_101119161 | |||
| 1052 | Ga0070660_100022349 | |||
| 1053 | Ga0070689_100038889 | |||
| 1054 | Ga0070689_101462113 | |||
| 1055 | Ga0070661_100025307 | |||
| 1056 | Ga0070661_100340881 | |||
| 1057 | Ga0070661_100506628 | |||
| 1058 | Ga0070661_100550282 | |||
| 1059 | Ga0070668_101260834 | |||
| 1060 | Ga0070669_100048316 | |||
| 1061 | Ga0070669_101357673 | |||
| 1062 | Ga0070675_100049409 | |||
| 1063 | Ga0070671_100223299 | |||
| 1064 | Ga0070671_101342205 | |||
| 1065 | Ga0070674_100132709 | |||
| 1066 | Ga0070674_100423297 | |||
| 1067 | Ga0070674_100727370 | |||
| 1068 | Ga0070674_100891270 | |||
| 1069 | Ga0070673_100047885 | |||
| 1070 | Ga0070688_100254387 | |||
| 1071 | Ga0070688_100349915 | |||
| 1072 | Ga0070688_101582768 | |||
| 1073 | Ga0070659_100596368 | |||
| 1074 | Ga0070667_100020834 | |||
| 1075 | Ga0070709_10665594 | |||
| 1076 | Ga0070714_100006091 | |||
| 1077 | Ga0070714_100253396 | |||
| 1078 | Ga0070714_100874366 | |||
| 1079 | Ga0070713_100060888 | |||
| 1080 | Ga0070713_100291892 | |||
| 1081 | Ga0070710_10757645 | |||
| 1082 | Ga0070710_10940918 | |||
| 1083 | Ga0070701_10707919 | |||
| 1084 | Ga0070711_100003224 | |||
| 1085 | Ga0070711_100343944 | |||
| 1086 | Ga0070711_100461961 | |||
| 1087 | Ga0070711_100744828 | |||
| 1088 | Ga0070711_100782188 | |||
| 1089 | Ga0070705_100715912 | |||
| 1090 | Ga0070705_100944396 | |||
| 1091 | Ga0070700_100348358 | |||
| 1092 | Ga0070700_100356234 | |||
| 1093 | Ga0070700_100814277 | |||
| 1094 | Ga0070700_101341330 | |||
| 1095 | Ga0070694_100859644 | |||
| 1096 | Ga0070694_101880571 | |||
| 1097 | Ga0070708_101710392 | |||
| 1098 | Ga0070708_101894024 | |||
| 1099 | Ga0070663_100193262 | |||
| 1100 | Ga0070663_101649687 | |||
| 1101 | Ga0070678_100169839 | |||
| 1102 | Ga0070678_100351726 | |||
| 1103 | Ga0070678_100519667 | |||
| 1104 | Ga0070678_101959659 | |||
| 1105 | Ga0070662_100031737 | |||
| 1106 | Ga0070662_100147763 | |||
| 1107 | Ga0070662_100201550 | |||
| 1108 | Ga0070662_100834910 | |||
| 1109 | Ga0070662_100863009 | |||
| 1110 | Ga0070681_10021785 | |||
| 1111 | Ga0070681_10062901 | |||
| 1112 | Ga0070681_10325745 | |||
| 1113 | Ga0070681_11197847 | |||
| 1114 | Ga0070685_10009435 | |||
| 1115 | Ga0070685_10775041 | |||
| 1116 | Ga0070685_11054178 | |||
| 1117 | Ga0070706_100027769 | |||
| 1118 | Ga0070706_100143285 | |||
| 1119 | Ga0070706_100410628 | |||
| 1120 | Ga0070706_100856636 | |||
| 1121 | Ga0070707_100007173 | |||
| 1122 | Ga0070707_100014596 | |||
| 1123 | Ga0070707_100251616 | |||
| 1124 | Ga0070707_101377295 | |||
| 1125 | Ga0070698_100010349 | |||
| 1126 | Ga0070698_100402081 | |||
| 1127 | Ga0070698_100794794 | |||
| 1128 | Ga0070698_100951962 | |||
| 1129 | Ga0070699_100156279 | |||
| 1130 | Ga0070699_100210167 | |||
| 1131 | Ga0070699_101037458 | |||
| 1132 | Ga0070699_102085164 | |||
| 1133 | Ga0070679_100092789 | |||
| 1134 | Ga0070679_100389512 | |||
| 1135 | Ga0070679_100417362 | |||
| 1136 | Ga0070684_100000054 | |||
| 1137 | Ga0070684_100136825 | |||
| 1138 | Ga0070684_100388699 | |||
| 1139 | Ga0070684_100455953 | |||
| 1140 | Ga0070684_100592991 | |||
| 1141 | Ga0070684_100665544 | |||
| 1142 | Ga0070684_100716497 | |||
| 1143 | Ga0070697_100009880 | |||
| 1144 | Ga0070697_100028395 | |||
| 1145 | Ga0070697_100357229 | |||
| 1146 | Ga0070697_100370898 | |||
| 1147 | Ga0068853_100023327 | |||
| 1148 | Ga0068853_100114516 | |||
| 1149 | Ga0068853_100206206 | |||
| 1150 | Ga0070672_100245143 | |||
| 1151 | Ga0070672_101075883 | |||
| 1152 | Ga0070672_101401315 | |||
| 1153 | Ga0070686_100012274 | |||
| 1154 | Ga0070686_100880303 | |||
| 1155 | Ga0070696_100531235 | |||
| 1156 | Ga0070693_100767359 | |||
| 1157 | Ga0070693_101114091 | |||
| 1158 | Ga0070665_100008511 | |||
| 1159 | Ga0070665_100094352 | |||
| 1160 | Ga0070665_100438693 | |||
| 1161 | Ga0070665_100921690 | |||
| 1162 | Ga0070665_101048599 | |||
| 1163 | Ga0070704_100242669 | |||
| 1164 | Ga0070704_100778257 | |||
| 1165 | Ga0070704_101193586 | |||
| 1166 | Ga0070704_101266580 | |||
| 1167 | Ga0070704_101990699 | |||
| 1168 | Ga0068855_100073361 | |||
| 1169 | Ga0068855_100198801 | |||
| 1170 | Ga0068855_100359009 | |||
| 1171 | Ga0070664_100000429 | |||
| 1172 | Ga0070664_100069193 | |||
| 1173 | Ga0070664_100104376 | |||
| 1174 | Ga0070664_100109619 | |||
| 1175 | Ga0070664_101658014 | |||
| 1176 | Ga0070664_101682841 | |||
| 1177 | Ga0070664_102185810 | |||
| 1178 | Ga0068857_100277991 | |||
| 1179 | Ga0068857_101733891 | |||
| 1180 | Ga0068854_101176085 | |||
| 1181 | Ga0068856_100010994 | |||
| 1182 | Ga0068856_100129963 | |||
| 1183 | Ga0068856_100242484 | |||
| 1184 | Ga0068856_100270945 | |||
| 1185 | Ga0068856_100917688 | |||
| 1186 | Ga0070702_101012174 | |||
| 1187 | Ga0068852_100005439 | |||
| 1188 | Ga0068852_100064608 | |||
| 1189 | Ga0068852_100597041 | |||
| 1190 | Ga0068852_100608984 | |||
| 1191 | Ga0068852_102087248 | |||
| 1192 | Ga0068859_100130119 | |||
| 1193 | Ga0068859_100904244 | |||
| 1194 | Ga0068859_100921090 | |||
| 1195 | Ga0068859_100954886 | |||
| 1196 | Ga0068859_101901834 | |||
| 1197 | Ga0068859_101998400 | |||
| 1198 | Ga0068864_100028205 | |||
| 1199 | Ga0068864_100237934 | |||
| 1200 | Ga0068864_101155019 | |||
| 1201 | Ga0068864_101337500 | |||
| 1202 | Ga0068866_10377416 | |||
| 1203 | Ga0068866_10466148 | |||
| 1204 | Ga0068866_10614773 | |||
| 1205 | Ga0068861_100038986 | |||
| 1206 | Ga0068861_100119391 | |||
| 1207 | Ga0068861_101613322 | |||
| 1208 | Ga0068851_10244281 | |||
| 1209 | Ga0068870_10913108 | |||
| 1210 | Ga0068863_100061832 | |||
| 1211 | Ga0068863_100128062 | |||
| 1212 | Ga0068863_100246980 | |||
| 1213 | Ga0068863_100307574 | |||
| 1214 | Ga0068863_100947194 | |||
| 1215 | Ga0068858_100073050 | |||
| 1216 | Ga0068858_100177003 | |||
| 1217 | Ga0068858_100215999 | |||
| 1218 | Ga0068858_100497062 | |||
| 1219 | Ga0068858_100736135 | |||
| 1220 | Ga0068858_101557522 | |||
| 1221 | Ga0068858_101623579 | |||
| 1222 | Ga0068860_100099512 | |||
| 1223 | Ga0068860_100204041 | |||
| 1224 | Ga0068862_100006466 | |||
| 1225 | Ga0068862_101430546 | |||
| 1226 | Ga0081455_10098481 | |||
| 1227 | Ga0081540_1057212 | |||
| 1228 | Ga0070717_10111222 | |||
| 1229 | Ga0075432_10054280 | |||
| 1230 | Ga0070715_10419075 | |||
| 1231 | Ga0070715_10487328 | |||
| 1232 | Ga0070716_100135127 | |||
| 1233 | Ga0070716_100341716 | |||
| 1234 | Ga0070716_100879235 | |||
| 1235 | Ga0070712_100137726 | |||
| 1236 | Ga0070712_100361168 | |||
| 1237 | Ga0070712_100423952 | |||
| 1238 | Ga0070712_100736079 | |||
| 1239 | Ga0070712_100888122 | |||
| 1240 | Ga0075427_10047844 | |||
| 1241 | Ga0097621_100176822 | |||
| 1242 | Ga0097621_100297807 | |||
| 1243 | Ga0068871_100064651 | |||
| 1244 | Ga0068871_100136514 | |||
| 1245 | Ga0068871_100204734 | |||
| 1246 | Ga0068871_100321774 | |||
| 1247 | Ga0068871_101381673 | |||
| 1248 | Ga0068871_101583694 | |||
| 1249 | Ga0075428_100006969 | |||
| 1250 | Ga0075428_100011058 | |||
| 1251 | Ga0075428_100066811 | |||
| 1252 | Ga0075428_100080785 | |||
| 1253 | Ga0075428_100113991 | |||
| 1254 | Ga0075428_101036352 | |||
| 1255 | Ga0075428_101340096 | |||
| 1256 | Ga0075430_100020197 | |||
| 1257 | Ga0075430_100040478 | |||
| 1258 | Ga0075430_100055472 | |||
| 1259 | Ga0075430_100405334 | |||
| 1260 | Ga0075430_100897739 | |||
| 1261 | Ga0075431_100016283 | |||
| 1262 | Ga0075431_100047196 | |||
| 1263 | Ga0075431_100142497 | |||
| 1264 | Ga0075431_100148788 | |||
| 1265 | Ga0075431_100186537 | |||
| 1266 | Ga0075431_100220189 | |||
| 1267 | Ga0075431_101049218 | |||
| 1268 | Ga0075431_101288169 | |||
| 1269 | Ga0075433_10049848 | |||
| 1270 | Ga0075433_10052858 | |||
| 1271 | Ga0075433_10353727 | |||
| 1272 | Ga0075433_10579015 | |||
| 1273 | Ga0075433_11097116 | |||
| 1274 | Ga0075433_11207419 | |||
| 1275 | Ga0075433_11668255 | |||
| 1276 | Ga0075433_11904649 | |||
| 1277 | Ga0075434_100002206 | |||
| 1278 | Ga0075434_100006938 | |||
| 1279 | Ga0075434_100017597 | |||
| 1280 | Ga0075434_100116157 | |||
| 1281 | Ga0075434_100226063 | |||
| 1282 | Ga0075434_100227931 | |||
| 1283 | Ga0075434_100428246 | |||
| 1284 | Ga0075434_100993264 | |||
| 1285 | Ga0075434_101184433 | |||
| 1286 | Ga0075429_100000755 | |||
| 1287 | Ga0075429_100238244 | |||
| 1288 | Ga0075429_100321390 | |||
| 1289 | Ga0075429_100722214 | |||
| 1290 | Ga0075429_101119836 | |||
| 1291 | Ga0068865_100417556 | |||
| 1292 | Ga0068865_100447892 | |||
| 1293 | Ga0068865_100870328 | |||
| 1294 | Ga0075436_100002140 | |||
| 1295 | Ga0075436_100005842 | |||
| 1296 | Ga0075436_100008477 | |||
| 1297 | Ga0075436_100012163 | |||
| 1298 | Ga0075436_100025764 | |||
| 1299 | Ga0075436_100074663 | |||
| 1300 | Ga0075436_100076220 | |||
| 1301 | Ga0075436_101377117 | |||
| 1302 | Ga0097620_100130124 | |||
| 1303 | Ga0097620_100904254 | |||
| 1304 | Ga0097620_100920981 | |||
| 1305 | Ga0097620_100954867 | |||
| 1306 | Ga0097620_101901806 | |||
| 1307 | Ga0097620_101998792 | |||
| 1308 | Ga0075435_100000818 | |||
| 1309 | Ga0075435_100029136 | |||
| 1310 | Ga0075435_100153700 | |||
| 1311 | Ga0075435_100193164 | |||
| 1312 | Ga0075435_100498910 | |||
| 1313 | Ga0099794_10589745 | |||
| 1314 | Ga0099795_10044068 | |||
| 1315 | Ga0105240_10023146 | |||
| 1316 | Ga0105240_10024118 | |||
| 1317 | Ga0105240_10167204 | |||
| 1318 | Ga0105240_10337558 | |||
| 1319 | Ga0105240_10390858 | |||
| 1320 | Ga0105240_10570475 | |||
| 1321 | Ga0105240_10694611 | |||
| 1322 | Ga0105240_11499492 | |||
| 1323 | Ga0105240_11811546 | |||
| 1324 | Ga0111539_10041453 | |||
| 1325 | Ga0111539_10094245 | |||
| 1326 | Ga0111539_10199880 | |||
| 1327 | Ga0111539_10411544 | |||
| 1328 | Ga0105245_10076950 | |||
| 1329 | Ga0105245_10160703 | |||
| 1330 | Ga0105245_10178116 | |||
| 1331 | Ga0105245_10217542 | |||
| 1332 | Ga0105245_11159008 | |||
| 1333 | Ga0105245_12331805 | |||
| 1334 | Ga0105245_12708008 | |||
| 1335 | Ga0105245_12871018 | |||
| 1336 | Ga0105247_10258550 | |||
| 1337 | Ga0105247_10626215 | |||
| 1338 | Ga0114129_10027137 | |||
| 1339 | Ga0114129_10103464 | |||
| 1340 | Ga0114129_10112953 | |||
| 1341 | Ga0114129_10125339 | |||
| 1342 | Ga0114129_10494631 | |||
| 1343 | Ga0114129_10498130 | |||
| 1344 | Ga0114129_10668681 | |||
| 1345 | Ga0114129_10692176 | |||
| 1346 | Ga0114129_10737408 | |||
| 1347 | Ga0114129_10776111 | |||
| 1348 | Ga0114129_11040261 | |||
| 1349 | Ga0114129_11172062 | |||
| 1350 | Ga0114129_12385171 | |||
| 1351 | Ga0105243_10434156 | |||
| 1352 | Ga0105243_11593046 | |||
| 1353 | Ga0105241_10269721 | |||
| 1354 | Ga0105241_10292895 | |||
| 1355 | Ga0105241_10321449 | |||
| 1356 | Ga0105241_10344608 | |||
| 1357 | Ga0105241_11207800 | |||
| 1358 | Ga0105241_11276604 | |||
| 1359 | Ga0105242_10032979 | |||
| 1360 | Ga0105242_10363364 | |||
| 1361 | Ga0105242_10998914 | |||
| 1362 | Ga0105242_11183154 | |||
| 1363 | Ga0105242_12588244 | |||
| 1364 | Ga0105248_10008930 | |||
| 1365 | Ga0105248_10023512 | |||
| 1366 | Ga0105248_10026910 | |||
| 1367 | Ga0105248_10028027 | |||
| 1368 | Ga0105248_10108561 | |||
| 1369 | Ga0105248_10157658 | |||
| 1370 | Ga0105248_10311351 | |||
| 1371 | Ga0105248_10363950 | |||
| 1372 | Ga0105248_10435918 | |||
| 1373 | Ga0105248_11093256 | |||
| 1374 | Ga0105248_13443543 | |||
| 1375 | Ga0105237_10006068 | |||
| 1376 | Ga0105237_10642128 | |||
| 1377 | Ga0105237_12396420 | |||
| 1378 | Ga0105238_10119937 | |||
| 1379 | Ga0105238_10160188 | |||
| 1380 | Ga0105238_10689625 | |||
| 1381 | Ga0105238_11034181 | |||
| 1382 | Ga0105238_11434234 | |||
| 1383 | Ga0105238_11881687 | |||
| 1384 | Ga0105238_12516255 | |||
| 1385 | Ga0105249_10030842 | |||
| 1386 | Ga0105249_10150091 | |||
| 1387 | Ga0105249_10171360 | |||
| 1388 | Ga0105249_10943496 | |||
| 1389 | Ga0105249_13307597 | |||
| 1390 | Ga0099796_10167549 | |||
| 1391 | Ga0105239_10002868 | |||
| 1392 | Ga0105239_10034331 | |||
| 1393 | Ga0105239_10068903 | |||
| 1394 | Ga0105239_10087446 | |||
| 1395 | Ga0105239_10208975 | |||
| 1396 | Ga0105239_10564483 | |||
| 1397 | Ga0105239_10729011 | |||
| 1398 | Ga0105239_11010919 | |||
| 1399 | Ga0105239_11713235 | |||
| 1400 | Ga0105239_12697274 | |||
| 1401 | Ga0105246_10134818 | |||
| 1402 | Ga0105246_11055761 | |||
| 1403 | Ga0105246_11214746 | |||
| 1404 | Ga0157373_10752718 | |||
| 1405 | Ga0157373_11392305 | |||
| 1406 | Ga0157371_10017063 | |||
| 1407 | Ga0157371_10150294 | |||
| 1408 | Ga0157370_10147985 | |||
| 1409 | Ga0157370_10300527 | |||
| 1410 | Ga0157370_10331947 | |||
| 1411 | Ga0157370_10492740 | |||
| 1412 | Ga0157370_10674049 | |||
| 1413 | Ga0157369_10003263 | |||
| 1414 | Ga0157369_10008271 | |||
| 1415 | Ga0157369_10104798 | |||
| 1416 | Ga0157369_10110505 | |||
| 1417 | Ga0157369_10587580 | |||
| 1418 | Ga0157369_10642222 | |||
| 1419 | Ga0157374_10029367 | |||
| 1420 | Ga0157374_10064449 | |||
| 1421 | Ga0157374_10070096 | |||
| 1422 | Ga0157374_10116110 | |||
| 1423 | Ga0157374_10487174 | |||
| 1424 | Ga0157374_11030440 | |||
| 1425 | Ga0157374_11458237 | |||
| 1426 | Ga0157374_11473907 | |||
| 1427 | Ga0157378_10030859 | |||
| 1428 | Ga0157378_10401954 | |||
| 1429 | Ga0157378_10633784 | |||
| 1430 | Ga0157378_11603301 | |||
| 1431 | Ga0157378_12845562 | |||
| 1432 | Ga0157378_13230333 | |||
| 1433 | Ga0163162_10087793 | |||
| 1434 | Ga0163162_10230897 | |||
| 1435 | Ga0163162_11273280 | |||
| 1436 | Ga0163162_12384734 | |||
| 1437 | Ga0157372_10005353 | |||
| 1438 | Ga0157372_10058201 | |||
| 1439 | Ga0157372_10240476 | |||
| 1440 | Ga0157372_10487074 | |||
| 1441 | Ga0157372_10503268 | |||
| 1442 | Ga0157372_10632388 | |||
| 1443 | Ga0157375_10142181 | |||
| 1444 | Ga0157375_10436595 | |||
| 1445 | Ga0157375_10460530 | |||
| 1446 | Ga0157375_12026705 | |||
| 1447 | Ga0157375_12700265 | |||
| 1448 | Ga0163163_10004648 | |||
| 1449 | Ga0163163_10009250 | |||
| 1450 | Ga0163163_10058764 | |||
| 1451 | Ga0163163_10112229 | |||
| 1452 | Ga0163163_10168736 | |||
| 1453 | Ga0163163_10171136 | |||
| 1454 | Ga0163163_10328780 | |||
| 1455 | Ga0163163_10589023 | |||
| 1456 | Ga0163163_10836591 | |||
| 1457 | Ga0157380_10037297 | |||
| 1458 | Ga0157380_10617657 | |||
| 1459 | Ga0157380_11474812 | |||
| 1460 | Ga0157380_12453515 | |||
| 1461 | Ga0157379_10002406 | |||
| 1462 | Ga0157379_10071438 | |||
| 1463 | Ga0157379_10612218 | |||
| 1464 | Ga0157376_10052985 | |||
| 1465 | Ga0157376_10134207 | |||
| 1466 | Ga0157376_11068689 | |||
| 1467 | Ga0157376_11411770 | |||
| 1468 | Ga0163161_10814537 | |||
| 1469 | Ga0163161_11196058 | |||
| 1470 | Ga0163161_11443026 | |||
| 1471 | Ga0213876_10015860 | |||
| 1472 | Ga0213876_10147482 | |||
| 1473 | Ga0213875_10012717 | |||
| 1474 | Ga0213875_10095566 | |||
| 1475 | Ga0207697_10198365 | |||
| 1476 | Ga0207697_10214383 | |||
| 1477 | Ga0207692_10162571 | |||
| 1478 | Ga0207642_10270533 | |||
| 1479 | Ga0207642_10286090 | |||
| 1480 | Ga0207710_10408713 | |||
| 1481 | Ga0207688_10070886 | |||
| 1482 | Ga0207680_10191820 | |||
| 1483 | Ga0207680_10371992 | |||
| 1484 | Ga0207680_10764389 | |||
| 1485 | Ga0207647_10244577 | |||
| 1486 | Ga0207699_10077514 | |||
| 1487 | Ga0207699_10158020 | |||
| 1488 | Ga0207699_10182138 | |||
| 1489 | Ga0207699_10781293 | |||
| 1490 | Ga0207645_10060604 | |||
| 1491 | Ga0207645_10280313 | |||
| 1492 | Ga0207705_10656434 | |||
| 1493 | Ga0207684_10013488 | |||
| 1494 | Ga0207684_10120833 | |||
| 1495 | Ga0207684_10371371 | |||
| 1496 | Ga0207654_10427248 | |||
| 1497 | Ga0207654_10437115 | |||
| 1498 | Ga0207654_11070495 | |||
| 1499 | Ga0207654_11271248 | |||
| 1500 | Ga0207707_10001181 | |||
| 1501 | Ga0207707_10024626 | |||
| 1502 | Ga0207707_10048678 | |||
| 1503 | Ga0207707_11435172 | |||
| 1504 | Ga0207707_11445500 | |||
| 1505 | Ga0207695_10189608 | |||
| 1506 | Ga0207695_10725961 | |||
| 1507 | Ga0207695_10741101 | |||
| 1508 | Ga0207695_11565023 | |||
| 1509 | Ga0207671_10019297 | |||
| 1510 | Ga0207671_10199060 | |||
| 1511 | Ga0207671_11130037 | |||
| 1512 | Ga0207693_10021001 | |||
| 1513 | Ga0207693_10278693 | |||
| 1514 | Ga0207693_10404578 | |||
| 1515 | Ga0207663_10003342 | |||
| 1516 | Ga0207663_10217587 | |||
| 1517 | Ga0207663_10636971 | |||
| 1518 | Ga0207663_10680851 | |||
| 1519 | Ga0207663_11098784 | |||
| 1520 | Ga0207660_10477433 | |||
| 1521 | Ga0207660_10519667 | |||
| 1522 | Ga0207662_11374064 | |||
| 1523 | Ga0207657_10021795 | |||
| 1524 | Ga0207657_10119922 | |||
| 1525 | Ga0207649_10054600 | |||
| 1526 | Ga0207649_11285295 | |||
| 1527 | Ga0207652_10032917 | |||
| 1528 | Ga0207652_10118922 | |||
| 1529 | Ga0207652_10879950 | |||
| 1530 | Ga0207646_10003444 | |||
| 1531 | Ga0207646_10060644 | |||
| 1532 | Ga0207646_10307857 | |||
| 1533 | Ga0207646_10703524 | |||
| 1534 | Ga0207646_11249092 | |||
| 1535 | Ga0207694_10001610 | |||
| 1536 | Ga0207694_10080599 | |||
| 1537 | Ga0207694_10103409 | |||
| 1538 | Ga0207694_11486593 | |||
| 1539 | Ga0207650_10023277 | |||
| 1540 | Ga0207650_10027993 | |||
| 1541 | Ga0207659_10214675 | |||
| 1542 | Ga0207659_10240316 | |||
| 1543 | Ga0207659_10599154 | |||
| 1544 | Ga0207659_10772720 | |||
| 1545 | Ga0207687_10234748 | |||
| 1546 | Ga0207687_10599487 | |||
| 1547 | Ga0207687_11454843 | |||
| 1548 | Ga0207700_10004781 | |||
| 1549 | Ga0207700_10010761 | |||
| 1550 | Ga0207700_10043541 | |||
| 1551 | Ga0207700_10406603 | |||
| 1552 | Ga0207700_10941408 | |||
| 1553 | Ga0207700_11696680 | |||
| 1554 | Ga0207664_10018371 | |||
| 1555 | Ga0207664_10153069 | |||
| 1556 | Ga0207664_10412305 | |||
| 1557 | Ga0207664_11656346 | |||
| 1558 | Ga0207644_10161713 | |||
| 1559 | Ga0207690_10749246 | |||
| 1560 | Ga0207706_10181762 | |||
| 1561 | Ga0207706_10198275 | |||
| 1562 | Ga0207706_10271530 | |||
| 1563 | Ga0207686_10046439 | |||
| 1564 | Ga0207686_10361601 | |||
| 1565 | Ga0207686_10621545 | |||
| 1566 | Ga0207709_10273146 | |||
| 1567 | Ga0207670_11224636 | |||
| 1568 | Ga0207669_10040467 | |||
| 1569 | Ga0207669_10353121 | |||
| 1570 | Ga0207669_10522728 | |||
| 1571 | Ga0207704_10372271 | |||
| 1572 | Ga0207704_11315397 | |||
| 1573 | Ga0207704_11881185 | |||
| 1574 | Ga0207665_10069172 | |||
| 1575 | Ga0207665_10475706 | |||
| 1576 | Ga0207665_10574221 | |||
| 1577 | Ga0207665_10632679 | |||
| 1578 | Ga0207665_10876525 | |||
| 1579 | Ga0207665_11255119 | |||
| 1580 | Ga0207691_10047571 | |||
| 1581 | Ga0207691_10723356 | |||
| 1582 | Ga0207711_10018002 | |||
| 1583 | Ga0207711_10027298 | |||
| 1584 | Ga0207711_10048463 | |||
| 1585 | Ga0207711_10082109 | |||
| 1586 | Ga0207711_10172931 | |||
| 1587 | Ga0207711_10213137 | |||
| 1588 | Ga0207711_10258724 | |||
| 1589 | Ga0207711_10286441 | |||
| 1590 | Ga0207711_10322802 | |||
| 1591 | Ga0207711_10492133 | |||
| 1592 | Ga0207711_10683166 | |||
| 1593 | Ga0207711_11256362 | |||
| 1594 | Ga0207689_11693903 | |||
| 1595 | Ga0207661_10000010 | |||
| 1596 | Ga0207661_10012391 | |||
| 1597 | Ga0207661_10028897 | |||
| 1598 | Ga0207661_10184472 | |||
| 1599 | Ga0207661_10227028 | |||
| 1600 | Ga0207661_10478684 | |||
| 1601 | Ga0207661_12040114 | |||
| 1602 | Ga0207679_10010245 | |||
| 1603 | Ga0207679_10264212 | |||
| 1604 | Ga0207679_10355022 | |||
| 1605 | Ga0207679_10510667 | |||
| 1606 | Ga0207667_10012725 | |||
| 1607 | Ga0207667_10130145 | |||
| 1608 | Ga0207667_10158095 | |||
| 1609 | Ga0207667_10416459 | |||
| 1610 | Ga0207712_10031792 | |||
| 1611 | Ga0207712_10326261 | |||
| 1612 | Ga0207712_10399305 | |||
| 1613 | Ga0207712_10722541 | |||
| 1614 | Ga0207668_10070147 | |||
| 1615 | Ga0207668_10155136 | |||
| 1616 | Ga0207668_10287646 | |||
| 1617 | Ga0207640_11246048 | |||
| 1618 | Ga0207640_11389366 | |||
| 1619 | Ga0207640_11595738 | |||
| 1620 | Ga0207658_10013205 | |||
| 1621 | Ga0207677_10091894 | |||
| 1622 | Ga0207677_10907064 | |||
| 1623 | Ga0207703_10394772 | |||
| 1624 | Ga0207703_10400235 | |||
| 1625 | Ga0207703_11180974 | |||
| 1626 | Ga0207703_11422815 | |||
| 1627 | Ga0207703_11929476 | |||
| 1628 | Ga0207639_10025964 | |||
| 1629 | Ga0207639_10206817 | |||
| 1630 | Ga0207639_10393897 | |||
| 1631 | Ga0207639_10398004 | |||
| 1632 | Ga0207639_10769490 | |||
| 1633 | Ga0207639_10865840 | |||
| 1634 | Ga0207639_11569980 | |||
| 1635 | Ga0207678_10108885 | |||
| 1636 | Ga0207678_10466975 | |||
| 1637 | Ga0207708_10172526 | |||
| 1638 | Ga0207708_10541482 | |||
| 1639 | Ga0207708_10867249 | |||
| 1640 | Ga0207702_10020562 | |||
| 1641 | Ga0207702_10100039 | |||
| 1642 | Ga0207702_11165730 | |||
| 1643 | Ga0207702_12453929 | |||
| 1644 | Ga0207641_10039620 | |||
| 1645 | Ga0207641_10049845 | |||
| 1646 | Ga0207641_10294787 | |||
| 1647 | Ga0207641_10597919 | |||
| 1648 | Ga0207648_10582968 | |||
| 1649 | Ga0207648_11142081 | |||
| 1650 | Ga0207676_10026037 | |||
| 1651 | Ga0207676_10158346 | |||
| 1652 | Ga0207676_10236302 | |||
| 1653 | Ga0207676_10731947 | |||
| 1654 | Ga0207676_11080145 | |||
| 1655 | Ga0207676_11178826 | |||
| 1656 | Ga0207674_10011373 | |||
| 1657 | Ga0207674_11178701 | |||
| 1658 | Ga0207675_100012198 | |||
| 1659 | Ga0207675_100029143 | |||
| 1660 | Ga0207675_100144971 | |||
| 1661 | Ga0207675_100460974 | |||
| 1662 | Ga0207683_10099986 | |||
| 1663 | Ga0207683_10155544 | |||
| 1664 | Ga0207683_10283445 | |||
| 1665 | Ga0207683_10870965 | |||
| 1666 | Ga0207683_10966538 | |||
| 1667 | Ga0207683_11224872 | |||
| 1668 | Ga0207683_11370538 | |||
| 1669 | Ga0207698_10213940 | |||
| 1670 | Ga0207698_10643476 | |||
| 1671 | Ga0207698_10714014 | |||
| 1672 | Ga0207428_10001006 | |||
| 1673 | Ga0207428_10248757 | |||
| 1674 | Ga0268266_10072808 | |||
| 1675 | Ga0268266_10092909 | |||
| 1676 | Ga0268265_10133788 | |||
| 1677 | Ga0268265_10468815 | |||
| 1678 | Ga0268265_11710056 | |||
| 1679 | Ga0268264_10201566 | |||
| 1680 | Ga0268264_10768611 | |||
| 1681 | Ga0268264_11676659 | |||
| 1682 | Ga0265762_1093827 | |||
| 1683 | Ga0265760_10197460 | |||
| 1684 | Ga0265332_10009769 | |||
| 1685 | Ga0265325_10026577 | |||
| 1686 | Ga0265331_10099545 | |||
| 1687 | Ga0265316_10220670 | |||
| 1688 | Ga0265314_10037637 | |||
| 1689 | Ga0265342_10105690 | |||
| 1690 | Ga0307414_11803115 | |||
| 1691 | Ga0373926_0007028 | |||
| 1692 | Ga0373926_0202018 | |||
| 1693 | Ga0373926_0311775 | |||
| 1694 | Ga0373934_0375175 | |||
| 1695 | Ga0373923_0009317 | |||
| 1696 | Ga0373936_0016123 | |||
| 1697 | Ga0373941_0308209 | |||
| 1698 | Ga0373945_0043915 | |||
| 1699 | Ga0373945_0126345 | |||
| 1700 | Ga0373945_0238988 | |||
| 1701 | Ga0373954_0293087 | |||
| 1702 | Ga0373954_0358536 | |||
| 1703 | Ga0373954_0395252 | |||
| 1704 | Ga0373943_0003012 | |||
| 1705 | Ga0373943_0031491 | |||
| 1706 | Ga0373943_0044802 | |||
| 1707 | Ga0373943_0214327 | |||
| 1708 | Ga0373946_0003104 | |||
| 1709 | Ga0373946_0025505 | |||
| 1710 | Ga0373946_0035666 | |||
| 1711 | Ga0373955_0073387 | |||
| 1712 | Ga0373955_0517892 | |||
| 1713 | Ga0373955_0590059 | |||
| 1714 | Ga0373924_0216248 | |||
| 1715 | Ga0373935_0011813 | |||
| 1716 | Ga0373935_0057743 | |||
| 1717 | Ga0373935_0179529 | |||
| 1718 | Ga0373935_0774046 | |||
| 1719 | Ga0373927_0003854 | |||
| 1720 | Ga0373927_0748048 | |||
| 1721 | Ga0373927_0768522 | |||
| 1722 | Ga0373927_1175678 | |||
| 1723 | Ga0373947_0018436 | |||
| 1724 | Ga0373947_0030921 | |||
| 1725 | Ga0373947_0094595 | |||
| 1726 | Ga0373947_0588915 | |||
| 1727 | Ga0373937_1379667 | |||
| 1728 | Ga0373937_1838533 | |||
| 1729 | Ga0373925_0002700 | |||
| 1730 | Ga0373925_0005483 | |||
| 1731 | Ga0373925_0013538 | |||
| 1732 | Ga0373925_0095111 | |||
| 1733 | Ga0373925_0510655 | |||
| 1734 | Ga0373925_0584680 | |||
| 1735 | Ga0395898_0426842 | |||
| 1736 | Ga0436364_0610209 | |||
| 1737 | Ga0436364_0723473 | |||
| 1738 | Ga0436364_1510264 | |||
| 1739 | Ga0436365_0125216 | |||
| 1740 | Ga0436365_0638243 | |||
| 1741 | Ga0436365_0702324 | |||
| 1742 | Ga0436365_0943435 | |||
| 1743 | Ga0436363_0790301 | |||
| 1744 | Ga0436362_0362587 | |||
| 1745 | Ga0436362_0722225 | |||
| 1746 | Ga0436362_1283006 | |||
| 1747 | Ga0439453_0021268 | |||
| 1748 | Ga0439453_0092611 | |||
| 1749 | Ga0451802_1996443 | |||
| 1750 | Ga0439435_0015772 | |||
| 1751 | Ga0439435_0061084 | |||
| 1752 | Ga0439444_0120426 | |||
| 1753 | Ga0439464_0032708 | |||
| 1754 | Ga0439464_0070956 | |||
| 1755 | Ga0439460_0139028 | |||
| 1756 | Ga0439460_0277344 | |||
| 1757 | Ga0450916_091990 | |||
| 1758 | Ga0451577_0017419 | |||
| 1759 | Ga0451577_1019402 | |||
| 1760 | Ga0439440_0125780 | |||
| 1761 | Ga0453683_1078637 | |||
| 1762 | Ga0466961_0199808 | |||
| 1763 | Ga0466961_0986456 | |||
| 1764 | Ga0466963_0284189 | |||
| 1765 | Ga0466971_0211668 | |||
| 1766 | Ga0451576_0215981 | |||
| 1767 | Ga0451576_2663837 | |||
| 1768 | Ga0466958_0440668 | |||
| 1769 | Ga0466967_0161446 | |||
| 1770 | Ga0495592_0313965 | |||
| 1771 | Ga0495651_0192992 | |||
| 1772 | Ga0495580_0012488 | |||
| 1773 | Ga0495580_0178600 | |||
| 1774 | Ga0495580_0229175 | |||
| 1775 | Ga0495580_0325673 | |||
| 1776 | Ga0495580_0656215 | |||
| 1777 | Ga0495580_0754513 | |||
| 1778 | Ga0495582_0005784 | |||
| 1779 | Ga0495639_0123086 | |||
| 1780 | Ga0495664_0320398 | |||
| 1781 | Ga0495594_0014437 | |||
| 1782 | Ga0495608_0765985 | |||
| 1783 | Ga0495628_0129961 | |||
| 1784 | Ga0495630_0020273 | |||
| 1785 | Ga0495630_0629313 | |||
| 1786 | Ga0495643_0005221 | |||
| 1787 | Ga0495666_0376483 | |||
| 1788 | Ga0495665_0200204 | |||
| 1789 | Ga0495640_0252757 | |||
| 1790 | Ga0495586_0224920 | |||
| 1791 | Ga0495586_0446981 | |||
| 1792 | Ga0495587_0064353 | |||
| 1793 | Ga0495587_0438294 | |||
| 1794 | Ga0495587_0642001 | |||
| 1795 | Ga0495667_0167486 | |||
| 1796 | Ga0495667_0679124 | |||
| 1797 | Ga0495667_0883091 | |||
| 1798 | Ga0495634_0406922 | |||
| 1799 | Ga0495635_0306302 | |||
| 1800 | Ga0495635_0654709 | |||
| 1801 | Ga0495659_0524157 | |||
| 1802 | Ga0495599_0300308 | |||
| 1803 | Ga0495599_0770207 | |||
| 1804 | Ga0495623_0377351 | |||
| 1805 | Ga0495647_0384112 | |||
| 1806 | Ga0495658_0149357 | |||
| 1807 | Ga0495658_0428033 | |||
| 1808 | Ga0495624_0294304 | |||
| 1809 | Ga0495581_0220685 | |||
| 1810 | Ga0495604_0062019 | |||
| 1811 | Ga0495674_0354884 | |||
| 1812 | Ga0495674_1194235 | |||
| 1813 | Ga0495676_0402495 | |||
| 1814 | Ga0495675_0281183 | |||
| 1815 | Ga0495684_0194558 | |||
| 1816 | Ga0495684_0197155 | |||
| 1817 | Ga0495684_0737969 | |||
| 1818 | Ga0495602_0165155 | |||
| 1819 | Ga0495602_0392321 | |||
| 1820 | Ga0495602_0527236 | |||
| 1821 | Ga0495614_0223622 | |||
| 1822 | Ga0496100_0067158 | |||
| 1823 | Ga0496101_0810119 | |||
| 1824 | Ga0496103_0300988 | |||
| 1825 | Ga0496104_0024493 | |||
| 1826 | Ga0496104_0296366 | |||
| 1827 | Ga0496104_1205653 | |||
| 1828 | Ga0496104_1284075 | |||
| 1829 | Ga0496105_0117039 | |||
| 1830 | Ga0496105_0492050 | |||
| 1831 | Ga0496106_0110862 | |||
| 1832 | Ga0496106_0618422 | |||
| 1833 | Ga0496106_1342968 | |||
| 1834 | Ga0496107_0114092 | |||
| 1835 | Ga0496108_0001958 | |||
| 1836 | Ga0496108_0437881 | |||
| 1837 | Ga0496109_0044494 | |||
| 1838 | Ga0496111_0006232 | |||
| 1839 | Ga0496111_0107477 | |||
| 1840 | Ga0496112_0019877 | |||
| 1841 | Ga0496112_0310483 | |||
| 1842 | Ga0496112_0491064 | |||
| 1843 | Ga0496113_0106054 | |||
| 1844 | Ga0496113_0193151 | |||
| 1845 | Ga0496114_0207199 | |||
| 1846 | Ga0496115_0020025 | |||
| 1847 | Ga0496115_0154592 | |||
| 1848 | Ga0496115_0549015 | |||
| 1849 | Ga0501290_057026 | |||
| 1850 | Ga0501031_0001424 | |||
| 1851 | Ga0501031_0006360 | |||
| 1852 | Ga0501032_0004150 | |||
| 1853 | Ga0501032_0035204 | |||
| 1854 | Ga0501032_0041737 | |||
| 1855 | Ga0501032_0161476 | |||
| 1856 | Ga0501033_0000613 | |||
| 1857 | Ga0501033_0010819 | |||
| 1858 | Ga0501033_0019393 | |||
| 1859 | Ga0501033_0024950 | |||
| 1860 | Ga0501034_0039838 | |||
| 1861 | Ga0501034_0054158 | |||
| 1862 | Ga0501034_0105861 | |||
| 1863 | Ga0501034_0237316 | |||
| 1864 | Ga0501036_0000820 | |||
| 1865 | Ga0501036_0038464 | |||
| 1866 | Ga0501036_0042429 | |||
| 1867 | Ga0501036_0143920 | |||
| 1868 | Ga0501037_0003364 | |||
| 1869 | Ga0501037_0004775 | |||
| 1870 | Ga0501037_0008586 | |||
| 1871 | Ga0501037_0331711 | |||
| 1872 | Ga0501038_0001876 | |||
| 1873 | Ga0501038_0035608 | |||
| 1874 | Ga0501038_0132536 | |||
| 1875 | Ga0501038_0233016 | |||
| 1876 | Ga0501039_1211309 | |||
| 1877 | Ga0501040_0483030 | |||
| 1878 | Ga0501041_0066292 | |||
| 1879 | Ga0501042_0021800 | |||
| 1880 | Ga0501043_0002642 | |||
| 1881 | Ga0501043_0008095 | |||
| 1882 | Ga0501043_0010081 | |||
| 1883 | Ga0501043_0010169 | |||
| 1884 | Ga0501046_0015105 | |||
| 1885 | Ga0501046_0056805 | |||
| 1886 | Ga0501046_0065339 | |||
| 1887 | Ga0501047_0019870 | |||
| 1888 | Ga0501047_0040581 | |||
| 1889 | Ga0501047_0053635 | |||
| 1890 | Ga0501047_0322025 | |||
| 1891 | Ga0501048_0050907 | |||
| 1892 | Ga0501048_0060886 | |||
| 1893 | Ga0501048_0368305 | |||
| 1894 | Ga0501067_0000638 | |||
| 1895 | Ga0501067_0024116 | |||
| 1896 | Ga0501068_0001033 | |||
| 1897 | Ga0501068_0005356 | |||
| 1898 | Ga0501068_0009482 | |||
| 1899 | Ga0501069_0012380 | |||
| 1900 | Ga0501069_0016210 | |||
| 1901 | Ga0501069_0086510 | |||
| 1902 | Ga0501070_0003990 | |||
| 1903 | Ga0501070_0011406 | |||
| 1904 | Ga0501070_0013460 | |||
| 1905 | Ga0501070_0136681 | |||
| 1906 | Ga0501071_0082233 | |||
| 1907 | Ga0501071_0173908 | |||
| 1908 | Ga0501071_1574114 | |||
| 1909 | Ga0501072_0389358 | |||
| 1910 | Ga0501072_1161108 | |||
| 1911 | Ga0501073_0001003 | |||
| 1912 | Ga0501073_0016244 | |||
| 1913 | Ga0501073_0044287 | |||
| 1914 | Ga0501073_0243672 | |||
| 1915 | Ga0501074_0003949 | |||
| 1916 | Ga0501074_0007234 | |||
| 1917 | Ga0501075_0273382 | |||
| 1918 | Ga0501075_0609373 | |||
| 1919 | Ga0501076_0000623 | |||
| 1920 | Ga0501076_0035267 | |||
| 1921 | Ga0501217_270203 | |||
| 1922 | Ga0501230_102518 | |||
| 1923 | Ga0501243_124551 | |||
| 1924 | Ga0501249_008075 | |||
| 1925 | Ga0501221_007321 | |||
| 1926 | Ga0501234_036912 | |||
| 1927 | Ga0501079_0002604 | |||
| 1928 | Ga0501079_0018156 | |||
| 1929 | Ga0501079_0023004 | |||
| 1930 | Ga0501079_0126922 | |||
| 1931 | Ga0501080_0014127 | |||
| 1932 | Ga0501080_0015677 | |||
| 1933 | Ga0501080_0073946 | |||
| 1934 | Ga0501080_0264975 | |||
| 1935 | Ga0501080_0576533 | |||
| 1936 | Ga0501081_0007300 | |||
| 1937 | Ga0501083_0041932 | |||
| 1938 | Ga0501083_0283044 | |||
| 1939 | Ga0501265_049265 | |||
| 1940 | Ga0501268_015624 | |||
| 1941 | Ga0501270_019776 | |||
| 1942 | Ga0501035_0022213 | |||
| 1943 | Ga0501035_0023213 | |||
| 1944 | Ga0501035_0047013 | |||
| 1945 | Ga0501035_0159342 | |||
| 1946 | Ga0501044_0018629 | |||
| 1947 | Ga0501044_0086278 | |||
| 1948 | Ga0501044_0086397 | |||
| 1949 | Ga0501044_0305192 | |||
| 1950 | Ga0501044_0944580 | |||
| 1951 | Ga0501045_0041337 | |||
| 1952 | Ga0501045_0563734 | |||
| 1953 | Ga0501045_1163247 | |||
| 1954 | nmdc:mga05p37_112411_c1 | |||
| 1955 | nmdc:mga05p37_1552876_c1 | |||
| 1956 | nmdc:mga05p37_243147_c1 | |||
| 1957 | nmdc:mga05p37_287208_c1 | |||
| 1958 | nmdc:mga05p37_294097_c1 | |||
| 1959 | nmdc:mga05p37_328625_c1 | |||
| 1960 | nmdc:mga05p37_463609_c1 | |||
| 1961 | nmdc:mga05p37_611370_c1 | |||
| 1962 | nmdc:mga05p37_690180_c1 | |||
| 1963 | nmdc:mga05p37_779008_c1 | |||
| 1964 | nmdc:mga05p37_94860_c1 | |||
| 1965 | nmdc:mga09592_1223_c1 | |||
| 1966 | nmdc:mga09592_18963_c1 | |||
| 1967 | nmdc:mga09592_219372_c1 | |||
| 1968 | nmdc:mga09592_289129_c1 | |||
| 1969 | nmdc:mga09592_385820_c1 | |||
| 1970 | nmdc:mga09592_408647_c1 | |||
| 1971 | nmdc:mga09592_889224_c1 | |||
| 1972 | nmdc:mga0qj67_101801_c1 | |||
| 1973 | nmdc:mga0qj67_1088088_c1 | |||
| 1974 | nmdc:mga0qj67_513931_c1 | |||
| 1975 | nmdc:mga0qj67_52233_c1 | |||
| 1976 | nmdc:mga0qj67_73680_c1 | |||
| 1977 | nmdc:mga0qj67_76574_c1 | |||
| 1978 | nmdc:mga06r32_116400_c1 | |||
| 1979 | nmdc:mga06r32_123463_c1 | |||
| 1980 | nmdc:mga06r32_1240330_c1 | |||
| 1981 | nmdc:mga06r32_188535_c1 | |||
| 1982 | nmdc:mga06r32_200840_c1 | |||
| 1983 | nmdc:mga06r32_21774_c1 | |||
| 1984 | nmdc:mga06r32_23037_c1 | |||
| 1985 | nmdc:mga06r32_380091_c1 | |||
| 1986 | nmdc:mga06r32_548106_c1 | |||
| 1987 | nmdc:mga06r32_646060_c1 | |||
| 1988 | nmdc:mga06r32_68404_c1 | |||
| 1989 | nmdc:mga08y16_340126_c1 | |||
| 1990 | nmdc:mga08y16_374030_c1 | |||
| 1991 | nmdc:mga08y16_4391_c1 | |||
| 1992 | nmdc:mga08y16_716440_c1 | |||
| 1993 | nmdc:mga0n895_1451010_c1 | |||
| 1994 | nmdc:mga0n895_21637_c1 | |||
| 1995 | nmdc:mga0n895_245362_c1 | |||
| 1996 | nmdc:mga0n895_255170_c1 | |||
| 1997 | nmdc:mga0n895_3216_c1 | |||
| 1998 | nmdc:mga0n895_398756_c1 | |||
| 1999 | nmdc:mga0n895_846680_c1 | |||
| 2000 | nmdc:mga0n895_963_c1 | |||
| 2001 | nmdc:mga0rr50_104743_c1 | |||
| 2002 | nmdc:mga0rr50_1095239_c1 | |||
| 2003 | nmdc:mga0rr50_192501_c1 | |||
| 2004 | nmdc:mga0rr50_203_c1 | |||
| 2005 | nmdc:mga0rr50_28685_c1 | |||
| 2006 | nmdc:mga0rr50_44121_c1 | |||
| 2007 | nmdc:mga08x19_115673_c1 | |||
| 2008 | nmdc:mga08x19_19068_c1 | |||
| 2009 | nmdc:mga08x19_329_c1 | |||
| 2010 | nmdc:mga08x19_5733_c1 | |||
| 2011 | nmdc:mga08x19_69367_c1 | |||
| 2012 | nmdc:mga08x19_8576_c1 | |||
| 2013 | nmdc:mga0a205_1029577_c1 | |||
| 2014 | nmdc:mga0a205_12285_c2 | |||
| 2015 | nmdc:mga0a205_14411_c1 | |||
| 2016 | nmdc:mga0a205_58173_c1 | |||
| 2017 | nmdc:mga0a205_78048_c1 | |||
| 2018 | Ga0500646_0022798 | |||
| 2019 | Ga0501084_0009701 | |||
| 2020 | Ga0501084_0021475 | |||
| 2021 | Ga0501084_0663205 | |||
| 2022 | Ga0501084_0745348 | |||
| 2023 | Ga0501084_0991592 | |||
| 2024 | Ga0501082_0000433 | |||
| 2025 | Ga0501082_0008898 | |||
| 2026 | Ga0501082_0017814 | |||
| 2027 | Ga0501082_0084903 | |||
| 2028 | Ga0501082_0285419 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hhh-assembly1.cif.gz_B | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.9553 | 11 | 106 |
| 6abq-assembly1.cif.gz_A | crystal structure of transcription factor from listeria monocytogenes | 0.927 | 9 | 106 |
| 3l7w-assembly1.cif.gz_A-2 | the crystal structure of smu.1704 from streptococcus mutans ua159 | 0.9245 | 6 | 108 |
| 3hhh-assembly1.cif.gz_A | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.9237 | 9 | 108 |
| 1xma-assembly1.cif.gz_B-2 | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9149 | 10 | 104 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57682_5_95_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9085 | 13 | 82 | 1.10.10.10 |
| 1xmaA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9056 | 10 | 104 | 1.10.10.10 |
| 5dymA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9027 | 11 | 107 | 1.10.10.10 |
| 4esbA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9017 | 9 | 107 | 1.10.10.10 |
| 3l7wA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9009 | 6 | 106 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N9MU15-F1-model_v4 | Transcriptional regulator, PadR family | 0.9826 | 16 | 108 |
|
| AF-A0A2V8J1R4-F1-model_v4 | PadR family transcriptional regulator | 0.9821 | 10 | 108 |
|
| AF-A0A416EI77-F1-model_v4 | PadR family transcriptional regulator | 0.9793 | 10 | 108 |
|
| AF-A0A2E8EBH7-F1-model_v4 | PadR family transcriptional regulator | 0.9788 | 10 | 107 |
|
| AF-A0A844J8G6-F1-model_v4 | deleted | 0.9781 | 10 | 108 |
|