F488217

General Info

Members Datasets Scaffolds Average Seq Length
1014 326 1003 149

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10108752|Ga0157369_101087521
Length 167
Sequence VSTDNVNVDVADAAPGRSSGPLDIGRVMAALPHRYPMLLVDRVVDLVPDTSISAIKAVSMNEQFFQGHFPGRPIMPGVLIVEAMAQAAGILAVESLGLAGSGKLVYFMAIDGAKFRKPVEPGVLLQLDVTFVQKRASVCKFAGRALVDGQLVAGANFTAMIADPPKA

Samples

Sample ID Description Type Environment
1 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
2 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
3 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
4 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
5 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
6 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
7 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
8 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
9 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
10 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
11 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
12 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
17 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
18 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
19 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
111 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
112 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
186 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
200 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
201 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
202 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
215 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
216 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
217 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
218 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
219 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
220 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
221 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
222 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
223 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
224 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
225 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
226 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
227 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
228 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
229 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
230 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
231 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
232 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
233 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
234 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
235 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
236 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
237 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
238 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
239 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
240 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
241 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
242 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
243 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
244 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
245 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
246 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
247 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
248 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
249 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
250 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
251 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
252 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
253 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
254 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
255 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
256 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
257 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
258 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
259 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
260 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
261 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
262 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
263 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
264 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
265 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
266 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
267 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
268 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
283 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
284 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
285 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
286 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
287 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
288 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
289 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
290 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
291 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
297 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
298 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
299 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
300 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
301 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
302 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
303 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
304 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
307 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
308 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
309 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
310 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
311 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
312 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
313 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
314 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
315 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
316 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
317 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
318 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
319 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
320 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
321 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
322 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
323 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
324 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
325 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
326 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 0
Isolates 1.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.61
Nodule 0
Rhizoplane 5.82
Rhizosphere 84.22
Stem 0
Stem Tuber 0
Unclassified 3.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1013644 3300001915 Bacteria 1375
2 JGI24740J21852_10003897 3300001979 Bacteria 6477
3 JGI24740J21852_10049950 3300001979 Bacteria 1205
4 JGI24739J22299_10002463 3300001989 Bacteria 7140
5 JGI24739J22299_10003529 3300001989 Bacteria 5972
6 JGI24739J22299_10003849 3300001989 Bacteria 5728
7 JGI24739J22299_10006074 3300001989 Bacteria 4566
8 JGI24737J22298_10000173 3300001990 Bacteria 20836
9 JGI24737J22298_10002968 3300001990 Bacteria 6011
10 JGI24737J22298_10011745 3300001990 Bacteria 2864
11 JGI24743J22301_10096099 3300001991 Bacteria 635
12 JGI24735J21928_10000757 3300002067 Bacteria 11475
13 JGI24735J21928_10001022 3300002067 Bacteria 10004
14 JGI24735J21928_10029333 3300002067 Bacteria 1638
15 JGI24735J21928_10032904 3300002067 Bacteria 1534
16 JGI24738J21930_10000726 3300002075 Bacteria 9484
17 JGI24738J21930_10007828 3300002075 Bacteria 2451
18 JGI24738J21930_10042868 3300002075 Bacteria 920
19 JGI25151J46595_10023505 3300003187 Bacteria 2538
20 JGI25153J46596_10000002 3300003215 Bacteria 653569
21 JGI25153J46596_10000248 3300003215 Bacteria 44326
22 JGI25153J46596_10000266 3300003215 Bacteria 41550
23 JGI25153J46596_10007611 3300003215 Bacteria 5295
24 Ga0055537_1001063 3300003773 Bacteria 12268
25 Ga0055537_1006552 3300003773 Bacteria 2933
26 Ga0055524_1001182 3300003775 Bacteria 15575
27 Ga0055536_1042845 3300003781 Bacteria 1055
28 Ga0055530_10000978 3300003791 Bacteria 23058
29 Ga0055530_10005504 3300003791 Bacteria 5992
30 Ga0055530_10005629 3300003791 Bacteria 5871
31 Ga0055530_10035868 3300003791 Bacteria 1253
32 Ga0055531_10002842 3300003794 Bacteria 11326
33 Ga0055531_10005946 3300003794 Bacteria 7015
34 Ga0065165_1008563 3300005262 Bacteria 4757
35 Ga0065165_1011492 3300005262 Bacteria 3686
36 Ga0065715_10360954 3300005293 Bacteria 935
37 Ga0070658_10000941 3300005327 Bacteria 24948
38 Ga0070658_10006985 3300005327 Bacteria 9120
39 Ga0070658_10019735 3300005327 Bacteria 5397
40 Ga0070658_10032145 3300005327 Bacteria 4219
41 Ga0070658_10113125 3300005327 Bacteria 2250
42 Ga0070658_10128944 3300005327 Bacteria 2107
43 Ga0070658_10202749 3300005327 Bacteria 1674
44 Ga0070658_10983735 3300005327 Bacteria 734
45 Ga0070676_10059361 3300005328 Bacteria 2269
46 Ga0070676_10096806 3300005328 Bacteria 1817
47 Ga0070676_10125260 3300005328 Bacteria 1618
48 Ga0070683_100001130 3300005329 Bacteria 20183
49 Ga0070683_100012089 3300005329 Bacteria 7489
50 Ga0070690_100000954 3300005330 Bacteria 14715
51 Ga0070690_100004532 3300005330 Bacteria 7723
52 Ga0070690_100055164 3300005330 Bacteria 2545
53 Ga0070670_100000051 3300005331 Bacteria 131351
54 Ga0070670_100003725 3300005331 Bacteria 12687
55 Ga0070670_100009485 3300005331 Bacteria 8312
56 Ga0070670_100177521 3300005331 Bacteria 1848
57 Ga0070670_100341345 3300005331 Bacteria 1315
58 Ga0070677_10034600 3300005333 Bacteria 1953
59 Ga0068869_100071630 3300005334 Bacteria 2567
60 Ga0070666_10000218 3300005335 Bacteria 39122
61 Ga0070666_10000523 3300005335 Bacteria 23274
62 Ga0070666_10002197 3300005335 Bacteria 11823
63 Ga0070666_10003372 3300005335 Bacteria 9687
64 Ga0070666_10012898 3300005335 Bacteria 5286
65 Ga0070666_10137968 3300005335 Bacteria 1698
66 Ga0070666_10407070 3300005335 Bacteria 979
67 Ga0070680_100000206 3300005336 Bacteria 38666
68 Ga0070680_100002981 3300005336 Bacteria 12577
69 Ga0070680_100009340 3300005336 Bacteria 7535
70 Ga0070680_100039872 3300005336 Bacteria 3800
71 Ga0070680_100046154 3300005336 Bacteria 3543
72 Ga0070680_100110499 3300005336 Bacteria 2288
73 Ga0070680_101051297 3300005336 Bacteria 703
74 Ga0070680_101164815 3300005336 Bacteria 666
75 Ga0070682_100059172 3300005337 Bacteria 2419
76 Ga0070682_100513816 3300005337 Bacteria 930
77 Ga0070682_100566299 3300005337 Bacteria 892
78 Ga0070682_100790826 3300005337 Bacteria 770
79 Ga0068868_100012329 3300005338 Bacteria 6246
80 Ga0068868_100017173 3300005338 Bacteria 5385
81 Ga0068868_100024853 3300005338 Bacteria 4549
82 Ga0068868_100849573 3300005338 Bacteria 827
83 Ga0070660_100000460 3300005339 Bacteria 27094
84 Ga0070660_100021732 3300005339 Bacteria 4736
85 Ga0070660_100038204 3300005339 Bacteria 3643
86 Ga0070660_100042943 3300005339 Bacteria 3453
87 Ga0070660_100059871 3300005339 Bacteria 2954
88 Ga0070660_100077529 3300005339 Bacteria 2604
89 Ga0070660_100134213 3300005339 Bacteria 1982
90 Ga0070660_100152430 3300005339 Bacteria 1859
91 Ga0070689_100666965 3300005340 Bacteria 906
92 Ga0070691_10006865 3300005341 Bacteria 5205
93 Ga0070687_100154071 3300005343 Bacteria 1352
94 Ga0070661_100000112 3300005344 Bacteria 67887
95 Ga0070661_100002617 3300005344 Bacteria 12325
96 Ga0070661_100012935 3300005344 Bacteria 5846
97 Ga0070661_100023427 3300005344 Bacteria 4424
98 Ga0070661_100029911 3300005344 Bacteria 3933
99 Ga0070661_100030687 3300005344 Bacteria 3884
100 Ga0070661_100038123 3300005344 Bacteria 3498
101 Ga0070661_100087760 3300005344 Bacteria 2301
102 Ga0070661_100267001 3300005344 Bacteria 1324
103 Ga0070661_100692999 3300005344 Bacteria 830
104 Ga0070661_100751296 3300005344 Bacteria 797
105 Ga0070668_100026641 3300005347 Bacteria 4388
106 Ga0070668_100079292 3300005347 Bacteria 2571
107 Ga0070669_100021259 3300005353 Bacteria 4638
108 Ga0070669_100049950 3300005353 Bacteria 3054
109 Ga0070669_100051888 3300005353 Bacteria 2999
110 Ga0070669_100159636 3300005353 Bacteria 1751
111 Ga0070675_100003351 3300005354 Bacteria 12139
112 Ga0070675_100184125 3300005354 Bacteria 1807
113 Ga0070675_100185524 3300005354 Bacteria 1800
114 Ga0070671_100000394 3300005355 Bacteria 30026
115 Ga0070671_100001018 3300005355 Bacteria 20600
116 Ga0070671_100012499 3300005355 Bacteria 6837
117 Ga0070671_100028698 3300005355 Bacteria 4584
118 Ga0070671_100064655 3300005355 Bacteria 3046
119 Ga0070671_100073257 3300005355 Bacteria 2861
120 Ga0070674_100009084 3300005356 Bacteria 5945
121 Ga0070674_100014733 3300005356 Bacteria 4866
122 Ga0070674_100018048 3300005356 Bacteria 4452
123 Ga0070674_100077688 3300005356 Bacteria 2364
124 Ga0070674_100253033 3300005356 Bacteria 1384
125 Ga0070673_100007115 3300005364 Bacteria 7350
126 Ga0070673_100011172 3300005364 Bacteria 6123
127 Ga0070673_100014795 3300005364 Bacteria 5454
128 Ga0070673_100056670 3300005364 Bacteria 3093
129 Ga0070673_100158333 3300005364 Bacteria 1924
130 Ga0070659_100001048 3300005366 Bacteria 20210
131 Ga0070659_100008832 3300005366 Bacteria 7383
132 Ga0070659_100011177 3300005366 Bacteria 6633
133 Ga0070659_100033596 3300005366 Bacteria 3985
134 Ga0070659_100039593 3300005366 Bacteria 3680
135 Ga0070659_100058376 3300005366 Bacteria 3045
136 Ga0070659_100069793 3300005366 Bacteria 2790
137 Ga0070659_100073508 3300005366 Bacteria 2721
138 Ga0070659_100078769 3300005366 Bacteria 2629
139 Ga0070659_100780975 3300005366 Bacteria 830
140 Ga0070667_100000943 3300005367 Bacteria 26747
141 Ga0070667_100002912 3300005367 Bacteria 14710
142 Ga0070667_100041159 3300005367 Bacteria 3876
143 Ga0070667_100048405 3300005367 Bacteria 3578
144 Ga0070667_100066479 3300005367 Bacteria 3063
145 Ga0070667_100089991 3300005367 Bacteria 2637
146 Ga0070667_100137238 3300005367 Bacteria 2139
147 Ga0070667_100574152 3300005367 Bacteria 1038
148 Ga0070667_100579866 3300005367 Bacteria 1032
149 Ga0070714_100177245 3300005435 Bacteria 1937
150 Ga0070714_100472791 3300005435 Bacteria 1193
151 Ga0070714_101399518 3300005435 Bacteria 683
152 Ga0070663_100012444 3300005455 Bacteria 5383
153 Ga0070663_100078346 3300005455 Bacteria 2422
154 Ga0070663_100085455 3300005455 Bacteria 2328
155 Ga0070663_100216815 3300005455 Bacteria 1501
156 Ga0070663_100292718 3300005455 Bacteria 1301
157 Ga0070663_100404576 3300005455 Bacteria 1116
158 Ga0070678_100107877 3300005456 Bacteria 2173
159 Ga0070678_100108041 3300005456 Bacteria 2171
160 Ga0070662_100000022 3300005457 Bacteria 92004
161 Ga0070662_100021849 3300005457 Bacteria 4373
162 Ga0070662_100027970 3300005457 Bacteria 3920
163 Ga0070662_100064500 3300005457 Bacteria 2682
164 Ga0070662_100064604 3300005457 Bacteria 2681
165 Ga0070662_100150001 3300005457 Bacteria 1814
166 Ga0070662_100153971 3300005457 Bacteria 1793
167 Ga0070662_100162347 3300005457 Bacteria 1748
168 Ga0070662_100249013 3300005457 Bacteria 1428
169 Ga0070662_100467398 3300005457 Bacteria 1049
170 Ga0070662_100607293 3300005457 Bacteria 920
171 Ga0070662_101014520 3300005457 Bacteria 711
172 Ga0070681_10064558 3300005458 Bacteria 3631
173 Ga0070681_10103713 3300005458 Bacteria 2787
174 Ga0070681_10120599 3300005458 Bacteria 2557
175 Ga0070681_11657104 3300005458 Bacteria 565
176 Ga0068867_100030434 3300005459 Bacteria 3894
177 Ga0068867_100274611 3300005459 Bacteria 1380
178 Ga0070685_10343208 3300005466 Bacteria 1019
179 Ga0070679_100183307 3300005530 Bacteria 2065
180 Ga0070679_100319851 3300005530 Bacteria 1501
181 Ga0070684_100014421 3300005535 Bacteria 6403
182 Ga0068853_100002248 3300005539 Bacteria 14433
183 Ga0068853_100108692 3300005539 Bacteria 2461
184 Ga0068853_100129550 3300005539 Bacteria 2257
185 Ga0068853_100167662 3300005539 Bacteria 1985
186 Ga0068853_100167691 3300005539 Bacteria 1985
187 Ga0068853_100625070 3300005539 Bacteria 1024
188 Ga0068853_100721782 3300005539 Bacteria 951
189 Ga0070672_100000733 3300005543 Bacteria 19477
190 Ga0070672_100039232 3300005543 Bacteria 3626
191 Ga0070672_100328647 3300005543 Bacteria 1300
192 Ga0070686_100087419 3300005544 Bacteria 2078
193 Ga0070693_100001995 3300005547 Bacteria 9340
194 Ga0070693_100283050 3300005547 Bacteria 1111
195 Ga0070665_100000086 3300005548 Bacteria 178229
196 Ga0070665_100005169 3300005548 Bacteria 13501
197 Ga0070665_100009388 3300005548 Bacteria 9898
198 Ga0070665_100078490 3300005548 Bacteria 3308
199 Ga0070665_100263897 3300005548 Bacteria 1723
200 Ga0070665_100328314 3300005548 Bacteria 1534
201 Ga0070665_100372889 3300005548 Bacteria 1434
202 Ga0070665_100399335 3300005548 Bacteria 1382
203 Ga0068855_100002519 3300005563 Bacteria 22572
204 Ga0068855_100091279 3300005563 Bacteria 3514
205 Ga0068855_100117752 3300005563 Bacteria 3043
206 Ga0068855_100128810 3300005563 Bacteria 2891
207 Ga0070664_100000980 3300005564 Bacteria 22350
208 Ga0070664_100005885 3300005564 Bacteria 9902
209 Ga0070664_100007845 3300005564 Bacteria 8621
210 Ga0070664_100012630 3300005564 Bacteria 6875
211 Ga0070664_100016350 3300005564 Bacteria 6082
212 Ga0070664_100032277 3300005564 Bacteria 4379
213 Ga0070664_100033395 3300005564 Bacteria 4309
214 Ga0070664_100035718 3300005564 Bacteria 4173
215 Ga0070664_100051706 3300005564 Bacteria 3479
216 Ga0070664_100053073 3300005564 Bacteria 3435
217 Ga0070664_100056768 3300005564 Bacteria 3327
218 Ga0070664_100192527 3300005564 Bacteria 1817
219 Ga0070664_100268909 3300005564 Bacteria 1535
220 Ga0070664_100591242 3300005564 Bacteria 1029
221 Ga0070664_101220626 3300005564 Bacteria 709
222 Ga0068857_100035524 3300005577 Bacteria 4414
223 Ga0068857_100103601 3300005577 Bacteria 2555
224 Ga0068857_100420004 3300005577 Bacteria 1247
225 Ga0068857_100693047 3300005577 Bacteria 967
226 Ga0068857_101013674 3300005577 Bacteria 799
227 Ga0068857_101518338 3300005577 Bacteria 653
228 Ga0068857_101680285 3300005577 Bacteria 620
229 Ga0068854_100001821 3300005578 Bacteria 12975
230 Ga0068854_100020653 3300005578 Bacteria 4462
231 Ga0068854_100030866 3300005578 Bacteria 3720
232 Ga0068854_100053978 3300005578 Bacteria 2888
233 Ga0068854_100083331 3300005578 Bacteria 2364
234 Ga0068854_100110306 3300005578 Bacteria 2074
235 Ga0068854_100152667 3300005578 Bacteria 1782
236 Ga0068854_100202946 3300005578 Bacteria 1559
237 Ga0068854_100251426 3300005578 Bacteria 1411
238 Ga0068856_100000081 3300005614 Bacteria 88388
239 Ga0068856_100008548 3300005614 Bacteria 9950
240 Ga0068856_100034222 3300005614 Bacteria 4977
241 Ga0068856_100854845 3300005614 Bacteria 929
242 Ga0068856_100984517 3300005614 Bacteria 862
243 Ga0068856_101596392 3300005614 Bacteria 665
244 Ga0068852_100001404 3300005616 Bacteria 16219
245 Ga0068852_100018418 3300005616 Bacteria 5500
246 Ga0068852_100048303 3300005616 Bacteria 3635
247 Ga0068852_100132456 3300005616 Bacteria 2297
248 Ga0068852_100162253 3300005616 Bacteria 2088
249 Ga0068852_100174661 3300005616 Bacteria 2016
250 Ga0068852_100275128 3300005616 Bacteria 1621
251 Ga0068852_100479439 3300005616 Bacteria 1236
252 Ga0068852_100557610 3300005616 Bacteria 1146
253 Ga0068852_100834315 3300005616 Bacteria 937
254 Ga0068859_100010218 3300005617 Bacteria 9446
255 Ga0068859_100046305 3300005617 Bacteria 4368
256 Ga0068859_100082905 3300005617 Bacteria 3248
257 Ga0068859_100112242 3300005617 Bacteria 2789
258 Ga0068859_100136170 3300005617 Bacteria 2529
259 Ga0068859_100207076 3300005617 Bacteria 2047
260 Ga0068859_100424721 3300005617 Bacteria 1425
261 Ga0068864_100000549 3300005618 Bacteria 32018
262 Ga0068864_100008805 3300005618 Bacteria 8321
263 Ga0068864_100101197 3300005618 Bacteria 2556
264 Ga0068864_100106402 3300005618 Bacteria 2494
265 Ga0068864_100234075 3300005618 Bacteria 1700
266 Ga0068866_10046341 3300005718 Bacteria 2186
267 Ga0068851_10006999 3300005834 Bacteria 5172
268 Ga0068851_10012858 3300005834 Bacteria 3953
269 Ga0068863_100000494 3300005841 Bacteria 39986
270 Ga0068863_100006151 3300005841 Bacteria 11772
271 Ga0068863_100179567 3300005841 Bacteria 2032
272 Ga0068863_100205201 3300005841 Bacteria 1897
273 Ga0068863_100388497 3300005841 Bacteria 1363
274 Ga0068863_101286957 3300005841 Bacteria 738
275 Ga0068858_100014867 3300005842 Bacteria 7322
276 Ga0068858_100023005 3300005842 Bacteria 5812
277 Ga0068858_100039092 3300005842 Bacteria 4401
278 Ga0068858_100039536 3300005842 Bacteria 4373
279 Ga0068858_100049261 3300005842 Bacteria 3901
280 Ga0068860_100002137 3300005843 Bacteria 20863
281 Ga0068860_100014123 3300005843 Bacteria 7831
282 Ga0068860_100157731 3300005843 Bacteria 2187
283 Ga0068860_100230995 3300005843 Bacteria 1798
284 Ga0068860_100438998 3300005843 Bacteria 1296
285 Ga0068860_100570481 3300005843 Bacteria 1135
286 Ga0068862_100002925 3300005844 Bacteria 14931
287 Ga0068862_100008503 3300005844 Bacteria 8491
288 Ga0068862_100011231 3300005844 Bacteria 7394
289 Ga0097621_100008094 3300006237 Bacteria 7552
290 Ga0097621_100166093 3300006237 Bacteria 1900
291 Ga0075370_10333184 3300006353 Bacteria 905
292 Ga0068871_100004149 3300006358 Bacteria 10027
293 Ga0068865_100012793 3300006881 Bacteria 5289
294 Ga0068865_100019246 3300006881 Bacteria 4417
295 Ga0097620_100010217 3300006931 Bacteria 9446
296 Ga0097620_100046308 3300006931 Bacteria 4368
297 Ga0097620_100082905 3300006931 Bacteria 3248
298 Ga0097620_100112244 3300006931 Bacteria 2789
299 Ga0097620_100136167 3300006931 Bacteria 2529
300 Ga0097620_100207078 3300006931 Bacteria 2047
301 Ga0097620_100424723 3300006931 Bacteria 1425
302 Ga0105240_10024567 3300009093 Bacteria 7942
303 Ga0105240_10035070 3300009093 Bacteria 6469
304 Ga0105240_10849773 3300009093 Bacteria 985
305 Ga0111539_10500271 3300009094 Bacteria 1416
306 Ga0105245_10018736 3300009098 Bacteria 6056
307 Ga0105245_10039776 3300009098 Bacteria 4185
308 Ga0105241_10026585 3300009174 Bacteria 4307
309 Ga0105241_10438670 3300009174 Bacteria 1153
310 Ga0105242_10032757 3300009176 Bacteria 4157
311 Ga0105242_10462414 3300009176 Bacteria 1198
312 Ga0105248_10000010 3300009177 Bacteria 344314
313 Ga0105248_10000755 3300009177 Bacteria 36223
314 Ga0105248_10001129 3300009177 Bacteria 29704
315 Ga0105248_10001278 3300009177 Bacteria 28090
316 Ga0105248_10002706 3300009177 Bacteria 19694
317 Ga0105248_10008598 3300009177 Bacteria 11211
318 Ga0105248_10012287 3300009177 Bacteria 9443
319 Ga0105248_10022674 3300009177 Bacteria 6968
320 Ga0105248_10025988 3300009177 Bacteria 6512
321 Ga0105248_10103106 3300009177 Bacteria 3215
322 Ga0105248_10106387 3300009177 Bacteria 3163
323 Ga0105248_10370470 3300009177 Bacteria 1612
324 Ga0105248_12081158 3300009177 Bacteria 645
325 Ga0105237_10003482 3300009545 Bacteria 18670
326 Ga0105237_10013043 3300009545 Bacteria 8726
327 Ga0105238_10018069 3300009551 Bacteria 7167
328 Ga0105238_10064345 3300009551 Bacteria 3667
329 Ga0105238_10074252 3300009551 Bacteria 3393
330 Ga0105238_10140782 3300009551 Bacteria 2389
331 Ga0105238_11511125 3300009551 Bacteria 700
332 Ga0105249_10002386 3300009553 Bacteria 16304
333 Ga0105249_10908900 3300009553 Bacteria 947
334 Ga0105239_10000320 3300010375 Bacteria 70971
335 Ga0105246_10013255 3300011119 Bacteria 5164
336 Ga0105246_10032636 3300011119 Bacteria 3454
337 Ga0157373_10004985 3300013100 Bacteria 9976
338 Ga0157373_10012630 3300013100 Bacteria 6210
339 Ga0157373_10045830 3300013100 Bacteria 3121
340 Ga0157373_10100761 3300013100 Bacteria 2032
341 Ga0157373_10105506 3300013100 Bacteria 1982
342 Ga0157373_10115611 3300013100 Bacteria 1886
343 Ga0157373_10122890 3300013100 Bacteria 1825
344 Ga0157373_10208923 3300013100 Bacteria 1376
345 Ga0157373_10230726 3300013100 Bacteria 1307
346 Ga0157373_10720679 3300013100 Bacteria 732
347 Ga0157371_10010481 3300013102 Bacteria 7213
348 Ga0157371_10043779 3300013102 Bacteria 3188
349 Ga0157371_10056852 3300013102 Bacteria 2774
350 Ga0157371_10067725 3300013102 Bacteria 2527
351 Ga0157371_10273377 3300013102 Bacteria 1220
352 Ga0157371_10432141 3300013102 Bacteria 966
353 Ga0157371_10636566 3300013102 Bacteria 795
354 Ga0157371_10652440 3300013102 Bacteria 785
355 Ga0157371_10827770 3300013102 Bacteria 699
356 Ga0157370_10032007 3300013104 Bacteria 5140
357 Ga0157370_10075192 3300013104 Bacteria 3185
358 Ga0157370_10905688 3300013104 Bacteria 800
359 Ga0157369_10100265 3300013105 Bacteria 3087
360 Ga0157369_10108752 3300013105 Bacteria 2948
361 Ga0157369_10162238 3300013105 Bacteria 2359
362 Ga0157369_10298876 3300013105 Bacteria 1675
363 Ga0157369_10314354 3300013105 Bacteria 1629
364 Ga0157378_10018727 3300013297 Bacteria 6086
365 Ga0157378_10038866 3300013297 Bacteria 4219
366 Ga0163162_10043040 3300013306 Bacteria 4521
367 Ga0163162_10105361 3300013306 Bacteria 2914
368 Ga0163162_10270445 3300013306 Bacteria 1831
369 Ga0163162_10317423 3300013306 Bacteria 1691
370 Ga0163162_10779979 3300013306 Bacteria 1074
371 Ga0157372_10005774 3300013307 Bacteria 13186
372 Ga0157372_10068153 3300013307 Bacteria 4000
373 Ga0157372_10152270 3300013307 Bacteria 2670
374 Ga0157372_10154307 3300013307 Bacteria 2652
375 Ga0157372_10155066 3300013307 Bacteria 2645
376 Ga0157372_10299357 3300013307 Bacteria 1871
377 Ga0157372_10380414 3300013307 Bacteria 1645
378 Ga0157372_11238776 3300013307 Bacteria 862
379 Ga0157372_11325813 3300013307 Bacteria 830
380 Ga0157375_10038075 3300013308 Bacteria 4614
381 Ga0157375_10292184 3300013308 Bacteria 1793
382 Ga0157375_11261756 3300013308 Bacteria 868
383 Ga0163163_10000161 3300014325 Bacteria 70120
384 Ga0163163_10001950 3300014325 Bacteria 17446
385 Ga0163163_10013876 3300014325 Bacteria 7390
386 Ga0182008_10369618 3300014497 Bacteria 764
387 Ga0157377_10898009 3300014745 Bacteria 662
388 Ga0157379_10033867 3300014968 Bacteria 4556
389 Ga0157379_10055029 3300014968 Bacteria 3555
390 Ga0157379_10165871 3300014968 Bacteria 1993
391 Ga0157379_10294762 3300014968 Bacteria 1478
392 Ga0163161_10081020 3300017792 Bacteria 2390
393 Ga0163161_10098013 3300017792 Bacteria 2178
394 Ga0163161_10198329 3300017792 Bacteria 1546
395 Ga0163161_10684014 3300017792 Bacteria 853
396 Ga0213876_10011153 3300021384 Bacteria 4806
397 Ga0207425_1000026 3300025245 Bacteria 301303
398 Ga0207425_1001730 3300025245 Bacteria 8622
399 Ga0209233_1037224 3300025261 Bacteria 1083
400 Ga0209565_1000010 3300025263 Bacteria 687724
401 Ga0209565_1000240 3300025263 Bacteria 59106
402 Ga0209673_1004268 3300025273 Bacteria 7759
403 Ga0209673_1014971 3300025273 Bacteria 2972
404 Ga0209675_1024754 3300025291 Bacteria 1527
405 Ga0209676_1007370 3300025292 Bacteria 5178
406 Ga0209025_1001326 3300025294 Bacteria 33497
407 Ga0209564_1002247 3300025295 Bacteria 15852
408 Ga0209758_1000001 3300025297 Bacteria 1981790
409 Ga0209758_1000004 3300025297 Bacteria 1375322
410 Ga0209758_1007806 3300025297 Bacteria 7145
411 Ga0209050_1000001 3300025298 Bacteria 3563507
412 Ga0209050_1000026 3300025298 Bacteria 499134
413 Ga0209050_1000550 3300025298 Bacteria 61775
414 Ga0209050_1002494 3300025298 Bacteria 15561
415 Ga0209050_1019011 3300025298 Bacteria 2636
416 Ga0209256_1000034 3300025299 Bacteria 388475
417 Ga0207426_1032389 3300025302 Bacteria 1696
418 Ga0207426_1083388 3300025302 Bacteria 862
419 Ga0209051_1000336 3300025303 Bacteria 70491
420 Ga0209257_1000009 3300025304 Bacteria 1205047
421 Ga0209257_1003507 3300025304 Bacteria 13353
422 Ga0209257_1006086 3300025304 Bacteria 8017
423 Ga0209257_1006091 3300025304 Bacteria 8014
424 Ga0209257_1006803 3300025304 Bacteria 7191
425 Ga0207697_10010323 3300025315 Bacteria 3996
426 Ga0207656_10370928 3300025321 Bacteria 717
427 Ga0207656_10381662 3300025321 Bacteria 706
428 Ga0207696_1046278 3300025711 Bacteria 1255
429 Ga0207642_10224922 3300025899 Bacteria 1051
430 Ga0207710_10073847 3300025900 Bacteria 1569
431 Ga0207688_10080361 3300025901 Bacteria 1861
432 Ga0207688_10093836 3300025901 Bacteria 1726
433 Ga0207680_10000955 3300025903 Bacteria 13608
434 Ga0207680_10004216 3300025903 Bacteria 6806
435 Ga0207680_10031423 3300025903 Bacteria 3007
436 Ga0207680_10050876 3300025903 Bacteria 2475
437 Ga0207680_10327698 3300025903 Bacteria 1072
438 Ga0207680_10452697 3300025903 Bacteria 911
439 Ga0207647_10001708 3300025904 Bacteria 16880
440 Ga0207647_10019695 3300025904 Bacteria 4535
441 Ga0207647_10048639 3300025904 Bacteria 2633
442 Ga0207647_10141624 3300025904 Bacteria 1409
443 Ga0207647_10201546 3300025904 Bacteria 1151
444 Ga0207647_10615998 3300025904 Bacteria 598
445 Ga0207645_10019647 3300025907 Bacteria 4428
446 Ga0207645_10098640 3300025907 Bacteria 1884
447 Ga0207645_10139883 3300025907 Bacteria 1577
448 Ga0207645_10725601 3300025907 Bacteria 676
449 Ga0207705_10000269 3300025909 Bacteria 49725
450 Ga0207705_10004371 3300025909 Bacteria 10687
451 Ga0207705_10010446 3300025909 Bacteria 6750
452 Ga0207705_10072797 3300025909 Bacteria 2493
453 Ga0207705_10161568 3300025909 Bacteria 1683
454 Ga0207705_10164747 3300025909 Bacteria 1667
455 Ga0207705_10581878 3300025909 Bacteria 870
456 Ga0207705_10776824 3300025909 Bacteria 744
457 Ga0207705_10795240 3300025909 Bacteria 734
458 Ga0207654_10075127 3300025911 Bacteria 2019
459 Ga0207707_10044541 3300025912 Bacteria 3868
460 Ga0207707_10268643 3300025912 Bacteria 1478
461 Ga0207707_11024241 3300025912 Bacteria 676
462 Ga0207695_10015380 3300025913 Bacteria 9007
463 Ga0207695_10015548 3300025913 Bacteria 8952
464 Ga0207695_10026318 3300025913 Bacteria 6494
465 Ga0207695_10586923 3300025913 Bacteria 995
466 Ga0207671_10008842 3300025914 Bacteria 8482
467 Ga0207660_10018966 3300025917 Bacteria 4594
468 Ga0207660_10021512 3300025917 Bacteria 4338
469 Ga0207660_10069074 3300025917 Bacteria 2564
470 Ga0207660_10093991 3300025917 Bacteria 2228
471 Ga0207660_10236203 3300025917 Bacteria 1439
472 Ga0207660_10367490 3300025917 Bacteria 1155
473 Ga0207660_10464133 3300025917 Bacteria 1025
474 Ga0207660_10877314 3300025917 Bacteria 732
475 Ga0207662_10065243 3300025918 Bacteria 2192
476 Ga0207657_10000015 3300025919 Bacteria 175776
477 Ga0207657_10001798 3300025919 Bacteria 23122
478 Ga0207657_10004704 3300025919 Bacteria 14407
479 Ga0207657_10005068 3300025919 Bacteria 13820
480 Ga0207657_10006194 3300025919 Bacteria 12433
481 Ga0207657_10007842 3300025919 Bacteria 10896
482 Ga0207657_10008998 3300025919 Bacteria 10085
483 Ga0207657_10022120 3300025919 Bacteria 5966
484 Ga0207657_10026506 3300025919 Bacteria 5325
485 Ga0207657_10033695 3300025919 Bacteria 4614
486 Ga0207657_10048263 3300025919 Bacteria 3718
487 Ga0207657_10078828 3300025919 Bacteria 2772
488 Ga0207657_10095335 3300025919 Bacteria 2476
489 Ga0207657_10292814 3300025919 Bacteria 1291
490 Ga0207649_10000198 3300025920 Bacteria 49957
491 Ga0207649_10006837 3300025920 Bacteria 6196
492 Ga0207649_10022509 3300025920 Bacteria 3642
493 Ga0207649_10048725 3300025920 Bacteria 2614
494 Ga0207649_10089958 3300025920 Bacteria 2008
495 Ga0207649_10101416 3300025920 Bacteria 1906
496 Ga0207649_10124298 3300025920 Bacteria 1744
497 Ga0207652_10094971 3300025921 Bacteria 2626
498 Ga0207652_10126002 3300025921 Bacteria 2281
499 Ga0207652_10256461 3300025921 Bacteria 1577
500 Ga0207652_10803030 3300025921 Bacteria 835
501 Ga0207652_11030568 3300025921 Bacteria 722
502 Ga0207681_10012078 3300025923 Bacteria 5322
503 Ga0207681_10039693 3300025923 Bacteria 3127
504 Ga0207681_10043674 3300025923 Bacteria 3001
505 Ga0207681_10130394 3300025923 Bacteria 1858
506 Ga0207681_10232280 3300025923 Bacteria 1432
507 Ga0207694_10036567 3300025924 Bacteria 3769
508 Ga0207694_10089768 3300025924 Bacteria 2424
509 Ga0207694_10253637 3300025924 Bacteria 1440
510 Ga0207694_10485080 3300025924 Bacteria 1034
511 Ga0207650_10001371 3300025925 Bacteria 17584
512 Ga0207650_10014851 3300025925 Bacteria 5417
513 Ga0207650_10138632 3300025925 Bacteria 1910
514 Ga0207650_10223250 3300025925 Bacteria 1517
515 Ga0207650_10532096 3300025925 Bacteria 984
516 Ga0207650_10812866 3300025925 Bacteria 792
517 Ga0207659_10002119 3300025926 Bacteria 11758
518 Ga0207659_10035251 3300025926 Bacteria 3457
519 Ga0207659_10166361 3300025926 Bacteria 1736
520 Ga0207659_10460597 3300025926 Bacteria 1072
521 Ga0207687_10013015 3300025927 Bacteria 5434
522 Ga0207687_10020468 3300025927 Bacteria 4389
523 Ga0207700_10266220 3300025928 Bacteria 1469
524 Ga0207664_10050641 3300025929 Bacteria 3276
525 Ga0207664_10346842 3300025929 Bacteria 1313
526 Ga0207644_10001296 3300025931 Bacteria 16085
527 Ga0207644_10003633 3300025931 Bacteria 10003
528 Ga0207644_10003809 3300025931 Bacteria 9767
529 Ga0207644_10007705 3300025931 Bacteria 7025
530 Ga0207644_10053448 3300025931 Bacteria 2906
531 Ga0207644_10101579 3300025931 Bacteria 2161
532 Ga0207644_10227911 3300025931 Bacteria 1479
533 Ga0207644_10375411 3300025931 Bacteria 1159
534 Ga0207690_10000032 3300025932 Bacteria 152479
535 Ga0207690_10056127 3300025932 Bacteria 2655
536 Ga0207690_10063130 3300025932 Bacteria 2525
537 Ga0207690_10103452 3300025932 Bacteria 2038
538 Ga0207690_10120271 3300025932 Bacteria 1906
539 Ga0207690_10196828 3300025932 Bacteria 1528
540 Ga0207690_10532543 3300025932 Bacteria 953
541 Ga0207690_10541188 3300025932 Bacteria 946
542 Ga0207706_10000032 3300025933 Bacteria 142723
543 Ga0207706_10000952 3300025933 Bacteria 29599
544 Ga0207706_10008832 3300025933 Bacteria 9273
545 Ga0207706_10036949 3300025933 Bacteria 4338
546 Ga0207706_10038080 3300025933 Bacteria 4266
547 Ga0207706_10040475 3300025933 Bacteria 4130
548 Ga0207706_10048655 3300025933 Bacteria 3749
549 Ga0207706_10060965 3300025933 Bacteria 3322
550 Ga0207706_10072888 3300025933 Bacteria 3020
551 Ga0207706_10139669 3300025933 Bacteria 2131
552 Ga0207706_10213044 3300025933 Bacteria 1693
553 Ga0207706_10288624 3300025933 Bacteria 1430
554 Ga0207706_10395160 3300025933 Bacteria 1199
555 Ga0207706_10785396 3300025933 Bacteria 810
556 Ga0207686_10009418 3300025934 Bacteria 5297
557 Ga0207670_10395136 3300025936 Bacteria 1104
558 Ga0207669_10005065 3300025937 Bacteria 5867
559 Ga0207669_10009795 3300025937 Bacteria 4581
560 Ga0207669_10023050 3300025937 Bacteria 3318
561 Ga0207669_10111257 3300025937 Bacteria 1836
562 Ga0207704_10091068 3300025938 Bacteria 2003
563 Ga0207691_10000881 3300025940 Bacteria 29835
564 Ga0207691_10006752 3300025940 Bacteria 11067
565 Ga0207691_10170468 3300025940 Bacteria 1906
566 Ga0207711_10000281 3300025941 Bacteria 54787
567 Ga0207711_10002208 3300025941 Bacteria 17478
568 Ga0207711_10004466 3300025941 Bacteria 11924
569 Ga0207711_10006481 3300025941 Bacteria 9852
570 Ga0207711_10012694 3300025941 Bacteria 6997
571 Ga0207711_10018740 3300025941 Bacteria 5754
572 Ga0207711_10024277 3300025941 Bacteria 5076
573 Ga0207711_10085727 3300025941 Bacteria 2760
574 Ga0207711_10181497 3300025941 Bacteria 1914
575 Ga0207711_10286213 3300025941 Bacteria 1518
576 Ga0207711_10946215 3300025941 Bacteria 800
577 Ga0207689_10077769 3300025942 Bacteria 2727
578 Ga0207661_10001054 3300025944 Bacteria 18322
579 Ga0207661_10103821 3300025944 Bacteria 2392
580 Ga0207661_10266138 3300025944 Bacteria 1528
581 Ga0207679_10000208 3300025945 Bacteria 46600
582 Ga0207679_10002546 3300025945 Bacteria 11236
583 Ga0207679_10004609 3300025945 Bacteria 8582
584 Ga0207679_10011792 3300025945 Bacteria 5677
585 Ga0207679_10012396 3300025945 Bacteria 5559
586 Ga0207679_10056259 3300025945 Bacteria 2904
587 Ga0207679_10064568 3300025945 Bacteria 2737
588 Ga0207679_10078924 3300025945 Bacteria 2509
589 Ga0207679_10221709 3300025945 Bacteria 1591
590 Ga0207679_10419697 3300025945 Bacteria 1180
591 Ga0207679_10438533 3300025945 Bacteria 1156
592 Ga0207667_10003698 3300025949 Bacteria 18854
593 Ga0207667_10020100 3300025949 Bacteria 7436
594 Ga0207667_10051755 3300025949 Bacteria 4328
595 Ga0207667_10125308 3300025949 Bacteria 2645
596 Ga0207667_10750769 3300025949 Bacteria 975
597 Ga0207667_11435567 3300025949 Bacteria 663
598 Ga0207651_10007541 3300025960 Bacteria 5803
599 Ga0207651_10012439 3300025960 Bacteria 4817
600 Ga0207651_10133042 3300025960 Bacteria 1907
601 Ga0207712_10072576 3300025961 Bacteria 2479
602 Ga0207712_10138654 3300025961 Bacteria 1863
603 Ga0207668_10007528 3300025972 Bacteria 6480
604 Ga0207668_10076624 3300025972 Bacteria 2409
605 Ga0207668_10344763 3300025972 Bacteria 1244
606 Ga0207668_10354047 3300025972 Bacteria 1228
607 Ga0207668_10500209 3300025972 Bacteria 1045
608 Ga0207640_10000546 3300025981 Bacteria 22578
609 Ga0207640_10044085 3300025981 Bacteria 2856
610 Ga0207640_10048402 3300025981 Bacteria 2748
611 Ga0207640_10057516 3300025981 Bacteria 2558
612 Ga0207640_10093790 3300025981 Bacteria 2086
613 Ga0207640_10125387 3300025981 Bacteria 1848
614 Ga0207640_10190701 3300025981 Bacteria 1545
615 Ga0207640_10229078 3300025981 Bacteria 1428
616 Ga0207640_10704036 3300025981 Bacteria 866
617 Ga0207640_11015506 3300025981 Bacteria 730
618 Ga0207658_10003998 3300025986 Bacteria 10331
619 Ga0207658_10004159 3300025986 Bacteria 10086
620 Ga0207658_10006887 3300025986 Bacteria 7738
621 Ga0207658_10008425 3300025986 Bacteria 7019
622 Ga0207658_10010214 3300025986 Bacteria 6377
623 Ga0207658_10041155 3300025986 Bacteria 3344
624 Ga0207658_10065822 3300025986 Bacteria 2724
625 Ga0207658_10135772 3300025986 Bacteria 1983
626 Ga0207658_10166166 3300025986 Bacteria 1813
627 Ga0207658_10199019 3300025986 Bacteria 1671
628 Ga0207658_10513686 3300025986 Bacteria 1068
629 Ga0207658_10535562 3300025986 Bacteria 1046
630 Ga0207658_10535572 3300025986 Bacteria 1046
631 Ga0207677_10002225 3300026023 Bacteria 10186
632 Ga0207677_10008855 3300026023 Bacteria 5642
633 Ga0207677_10018351 3300026023 Bacteria 4196
634 Ga0207677_10295704 3300026023 Bacteria 1336
635 Ga0207677_11480076 3300026023 Bacteria 627
636 Ga0207703_10001347 3300026035 Bacteria 22483
637 Ga0207703_10008666 3300026035 Bacteria 8025
638 Ga0207703_10142526 3300026035 Bacteria 2081
639 Ga0207703_10334890 3300026035 Bacteria 1389
640 Ga0207703_10436963 3300026035 Bacteria 1220
641 Ga0207703_10956145 3300026035 Bacteria 821
642 Ga0207639_10000285 3300026041 Bacteria 36135
643 Ga0207639_10039136 3300026041 Bacteria 3531
644 Ga0207639_10081600 3300026041 Bacteria 2561
645 Ga0207639_10085355 3300026041 Bacteria 2510
646 Ga0207639_10101721 3300026041 Bacteria 2324
647 Ga0207639_10149868 3300026041 Bacteria 1953
648 Ga0207639_10204899 3300026041 Bacteria 1694
649 Ga0207639_10242560 3300026041 Bacteria 1568
650 Ga0207639_11108288 3300026041 Bacteria 742
651 Ga0207678_10000671 3300026067 Bacteria 31429
652 Ga0207678_10003552 3300026067 Bacteria 14026
653 Ga0207678_10006560 3300026067 Bacteria 10315
654 Ga0207678_10009969 3300026067 Bacteria 8336
655 Ga0207678_10011847 3300026067 Bacteria 7656
656 Ga0207678_10041180 3300026067 Bacteria 4005
657 Ga0207678_10057241 3300026067 Bacteria 3354
658 Ga0207678_10208937 3300026067 Bacteria 1670
659 Ga0207678_10262815 3300026067 Bacteria 1479
660 Ga0207678_10566693 3300026067 Bacteria 994
661 Ga0207702_10003032 3300026078 Bacteria 15605
662 Ga0207702_10039238 3300026078 Bacteria 3967
663 Ga0207702_10403838 3300026078 Bacteria 1318
664 Ga0207641_10002125 3300026088 Bacteria 18732
665 Ga0207641_10092900 3300026088 Bacteria 2643
666 Ga0207641_10099884 3300026088 Bacteria 2554
667 Ga0207641_10600361 3300026088 Bacteria 1077
668 Ga0207648_10040091 3300026089 Bacteria 4116
669 Ga0207648_10644061 3300026089 Bacteria 979
670 Ga0207676_10004063 3300026095 Bacteria 10319
671 Ga0207676_10009788 3300026095 Bacteria 6816
672 Ga0207676_10018677 3300026095 Bacteria 5045
673 Ga0207676_10503572 3300026095 Bacteria 1150
674 Ga0207674_10001776 3300026116 Bacteria 27533
675 Ga0207674_10006833 3300026116 Bacteria 13380
676 Ga0207674_10010399 3300026116 Bacteria 10543
677 Ga0207674_10012215 3300026116 Bacteria 9606
678 Ga0207674_10034950 3300026116 Bacteria 5248
679 Ga0207674_10157526 3300026116 Bacteria 2226
680 Ga0207674_10255964 3300026116 Bacteria 1697
681 Ga0207675_100877898 3300026118 Bacteria 912
682 Ga0207683_10001432 3300026121 Bacteria 21596
683 Ga0207683_10070127 3300026121 Bacteria 3096
684 Ga0207683_10095809 3300026121 Bacteria 2646
685 Ga0207683_10131200 3300026121 Bacteria 2254
686 Ga0207683_10481712 3300026121 Bacteria 1145
687 Ga0207698_10003874 3300026142 Bacteria 9051
688 Ga0207698_10012231 3300026142 Bacteria 5606
689 Ga0207698_10036879 3300026142 Bacteria 3594
690 Ga0207698_10091568 3300026142 Bacteria 2489
691 Ga0207698_10108029 3300026142 Bacteria 2324
692 Ga0207698_10271827 3300026142 Bacteria 1563
693 Ga0207698_10274679 3300026142 Bacteria 1555
694 Ga0207698_10358774 3300026142 Bacteria 1380
695 Ga0207698_10362229 3300026142 Bacteria 1373
696 Ga0207698_11787618 3300026142 Bacteria 630
697 Ga0209983_1016393 3300027665 Bacteria 1530
698 Ga0209974_10002783 3300027876 Bacteria 6341
699 Ga0268266_10000002 3300028379 Bacteria 3059047
700 Ga0268266_10000186 3300028379 Bacteria 110448
701 Ga0268266_10043336 3300028379 Bacteria 3845
702 Ga0268266_10179128 3300028379 Bacteria 1929
703 Ga0268266_10498802 3300028379 Bacteria 1162
704 Ga0268265_10004985 3300028380 Bacteria 9116
705 Ga0268265_10029887 3300028380 Bacteria 3919
706 Ga0268265_10166689 3300028380 Bacteria 1878
707 Ga0268264_10001116 3300028381 Bacteria 26474
708 Ga0268264_10095426 3300028381 Bacteria 2574
709 Ga0268264_10250604 3300028381 Bacteria 1645
710 Ga0268264_10338125 3300028381 Bacteria 1429
711 Ga0268264_10447611 3300028381 Bacteria 1251
712 Ga0268264_10517330 3300028381 Bacteria 1166
713 Ga0265338_10143233 3300028800 Bacteria 1869
714 Ga0307513_10137902 3300031456 Bacteria 2371
715 Ga0307408_100059836 3300031548 Bacteria 2774
716 Ga0307408_100619985 3300031548 Bacteria 963
717 Ga0307405_10006496 3300031731 Bacteria 5755
718 Ga0307405_10085705 3300031731 Bacteria 2072
719 Ga0307413_10431709 3300031824 Bacteria 1040
720 Ga0307410_10014389 3300031852 Bacteria 4653
721 Ga0307410_10026230 3300031852 Bacteria 3665
722 Ga0307406_10157733 3300031901 Bacteria 1627
723 Ga0307406_11157023 3300031901 Bacteria 670
724 Ga0307407_10001773 3300031903 Bacteria 8062
725 Ga0307407_10806390 3300031903 Bacteria 714
726 Ga0307412_10388855 3300031911 Bacteria 1132
727 Ga0307409_100006069 3300031995 Bacteria 7056
728 Ga0307409_100012106 3300031995 Bacteria 5478
729 Ga0307416_100011540 3300032002 Bacteria 5901
730 Ga0307416_100020087 3300032002 Bacteria 4757
731 Ga0307416_100021516 3300032002 Bacteria 4633
732 Ga0307414_10000892 3300032004 Bacteria 15267
733 Ga0307414_10007292 3300032004 Bacteria 6213
734 Ga0307411_11197841 3300032005 Bacteria 688
735 Ga0307415_100006242 3300032126 Bacteria 6406
736 Ga0307415_100191423 3300032126 Bacteria 1615
737 Ga0307415_100480413 3300032126 Bacteria 1082
738 Ga0307415_100511859 3300032126 Bacteria 1052
739 Ga0373928_0088327 3300035084 Bacteria 792
740 Ga0373940_0042506 3300035088 Bacteria 1253
741 Ga0373940_0107190 3300035088 Bacteria 854
742 Ga0373932_0026934 3300035112 Bacteria 1568
743 Ga0373946_0550282 3300035171 Bacteria 595
744 Ga0373931_0020778 3300035691 Bacteria 3287
745 Ga0373935_0015607 3300035692 Bacteria 4594
746 Ga0373947_0044719 3300035725 Bacteria 2648
747 Ga0373925_0049634 3300037068 Bacteria 3128
748 Ga0395899_0018664 3300037312 Bacteria 5270
749 Ga0395899_0046683 3300037312 Bacteria 3226
750 Ga0395899_0055241 3300037312 Bacteria 2938
751 Ga0395899_0187050 3300037312 Bacteria 1451
752 Ga0395899_0272913 3300037312 Bacteria 1153
753 Ga0395900_0023778 3300037418 Bacteria 6269
754 Ga0395900_0036730 3300037418 Bacteria 5050
755 Ga0395900_0060452 3300037418 Bacteria 3899
756 Ga0395900_0066776 3300037418 Bacteria 3696
757 Ga0395900_0066937 3300037418 Bacteria 3691
758 Ga0395900_0087902 3300037418 Bacteria 3194
759 Ga0395900_0143357 3300037418 Bacteria 2445
760 Ga0395900_0194834 3300037418 Bacteria 2053
761 Ga0395900_0197368 3300037418 Bacteria 2038
762 Ga0395900_0220894 3300037418 Bacteria 1910
763 Ga0395900_0516044 3300037418 Bacteria 1144
764 Ga0395900_0583828 3300037418 Bacteria 1059
765 Ga0395900_0592850 3300037418 Bacteria 1049
766 Ga0395900_0651731 3300037418 Bacteria 989
767 Ga0395900_1712334 3300037418 Bacteria 539
768 Ga0395900_1807313 3300037418 Bacteria 522
769 Ga0395898_0021937 3300037466 Bacteria 6468
770 Ga0395898_0074710 3300037466 Bacteria 3274
771 Ga0395898_0477643 3300037466 Bacteria 1186
772 Ga0395898_1166300 3300037466 Bacteria 702
773 Ga0395898_1457992 3300037466 Bacteria 611
774 Ga0395905_0000207 3300037471 Bacteria 91620
775 Ga0395905_0004160 3300037471 Bacteria 15134
776 Ga0395905_0012298 3300037471 Bacteria 8240
777 Ga0395905_0028268 3300037471 Bacteria 5286
778 Ga0395905_0069982 3300037471 Bacteria 3287
779 Ga0395905_0098850 3300037471 Bacteria 2741
780 Ga0395905_0102032 3300037471 Bacteria 2693
781 Ga0395905_0122882 3300037471 Bacteria 2441
782 Ga0395905_0156209 3300037471 Bacteria 2146
783 Ga0395905_0207983 3300037471 Bacteria 1834
784 Ga0395905_0222784 3300037471 Bacteria 1765
785 Ga0395905_0342308 3300037471 Bacteria 1386
786 Ga0395905_0443656 3300037471 Bacteria 1195
787 Ga0395905_0590496 3300037471 Bacteria 1012
788 Ga0395905_1239420 3300037471 Bacteria 649
789 Ga0395901_0012736 3300038443 Bacteria 8532
790 Ga0395901_0019808 3300038443 Bacteria 6881
791 Ga0395901_0075609 3300038443 Bacteria 3513
792 Ga0395901_0100638 3300038443 Bacteria 3032
793 Ga0395901_0175268 3300038443 Bacteria 2249
794 Ga0395901_0266359 3300038443 Bacteria 1783
795 Ga0395901_1331831 3300038443 Bacteria 679
796 Ga0436365_1103114 3300039437 Bacteria 5223
797 Ga0436363_0285327 3300039450 Bacteria 2248
798 Ga0439436_0063795 3300041404 Bacteria 1029
799 Ga0439461_0001537 3300041410 Bacteria 3573
800 Ga0439461_0002606 3300041410 Bacteria 2902
801 Ga0439466_0061720 3300041411 Bacteria 1206
802 Ga0439465_0001418 3300041413 Bacteria 7752
803 Ga0439465_0033378 3300041413 Bacteria 1645
804 Ga0439465_0302779 3300041413 Bacteria 598
805 Ga0451804_0271056 3300041463 Bacteria 628
806 Ga0451843_0976283 3300041509 Bacteria 700
807 Ga0439431_0002834 3300041997 Bacteria 3812
808 Ga0439442_001465 3300042002 Bacteria 4650
809 Ga0439445_0000496 3300042004 Bacteria 7995
810 Ga0439445_0058886 3300042004 Bacteria 1047
811 Ga0439445_0071454 3300042004 Bacteria 960
812 Ga0439445_0091756 3300042004 Bacteria 856
813 Ga0439432_000368 3300042006 Bacteria 16610
814 Ga0439452_013295 3300042010 Bacteria 2315
815 Ga0439455_0094813 3300042012 Bacteria 821
816 Ga0450923_021516 3300042125 Bacteria 1258
817 Ga0450909_003154 3300042185 Bacteria 2346
818 Ga0439434_0000604 3300042435 Bacteria 10330
819 Ga0439434_0125376 3300042435 Bacteria 840
820 Ga0450916_026751 3300042530 Bacteria 821
821 Ga0466966_0078576 3300044684 Bacteria 2057
822 Ga0466963_0000126 3300044694 Bacteria 28872
823 Ga0466963_0031761 3300044694 Bacteria 3415
824 Ga0466963_0317327 3300044694 Bacteria 1096
825 Ga0466964_0011042 3300044706 Bacteria 3413
826 Ga0466971_0294807 3300044719 Bacteria 778
827 Ga0466970_0052812 3300044765 Bacteria 2170
828 Ga0466957_0000607 3300044842 Bacteria 18071
829 Ga0466957_0080709 3300044842 Bacteria 2025
830 Ga0466957_0717825 3300044842 Bacteria 706
831 Ga0466960_0030752 3300044901 Bacteria 2473
832 Ga0466958_1054144 3300045836 Bacteria 531
833 Ga0466967_0001679 3300045976 Bacteria 13131
834 Ga0466967_0020409 3300045976 Bacteria 5355
835 Ga0466967_0104246 3300045976 Bacteria 2596
836 Ga0466967_0238550 3300045976 Bacteria 1733
837 Ga0466967_0400434 3300045976 Bacteria 1335
838 Ga0466967_0599356 3300045976 Bacteria 1087
839 Ga0495627_035158 3300046453 Bacteria 1562
840 Ga0495584_0022305 3300046491 Bacteria 3214
841 Ga0495585_0004390 3300046492 Bacteria 9152
842 Ga0495596_0000621 3300046500 Bacteria 22273
843 Ga0495596_0028035 3300046500 Bacteria 2262
844 Ga0495607_0070947 3300046501 Bacteria 1944
845 Ga0495606_0000978 3300046507 Bacteria 41691
846 Ga0495606_0114390 3300046507 Bacteria 1623
847 Ga0495610_0001450 3300046512 Bacteria 20950
848 Ga0495643_0011156 3300046522 Bacteria 5491
849 Ga0495644_0127772 3300046523 Bacteria 968
850 Ga0495648_0004389 3300046524 Bacteria 12067
851 Ga0495663_0002244 3300046525 Bacteria 5875
852 Ga0495663_0003680 3300046525 Bacteria 4389
853 Ga0495663_0005232 3300046525 Bacteria 3613
854 Ga0495663_0123360 3300046525 Bacteria 869
855 Ga0495642_0069976 3300046528 Bacteria 1466
856 Ga0495654_0051727 3300046530 Bacteria 2004
857 Ga0495598_0001994 3300046537 Bacteria 4147
858 Ga0495621_0000771 3300046539 Bacteria 8117
859 Ga0495621_0010461 3300046539 Bacteria 2839
860 Ga0495621_0271177 3300046539 Bacteria 697
861 Ga0495633_0201419 3300046558 Bacteria 914
862 Ga0495611_0115203 3300046648 Bacteria 1252
863 Ga0495625_0001173 3300046660 Bacteria 33660
864 Ga0495625_0049555 3300046660 Bacteria 3018
865 Ga0495625_0460689 3300046660 Bacteria 784
866 Ga0495661_0107476 3300046665 Bacteria 1560
867 Ga0495669_0008925 3300046684 Bacteria 4222
868 Ga0495669_0014428 3300046684 Bacteria 3376
869 Ga0495669_0035565 3300046684 Bacteria 2199
870 Ga0495669_0147950 3300046684 Bacteria 1111
871 Ga0495669_0365782 3300046684 Bacteria 697
872 Ga0495670_0000009 3300046691 Bacteria 210956
873 Ga0495670_0030775 3300046691 Bacteria 2666
874 Ga0495671_0025956 3300046692 Bacteria 3041
875 Ga0495649_0025950 3300046694 Bacteria 3262
876 Ga0495649_0158362 3300046694 Bacteria 1188
877 Ga0495683_0009989 3300047323 Bacteria 5038
878 Ga0495677_0009818 3300047445 Bacteria 3527
879 Ga0495677_0016355 3300047445 Bacteria 2692
880 Ga0495677_0028894 3300047445 Bacteria 2015
881 Ga0495681_0004188 3300047470 Bacteria 9902
882 Ga0495681_0049298 3300047470 Bacteria 1991
883 Ga0495686_0000185 3300047472 Bacteria 116495
884 Ga0495626_0000450 3300048091 Bacteria 41919
885 Ga0496100_0026728 3300048903 Bacteria 3541
886 Ga0496100_0058796 3300048903 Bacteria 2524
887 Ga0496100_0893050 3300048903 Bacteria 698
888 Ga0496101_0015416 3300048904 Bacteria 5151
889 Ga0496101_0134812 3300048904 Bacteria 1878
890 Ga0496101_0214809 3300048904 Bacteria 1491
891 Ga0496101_0908253 3300048904 Bacteria 693
892 Ga0496102_0000452 3300048905 Bacteria 46768
893 Ga0496102_0137047 3300048905 Bacteria 2294
894 Ga0496103_0000518 3300048906 Bacteria 31718
895 Ga0496104_0225573 3300048907 Bacteria 1786
896 Ga0496104_0297622 3300048907 Bacteria 1526
897 Ga0496106_0026728 3300048909 Bacteria 4298
898 Ga0496106_0037982 3300048909 Bacteria 3603
899 Ga0496106_0845689 3300048909 Bacteria 724
900 Ga0496107_0000451 3300048910 Bacteria 22422
901 Ga0496107_0015415 3300048910 Bacteria 5356
902 Ga0496107_0047696 3300048910 Bacteria 3085
903 Ga0496107_0131052 3300048910 Bacteria 1851
904 Ga0496107_0294287 3300048910 Bacteria 1208
905 Ga0496107_0366424 3300048910 Bacteria 1072
906 Ga0496107_0614822 3300048910 Bacteria 802
907 Ga0496108_0000190 3300048911 Bacteria 57059
908 Ga0496108_0007898 3300048911 Bacteria 8627
909 Ga0496108_0116240 3300048911 Bacteria 2291
910 Ga0496108_0371588 3300048911 Bacteria 1248
911 Ga0496108_0614515 3300048911 Bacteria 947
912 Ga0496109_0019964 3300048912 Bacteria 5915
913 Ga0496109_0035647 3300048912 Bacteria 4489
914 Ga0496109_0213503 3300048912 Bacteria 1815
915 Ga0496109_0319296 3300048912 Bacteria 1465
916 Ga0496109_0395975 3300048912 Bacteria 1305
917 Ga0496110_0003207 3300048913 Bacteria 12455
918 Ga0496110_0003671 3300048913 Bacteria 11808
919 Ga0496110_0004122 3300048913 Bacteria 11228
920 Ga0496110_0231402 3300048913 Bacteria 1681
921 Ga0496110_0849185 3300048913 Bacteria 818
922 Ga0496111_0009471 3300048914 Bacteria 6504
923 Ga0496111_0011292 3300048914 Bacteria 6012
924 Ga0496111_0036500 3300048914 Bacteria 3514
925 Ga0496111_0105035 3300048914 Bacteria 2078
926 Ga0496111_0225186 3300048914 Bacteria 1393
927 Ga0496111_0294145 3300048914 Bacteria 1204
928 Ga0496111_0391591 3300048914 Bacteria 1027
929 Ga0496111_0535535 3300048914 Bacteria 860
930 Ga0496111_0653951 3300048914 Bacteria 767
931 Ga0496112_0000197 3300048915 Bacteria 39454
932 Ga0496112_0024818 3300048915 Bacteria 5750
933 Ga0496112_0036712 3300048915 Bacteria 4780
934 Ga0496113_0020387 3300048916 Bacteria 4660
935 Ga0496113_0107726 3300048916 Bacteria 2165
936 Ga0496113_0119032 3300048916 Bacteria 2063
937 Ga0496113_0210944 3300048916 Bacteria 1546
938 Ga0496113_0221488 3300048916 Bacteria 1508
939 Ga0496114_0005301 3300048917 Bacteria 10078
940 Ga0496114_0075116 3300048917 Bacteria 2846
941 Ga0496115_0000230 3300048918 Bacteria 50872
942 Ga0496115_0000965 3300048918 Bacteria 20893
943 Ga0496116_0003936 3300048919 Bacteria 14452
944 Ga0496117_0000885 3300048920 Bacteria 46146
945 Ga0496117_0034830 3300048920 Bacteria 3788
946 Ga0496118_0000144 3300048921 Bacteria 124411
947 Ga0496118_0008365 3300048921 Bacteria 10704
948 Ga0496119_0018184 3300048922 Bacteria 5248
949 Ga0496121_0000295 3300048924 Bacteria 103239
950 Ga0496121_0000681 3300048924 Bacteria 63345
951 Ga0496121_0003998 3300048924 Bacteria 20339
952 Ga0496121_0004126 3300048924 Bacteria 19904
953 Ga0496122_0007834 3300048925 Bacteria 11731
954 Ga0496122_0019690 3300048925 Bacteria 6150
955 Ga0496123_0010830 3300048926 Bacteria 7996
956 Ga0496123_0018507 3300048926 Bacteria 5537
957 Ga0496124_0000683 3300048927 Bacteria 55788
958 Ga0496124_0067394 3300048927 Bacteria 2978
959 Ga0496125_0001206 3300048928 Bacteria 38876
960 Ga0496125_0327705 3300048928 Bacteria 925
961 Ga0496126_0001756 3300048929 Bacteria 32069
962 Ga0496126_0018894 3300048929 Bacteria 6810
963 Ga0501034_0366964 3300049571 Bacteria 1366
964 Ga0501037_0630295 3300049573 Bacteria 718
965 Ga0501043_0929420 3300049579 Bacteria 622
966 Ga0501047_0088076 3300049581 Bacteria 2982
967 Ga0501047_0337953 3300049581 Bacteria 1344
968 Ga0501067_0123011 3300049583 Bacteria 1444
969 Ga0501071_0250143 3300049587 Bacteria 1338
970 Ga0501076_0598323 3300049592 Bacteria 910
971 Ga0501076_1354963 3300049592 Bacteria 585
972 Ga0501248_018909 3300049678 Bacteria 695
973 Ga0501079_0559987 3300049741 Bacteria 899
974 Ga0501081_0266208 3300049743 Bacteria 1253
975 Ga0501241_111998 3300049758 Bacteria 598
976 Ga0501268_017602 3300049765 Bacteria 1194
977 Ga0501035_0194747 3300049822 Bacteria 1741
978 Ga0501035_1068703 3300049822 Bacteria 632
979 Ga0501044_0054348 3300049823 Bacteria 4117
980 Ga0501045_0285618 3300049824 Bacteria 1228
981 nmdc:mga07m45_313316_c1 3300050496 Bacteria 912
982 Ga0500566_0017097 3300053094 Bacteria 4259
983 Ga0500650_0111957 3300053098 Bacteria 1274
984 Ga0500594_0001348 3300053118 Bacteria 5320
985 Ga0500597_001264 3300053120 Bacteria 6270
986 Ga0500608_002725 3300053122 Bacteria 6491
987 Ga0500618_006844 3300053125 Bacteria 3306
988 Ga0500642_0000363 3300053130 Bacteria 15269
989 Ga0500658_0000029 3300053134 Bacteria 99170
990 Ga0500658_0001776 3300053134 Bacteria 8497
991 Ga0500559_0482100 3300053136 Bacteria 571
992 Ga0500568_0014968 3300053139 Bacteria 3483
993 Ga0500573_0000021 3300053140 Bacteria 159093
994 Ga0500573_0080846 3300053140 Bacteria 1846
995 Ga0500619_149140 3300053154 Bacteria 796
996 Ga0500624_000212 3300053157 Bacteria 21975
997 Ga0500636_0083870 3300053177 Bacteria 1833
998 Ga0500637_0000205 3300053178 Bacteria 21975
999 Ga0500567_001427 3300053723 Bacteria 9615
1000 Ga0500625_000041 3300053729 Bacteria 35224
1001 Ga0500596_000419 3300053735 Bacteria 7812
1002 Ga0530510_0384705 3300061734 Bacteria 1056
1003 Ga0530510_0625516 3300061734 Bacteria 819

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049579 Ga0501043_0929420 Ga0501043_0929420_231_611 117
2 3300049592 Ga0501076_0598323 Ga0501076_0598323_101_514 129
3 3300049741 Ga0501079_0559987 Ga0501079_0559987_23_436 129
4 3300049743 Ga0501081_0266208 Ga0501081_0266208_82_495 129
5 3300061734 Ga0530510_0384705 Ga0530510_0384705_116_529 129
6 3300005327 Ga0070658_10032145 Ga0070658_100321452 130
7 3300005344 Ga0070661_100029911 Ga0070661_1000299112 130
8 3300005455 Ga0070663_100404576 Ga0070663_1004045761 130
9 3300005564 Ga0070664_100268909 Ga0070664_1002689092 130
10 3300005616 Ga0068852_100557610 Ga0068852_1005576102 130
11 3300025900 Ga0207710_10073847 Ga0207710_100738472 130
12 3300025920 Ga0207649_10048725 Ga0207649_100487252 130
13 3300025925 Ga0207650_10014851 Ga0207650_100148512 130
14 3300025945 Ga0207679_10011792 Ga0207679_100117922 130
15 3300026067 Ga0207678_10208937 Ga0207678_102089373 130
16 3300037418 Ga0395900_0516044 Ga0395900_0516044_16_435 130
17 3300046684 Ga0495669_0365782 Ga0495669_0365782_263_682 130
18 3300049678 Ga0501248_018909 Ga0501248_018909_19_438 130
19 3300049765 Ga0501268_017602 Ga0501268_017602_31_450 130
20 3300053120 Ga0500597_001264 Ga0500597_001264_1727_2146 130
21 3300053157 Ga0500624_000212 Ga0500624_000212_13039_13458 130
22 3300053178 Ga0500637_0000205 Ga0500637_0000205_8518_8937 130
23 3300013100 Ga0157373_10100761 Ga0157373_101007611 131
24 3300025928 Ga0207700_10266220 Ga0207700_102662202 131
25 3300035171 Ga0373946_0550282 Ga0373946_0550282_144_566 131
26 3300049592 Ga0501076_1354963 Ga0501076_1354963_56_478 131
27 3300049758 Ga0501241_111998 Ga0501241_111998_166_588 131
28 3300053098 Ga0500650_0111957 Ga0500650_0111957_59_481 131
29 3300046660 Ga0495625_0460689 Ga0495625_0460689_269_751 133
30 3300046692 Ga0495671_0025956 Ga0495671_0025956_2339_2821 133
31 3300053118 Ga0500594_0001348 Ga0500594_0001348_97_579 133
32 3300049824 Ga0501045_0285618 Ga0501045_0285618_306_743 135
33 3300005841 Ga0068863_100179567 Ga0068863_1001795671 137
34 3300025923 Ga0207681_10130394 Ga0207681_101303943 137
35 3300049571 Ga0501034_0366964 Ga0501034_0366964_145_609 137
36 3300049573 Ga0501037_0630295 Ga0501037_0630295_240_704 137
37 3300049581 Ga0501047_0088076 Ga0501047_0088076_1234_1698 137
38 3300049822 Ga0501035_0194747 Ga0501035_0194747_1117_1581 137
39 3300049823 Ga0501044_0054348 Ga0501044_0054348_49_513 137
40 3300005331 Ga0070670_100341345 Ga0070670_1003413451 139
41 3300025925 Ga0207650_10532096 Ga0207650_105320962 139
42 3300025981 Ga0207640_10048402 Ga0207640_100484022 139
43 3300013100 Ga0157373_10115611 Ga0157373_101156112 140
44 3300028800 Ga0265338_10143233 Ga0265338_101432331 140
45 3300046500 Ga0495596_0000621 Ga0495596_0000621_17868_18320 140
46 3300046507 Ga0495606_0114390 Ga0495606_0114390_968_1420 140
47 3300046512 Ga0495610_0001450 Ga0495610_0001450_16699_17151 140
48 3300046523 Ga0495644_0127772 Ga0495644_0127772_297_749 140
49 3300048091 Ga0495626_0000450 Ga0495626_0000450_39726_40178 140
50 3300009177 Ga0105248_10012287 Ga0105248_100122874 141
51 iso_pu_bacteria 2738541275 2738712534 141
52 iso_pu_bacteria 2738541301 2738850958 141
53 iso_pu_bacteria 2738541304 2738866688 141
54 iso_pu_bacteria 2738543022 2739299205 141
55 iso_pu_bacteria 2738543033 2739360884 141
56 iso_pu_bacteria 2928100450 2928103842 141
57 iso_pu_bacteria 2928959182 2928961771 141
58 3300044694 Ga0466963_0317327 Ga0466963_0317327_151_624 142
59 3300037418 Ga0395900_1807313 Ga0395900_1807313_34_507 143
60 3300037471 Ga0395905_0122882 Ga0395905_0122882_1151_1624 143
61 3300045836 Ga0466958_1054144 Ga0466958_1054144_28_492 143
62 3300005366 Ga0070659_100069793 Ga0070659_1000697932 144
63 3300005617 Ga0068859_100207076 Ga0068859_1002070763 144
64 3300006353 Ga0075370_10333184 Ga0075370_103331841 144
65 3300006931 Ga0097620_100207078 Ga0097620_1002070782 144
66 3300009177 Ga0105248_12081158 Ga0105248_120811581 144
67 3300025903 Ga0207680_10327698 Ga0207680_103276982 144
68 3300025919 Ga0207657_10048263 Ga0207657_100482635 144
69 3300026142 Ga0207698_10271827 Ga0207698_102718273 144
70 3300035088 Ga0373940_0107190 Ga0373940_0107190_336_800 144
71 3300041509 Ga0451843_0976283 Ga0451843_0976283_124_594 144
72 3300046530 Ga0495654_0051727 Ga0495654_0051727_1058_1546 144
73 3300048903 Ga0496100_0058796 Ga0496100_0058796_1291_1764 144
74 3300050496 nmdc:mga07m45_313316_c1 nmdc:mga07m45_313316_c1_81_569 144
75 3300053122 Ga0500608_002725 Ga0500608_002725_193_681 144
76 3300053136 Ga0500559_0482100 Ga0500559_0482100_24_512 144
77 3300053140 Ga0500573_0080846 Ga0500573_0080846_1218_1706 144
78 3300053154 Ga0500619_149140 Ga0500619_149140_169_657 144
79 3300053177 Ga0500636_0083870 Ga0500636_0083870_217_705 144
80 3300053723 Ga0500567_001427 Ga0500567_001427_7126_7614 144
81 3300053729 Ga0500625_000041 Ga0500625_000041_10386_10874 144
82 iso_pu_bacteria 2739367664 2739650409 144
83 iso_pu_bacteria 2739367865 2740028882 144
84 3300001991 JGI24743J22301_10096099 JGI24743J22301_100960992 145
85 3300005327 Ga0070658_10019735 Ga0070658_100197354 145
86 3300005327 Ga0070658_10128944 Ga0070658_101289442 145
87 3300005328 Ga0070676_10096806 Ga0070676_100968062 145
88 3300005330 Ga0070690_100004532 Ga0070690_1000045323 145
89 3300005335 Ga0070666_10002197 Ga0070666_100021973 145
90 3300005338 Ga0068868_100017173 Ga0068868_1000171733 145
91 3300005339 Ga0070660_100021732 Ga0070660_1000217324 145
92 3300005339 Ga0070660_100059871 Ga0070660_1000598713 145
93 3300005344 Ga0070661_100012935 Ga0070661_1000129352 145
94 3300005344 Ga0070661_100692999 Ga0070661_1006929992 145
95 3300005353 Ga0070669_100021259 Ga0070669_1000212593 145
96 3300005354 Ga0070675_100185524 Ga0070675_1001855242 145
97 3300005355 Ga0070671_100028698 Ga0070671_1000286983 145
98 3300005364 Ga0070673_100014795 Ga0070673_1000147953 145
99 3300005366 Ga0070659_100011177 Ga0070659_1000111773 145
100 3300005366 Ga0070659_100078769 Ga0070659_1000787692 145
101 3300005367 Ga0070667_100574152 Ga0070667_1005741522 145
102 3300005455 Ga0070663_100078346 Ga0070663_1000783463 145
103 3300005457 Ga0070662_100021849 Ga0070662_1000218492 145
104 3300005457 Ga0070662_100064500 Ga0070662_1000645002 145
105 3300005459 Ga0068867_100030434 Ga0068867_1000304342 145
106 3300005543 Ga0070672_100039232 Ga0070672_1000392323 145
107 3300005548 Ga0070665_100399335 Ga0070665_1003993352 145
108 3300005564 Ga0070664_100007845 Ga0070664_1000078455 145
109 3300005564 Ga0070664_100032277 Ga0070664_1000322773 145
110 3300005577 Ga0068857_100103601 Ga0068857_1001036012 145
111 3300005578 Ga0068854_100030866 Ga0068854_1000308663 145
112 3300005616 Ga0068852_100018418 Ga0068852_1000184183 145
113 3300005616 Ga0068852_100048303 Ga0068852_1000483033 145
114 3300005618 Ga0068864_100101197 Ga0068864_1001011973 145
115 3300005834 Ga0068851_10012858 Ga0068851_100128583 145
116 3300005842 Ga0068858_100049261 Ga0068858_1000492613 145
117 3300005843 Ga0068860_100570481 Ga0068860_1005704812 145
118 3300006237 Ga0097621_100008094 Ga0097621_1000080943 145
119 3300006358 Ga0068871_100004149 Ga0068871_1000041497 145
120 3300006881 Ga0068865_100012793 Ga0068865_1000127932 145
121 3300009093 Ga0105240_10849773 Ga0105240_108497732 145
122 3300009098 Ga0105245_10018736 Ga0105245_100187362 145
123 3300009176 Ga0105242_10032757 Ga0105242_100327572 145
124 3300009545 Ga0105237_10003482 Ga0105237_100034828 145
125 3300009551 Ga0105238_10140782 Ga0105238_101407822 145
126 3300010375 Ga0105239_10000320 Ga0105239_1000032019 145
127 3300011119 Ga0105246_10013255 Ga0105246_100132552 145
128 3300013297 Ga0157378_10038866 Ga0157378_100388662 145
129 3300013306 Ga0163162_10317423 Ga0163162_103174232 145
130 3300013308 Ga0157375_10292184 Ga0157375_102921842 145
131 3300014325 Ga0163163_10013876 Ga0163163_100138764 145
132 3300014968 Ga0157379_10033867 Ga0157379_100338673 145
133 3300017792 Ga0163161_10684014 Ga0163161_106840141 145
134 3300025315 Ga0207697_10010323 Ga0207697_100103232 145
135 3300025321 Ga0207656_10381662 Ga0207656_103816622 145
136 3300025901 Ga0207688_10093836 Ga0207688_100938363 145
137 3300025903 Ga0207680_10031423 Ga0207680_100314233 145
138 3300025907 Ga0207645_10098640 Ga0207645_100986402 145
139 3300025909 Ga0207705_10010446 Ga0207705_100104462 145
140 3300025909 Ga0207705_10581878 Ga0207705_105818782 145
141 3300025909 Ga0207705_10795240 Ga0207705_107952401 145
142 3300025913 Ga0207695_10015548 Ga0207695_100155484 145
143 3300025914 Ga0207671_10008842 Ga0207671_100088421 145
144 3300025919 Ga0207657_10005068 Ga0207657_100050682 145
145 3300025919 Ga0207657_10008998 Ga0207657_100089982 145
146 3300025919 Ga0207657_10033695 Ga0207657_100336953 145
147 3300025920 Ga0207649_10101416 Ga0207649_101014163 145
148 3300025923 Ga0207681_10232280 Ga0207681_102322802 145
149 3300025924 Ga0207694_10253637 Ga0207694_102536372 145
150 3300025925 Ga0207650_10223250 Ga0207650_102232502 145
151 3300025925 Ga0207650_10812866 Ga0207650_108128661 145
152 3300025926 Ga0207659_10460597 Ga0207659_104605972 145
153 3300025927 Ga0207687_10020468 Ga0207687_100204683 145
154 3300025931 Ga0207644_10001296 Ga0207644_100012963 145
155 3300025932 Ga0207690_10120271 Ga0207690_101202712 145
156 3300025932 Ga0207690_10532543 Ga0207690_105325432 145
157 3300025932 Ga0207690_10541188 Ga0207690_105411881 145
158 3300025933 Ga0207706_10000952 Ga0207706_1000095211 145
159 3300025933 Ga0207706_10060965 Ga0207706_100609653 145
160 3300025933 Ga0207706_10213044 Ga0207706_102130441 145
161 3300025934 Ga0207686_10009418 Ga0207686_100094182 145
162 3300025940 Ga0207691_10000881 Ga0207691_1000088117 145
163 3300025941 Ga0207711_10018740 Ga0207711_100187402 145
164 3300025945 Ga0207679_10012396 Ga0207679_100123965 145
165 3300025945 Ga0207679_10438533 Ga0207679_104385332 145
166 3300025981 Ga0207640_10704036 Ga0207640_107040362 145
167 3300025981 Ga0207640_11015506 Ga0207640_110155061 145
168 3300026023 Ga0207677_10018351 Ga0207677_100183513 145
169 3300026035 Ga0207703_10436963 Ga0207703_104369631 145
170 3300026067 Ga0207678_10041180 Ga0207678_100411803 145
171 3300026088 Ga0207641_10092900 Ga0207641_100929002 145
172 3300026089 Ga0207648_10040091 Ga0207648_100400914 145
173 3300026121 Ga0207683_10001432 Ga0207683_1000143211 145
174 3300026142 Ga0207698_10003874 Ga0207698_100038742 145
175 3300026142 Ga0207698_10036879 Ga0207698_100368793 145
176 3300028379 Ga0268266_10179128 Ga0268266_101791282 145
177 3300028381 Ga0268264_10517330 Ga0268264_105173302 145
178 3300037418 Ga0395900_0066937 Ga0395900_0066937_3083_3547 145
179 3300037466 Ga0395898_0477643 Ga0395898_0477643_352_816 145
180 3300037471 Ga0395905_0069982 Ga0395905_0069982_2099_2563 145
181 3300037471 Ga0395905_0156209 Ga0395905_0156209_1656_2126 145
182 3300038443 Ga0395901_0100638 Ga0395901_0100638_693_1157 145
183 3300044694 Ga0466963_0000126 Ga0466963_0000126_8475_8945 145
184 3300044706 Ga0466964_0011042 Ga0466964_0011042_1278_1748 145
185 3300044719 Ga0466971_0294807 Ga0466971_0294807_116_586 145
186 3300044842 Ga0466957_0000607 Ga0466957_0000607_12968_13438 145
187 3300044901 Ga0466960_0030752 Ga0466960_0030752_1393_1857 145
188 3300045976 Ga0466967_0001679 Ga0466967_0001679_5169_5639 145
189 3300048903 Ga0496100_0026728 Ga0496100_0026728_1984_2451 145
190 3300048905 Ga0496102_0137047 Ga0496102_0137047_1698_2165 145
191 3300048909 Ga0496106_0037982 Ga0496106_0037982_2978_3445 145
192 3300048910 Ga0496107_0015415 Ga0496107_0015415_1820_2287 145
193 3300048911 Ga0496108_0007898 Ga0496108_0007898_7531_7998 145
194 3300048911 Ga0496108_0614515 Ga0496108_0614515_284_748 145
195 3300048912 Ga0496109_0019964 Ga0496109_0019964_5401_5868 145
196 3300048913 Ga0496110_0004122 Ga0496110_0004122_10036_10503 145
197 3300048915 Ga0496112_0036712 Ga0496112_0036712_2622_3089 145
198 3300048916 Ga0496113_0107726 Ga0496113_0107726_1137_1604 145
199 3300048924 Ga0496121_0003998 Ga0496121_0003998_674_1153 145
200 3300048924 Ga0496121_0004126 Ga0496121_0004126_674_1153 145
201 3300048929 Ga0496126_0018894 Ga0496126_0018894_5517_5996 145
202 3300049581 Ga0501047_0337953 Ga0501047_0337953_47_529 145
203 3300053140 Ga0500573_0000021 Ga0500573_0000021_10992_11471 145
204 3300061734 Ga0530510_0625516 Ga0530510_0625516_83_547 145
205 iso_pu_bacteria 2643221622 2644126388 145
206 3300005293 Ga0065715_10360954 Ga0065715_103609542 146
207 3300005327 Ga0070658_10006985 Ga0070658_100069858 146
208 3300005328 Ga0070676_10125260 Ga0070676_101252602 146
209 3300005330 Ga0070690_100000954 Ga0070690_1000009544 146
210 3300005331 Ga0070670_100009485 Ga0070670_1000094853 146
211 3300005333 Ga0070677_10034600 Ga0070677_100346003 146
212 3300005335 Ga0070666_10000218 Ga0070666_1000021812 146
213 3300005335 Ga0070666_10012898 Ga0070666_100128985 146
214 3300005336 Ga0070680_100000206 Ga0070680_10000020617 146
215 3300005336 Ga0070680_100046154 Ga0070680_1000461543 146
216 3300005338 Ga0068868_100012329 Ga0068868_1000123295 146
217 3300005339 Ga0070660_100042943 Ga0070660_1000429433 146
218 3300005340 Ga0070689_100666965 Ga0070689_1006669652 146
219 3300005343 Ga0070687_100154071 Ga0070687_1001540712 146
220 3300005344 Ga0070661_100002617 Ga0070661_1000026177 146
221 3300005344 Ga0070661_100087760 Ga0070661_1000877603 146
222 3300005353 Ga0070669_100159636 Ga0070669_1001596362 146
223 3300005354 Ga0070675_100003351 Ga0070675_1000033515 146
224 3300005355 Ga0070671_100001018 Ga0070671_1000010183 146
225 3300005355 Ga0070671_100064655 Ga0070671_1000646553 146
226 3300005356 Ga0070674_100009084 Ga0070674_1000090845 146
227 3300005356 Ga0070674_100014733 Ga0070674_1000147332 146
228 3300005356 Ga0070674_100077688 Ga0070674_1000776883 146
229 3300005364 Ga0070673_100007115 Ga0070673_1000071157 146
230 3300005364 Ga0070673_100011172 Ga0070673_1000111723 146
231 3300005364 Ga0070673_100158333 Ga0070673_1001583332 146
232 3300005366 Ga0070659_100008832 Ga0070659_1000088324 146
233 3300005367 Ga0070667_100000943 Ga0070667_10000094312 146
234 3300005455 Ga0070663_100085455 Ga0070663_1000854553 146
235 3300005456 Ga0070678_100108041 Ga0070678_1001080413 146
236 3300005457 Ga0070662_100027970 Ga0070662_1000279702 146
237 3300005459 Ga0068867_100274611 Ga0068867_1002746112 146
238 3300005466 Ga0070685_10343208 Ga0070685_103432082 146
239 3300005539 Ga0068853_100129550 Ga0068853_1001295503 146
240 3300005543 Ga0070672_100000733 Ga0070672_1000007333 146
241 3300005544 Ga0070686_100087419 Ga0070686_1000874191 146
242 3300005548 Ga0070665_100328314 Ga0070665_1003283142 146
243 3300005548 Ga0070665_100372889 Ga0070665_1003728892 146
244 3300005563 Ga0068855_100117752 Ga0068855_1001177523 146
245 3300005564 Ga0070664_100005885 Ga0070664_1000058855 146
246 3300005564 Ga0070664_100591242 Ga0070664_1005912422 146
247 3300005578 Ga0068854_100152667 Ga0068854_1001526672 146
248 3300005617 Ga0068859_100424721 Ga0068859_1004247212 146
249 3300005718 Ga0068866_10046341 Ga0068866_100463413 146
250 3300005834 Ga0068851_10006999 Ga0068851_100069995 146
251 3300005842 Ga0068858_100014867 Ga0068858_1000148676 146
252 3300005843 Ga0068860_100230995 Ga0068860_1002309953 146
253 3300006931 Ga0097620_100424723 Ga0097620_1004247232 146
254 3300009098 Ga0105245_10039776 Ga0105245_100397763 146
255 3300009177 Ga0105248_10002706 Ga0105248_1000270615 146
256 3300009177 Ga0105248_10025988 Ga0105248_100259883 146
257 3300009177 Ga0105248_10370470 Ga0105248_103704702 146
258 3300013100 Ga0157373_10122890 Ga0157373_101228902 146
259 3300013102 Ga0157371_10652440 Ga0157371_106524402 146
260 3300013104 Ga0157370_10075192 Ga0157370_100751922 146
261 3300013306 Ga0163162_10270445 Ga0163162_102704452 146
262 3300013308 Ga0157375_10038075 Ga0157375_100380753 146
263 3300014968 Ga0157379_10165871 Ga0157379_101658712 146
264 3300017792 Ga0163161_10198329 Ga0163161_101983293 146
265 3300025304 Ga0209257_1006803 Ga0209257_10068032 146
266 3300025899 Ga0207642_10224922 Ga0207642_102249221 146
267 3300025903 Ga0207680_10004216 Ga0207680_100042164 146
268 3300025903 Ga0207680_10050876 Ga0207680_100508763 146
269 3300025904 Ga0207647_10615998 Ga0207647_106159982 146
270 3300025907 Ga0207645_10139883 Ga0207645_101398832 146
271 3300025909 Ga0207705_10164747 Ga0207705_101647472 146
272 3300025917 Ga0207660_10018966 Ga0207660_100189663 146
273 3300025918 Ga0207662_10065243 Ga0207662_100652433 146
274 3300025919 Ga0207657_10292814 Ga0207657_102928142 146
275 3300025921 Ga0207652_10094971 Ga0207652_100949712 146
276 3300025923 Ga0207681_10012078 Ga0207681_100120785 146
277 3300025925 Ga0207650_10001371 Ga0207650_1000137111 146
278 3300025926 Ga0207659_10002119 Ga0207659_100021195 146
279 3300025927 Ga0207687_10013015 Ga0207687_100130152 146
280 3300025931 Ga0207644_10007705 Ga0207644_100077054 146
281 3300025931 Ga0207644_10101579 Ga0207644_101015793 146
282 3300025932 Ga0207690_10196828 Ga0207690_101968282 146
283 3300025933 Ga0207706_10048655 Ga0207706_100486553 146
284 3300025933 Ga0207706_10288624 Ga0207706_102886242 146
285 3300025937 Ga0207669_10005065 Ga0207669_100050652 146
286 3300025937 Ga0207669_10009795 Ga0207669_100097954 146
287 3300025937 Ga0207669_10111257 Ga0207669_101112573 146
288 3300025940 Ga0207691_10006752 Ga0207691_100067525 146
289 3300025941 Ga0207711_10004466 Ga0207711_1000446612 146
290 3300025941 Ga0207711_10012694 Ga0207711_100126943 146
291 3300025945 Ga0207679_10004609 Ga0207679_100046098 146
292 3300025949 Ga0207667_11435567 Ga0207667_114355671 146
293 3300025960 Ga0207651_10007541 Ga0207651_100075414 146
294 3300025960 Ga0207651_10133042 Ga0207651_101330423 146
295 3300025981 Ga0207640_10190701 Ga0207640_101907012 146
296 3300025986 Ga0207658_10004159 Ga0207658_100041594 146
297 3300025986 Ga0207658_10008425 Ga0207658_100084254 146
298 3300025986 Ga0207658_10513686 Ga0207658_105136862 146
299 3300026023 Ga0207677_10002225 Ga0207677_1000222510 146
300 3300026035 Ga0207703_10001347 Ga0207703_1000134720 146
301 3300026035 Ga0207703_10334890 Ga0207703_103348902 146
302 3300026041 Ga0207639_10204899 Ga0207639_102048992 146
303 3300026067 Ga0207678_10566693 Ga0207678_105666932 146
304 3300026089 Ga0207648_10644061 Ga0207648_106440612 146
305 3300026121 Ga0207683_10481712 Ga0207683_104817122 146
306 3300026142 Ga0207698_10274679 Ga0207698_102746793 146
307 3300028381 Ga0268264_10447611 Ga0268264_104476112 146
308 3300031548 Ga0307408_100059836 Ga0307408_1000598363 146
309 3300031852 Ga0307410_10014389 Ga0307410_100143893 146
310 3300031903 Ga0307407_10001773 Ga0307407_100017735 146
311 3300031995 Ga0307409_100012106 Ga0307409_1000121063 146
312 3300032002 Ga0307416_100011540 Ga0307416_1000115405 146
313 3300032126 Ga0307415_100191423 Ga0307415_1001914231 146
314 3300037418 Ga0395900_0066776 Ga0395900_0066776_1327_1794 146
315 3300037471 Ga0395905_0098850 Ga0395905_0098850_423_896 146
316 3300038443 Ga0395901_1331831 Ga0395901_1331831_174_647 146
317 3300046684 Ga0495669_0014428 Ga0495669_0014428_2201_2668 146
318 3300046691 Ga0495670_0000009 Ga0495670_0000009_10524_11003 146
319 3300046694 Ga0495649_0158362 Ga0495649_0158362_323_799 146
320 3300048904 Ga0496101_0908253 Ga0496101_0908253_139_618 146
321 3300048910 Ga0496107_0294287 Ga0496107_0294287_59_538 146
322 3300048911 Ga0496108_0371588 Ga0496108_0371588_261_740 146
323 3300048912 Ga0496109_0319296 Ga0496109_0319296_234_713 146
324 3300048913 Ga0496110_0003671 Ga0496110_0003671_5175_5642 146
325 3300048913 Ga0496110_0231402 Ga0496110_0231402_198_677 146
326 3300048914 Ga0496111_0009471 Ga0496111_0009471_2201_2668 146
327 3300048914 Ga0496111_0535535 Ga0496111_0535535_199_678 146
328 3300048914 Ga0496111_0653951 Ga0496111_0653951_90_572 146
329 3300048917 Ga0496114_0075116 Ga0496114_0075116_1125_1604 146
330 3300049583 Ga0501067_0123011 Ga0501067_0123011_342_815 146
331 3300053125 Ga0500618_006844 Ga0500618_006844_245_721 146
332 3300001979 JGI24740J21852_10003897 JGI24740J21852_100038972 147
333 3300001989 JGI24739J22299_10003849 JGI24739J22299_100038494 147
334 3300001989 JGI24739J22299_10006074 JGI24739J22299_100060743 147
335 3300001990 JGI24737J22298_10011745 JGI24737J22298_100117453 147
336 3300002067 JGI24735J21928_10000757 JGI24735J21928_100007573 147
337 3300002075 JGI24738J21930_10000726 JGI24738J21930_100007265 147
338 3300002075 JGI24738J21930_10042868 JGI24738J21930_100428682 147
339 3300005327 Ga0070658_10983735 Ga0070658_109837352 147
340 3300005328 Ga0070676_10059361 Ga0070676_100593613 147
341 3300005329 Ga0070683_100012089 Ga0070683_1000120897 147
342 3300005331 Ga0070670_100003725 Ga0070670_1000037253 147
343 3300005331 Ga0070670_100177521 Ga0070670_1001775212 147
344 3300005334 Ga0068869_100071630 Ga0068869_1000716302 147
345 3300005335 Ga0070666_10003372 Ga0070666_100033726 147
346 3300005336 Ga0070680_100002981 Ga0070680_1000029812 147
347 3300005336 Ga0070680_100009340 Ga0070680_1000093402 147
348 3300005336 Ga0070680_100039872 Ga0070680_1000398723 147
349 3300005337 Ga0070682_100513816 Ga0070682_1005138162 147
350 3300005337 Ga0070682_100566299 Ga0070682_1005662992 147
351 3300005337 Ga0070682_100790826 Ga0070682_1007908262 147
352 3300005338 Ga0068868_100024853 Ga0068868_1000248533 147
353 3300005338 Ga0068868_100849573 Ga0068868_1008495732 147
354 3300005339 Ga0070660_100038204 Ga0070660_1000382043 147
355 3300005339 Ga0070660_100134213 Ga0070660_1001342131 147
356 3300005339 Ga0070660_100152430 Ga0070660_1001524302 147
357 3300005341 Ga0070691_10006865 Ga0070691_100068652 147
358 3300005344 Ga0070661_100023427 Ga0070661_1000234273 147
359 3300005344 Ga0070661_100030687 Ga0070661_1000306873 147
360 3300005344 Ga0070661_100038123 Ga0070661_1000381233 147
361 3300005344 Ga0070661_100751296 Ga0070661_1007512962 147
362 3300005347 Ga0070668_100026641 Ga0070668_1000266413 147
363 3300005347 Ga0070668_100079292 Ga0070668_1000792922 147
364 3300005353 Ga0070669_100051888 Ga0070669_1000518882 147
365 3300005354 Ga0070675_100184125 Ga0070675_1001841253 147
366 3300005355 Ga0070671_100073257 Ga0070671_1000732572 147
367 3300005364 Ga0070673_100056670 Ga0070673_1000566703 147
368 3300005366 Ga0070659_100033596 Ga0070659_1000335963 147
369 3300005366 Ga0070659_100058376 Ga0070659_1000583762 147
370 3300005366 Ga0070659_100073508 Ga0070659_1000735082 147
371 3300005367 Ga0070667_100002912 Ga0070667_10000291213 147
372 3300005367 Ga0070667_100041159 Ga0070667_1000411593 147
373 3300005367 Ga0070667_100048405 Ga0070667_1000484053 147
374 3300005367 Ga0070667_100066479 Ga0070667_1000664793 147
375 3300005367 Ga0070667_100579866 Ga0070667_1005798662 147
376 3300005435 Ga0070714_100472791 Ga0070714_1004727911 147
377 3300005455 Ga0070663_100216815 Ga0070663_1002168152 147
378 3300005455 Ga0070663_100292718 Ga0070663_1002927182 147
379 3300005457 Ga0070662_100064604 Ga0070662_1000646042 147
380 3300005457 Ga0070662_100150001 Ga0070662_1001500012 147
381 3300005457 Ga0070662_100153971 Ga0070662_1001539712 147
382 3300005457 Ga0070662_100162347 Ga0070662_1001623472 147
383 3300005457 Ga0070662_100607293 Ga0070662_1006072932 147
384 3300005457 Ga0070662_101014520 Ga0070662_1010145202 147
385 3300005458 Ga0070681_10064558 Ga0070681_100645582 147
386 3300005458 Ga0070681_10103713 Ga0070681_101037133 147
387 3300005530 Ga0070679_100183307 Ga0070679_1001833072 147
388 3300005535 Ga0070684_100014421 Ga0070684_1000144211 147
389 3300005539 Ga0068853_100108692 Ga0068853_1001086923 147
390 3300005539 Ga0068853_100167662 Ga0068853_1001676622 147
391 3300005539 Ga0068853_100167691 Ga0068853_1001676912 147
392 3300005539 Ga0068853_100721782 Ga0068853_1007217822 147
393 3300005548 Ga0070665_100005169 Ga0070665_1000051693 147
394 3300005548 Ga0070665_100009388 Ga0070665_1000093887 147
395 3300005548 Ga0070665_100263897 Ga0070665_1002638972 147
396 3300005564 Ga0070664_100012630 Ga0070664_1000126306 147
397 3300005564 Ga0070664_100016350 Ga0070664_1000163503 147
398 3300005564 Ga0070664_100033395 Ga0070664_1000333953 147
399 3300005564 Ga0070664_100051706 Ga0070664_1000517062 147
400 3300005564 Ga0070664_100053073 Ga0070664_1000530733 147
401 3300005564 Ga0070664_100192527 Ga0070664_1001925273 147
402 3300005577 Ga0068857_100420004 Ga0068857_1004200042 147
403 3300005577 Ga0068857_100693047 Ga0068857_1006930472 147
404 3300005578 Ga0068854_100083331 Ga0068854_1000833313 147
405 3300005578 Ga0068854_100110306 Ga0068854_1001103063 147
406 3300005578 Ga0068854_100202946 Ga0068854_1002029463 147
407 3300005578 Ga0068854_100251426 Ga0068854_1002514262 147
408 3300005614 Ga0068856_100008548 Ga0068856_1000085483 147
409 3300005614 Ga0068856_100854845 Ga0068856_1008548452 147
410 3300005614 Ga0068856_101596392 Ga0068856_1015963922 147
411 3300005616 Ga0068852_100132456 Ga0068852_1001324562 147
412 3300005616 Ga0068852_100162253 Ga0068852_1001622532 147
413 3300005616 Ga0068852_100174661 Ga0068852_1001746612 147
414 3300005616 Ga0068852_100275128 Ga0068852_1002751282 147
415 3300005616 Ga0068852_100834315 Ga0068852_1008343152 147
416 3300005617 Ga0068859_100010218 Ga0068859_1000102182 147
417 3300005617 Ga0068859_100046305 Ga0068859_1000463052 147
418 3300005617 Ga0068859_100082905 Ga0068859_1000829052 147
419 3300005617 Ga0068859_100112242 Ga0068859_1001122422 147
420 3300005617 Ga0068859_100136170 Ga0068859_1001361702 147
421 3300005618 Ga0068864_100000549 Ga0068864_1000005498 147
422 3300005618 Ga0068864_100106402 Ga0068864_1001064023 147
423 3300005618 Ga0068864_100234075 Ga0068864_1002340752 147
424 3300005841 Ga0068863_100000494 Ga0068863_10000049414 147
425 3300005841 Ga0068863_100006151 Ga0068863_1000061515 147
426 3300005841 Ga0068863_100205201 Ga0068863_1002052012 147
427 3300005841 Ga0068863_100388497 Ga0068863_1003884972 147
428 3300005842 Ga0068858_100023005 Ga0068858_1000230055 147
429 3300005842 Ga0068858_100039536 Ga0068858_1000395362 147
430 3300005843 Ga0068860_100002137 Ga0068860_10000213713 147
431 3300005843 Ga0068860_100014123 Ga0068860_1000141232 147
432 3300005843 Ga0068860_100157731 Ga0068860_1001577312 147
433 3300005843 Ga0068860_100438998 Ga0068860_1004389982 147
434 3300005844 Ga0068862_100002925 Ga0068862_10000292510 147
435 3300005844 Ga0068862_100008503 Ga0068862_1000085035 147
436 3300006931 Ga0097620_100010217 Ga0097620_1000102172 147
437 3300006931 Ga0097620_100046308 Ga0097620_1000463082 147
438 3300006931 Ga0097620_100082905 Ga0097620_1000829052 147
439 3300006931 Ga0097620_100112244 Ga0097620_1001122442 147
440 3300006931 Ga0097620_100136167 Ga0097620_1001361672 147
441 3300009093 Ga0105240_10035070 Ga0105240_100350703 147
442 3300009177 Ga0105248_10001278 Ga0105248_100012785 147
443 3300009177 Ga0105248_10008598 Ga0105248_1000859810 147
444 3300009177 Ga0105248_10103106 Ga0105248_101031062 147
445 3300009545 Ga0105237_10013043 Ga0105237_100130439 147
446 3300009551 Ga0105238_10074252 Ga0105238_100742522 147
447 3300009551 Ga0105238_11511125 Ga0105238_115111252 147
448 3300009553 Ga0105249_10002386 Ga0105249_1000238611 147
449 3300009553 Ga0105249_10908900 Ga0105249_109089001 147
450 3300011119 Ga0105246_10032636 Ga0105246_100326362 147
451 3300013100 Ga0157373_10045830 Ga0157373_100458302 147
452 3300013100 Ga0157373_10105506 Ga0157373_101055063 147
453 3300013100 Ga0157373_10208923 Ga0157373_102089232 147
454 3300013100 Ga0157373_10230726 Ga0157373_102307264 147
455 3300013102 Ga0157371_10043779 Ga0157371_100437793 147
456 3300013102 Ga0157371_10067725 Ga0157371_100677253 147
457 3300013102 Ga0157371_10432141 Ga0157371_104321412 147
458 3300013102 Ga0157371_10827770 Ga0157371_108277702 147
459 3300013104 Ga0157370_10032007 Ga0157370_100320073 147
460 3300013105 Ga0157369_10100265 Ga0157369_101002653 147
461 3300013105 Ga0157369_10314354 Ga0157369_103143542 147
462 3300013306 Ga0163162_10043040 Ga0163162_100430402 147
463 3300013307 Ga0157372_10068153 Ga0157372_100681533 147
464 3300013307 Ga0157372_10152270 Ga0157372_101522703 147
465 3300013307 Ga0157372_10299357 Ga0157372_102993571 147
466 3300013307 Ga0157372_11238776 Ga0157372_112387762 147
467 3300013307 Ga0157372_11325813 Ga0157372_113258132 147
468 3300014325 Ga0163163_10000161 Ga0163163_1000016156 147
469 3300014497 Ga0182008_10369618 Ga0182008_103696182 147
470 3300014745 Ga0157377_10898009 Ga0157377_108980092 147
471 3300014968 Ga0157379_10294762 Ga0157379_102947622 147
472 3300021384 Ga0213876_10011153 Ga0213876_100111532 147
473 3300025711 Ga0207696_1046278 Ga0207696_10462782 147
474 3300025904 Ga0207647_10001708 Ga0207647_1000170814 147
475 3300025904 Ga0207647_10201546 Ga0207647_102015461 147
476 3300025907 Ga0207645_10019647 Ga0207645_100196474 147
477 3300025909 Ga0207705_10004371 Ga0207705_1000437110 147
478 3300025909 Ga0207705_10072797 Ga0207705_100727972 147
479 3300025909 Ga0207705_10776824 Ga0207705_107768242 147
480 3300025912 Ga0207707_10268643 Ga0207707_102686432 147
481 3300025912 Ga0207707_11024241 Ga0207707_110242412 147
482 3300025913 Ga0207695_10026318 Ga0207695_100263187 147
483 3300025913 Ga0207695_10586923 Ga0207695_105869232 147
484 3300025917 Ga0207660_10021512 Ga0207660_100215123 147
485 3300025917 Ga0207660_10069074 Ga0207660_100690743 147
486 3300025917 Ga0207660_10236203 Ga0207660_102362032 147
487 3300025919 Ga0207657_10004704 Ga0207657_100047046 147
488 3300025919 Ga0207657_10006194 Ga0207657_100061949 147
489 3300025919 Ga0207657_10007842 Ga0207657_1000784210 147
490 3300025919 Ga0207657_10022120 Ga0207657_100221201 147
491 3300025919 Ga0207657_10026506 Ga0207657_100265063 147
492 3300025919 Ga0207657_10078828 Ga0207657_100788282 147
493 3300025919 Ga0207657_10095335 Ga0207657_100953353 147
494 3300025920 Ga0207649_10022509 Ga0207649_100225093 147
495 3300025920 Ga0207649_10089958 Ga0207649_100899582 147
496 3300025921 Ga0207652_10126002 Ga0207652_101260022 147
497 3300025921 Ga0207652_10256461 Ga0207652_102564611 147
498 3300025921 Ga0207652_10803030 Ga0207652_108030301 147
499 3300025923 Ga0207681_10043674 Ga0207681_100436743 147
500 3300025924 Ga0207694_10089768 Ga0207694_100897682 147
501 3300025925 Ga0207650_10138632 Ga0207650_101386322 147
502 3300025926 Ga0207659_10035251 Ga0207659_100352513 147
503 3300025929 Ga0207664_10346842 Ga0207664_103468422 147
504 3300025931 Ga0207644_10053448 Ga0207644_100534482 147
505 3300025931 Ga0207644_10375411 Ga0207644_103754112 147
506 3300025932 Ga0207690_10056127 Ga0207690_100561273 147
507 3300025932 Ga0207690_10063130 Ga0207690_100631302 147
508 3300025932 Ga0207690_10103452 Ga0207690_101034523 147
509 3300025933 Ga0207706_10008832 Ga0207706_100088323 147
510 3300025933 Ga0207706_10036949 Ga0207706_100369493 147
511 3300025933 Ga0207706_10038080 Ga0207706_100380803 147
512 3300025933 Ga0207706_10072888 Ga0207706_100728882 147
513 3300025933 Ga0207706_10395160 Ga0207706_103951602 147
514 3300025936 Ga0207670_10395136 Ga0207670_103951362 147
515 3300025941 Ga0207711_10000281 Ga0207711_1000028126 147
516 3300025941 Ga0207711_10024277 Ga0207711_100242772 147
517 3300025941 Ga0207711_10286213 Ga0207711_102862131 147
518 3300025941 Ga0207711_10946215 Ga0207711_109462152 147
519 3300025942 Ga0207689_10077769 Ga0207689_100777692 147
520 3300025944 Ga0207661_10266138 Ga0207661_102661382 147
521 3300025945 Ga0207679_10002546 Ga0207679_100025462 147
522 3300025945 Ga0207679_10056259 Ga0207679_100562592 147
523 3300025945 Ga0207679_10078924 Ga0207679_100789243 147
524 3300025945 Ga0207679_10221709 Ga0207679_102217093 147
525 3300025945 Ga0207679_10419697 Ga0207679_104196972 147
526 3300025949 Ga0207667_10020100 Ga0207667_100201002 147
527 3300025949 Ga0207667_10750769 Ga0207667_107507692 147
528 3300025960 Ga0207651_10012439 Ga0207651_100124394 147
529 3300025961 Ga0207712_10072576 Ga0207712_100725763 147
530 3300025961 Ga0207712_10138654 Ga0207712_101386542 147
531 3300025972 Ga0207668_10076624 Ga0207668_100766243 147
532 3300025972 Ga0207668_10344763 Ga0207668_103447632 147
533 3300025972 Ga0207668_10354047 Ga0207668_103540472 147
534 3300025972 Ga0207668_10500209 Ga0207668_105002092 147
535 3300025981 Ga0207640_10044085 Ga0207640_100440853 147
536 3300025981 Ga0207640_10093790 Ga0207640_100937902 147
537 3300025981 Ga0207640_10125387 Ga0207640_101253872 147
538 3300025981 Ga0207640_10229078 Ga0207640_102290781 147
539 3300025986 Ga0207658_10003998 Ga0207658_100039989 147
540 3300025986 Ga0207658_10006887 Ga0207658_100068876 147
541 3300025986 Ga0207658_10041155 Ga0207658_100411553 147
542 3300025986 Ga0207658_10166166 Ga0207658_101661662 147
543 3300025986 Ga0207658_10535562 Ga0207658_105355622 147
544 3300025986 Ga0207658_10535572 Ga0207658_105355722 147
545 3300026023 Ga0207677_10008855 Ga0207677_100088553 147
546 3300026023 Ga0207677_10295704 Ga0207677_102957043 147
547 3300026023 Ga0207677_11480076 Ga0207677_114800761 147
548 3300026035 Ga0207703_10008666 Ga0207703_100086662 147
549 3300026035 Ga0207703_10142526 Ga0207703_101425263 147
550 3300026035 Ga0207703_10956145 Ga0207703_109561451 147
551 3300026041 Ga0207639_10081600 Ga0207639_100816003 147
552 3300026041 Ga0207639_10085355 Ga0207639_100853552 147
553 3300026041 Ga0207639_10101721 Ga0207639_101017212 147
554 3300026041 Ga0207639_10242560 Ga0207639_102425602 147
555 3300026041 Ga0207639_11108288 Ga0207639_111082882 147
556 3300026067 Ga0207678_10003552 Ga0207678_1000355210 147
557 3300026067 Ga0207678_10009969 Ga0207678_100099696 147
558 3300026067 Ga0207678_10011847 Ga0207678_100118475 147
559 3300026067 Ga0207678_10057241 Ga0207678_100572411 147
560 3300026067 Ga0207678_10262815 Ga0207678_102628152 147
561 3300026078 Ga0207702_10403838 Ga0207702_104038382 147
562 3300026088 Ga0207641_10002125 Ga0207641_100021254 147
563 3300026088 Ga0207641_10099884 Ga0207641_100998842 147
564 3300026088 Ga0207641_10600361 Ga0207641_106003612 147
565 3300026095 Ga0207676_10004063 Ga0207676_100040634 147
566 3300026095 Ga0207676_10018677 Ga0207676_100186773 147
567 3300026095 Ga0207676_10503572 Ga0207676_105035722 147
568 3300026116 Ga0207674_10001776 Ga0207674_100017762 147
569 3300026116 Ga0207674_10006833 Ga0207674_1000683311 147
570 3300026116 Ga0207674_10010399 Ga0207674_100103999 147
571 3300026116 Ga0207674_10034950 Ga0207674_100349503 147
572 3300026116 Ga0207674_10157526 Ga0207674_101575262 147
573 3300026116 Ga0207674_10255964 Ga0207674_102559642 147
574 3300026121 Ga0207683_10095809 Ga0207683_100958092 147
575 3300026142 Ga0207698_10012231 Ga0207698_100122315 147
576 3300026142 Ga0207698_10091568 Ga0207698_100915683 147
577 3300026142 Ga0207698_10108029 Ga0207698_101080292 147
578 3300026142 Ga0207698_10362229 Ga0207698_103622293 147
579 3300026142 Ga0207698_11787618 Ga0207698_117876182 147
580 3300027665 Ga0209983_1016393 Ga0209983_10163932 147
581 3300027876 Ga0209974_10002783 Ga0209974_100027834 147
582 3300028379 Ga0268266_10000186 Ga0268266_10000186106 147
583 3300028379 Ga0268266_10043336 Ga0268266_100433363 147
584 3300028379 Ga0268266_10498802 Ga0268266_104988022 147
585 3300028380 Ga0268265_10004985 Ga0268265_100049853 147
586 3300028380 Ga0268265_10029887 Ga0268265_100298873 147
587 3300028380 Ga0268265_10166689 Ga0268265_101666893 147
588 3300028381 Ga0268264_10001116 Ga0268264_100011168 147
589 3300028381 Ga0268264_10095426 Ga0268264_100954262 147
590 3300028381 Ga0268264_10338125 Ga0268264_103381252 147
591 3300031548 Ga0307408_100619985 Ga0307408_1006199852 147
592 3300031731 Ga0307405_10006496 Ga0307405_100064964 147
593 3300031731 Ga0307405_10085705 Ga0307405_100857052 147
594 3300031824 Ga0307413_10431709 Ga0307413_104317092 147
595 3300031901 Ga0307406_10157733 Ga0307406_101577333 147
596 3300031901 Ga0307406_11157023 Ga0307406_111570232 147
597 3300031903 Ga0307407_10806390 Ga0307407_108063902 147
598 3300031911 Ga0307412_10388855 Ga0307412_103888552 147
599 3300031995 Ga0307409_100006069 Ga0307409_1000060697 147
600 3300032002 Ga0307416_100020087 Ga0307416_1000200874 147
601 3300032002 Ga0307416_100021516 Ga0307416_1000215164 147
602 3300032004 Ga0307414_10007292 Ga0307414_100072923 147
603 3300032005 Ga0307411_11197841 Ga0307411_111978412 147
604 3300032126 Ga0307415_100480413 Ga0307415_1004804132 147
605 3300032126 Ga0307415_100511859 Ga0307415_1005118592 147
606 3300035084 Ga0373928_0088327 Ga0373928_0088327_200_673 147
607 3300035088 Ga0373940_0042506 Ga0373940_0042506_531_1004 147
608 3300035692 Ga0373935_0015607 Ga0373935_0015607_3707_4183 147
609 3300035725 Ga0373947_0044719 Ga0373947_0044719_318_794 147
610 3300037068 Ga0373925_0049634 Ga0373925_0049634_1993_2469 147
611 3300037312 Ga0395899_0018664 Ga0395899_0018664_865_1338 147
612 3300037312 Ga0395899_0272913 Ga0395899_0272913_458_931 147
613 3300037418 Ga0395900_0087902 Ga0395900_0087902_1383_1856 147
614 3300037418 Ga0395900_0143357 Ga0395900_0143357_36_509 147
615 3300037418 Ga0395900_0194834 Ga0395900_0194834_81_554 147
616 3300037418 Ga0395900_0197368 Ga0395900_0197368_1434_1907 147
617 3300037418 Ga0395900_0651731 Ga0395900_0651731_151_624 147
618 3300037418 Ga0395900_1712334 Ga0395900_1712334_44_517 147
619 3300037466 Ga0395898_0074710 Ga0395898_0074710_785_1258 147
620 3300037466 Ga0395898_1457992 Ga0395898_1457992_128_601 147
621 3300037471 Ga0395905_0207983 Ga0395905_0207983_904_1377 147
622 3300037471 Ga0395905_0222784 Ga0395905_0222784_119_592 147
623 3300037471 Ga0395905_0342308 Ga0395905_0342308_123_596 147
624 3300037471 Ga0395905_0590496 Ga0395905_0590496_529_1002 147
625 3300037471 Ga0395905_1239420 Ga0395905_1239420_148_621 147
626 3300038443 Ga0395901_0175268 Ga0395901_0175268_1160_1633 147
627 3300039437 Ga0436365_1103114 Ga0436365_1103114_2740_3213 147
628 3300039450 Ga0436363_0285327 Ga0436363_0285327_171_644 147
629 3300042004 Ga0439445_0091756 Ga0439445_0091756_105_578 147
630 3300042012 Ga0439455_0094813 Ga0439455_0094813_166_639 147
631 3300042530 Ga0450916_026751 Ga0450916_026751_297_770 147
632 3300044842 Ga0466957_0080709 Ga0466957_0080709_1211_1684 147
633 3300045976 Ga0466967_0020409 Ga0466967_0020409_2135_2608 147
634 3300045976 Ga0466967_0104246 Ga0466967_0104246_2109_2582 147
635 3300045976 Ga0466967_0599356 Ga0466967_0599356_486_959 147
636 3300046525 Ga0495663_0123360 Ga0495663_0123360_381_854 147
637 3300046684 Ga0495669_0035565 Ga0495669_0035565_1432_1905 147
638 3300048903 Ga0496100_0893050 Ga0496100_0893050_192_668 147
639 3300048910 Ga0496107_0047696 Ga0496107_0047696_527_1003 147
640 3300048910 Ga0496107_0366424 Ga0496107_0366424_349_825 147
641 3300048912 Ga0496109_0213503 Ga0496109_0213503_10_483 147
642 3300048912 Ga0496109_0395975 Ga0496109_0395975_68_541 147
643 3300048914 Ga0496111_0105035 Ga0496111_0105035_1524_2000 147
644 3300048914 Ga0496111_0225186 Ga0496111_0225186_850_1323 147
645 3300048914 Ga0496111_0391591 Ga0496111_0391591_519_992 147
646 3300048925 Ga0496122_0007834 Ga0496122_0007834_7594_8070 147
647 3300048926 Ga0496123_0010830 Ga0496123_0010830_5096_5572 147
648 3300048927 Ga0496124_0067394 Ga0496124_0067394_83_559 147
649 3300053134 Ga0500658_0000029 Ga0500658_0000029_82802_83275 147
650 3300001915 JGI24741J21665_1013644 JGI24741J21665_10136442 148
651 3300001979 JGI24740J21852_10049950 JGI24740J21852_100499501 148
652 3300001989 JGI24739J22299_10002463 JGI24739J22299_100024633 148
653 3300001989 JGI24739J22299_10003529 JGI24739J22299_100035292 148
654 3300001990 JGI24737J22298_10000173 JGI24737J22298_1000017319 148
655 3300001990 JGI24737J22298_10002968 JGI24737J22298_100029685 148
656 3300002067 JGI24735J21928_10001022 JGI24735J21928_100010223 148
657 3300002067 JGI24735J21928_10029333 JGI24735J21928_100293332 148
658 3300002067 JGI24735J21928_10032904 JGI24735J21928_100329042 148
659 3300002075 JGI24738J21930_10007828 JGI24738J21930_100078282 148
660 3300003187 JGI25151J46595_10023505 JGI25151J46595_100235053 148
661 3300003215 JGI25153J46596_10000002 JGI25153J46596_10000002566 148
662 3300003215 JGI25153J46596_10000248 JGI25153J46596_1000024812 148
663 3300003215 JGI25153J46596_10000266 JGI25153J46596_1000026639 148
664 3300003215 JGI25153J46596_10007611 JGI25153J46596_100076113 148
665 3300003773 Ga0055537_1001063 Ga0055537_10010635 148
666 3300003773 Ga0055537_1006552 Ga0055537_10065523 148
667 3300003775 Ga0055524_1001182 Ga0055524_10011827 148
668 3300003781 Ga0055536_1042845 Ga0055536_10428451 148
669 3300003791 Ga0055530_10000978 Ga0055530_1000097822 148
670 3300003791 Ga0055530_10005504 Ga0055530_100055044 148
671 3300003791 Ga0055530_10005629 Ga0055530_100056294 148
672 3300003791 Ga0055530_10035868 Ga0055530_100358681 148
673 3300003794 Ga0055531_10002842 Ga0055531_100028429 148
674 3300003794 Ga0055531_10005946 Ga0055531_100059466 148
675 3300005262 Ga0065165_1008563 Ga0065165_10085632 148
676 3300005262 Ga0065165_1011492 Ga0065165_10114923 148
677 3300005327 Ga0070658_10000941 Ga0070658_1000094110 148
678 3300005327 Ga0070658_10113125 Ga0070658_101131253 148
679 3300005327 Ga0070658_10202749 Ga0070658_102027492 148
680 3300005329 Ga0070683_100001130 Ga0070683_10000113011 148
681 3300005330 Ga0070690_100055164 Ga0070690_1000551643 148
682 3300005331 Ga0070670_100000051 Ga0070670_10000005151 148
683 3300005335 Ga0070666_10000523 Ga0070666_100005233 148
684 3300005335 Ga0070666_10137968 Ga0070666_101379683 148
685 3300005335 Ga0070666_10407070 Ga0070666_104070702 148
686 3300005336 Ga0070680_100110499 Ga0070680_1001104992 148
687 3300005336 Ga0070680_101051297 Ga0070680_1010512971 148
688 3300005336 Ga0070680_101164815 Ga0070680_1011648151 148
689 3300005337 Ga0070682_100059172 Ga0070682_1000591722 148
690 3300005339 Ga0070660_100000460 Ga0070660_10000046013 148
691 3300005339 Ga0070660_100077529 Ga0070660_1000775292 148
692 3300005344 Ga0070661_100000112 Ga0070661_1000001128 148
693 3300005344 Ga0070661_100267001 Ga0070661_1002670012 148
694 3300005353 Ga0070669_100049950 Ga0070669_1000499503 148
695 3300005355 Ga0070671_100000394 Ga0070671_10000039416 148
696 3300005355 Ga0070671_100012499 Ga0070671_1000124996 148
697 3300005356 Ga0070674_100018048 Ga0070674_1000180483 148
698 3300005356 Ga0070674_100253033 Ga0070674_1002530332 148
699 3300005366 Ga0070659_100001048 Ga0070659_10000104811 148
700 3300005366 Ga0070659_100039593 Ga0070659_1000395935 148
701 3300005366 Ga0070659_100780975 Ga0070659_1007809752 148
702 3300005367 Ga0070667_100089991 Ga0070667_1000899912 148
703 3300005367 Ga0070667_100137238 Ga0070667_1001372383 148
704 3300005435 Ga0070714_100177245 Ga0070714_1001772452 148
705 3300005435 Ga0070714_101399518 Ga0070714_1013995181 148
706 3300005455 Ga0070663_100012444 Ga0070663_1000124441 148
707 3300005456 Ga0070678_100107877 Ga0070678_1001078772 148
708 3300005457 Ga0070662_100000022 Ga0070662_10000002218 148
709 3300005457 Ga0070662_100249013 Ga0070662_1002490133 148
710 3300005457 Ga0070662_100467398 Ga0070662_1004673982 148
711 3300005458 Ga0070681_10120599 Ga0070681_101205993 148
712 3300005458 Ga0070681_11657104 Ga0070681_116571041 148
713 3300005530 Ga0070679_100319851 Ga0070679_1003198512 148
714 3300005539 Ga0068853_100002248 Ga0068853_1000022485 148
715 3300005539 Ga0068853_100625070 Ga0068853_1006250702 148
716 3300005543 Ga0070672_100328647 Ga0070672_1003286471 148
717 3300005547 Ga0070693_100001995 Ga0070693_1000019954 148
718 3300005547 Ga0070693_100283050 Ga0070693_1002830501 148
719 3300005548 Ga0070665_100000086 Ga0070665_10000008694 148
720 3300005548 Ga0070665_100078490 Ga0070665_1000784903 148
721 3300005563 Ga0068855_100002519 Ga0068855_10000251912 148
722 3300005563 Ga0068855_100091279 Ga0068855_1000912792 148
723 3300005563 Ga0068855_100128810 Ga0068855_1001288103 148
724 3300005564 Ga0070664_100000980 Ga0070664_10000098011 148
725 3300005564 Ga0070664_100035718 Ga0070664_1000357183 148
726 3300005564 Ga0070664_100056768 Ga0070664_1000567683 148
727 3300005564 Ga0070664_101220626 Ga0070664_1012206261 148
728 3300005577 Ga0068857_100035524 Ga0068857_1000355243 148
729 3300005577 Ga0068857_101013674 Ga0068857_1010136741 148
730 3300005577 Ga0068857_101518338 Ga0068857_1015183382 148
731 3300005577 Ga0068857_101680285 Ga0068857_1016802851 148
732 3300005578 Ga0068854_100001821 Ga0068854_1000018219 148
733 3300005578 Ga0068854_100020653 Ga0068854_1000206532 148
734 3300005578 Ga0068854_100053978 Ga0068854_1000539783 148
735 3300005614 Ga0068856_100000081 Ga0068856_10000008116 148
736 3300005614 Ga0068856_100034222 Ga0068856_1000342223 148
737 3300005614 Ga0068856_100984517 Ga0068856_1009845171 148
738 3300005616 Ga0068852_100001404 Ga0068852_10000140412 148
739 3300005616 Ga0068852_100479439 Ga0068852_1004794392 148
740 3300005618 Ga0068864_100008805 Ga0068864_1000088052 148
741 3300005841 Ga0068863_101286957 Ga0068863_1012869572 148
742 3300005842 Ga0068858_100039092 Ga0068858_1000390923 148
743 3300005844 Ga0068862_100011231 Ga0068862_1000112316 148
744 3300006237 Ga0097621_100166093 Ga0097621_1001660933 148
745 3300006881 Ga0068865_100019246 Ga0068865_1000192463 148
746 3300009093 Ga0105240_10024567 Ga0105240_100245676 148
747 3300009094 Ga0111539_10500271 Ga0111539_105002712 148
748 3300009174 Ga0105241_10026585 Ga0105241_100265852 148
749 3300009174 Ga0105241_10438670 Ga0105241_104386702 148
750 3300009176 Ga0105242_10462414 Ga0105242_104624142 148
751 3300009177 Ga0105248_10000010 Ga0105248_10000010271 148
752 3300009177 Ga0105248_10000755 Ga0105248_1000075512 148
753 3300009177 Ga0105248_10001129 Ga0105248_1000112920 148
754 3300009177 Ga0105248_10022674 Ga0105248_100226742 148
755 3300009177 Ga0105248_10106387 Ga0105248_101063872 148
756 3300009551 Ga0105238_10018069 Ga0105238_100180692 148
757 3300009551 Ga0105238_10064345 Ga0105238_100643454 148
758 3300013100 Ga0157373_10004985 Ga0157373_100049853 148
759 3300013100 Ga0157373_10012630 Ga0157373_100126305 148
760 3300013100 Ga0157373_10720679 Ga0157373_107206792 148
761 3300013102 Ga0157371_10010481 Ga0157371_100104813 148
762 3300013102 Ga0157371_10056852 Ga0157371_100568523 148
763 3300013102 Ga0157371_10273377 Ga0157371_102733772 148
764 3300013102 Ga0157371_10636566 Ga0157371_106365662 148
765 3300013104 Ga0157370_10905688 Ga0157370_109056882 148
766 3300013105 Ga0157369_10108752 Ga0157369_101087521 148
767 3300013105 Ga0157369_10162238 Ga0157369_101622383 148
768 3300013105 Ga0157369_10298876 Ga0157369_102988762 148
769 3300013297 Ga0157378_10018727 Ga0157378_100187277 148
770 3300013306 Ga0163162_10105361 Ga0163162_101053612 148
771 3300013306 Ga0163162_10779979 Ga0163162_107799792 148
772 3300013307 Ga0157372_10005774 Ga0157372_100057748 148
773 3300013307 Ga0157372_10154307 Ga0157372_101543072 148
774 3300013307 Ga0157372_10155066 Ga0157372_101550663 148
775 3300013307 Ga0157372_10380414 Ga0157372_103804142 148
776 3300013308 Ga0157375_11261756 Ga0157375_112617562 148
777 3300014325 Ga0163163_10001950 Ga0163163_1000195014 148
778 3300014968 Ga0157379_10055029 Ga0157379_100550293 148
779 3300017792 Ga0163161_10081020 Ga0163161_100810202 148
780 3300017792 Ga0163161_10098013 Ga0163161_100980133 148
781 3300025245 Ga0207425_1000026 Ga0207425_1000026287 148
782 3300025245 Ga0207425_1001730 Ga0207425_10017305 148
783 3300025261 Ga0209233_1037224 Ga0209233_10372242 148
784 3300025263 Ga0209565_1000010 Ga0209565_1000010505 148
785 3300025263 Ga0209565_1000240 Ga0209565_100024037 148
786 3300025273 Ga0209673_1004268 Ga0209673_10042683 148
787 3300025273 Ga0209673_1014971 Ga0209673_10149713 148
788 3300025291 Ga0209675_1024754 Ga0209675_10247542 148
789 3300025292 Ga0209676_1007370 Ga0209676_10073706 148
790 3300025294 Ga0209025_1001326 Ga0209025_100132628 148
791 3300025295 Ga0209564_1002247 Ga0209564_100224711 148
792 3300025297 Ga0209758_1000001 Ga0209758_10000011364 148
793 3300025297 Ga0209758_1000004 Ga0209758_10000041229 148
794 3300025297 Ga0209758_1007806 Ga0209758_10078066 148
795 3300025298 Ga0209050_1000001 Ga0209050_10000013232 148
796 3300025298 Ga0209050_1000026 Ga0209050_1000026256 148
797 3300025298 Ga0209050_1000550 Ga0209050_100055023 148
798 3300025298 Ga0209050_1002494 Ga0209050_10024943 148
799 3300025298 Ga0209050_1019011 Ga0209050_10190113 148
800 3300025299 Ga0209256_1000034 Ga0209256_1000034361 148
801 3300025302 Ga0207426_1032389 Ga0207426_10323891 148
802 3300025302 Ga0207426_1083388 Ga0207426_10833881 148
803 3300025303 Ga0209051_1000336 Ga0209051_100033650 148
804 3300025304 Ga0209257_1000009 Ga0209257_1000009256 148
805 3300025304 Ga0209257_1003507 Ga0209257_10035079 148
806 3300025304 Ga0209257_1006086 Ga0209257_10060866 148
807 3300025304 Ga0209257_1006091 Ga0209257_10060916 148
808 3300025321 Ga0207656_10370928 Ga0207656_103709282 148
809 3300025901 Ga0207688_10080361 Ga0207688_100803614 148
810 3300025903 Ga0207680_10000955 Ga0207680_1000095512 148
811 3300025903 Ga0207680_10452697 Ga0207680_104526972 148
812 3300025904 Ga0207647_10019695 Ga0207647_100196953 148
813 3300025904 Ga0207647_10048639 Ga0207647_100486393 148
814 3300025904 Ga0207647_10141624 Ga0207647_101416242 148
815 3300025907 Ga0207645_10725601 Ga0207645_107256011 148
816 3300025909 Ga0207705_10000269 Ga0207705_100002693 148
817 3300025909 Ga0207705_10161568 Ga0207705_101615682 148
818 3300025911 Ga0207654_10075127 Ga0207654_100751273 148
819 3300025912 Ga0207707_10044541 Ga0207707_100445413 148
820 3300025913 Ga0207695_10015380 Ga0207695_100153802 148
821 3300025917 Ga0207660_10093991 Ga0207660_100939912 148
822 3300025917 Ga0207660_10367490 Ga0207660_103674902 148
823 3300025917 Ga0207660_10464133 Ga0207660_104641331 148
824 3300025917 Ga0207660_10877314 Ga0207660_108773141 148
825 3300025919 Ga0207657_10000015 Ga0207657_1000001542 148
826 3300025919 Ga0207657_10001798 Ga0207657_1000179817 148
827 3300025920 Ga0207649_10000198 Ga0207649_1000019845 148
828 3300025920 Ga0207649_10006837 Ga0207649_100068375 148
829 3300025920 Ga0207649_10124298 Ga0207649_101242983 148
830 3300025921 Ga0207652_11030568 Ga0207652_110305681 148
831 3300025923 Ga0207681_10039693 Ga0207681_100396933 148
832 3300025924 Ga0207694_10036567 Ga0207694_100365673 148
833 3300025924 Ga0207694_10485080 Ga0207694_104850802 148
834 3300025926 Ga0207659_10166361 Ga0207659_101663613 148
835 3300025929 Ga0207664_10050641 Ga0207664_100506412 148
836 3300025931 Ga0207644_10003633 Ga0207644_1000363310 148
837 3300025931 Ga0207644_10003809 Ga0207644_100038093 148
838 3300025931 Ga0207644_10227911 Ga0207644_102279112 148
839 3300025932 Ga0207690_10000032 Ga0207690_10000032154 148
840 3300025933 Ga0207706_10000032 Ga0207706_100000326 148
841 3300025933 Ga0207706_10040475 Ga0207706_100404752 148
842 3300025933 Ga0207706_10139669 Ga0207706_101396692 148
843 3300025933 Ga0207706_10785396 Ga0207706_107853962 148
844 3300025937 Ga0207669_10023050 Ga0207669_100230502 148
845 3300025938 Ga0207704_10091068 Ga0207704_100910682 148
846 3300025940 Ga0207691_10170468 Ga0207691_101704681 148
847 3300025941 Ga0207711_10002208 Ga0207711_100022083 148
848 3300025941 Ga0207711_10006481 Ga0207711_100064818 148
849 3300025941 Ga0207711_10085727 Ga0207711_100857273 148
850 3300025941 Ga0207711_10181497 Ga0207711_101814973 148
851 3300025944 Ga0207661_10001054 Ga0207661_100010549 148
852 3300025944 Ga0207661_10103821 Ga0207661_101038211 148
853 3300025945 Ga0207679_10000208 Ga0207679_1000020816 148
854 3300025945 Ga0207679_10064568 Ga0207679_100645683 148
855 3300025949 Ga0207667_10003698 Ga0207667_1000369817 148
856 3300025949 Ga0207667_10051755 Ga0207667_100517554 148
857 3300025949 Ga0207667_10125308 Ga0207667_101253083 148
858 3300025972 Ga0207668_10007528 Ga0207668_100075282 148
859 3300025981 Ga0207640_10000546 Ga0207640_1000054610 148
860 3300025981 Ga0207640_10057516 Ga0207640_100575162 148
861 3300025986 Ga0207658_10010214 Ga0207658_100102145 148
862 3300025986 Ga0207658_10065822 Ga0207658_100658223 148
863 3300025986 Ga0207658_10135772 Ga0207658_101357722 148
864 3300025986 Ga0207658_10199019 Ga0207658_101990191 148
865 3300026041 Ga0207639_10000285 Ga0207639_1000028527 148
866 3300026041 Ga0207639_10039136 Ga0207639_100391362 148
867 3300026041 Ga0207639_10149868 Ga0207639_101498682 148
868 3300026067 Ga0207678_10000671 Ga0207678_1000067119 148
869 3300026067 Ga0207678_10006560 Ga0207678_100065603 148
870 3300026078 Ga0207702_10003032 Ga0207702_1000303211 148
871 3300026078 Ga0207702_10039238 Ga0207702_100392382 148
872 3300026095 Ga0207676_10009788 Ga0207676_100097883 148
873 3300026116 Ga0207674_10012215 Ga0207674_100122159 148
874 3300026118 Ga0207675_100877898 Ga0207675_1008778982 148
875 3300026121 Ga0207683_10070127 Ga0207683_100701272 148
876 3300026121 Ga0207683_10131200 Ga0207683_101312002 148
877 3300026142 Ga0207698_10358774 Ga0207698_103587743 148
878 3300028379 Ga0268266_10000002 Ga0268266_100000022466 148
879 3300028381 Ga0268264_10250604 Ga0268264_102506043 148
880 3300031456 Ga0307513_10137902 Ga0307513_101379023 148
881 3300031852 Ga0307410_10026230 Ga0307410_100262302 148
882 3300032004 Ga0307414_10000892 Ga0307414_100008923 148
883 3300032126 Ga0307415_100006242 Ga0307415_1000062427 148
884 3300035112 Ga0373932_0026934 Ga0373932_0026934_604_1077 148
885 3300035691 Ga0373931_0020778 Ga0373931_0020778_2580_3053 148
886 3300037312 Ga0395899_0046683 Ga0395899_0046683_224_700 148
887 3300037312 Ga0395899_0055241 Ga0395899_0055241_1251_1727 148
888 3300037312 Ga0395899_0187050 Ga0395899_0187050_132_608 148
889 3300037418 Ga0395900_0023778 Ga0395900_0023778_5303_5779 148
890 3300037418 Ga0395900_0036730 Ga0395900_0036730_1103_1579 148
891 3300037418 Ga0395900_0060452 Ga0395900_0060452_1211_1687 148
892 3300037418 Ga0395900_0220894 Ga0395900_0220894_120_596 148
893 3300037418 Ga0395900_0583828 Ga0395900_0583828_28_504 148
894 3300037418 Ga0395900_0592850 Ga0395900_0592850_510_986 148
895 3300037466 Ga0395898_0021937 Ga0395898_0021937_4117_4593 148
896 3300037466 Ga0395898_1166300 Ga0395898_1166300_210_686 148
897 3300037471 Ga0395905_0000207 Ga0395905_0000207_80903_81379 148
898 3300037471 Ga0395905_0004160 Ga0395905_0004160_2855_3331 148
899 3300037471 Ga0395905_0012298 Ga0395905_0012298_6334_6810 148
900 3300037471 Ga0395905_0028268 Ga0395905_0028268_2813_3289 148
901 3300037471 Ga0395905_0102032 Ga0395905_0102032_99_575 148
902 3300037471 Ga0395905_0443656 Ga0395905_0443656_376_852 148
903 3300038443 Ga0395901_0012736 Ga0395901_0012736_513_989 148
904 3300038443 Ga0395901_0019808 Ga0395901_0019808_2499_2975 148
905 3300038443 Ga0395901_0075609 Ga0395901_0075609_2786_3262 148
906 3300038443 Ga0395901_0266359 Ga0395901_0266359_775_1254 148
907 3300041404 Ga0439436_0063795 Ga0439436_0063795_435_914 148
908 3300041410 Ga0439461_0001537 Ga0439461_0001537_2086_2565 148
909 3300041410 Ga0439461_0002606 Ga0439461_0002606_270_749 148
910 3300041411 Ga0439466_0061720 Ga0439466_0061720_182_661 148
911 3300041413 Ga0439465_0001418 Ga0439465_0001418_2287_2766 148
912 3300041413 Ga0439465_0033378 Ga0439465_0033378_893_1372 148
913 3300041413 Ga0439465_0302779 Ga0439465_0302779_41_520 148
914 3300041463 Ga0451804_0271056 Ga0451804_0271056_132_614 148
915 3300041997 Ga0439431_0002834 Ga0439431_0002834_1191_1670 148
916 3300042002 Ga0439442_001465 Ga0439442_001465_2305_2784 148
917 3300042004 Ga0439445_0000496 Ga0439445_0000496_3015_3494 148
918 3300042004 Ga0439445_0058886 Ga0439445_0058886_381_860 148
919 3300042004 Ga0439445_0071454 Ga0439445_0071454_220_699 148
920 3300042006 Ga0439432_000368 Ga0439432_000368_7693_8172 148
921 3300042010 Ga0439452_013295 Ga0439452_013295_423_902 148
922 3300042125 Ga0450923_021516 Ga0450923_021516_737_1216 148
923 3300042185 Ga0450909_003154 Ga0450909_003154_1321_1800 148
924 3300042435 Ga0439434_0000604 Ga0439434_0000604_9419_9898 148
925 3300042435 Ga0439434_0125376 Ga0439434_0125376_81_560 148
926 3300044684 Ga0466966_0078576 Ga0466966_0078576_1302_1778 148
927 3300044694 Ga0466963_0031761 Ga0466963_0031761_756_1229 148
928 3300044765 Ga0466970_0052812 Ga0466970_0052812_683_1159 148
929 3300044842 Ga0466957_0717825 Ga0466957_0717825_15_488 148
930 3300045976 Ga0466967_0238550 Ga0466967_0238550_192_665 148
931 3300045976 Ga0466967_0400434 Ga0466967_0400434_22_495 148
932 3300046453 Ga0495627_035158 Ga0495627_035158_924_1403 148
933 3300046491 Ga0495584_0022305 Ga0495584_0022305_841_1320 148
934 3300046492 Ga0495585_0004390 Ga0495585_0004390_8436_8915 148
935 3300046500 Ga0495596_0028035 Ga0495596_0028035_830_1306 148
936 3300046501 Ga0495607_0070947 Ga0495607_0070947_389_862 148
937 3300046507 Ga0495606_0000978 Ga0495606_0000978_10456_10935 148
938 3300046522 Ga0495643_0011156 Ga0495643_0011156_4739_5218 148
939 3300046524 Ga0495648_0004389 Ga0495648_0004389_6151_6633 148
940 3300046525 Ga0495663_0002244 Ga0495663_0002244_2038_2520 148
941 3300046525 Ga0495663_0003680 Ga0495663_0003680_1204_1680 148
942 3300046525 Ga0495663_0005232 Ga0495663_0005232_1036_1512 148
943 3300046528 Ga0495642_0069976 Ga0495642_0069976_853_1326 148
944 3300046537 Ga0495598_0001994 Ga0495598_0001994_2175_2651 148
945 3300046539 Ga0495621_0000771 Ga0495621_0000771_3198_3674 148
946 3300046539 Ga0495621_0010461 Ga0495621_0010461_2076_2552 148
947 3300046539 Ga0495621_0271177 Ga0495621_0271177_93_569 148
948 3300046558 Ga0495633_0201419 Ga0495633_0201419_253_729 148
949 3300046648 Ga0495611_0115203 Ga0495611_0115203_173_655 148
950 3300046660 Ga0495625_0001173 Ga0495625_0001173_12224_12703 148
951 3300046660 Ga0495625_0049555 Ga0495625_0049555_2292_2774 148
952 3300046665 Ga0495661_0107476 Ga0495661_0107476_362_841 148
953 3300046684 Ga0495669_0008925 Ga0495669_0008925_2605_3081 148
954 3300046684 Ga0495669_0147950 Ga0495669_0147950_12_485 148
955 3300046691 Ga0495670_0030775 Ga0495670_0030775_665_1141 148
956 3300046694 Ga0495649_0025950 Ga0495649_0025950_1245_1727 148
957 3300047323 Ga0495683_0009989 Ga0495683_0009989_3525_4007 148
958 3300047445 Ga0495677_0009818 Ga0495677_0009818_439_915 148
959 3300047445 Ga0495677_0016355 Ga0495677_0016355_92_568 148
960 3300047445 Ga0495677_0028894 Ga0495677_0028894_189_668 148
961 3300047470 Ga0495681_0004188 Ga0495681_0004188_2945_3427 148
962 3300047470 Ga0495681_0049298 Ga0495681_0049298_29_508 148
963 3300047472 Ga0495686_0000185 Ga0495686_0000185_23158_23637 148
964 3300048904 Ga0496101_0015416 Ga0496101_0015416_3148_3621 148
965 3300048904 Ga0496101_0134812 Ga0496101_0134812_247_723 148
966 3300048904 Ga0496101_0214809 Ga0496101_0214809_603_1085 148
967 3300048905 Ga0496102_0000452 Ga0496102_0000452_37434_37916 148
968 3300048906 Ga0496103_0000518 Ga0496103_0000518_10358_10840 148
969 3300048907 Ga0496104_0225573 Ga0496104_0225573_195_677 148
970 3300048907 Ga0496104_0297622 Ga0496104_0297622_877_1350 148
971 3300048909 Ga0496106_0026728 Ga0496106_0026728_29_502 148
972 3300048909 Ga0496106_0845689 Ga0496106_0845689_217_693 148
973 3300048910 Ga0496107_0000451 Ga0496107_0000451_12218_12691 148
974 3300048910 Ga0496107_0131052 Ga0496107_0131052_680_1162 148
975 3300048910 Ga0496107_0614822 Ga0496107_0614822_123_599 148
976 3300048911 Ga0496108_0000190 Ga0496108_0000190_25082_25558 148
977 3300048911 Ga0496108_0116240 Ga0496108_0116240_1097_1570 148
978 3300048912 Ga0496109_0035647 Ga0496109_0035647_3183_3656 148
979 3300048913 Ga0496110_0003207 Ga0496110_0003207_4172_4645 148
980 3300048913 Ga0496110_0849185 Ga0496110_0849185_151_633 148
981 3300048914 Ga0496111_0011292 Ga0496111_0011292_3332_3805 148
982 3300048914 Ga0496111_0036500 Ga0496111_0036500_2032_2514 148
983 3300048914 Ga0496111_0294145 Ga0496111_0294145_419_892 148
984 3300048915 Ga0496112_0000197 Ga0496112_0000197_28540_29013 148
985 3300048915 Ga0496112_0024818 Ga0496112_0024818_2891_3367 148
986 3300048916 Ga0496113_0020387 Ga0496113_0020387_3284_3757 148
987 3300048916 Ga0496113_0119032 Ga0496113_0119032_635_1117 148
988 3300048916 Ga0496113_0210944 Ga0496113_0210944_627_1103 148
989 3300048916 Ga0496113_0221488 Ga0496113_0221488_944_1417 148
990 3300048917 Ga0496114_0005301 Ga0496114_0005301_4997_5479 148
991 3300048918 Ga0496115_0000230 Ga0496115_0000230_13729_14211 148
992 3300048918 Ga0496115_0000965 Ga0496115_0000965_17506_17985 148
993 3300048919 Ga0496116_0003936 Ga0496116_0003936_1458_1940 148
994 3300048920 Ga0496117_0000885 Ga0496117_0000885_8829_9311 148
995 3300048920 Ga0496117_0034830 Ga0496117_0034830_1140_1619 148
996 3300048921 Ga0496118_0000144 Ga0496118_0000144_113245_113727 148
997 3300048921 Ga0496118_0008365 Ga0496118_0008365_173_652 148
998 3300048922 Ga0496119_0018184 Ga0496119_0018184_3164_3646 148
999 3300048924 Ga0496121_0000295 Ga0496121_0000295_81744_82226 148
1000 3300048924 Ga0496121_0000681 Ga0496121_0000681_51664_52143 148
1001 3300048925 Ga0496122_0019690 Ga0496122_0019690_3675_4157 148
1002 3300048926 Ga0496123_0018507 Ga0496123_0018507_4902_5384 148
1003 3300048927 Ga0496124_0000683 Ga0496124_0000683_10497_10979 148
1004 3300048928 Ga0496125_0001206 Ga0496125_0001206_33705_34187 148
1005 3300048928 Ga0496125_0327705 Ga0496125_0327705_75_554 148
1006 3300048929 Ga0496126_0001756 Ga0496126_0001756_20951_21433 148
1007 3300049587 Ga0501071_0250143 Ga0501071_0250143_281_769 148
1008 3300049822 Ga0501035_1068703 Ga0501035_1068703_23_499 148
1009 3300053094 Ga0500566_0017097 Ga0500566_0017097_1790_2269 148
1010 3300053130 Ga0500642_0000363 Ga0500642_0000363_5781_6263 148
1011 3300053134 Ga0500658_0001776 Ga0500658_0001776_6626_7105 148
1012 3300053139 Ga0500568_0014968 Ga0500568_0014968_2035_2514 148
1013 3300053735 Ga0500596_000419 Ga0500596_000419_689_1168 148
1014 iso_pu_bacteria 2946787523 2946791106 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07977

FabA

FabA-like domain

31

156

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5m6k-assembly1.cif.gz_A crystal structure of nitrophorin 7 e27v mutant from rhodnius prolixus with imidazole 0.9217 106 141
2egi-assembly1.cif.gz_H crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.8618 86 141
4w78-assembly1.cif.gz_F crystal structure of the chsh1-chsh2 complex from mycobacterium tuberculosis 0.8488 86 142
2gf6-assembly1.cif.gz_A crystal structure of a putative thioesterase (sso2295) from sulfolobus solfataricus at 1.91 a resolution 0.8164 83 145
3p3f-assembly3.cif.gz_E crystal structure of the f36a mutant of the fluoroacetyl-coa-specific thioesterase flk 0.8108 69 142
ID Description Score Start End Superfamily
af_A0A0R0JUA4_1_78_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9299 87 138 3.10.129.10
2egiH00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8618 86 141 3.10.129.10
4w78F00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8488 86 142 3.10.129.10
2hljA01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8393 86 141 3.10.129.10
af_Q9VMA4_98_246_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8291 83 144 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A3A4Q1I6-F1-model_v4 Beta-hydroxyacyl-ACP dehydratase 0.8287 29 144 GO:0016829
AF-A0A0F2PVJ9-F1-model_v4 3-hydroxyacyl-ACP dehydratase 0.82 30 147 GO:0016829
AF-A0A0R2CHE5-F1-model_v4 Uncharacterized protein 0.8194 22 147 GO:0016829
AF-A0A3S0FGY1-F1-model_v4 Beta-hydroxyacyl-ACP dehydratase 0.8173 27 147 GO:0016829
AF-A0A1T4PW50-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase 0.8165 29 145

Feature Viewer

pLDDT pTM Quality
79.35 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map