F488201

General Info

Members Datasets Scaffolds Average Seq Length
1013 564 859 201

Family's Representative Sequence

Representative Sequence 3300046679|Ga0495623_0201805|Ga0495623_0201805_123_830
Length 235
Sequence MKLLHLDSSVLGPHSVSRQVSAAIVDRLRKATPGLEITYRDLTLTPLAHLSGSHLAAGQGAPAEASLREDIAAGQAVLDEFLAADIVVLGAPMYNFTIPSQLKAWIDRILVAGKTFKYSAQGVEGLAGNKRVIVAISRGGFYGAGTPAAVGEHLETYLRWVFGFIGVTNPEFISARRRQSRRRITGSRHRPSLLSEAAGGCHAGKTPPALIPGALYTHDDGNKRDQKAETGKYGD

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
16 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
17 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
18 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
19 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
20 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
21 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
22 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
23 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
24 2791355199
25 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
26 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
27 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
28 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
29 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
30 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
31 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
32 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
33 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
34 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
35 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
36 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
37 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
38 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
39 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
40 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
41 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
42 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
43 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
44 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
45 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
46 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
47 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
48 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
49 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
50 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
51 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
52 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
53 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
54 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
55 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
56 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
57 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
58 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
59 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
60 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
61 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
62 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
63 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
64 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
65 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
66 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
67 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
68 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
69 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
70 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
71 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
72 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
73 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
74 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
75 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
76 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
77 2922368715
78 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
79 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
80 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
81 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
82 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
83 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
84 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
85 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
86 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
87 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
88 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
89 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
90 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
91 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
92 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
93 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
94 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
95 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
96 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
97 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
98 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
99 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
100 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
101 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
102 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
103 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
104 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
105 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
106 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
107 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
108 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
109 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
110 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
111 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
112 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
113 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
114 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
115 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
116 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
117 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
118 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
119 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
120 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
121 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
122 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
123 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
124 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
125 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
126 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
127 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
128 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
129 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
130 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
131 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
132 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
133 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
134 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
135 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
136 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
137 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
138 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
139 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
140 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
141 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
142 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
143 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
144 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
145 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
146 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
147 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
148 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
149 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
150 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
151 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
152 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
153 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
154 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
155 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
156 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
157 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
158 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
159 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
160 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
161 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
162 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
163 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
164 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
165 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
166 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
167 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
168 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
169 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
170 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
171 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
172 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
173 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
174 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
175 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
176 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
177 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
178 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
179 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
180 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
181 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
182 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
183 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
184 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
185 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
186 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
187 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
188 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
189 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
190 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
191 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
192 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
193 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
194 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
195 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
196 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
197 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
198 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
199 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
200 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
201 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
202 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
203 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
204 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
205 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
206 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
207 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
208 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
209 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
210 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
211 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
212 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
213 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
214 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
215 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
216 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
217 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
218 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
219 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
220 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
221 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
222 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
223 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
224 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
225 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
226 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
227 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
228 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
229 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
230 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
231 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
232 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
233 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
234 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
235 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
236 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
237 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
238 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
239 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
240 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
241 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
242 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
243 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
244 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
245 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
248 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
250 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
251 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
252 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
253 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
254 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
255 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
312 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
313 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
314 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
315 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
316 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
320 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
321 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
322 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
323 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
324 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
325 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
326 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
327 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
328 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
329 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
330 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
331 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
332 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
333 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
334 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
335 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
336 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
337 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
338 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
339 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
340 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
341 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
342 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
343 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
344 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
345 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
346 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
347 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
348 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
349 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
350 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
351 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
352 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
353 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
354 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
355 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
356 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
357 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
358 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
359 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
360 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
361 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
362 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
363 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
364 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
365 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
366 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
367 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
368 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
369 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
370 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
371 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
372 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
373 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
374 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
375 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
376 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
377 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
378 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
379 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
380 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
381 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
382 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
383 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
384 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
385 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
386 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
387 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
388 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
389 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
390 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
391 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
392 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
393 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
394 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
395 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
396 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
397 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
398 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
399 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
400 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
401 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
402 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
403 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
404 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
405 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
406 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
407 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
408 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
409 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
410 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
411 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
412 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
413 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
414 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
415 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
416 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
417 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
418 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
419 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
420 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
421 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
422 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
423 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
424 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
425 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
426 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
427 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
428 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
429 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
430 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
431 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
432 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
433 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
434 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
435 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
436 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
437 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
438 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
439 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
440 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
441 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
442 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
443 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
444 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
445 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
446 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
447 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
448 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
449 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
450 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
451 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
452 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
453 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
454 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
455 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
456 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
457 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
458 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
459 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
460 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
461 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
462 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
463 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
464 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
465 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
466 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
467 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
468 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
469 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
470 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
471 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
472 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
473 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
474 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
475 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
476 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
477 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
478 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
479 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
480 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
481 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
482 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
483 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
484 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
485 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
486 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
487 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
488 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
489 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
490 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
491 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
492 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
493 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
494 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
495 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
496 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
497 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
498 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
499 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
500 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
501 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
502 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
503 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
504 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
505 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
506 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
507 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
508 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
509 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
510 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
511 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
512 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
513 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
514 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
515 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
516 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
517 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
518 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
519 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
520 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
521 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
522 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
523 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
524 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
525 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
526 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
527 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
528 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
529 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
530 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
531 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
532 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
533 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
534 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
535 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
536 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
537 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
538 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
539 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
540 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
541 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
542 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
543 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
544 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
545 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
546 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
547 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
548 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
549 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
550 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
551 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
552 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
553 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
554 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
555 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
556 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
557 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
558 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
559 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
560 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
561 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
562 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
563 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
564 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.87
Metatranscriptomes 0.1
Isolates 15.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.74
Nodule 12.34
Rhizoplane 5.33
Rhizosphere 53.41
Stem 0
Stem Tuber 0
Unclassified 9.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10011169 3300003203 Bacteria 3948
2 JGI25153J46596_10000691 3300003215 Bacteria 20594
3 JGI25153J46596_10020279 3300003215 Bacteria 2517
4 JGI25160J50197_1001658 3300003354 Bacteria 10886
5 JGI25160J50197_1002198 3300003354 Bacteria 9169
6 JGI25160J50197_1010357 3300003354 Bacteria 3377
7 JGI25404J52841_10002001 3300003659 Bacteria 3759
8 JGI25404J52841_10014633 3300003659 Bacteria 1703
9 JGI25404J52841_10031403 3300003659 Bacteria 1135
10 Ga0055542_1011817 3300003762 Bacteria 1533
11 Ga0055529_1007273 3300003763 Bacteria 1513
12 Ga0055531_10005197 3300003794 Bacteria 7659
13 Ga0055543_1002937 3300004625 Bacteria 5317
14 Ga0065165_1000871 3300005262 Bacteria 39257
15 Ga0065165_1003314 3300005262 Bacteria 11522
16 Ga0065165_1004734 3300005262 Bacteria 8166
17 Ga0070658_10065242 3300005327 Bacteria 2971
18 Ga0070658_10080843 3300005327 Bacteria 2669
19 Ga0070676_10550678 3300005328 Bacteria 826
20 Ga0070683_100074272 3300005329 Bacteria 3175
21 Ga0070683_101016651 3300005329 Bacteria 796
22 Ga0070670_100189040 3300005331 Bacteria 1788
23 Ga0068869_100101596 3300005334 Bacteria 2175
24 Ga0068869_100266656 3300005334 Bacteria 1373
25 Ga0068869_100510706 3300005334 Bacteria 1005
26 Ga0070666_10143913 3300005335 Bacteria 1661
27 Ga0070680_100021259 3300005336 Bacteria 5155
28 Ga0070680_100194989 3300005336 Bacteria 1707
29 Ga0070682_100207748 3300005337 Bacteria 1386
30 Ga0068868_100054226 3300005338 Bacteria 3159
31 Ga0068868_100100372 3300005338 Bacteria 2342
32 Ga0068868_100940573 3300005338 Bacteria 787
33 Ga0070660_100541367 3300005339 Bacteria 971
34 Ga0070689_100255623 3300005340 Bacteria 1447
35 Ga0070689_100341143 3300005340 Bacteria 1255
36 Ga0070661_100301297 3300005344 Bacteria 1248
37 Ga0070692_10582204 3300005345 Bacteria 738
38 Ga0070668_100028639 3300005347 Bacteria 4227
39 Ga0070668_101064669 3300005347 Bacteria 729
40 Ga0070669_100135775 3300005353 Bacteria 1892
41 Ga0070669_100348404 3300005353 Bacteria 1202
42 Ga0070669_100474224 3300005353 Bacteria 1034
43 Ga0070674_100131524 3300005356 Bacteria 1866
44 Ga0070674_100236283 3300005356 Bacteria 1429
45 Ga0070674_100607843 3300005356 Bacteria 925
46 Ga0070673_100320170 3300005364 Bacteria 1370
47 Ga0070673_100890453 3300005364 Bacteria 825
48 Ga0070659_100210868 3300005366 Bacteria 1601
49 Ga0070659_100269750 3300005366 Bacteria 1414
50 Ga0070659_100730734 3300005366 Bacteria 858
51 Ga0070667_100203164 3300005367 Bacteria 1759
52 Ga0070667_100322355 3300005367 Bacteria 1394
53 Ga0070667_100496308 3300005367 Bacteria 1119
54 Ga0070709_10125065 3300005434 Bacteria 1748
55 Ga0070713_100021265 3300005436 Bacteria 4987
56 Ga0070710_10008327 3300005437 Bacteria 5046
57 Ga0070711_100008935 3300005439 Bacteria 6151
58 Ga0070711_100203872 3300005439 Bacteria 1528
59 Ga0070708_100493821 3300005445 Bacteria 1155
60 Ga0070663_100034664 3300005455 Bacteria 3497
61 Ga0070663_100045007 3300005455 Bacteria 3116
62 Ga0070663_100070219 3300005455 Bacteria 2547
63 Ga0070663_100084859 3300005455 Bacteria 2335
64 Ga0070663_100119176 3300005455 Bacteria 1991
65 Ga0070663_100148880 3300005455 Bacteria 1793
66 Ga0070663_100154936 3300005455 Bacteria 1760
67 Ga0070663_100221808 3300005455 Bacteria 1485
68 Ga0070663_100688911 3300005455 Bacteria 868
69 Ga0070678_100055122 3300005456 Bacteria 2901
70 Ga0070678_100156851 3300005456 Bacteria 1839
71 Ga0070678_100289234 3300005456 Bacteria 1388
72 Ga0070662_100054866 3300005457 Bacteria 2889
73 Ga0070662_100125614 3300005457 Bacteria 1971
74 Ga0070662_100444034 3300005457 Bacteria 1076
75 Ga0070681_10141978 3300005458 Bacteria 2331
76 Ga0068867_100042809 3300005459 Bacteria 3314
77 Ga0070698_100128545 3300005471 Bacteria 2490
78 Ga0070698_100853208 3300005471 Bacteria 856
79 Ga0070679_100025377 3300005530 Bacteria 5815
80 Ga0070679_100155125 3300005530 Bacteria 2265
81 Ga0070679_100164929 3300005530 Bacteria 2189
82 Ga0070684_100043252 3300005535 Bacteria 3889
83 Ga0070684_100044414 3300005535 Bacteria 3843
84 Ga0068853_100212051 3300005539 Bacteria 1765
85 Ga0068853_100235696 3300005539 Bacteria 1675
86 Ga0068853_101133520 3300005539 Bacteria 755
87 Ga0070672_100289025 3300005543 Bacteria 1388
88 Ga0070686_100516978 3300005544 Bacteria 929
89 Ga0070696_100049519 3300005546 Bacteria 2919
90 Ga0070665_100015770 3300005548 Bacteria 7591
91 Ga0070665_100031231 3300005548 Bacteria 5361
92 Ga0070665_100058777 3300005548 Bacteria 3854
93 Ga0070665_100154528 3300005548 Bacteria 2296
94 Ga0070665_100216220 3300005548 Bacteria 1917
95 Ga0070665_100639881 3300005548 Bacteria 1076
96 Ga0068855_100031798 3300005563 Bacteria 6300
97 Ga0068855_100084909 3300005563 Bacteria 3664
98 Ga0068855_100248640 3300005563 Bacteria 1984
99 Ga0068855_100460457 3300005563 Bacteria 1387
100 Ga0068854_100345821 3300005578 Bacteria 1216
101 Ga0068854_100480975 3300005578 Bacteria 1043
102 Ga0068856_100118716 3300005614 Bacteria 2646
103 Ga0070702_100161837 3300005615 Bacteria 1447
104 Ga0068852_100340861 3300005616 Bacteria 1461
105 Ga0068852_100425356 3300005616 Bacteria 1311
106 Ga0068859_100090404 3300005617 Bacteria 3112
107 Ga0068859_100248610 3300005617 Bacteria 1868
108 Ga0068864_100171668 3300005618 Bacteria 1977
109 Ga0068864_100291493 3300005618 Bacteria 1526
110 Ga0068861_100066340 3300005719 Bacteria 2782
111 Ga0068861_100087457 3300005719 Bacteria 2452
112 Ga0068861_101574326 3300005719 Bacteria 647
113 Ga0068858_100192416 3300005842 Bacteria 1927
114 Ga0068858_100331943 3300005842 Bacteria 1454
115 Ga0068858_100652876 3300005842 Bacteria 1022
116 Ga0068860_100000268 3300005843 Bacteria 76328
117 Ga0068860_100129164 3300005843 Bacteria 2423
118 Ga0068860_100209751 3300005843 Bacteria 1889
119 Ga0068860_100677745 3300005843 Bacteria 1040
120 Ga0068862_100120992 3300005844 Bacteria 2307
121 Ga0068862_100157004 3300005844 Bacteria 2028
122 Ga0068862_100248753 3300005844 Bacteria 1619
123 Ga0068862_101063622 3300005844 Bacteria 803
124 Ga0081455_10015453 3300005937 Bacteria 7417
125 Ga0081455_10016132 3300005937 Bacteria 7222
126 Ga0081455_10046470 3300005937 Bacteria 3766
127 Ga0081538_10040658 3300005981 Bacteria 2962
128 Ga0081538_10086463 3300005981 Bacteria 1641
129 Ga0081540_1000916 3300005983 Bacteria 26580
130 Ga0081540_1001739 3300005983 Bacteria 18329
131 Ga0081540_1002076 3300005983 Bacteria 16707
132 Ga0081540_1005549 3300005983 Bacteria 9399
133 Ga0081540_1008801 3300005983 Bacteria 7014
134 Ga0081540_1010073 3300005983 Bacteria 6434
135 Ga0081540_1013619 3300005983 Bacteria 5274
136 Ga0081540_1031349 3300005983 Bacteria 2925
137 Ga0081540_1037846 3300005983 Bacteria 2552
138 Ga0081540_1042536 3300005983 Bacteria 2342
139 Ga0081540_1092709 3300005983 Bacteria 1325
140 Ga0081539_10000231 3300005985 Bacteria 131197
141 Ga0081539_10064938 3300005985 Bacteria 1984
142 Ga0070717_10839531 3300006028 Bacteria 836
143 Ga0075365_10012972 3300006038 Bacteria 4969
144 Ga0075365_10021295 3300006038 Bacteria 4042
145 Ga0075365_10024860 3300006038 Bacteria 3785
146 Ga0075365_10038356 3300006038 Bacteria 3113
147 Ga0075365_10122701 3300006038 Bacteria 1793
148 Ga0075365_10150914 3300006038 Bacteria 1616
149 Ga0075365_10195036 3300006038 Bacteria 1418
150 Ga0075368_10048377 3300006042 Bacteria 1685
151 Ga0075368_10177735 3300006042 Bacteria 896
152 Ga0075363_100002157 3300006048 Bacteria 7916
153 Ga0075364_10128577 3300006051 Bacteria 1699
154 Ga0075432_10157205 3300006058 Bacteria 877
155 Ga0070712_100001161 3300006175 Bacteria 15933
156 Ga0070712_100101015 3300006175 Bacteria 2133
157 Ga0075367_10051638 3300006178 Bacteria 2431
158 Ga0075367_10107241 3300006178 Bacteria 1712
159 Ga0075367_10126318 3300006178 Bacteria 1578
160 Ga0075367_10167700 3300006178 Bacteria 1367
161 Ga0075367_10219603 3300006178 Bacteria 1189
162 Ga0075367_10242799 3300006178 Bacteria 1129
163 Ga0075369_10021279 3300006186 Bacteria 2663
164 Ga0075366_10011107 3300006195 Bacteria 5074
165 Ga0075366_10012033 3300006195 Bacteria 4901
166 Ga0075366_10120711 3300006195 Bacteria 1579
167 Ga0075366_10298344 3300006195 Bacteria 986
168 Ga0097621_100271359 3300006237 Bacteria 1491
169 Ga0075370_10020470 3300006353 Bacteria 3617
170 Ga0075370_10022532 3300006353 Bacteria 3459
171 Ga0075370_10040894 3300006353 Bacteria 2616
172 Ga0075370_10070591 3300006353 Bacteria 1997
173 Ga0068871_100178148 3300006358 Bacteria 1826
174 Ga0068871_100527984 3300006358 Bacteria 1067
175 Ga0075430_100237715 3300006846 Bacteria 1510
176 Ga0075433_10334199 3300006852 Bacteria 1339
177 Ga0068865_100035885 3300006881 Bacteria 3338
178 Ga0068865_100157128 3300006881 Bacteria 1731
179 Ga0097620_100090405 3300006931 Bacteria 3112
180 Ga0097620_100248610 3300006931 Bacteria 1868
181 Ga0099825_1041212 3300006941 Bacteria 1335
182 Ga0099824_1007084 3300006942 Bacteria 15049
183 Ga0099822_1001392 3300006943 Bacteria 27954
184 Ga0099794_10013241 3300007265 Bacteria 3585
185 Ga0099794_10067899 3300007265 Bacteria 1742
186 Ga0099794_10248759 3300007265 Bacteria 916
187 Ga0099795_10041394 3300007788 Bacteria 1640
188 Ga0099795_10104338 3300007788 Bacteria 1116
189 Ga0099795_10287178 3300007788 Bacteria 720
190 Ga0105240_10066371 3300009093 Bacteria 4477
191 Ga0111539_10183852 3300009094 Bacteria 2441
192 Ga0111539_10640908 3300009094 Bacteria 1237
193 Ga0105245_10014670 3300009098 Bacteria 6823
194 Ga0105245_10963258 3300009098 Bacteria 897
195 Ga0105247_10019050 3300009101 Bacteria 4122
196 Ga0105247_10105203 3300009101 Bacteria 1809
197 Ga0105247_10149644 3300009101 Bacteria 1537
198 Ga0114129_10739095 3300009147 Bacteria 1261
199 Ga0105243_10030714 3300009148 Bacteria 4139
200 Ga0105243_10113943 3300009148 Bacteria 2268
201 Ga0105241_10062569 3300009174 Bacteria 2869
202 Ga0105242_10127131 3300009176 Bacteria 2195
203 Ga0105242_10203945 3300009176 Bacteria 1758
204 Ga0105248_10064647 3300009177 Bacteria 4107
205 Ga0105248_10097284 3300009177 Bacteria 3316
206 Ga0105248_10123377 3300009177 Bacteria 2922
207 Ga0105248_10715832 3300009177 Bacteria 1130
208 Ga0105237_10108665 3300009545 Bacteria 2765
209 Ga0105237_10148136 3300009545 Bacteria 2343
210 Ga0105237_10163537 3300009545 Bacteria 2224
211 Ga0105237_10469951 3300009545 Bacteria 1264
212 Ga0105237_10679482 3300009545 Bacteria 1036
213 Ga0105238_10073340 3300009551 Bacteria 3418
214 Ga0105238_10140887 3300009551 Bacteria 2388
215 Ga0105238_10643534 3300009551 Bacteria 1070
216 Ga0105238_11214917 3300009551 Bacteria 778
217 Ga0105249_10135471 3300009553 Bacteria 2356
218 Ga0099796_10010834 3300010159 Bacteria 2521
219 Ga0099796_10035897 3300010159 Bacteria 1647
220 Ga0099796_10060007 3300010159 Bacteria 1345
221 Ga0099796_10099381 3300010159 Bacteria 1093
222 Ga0099796_10198276 3300010159 Bacteria 813
223 Ga0105239_10095851 3300010375 Bacteria 3277
224 Ga0105239_10195349 3300010375 Bacteria 2266
225 Ga0105239_10221900 3300010375 Bacteria 2120
226 Ga0105239_10227269 3300010375 Bacteria 2094
227 Ga0105239_10364518 3300010375 Bacteria 1632
228 Ga0105239_10846048 3300010375 Bacteria 1049
229 Ga0105246_10021251 3300011119 Bacteria 4174
230 Ga0105246_10033786 3300011119 Bacteria 3402
231 Ga0105246_10253100 3300011119 Bacteria 1399
232 Ga0157370_10019096 3300013104 Bacteria 6890
233 Ga0157370_10424671 3300013104 Bacteria 1223
234 Ga0157370_10778278 3300013104 Bacteria 871
235 Ga0157369_10006177 3300013105 Bacteria 13901
236 Ga0157374_10048968 3300013296 Bacteria 3923
237 Ga0157374_10063854 3300013296 Bacteria 3454
238 Ga0157378_10010133 3300013297 Bacteria 8218
239 Ga0157378_10132303 3300013297 Bacteria 2310
240 Ga0157378_10836249 3300013297 Bacteria 948
241 Ga0163162_10039097 3300013306 Bacteria 4738
242 Ga0163162_10287707 3300013306 Bacteria 1775
243 Ga0163162_10416811 3300013306 Bacteria 1475
244 Ga0163162_10493363 3300013306 Bacteria 1355
245 Ga0163162_10508501 3300013306 Bacteria 1335
246 Ga0163162_10549362 3300013306 Bacteria 1283
247 Ga0157375_10094493 3300013308 Bacteria 3059
248 Ga0157375_10218511 3300013308 Bacteria 2064
249 Ga0157375_10258013 3300013308 Bacteria 1904
250 Ga0157375_11516640 3300013308 Bacteria 791
251 Ga0163163_10078767 3300014325 Bacteria 3293
252 Ga0163163_10138716 3300014325 Bacteria 2473
253 Ga0163163_10382429 3300014325 Bacteria 1465
254 Ga0163163_10475031 3300014325 Bacteria 1311
255 Ga0163163_10699508 3300014325 Bacteria 1077
256 Ga0157380_10114271 3300014326 Bacteria 2275
257 Ga0157380_10252682 3300014326 Bacteria 1596
258 Ga0157380_10445725 3300014326 Bacteria 1242
259 Ga0157379_10161903 3300014968 Bacteria 2020
260 Ga0157379_10224480 3300014968 Bacteria 1702
261 Ga0157379_10272655 3300014968 Bacteria 1539
262 Ga0157379_10464677 3300014968 Bacteria 1170
263 Ga0157379_10550558 3300014968 Bacteria 1073
264 Ga0157376_10009717 3300014969 Bacteria 7002
265 Ga0157376_10226114 3300014969 Bacteria 1736
266 Ga0163161_10492539 3300017792 Bacteria 997
267 Ga0163161_10606418 3300017792 Bacteria 903
268 Ga0214544_1025681 3300021320 Bacteria 2773
269 Ga0207425_1006603 3300025245 Bacteria 3155
270 Ga0209677_100646 3300025253 Bacteria 18446
271 Ga0209148_1000493 3300025254 Bacteria 40546
272 Ga0209233_1002669 3300025261 Bacteria 6461
273 Ga0209233_1005867 3300025261 Bacteria 4029
274 Ga0209233_1025979 3300025261 Bacteria 1439
275 Ga0209455_1001622 3300025272 Bacteria 9830
276 Ga0209025_1072018 3300025294 Bacteria 1221
277 Ga0209564_1000405 3300025295 Bacteria 76803
278 Ga0209564_1004955 3300025295 Bacteria 7858
279 Ga0209564_1005132 3300025295 Bacteria 7612
280 Ga0209758_1000100 3300025297 Bacteria 227948
281 Ga0209758_1002189 3300025297 Bacteria 20469
282 Ga0209758_1003333 3300025297 Bacteria 14770
283 Ga0209758_1003494 3300025297 Bacteria 14210
284 Ga0209758_1003786 3300025297 Bacteria 13331
285 Ga0209758_1011629 3300025297 Bacteria 5066
286 Ga0209256_1007360 3300025299 Bacteria 5466
287 Ga0207426_1000382 3300025302 Bacteria 76034
288 Ga0207426_1001403 3300025302 Bacteria 20249
289 Ga0207426_1069001 3300025302 Bacteria 992
290 Ga0209257_1001443 3300025304 Bacteria 28086
291 Ga0209257_1023874 3300025304 Bacteria 2134
292 Ga0207697_10056760 3300025315 Bacteria 1625
293 Ga0207656_10124718 3300025321 Bacteria 1202
294 Ga0207653_10077242 3300025885 Bacteria 1147
295 Ga0207692_10009740 3300025898 Bacteria 4023
296 Ga0207642_10258729 3300025899 Bacteria 991
297 Ga0207642_10449332 3300025899 Bacteria 781
298 Ga0207710_10080913 3300025900 Bacteria 1507
299 Ga0207710_10084640 3300025900 Bacteria 1476
300 Ga0207710_10241106 3300025900 Bacteria 902
301 Ga0207688_10020113 3300025901 Bacteria 3643
302 Ga0207688_10219745 3300025901 Bacteria 1144
303 Ga0207680_10351041 3300025903 Bacteria 1036
304 Ga0207699_10002755 3300025906 Bacteria 8304
305 Ga0207643_10121909 3300025908 Bacteria 1545
306 Ga0207705_10108138 3300025909 Bacteria 2052
307 Ga0207705_10132107 3300025909 Bacteria 1858
308 Ga0207654_10026295 3300025911 Bacteria 3150
309 Ga0207707_10010734 3300025912 Bacteria 7959
310 Ga0207707_10057302 3300025912 Bacteria 3391
311 Ga0207695_10063748 3300025913 Bacteria 3798
312 Ga0207695_10106347 3300025913 Bacteria 2792
313 Ga0207671_10094373 3300025914 Bacteria 2258
314 Ga0207671_10155518 3300025914 Bacteria 1768
315 Ga0207671_10231673 3300025914 Bacteria 1449
316 Ga0207693_10008054 3300025915 Bacteria 8648
317 Ga0207693_10064517 3300025915 Bacteria 2869
318 Ga0207693_10126731 3300025915 Bacteria 2007
319 Ga0207663_10001581 3300025916 Bacteria 10701
320 Ga0207660_10072909 3300025917 Bacteria 2502
321 Ga0207660_10217537 3300025917 Bacteria 1498
322 Ga0207657_10073860 3300025919 Bacteria 2881
323 Ga0207657_10346113 3300025919 Bacteria 1173
324 Ga0207649_10272214 3300025920 Bacteria 1228
325 Ga0207652_10007801 3300025921 Bacteria 8598
326 Ga0207652_10120967 3300025921 Bacteria 2329
327 Ga0207694_10059861 3300025924 Bacteria 2963
328 Ga0207694_10136325 3300025924 Bacteria 1971
329 Ga0207650_10348803 3300025925 Bacteria 1217
330 Ga0207687_10017344 3300025927 Bacteria 4739
331 Ga0207687_10051048 3300025927 Bacteria 2882
332 Ga0207700_10072458 3300025928 Bacteria 2656
333 Ga0207700_10579547 3300025928 Bacteria 998
334 Ga0207664_10065254 3300025929 Bacteria 2914
335 Ga0207644_10544380 3300025931 Bacteria 960
336 Ga0207690_10297683 3300025932 Bacteria 1261
337 Ga0207690_10784710 3300025932 Bacteria 787
338 Ga0207706_10032326 3300025933 Bacteria 4661
339 Ga0207706_10109322 3300025933 Bacteria 2433
340 Ga0207706_10125503 3300025933 Bacteria 2257
341 Ga0207706_10149026 3300025933 Bacteria 2058
342 Ga0207706_10184663 3300025933 Bacteria 1831
343 Ga0207686_10590643 3300025934 Bacteria 873
344 Ga0207709_10125907 3300025935 Bacteria 1738
345 Ga0207709_10264905 3300025935 Bacteria 1262
346 Ga0207670_10364995 3300025936 Bacteria 1147
347 Ga0207669_10056135 3300025937 Bacteria 2389
348 Ga0207704_10065332 3300025938 Bacteria 2277
349 Ga0207704_10956968 3300025938 Bacteria 722
350 Ga0207691_10021301 3300025940 Bacteria 6121
351 Ga0207691_10165129 3300025940 Bacteria 1941
352 Ga0207711_10156486 3300025941 Bacteria 2060
353 Ga0207711_10189033 3300025941 Bacteria 1876
354 Ga0207689_10013204 3300025942 Bacteria 7050
355 Ga0207689_10023880 3300025942 Bacteria 5128
356 Ga0207661_10025924 3300025944 Bacteria 4461
357 Ga0207661_10165195 3300025944 Bacteria 1923
358 Ga0207679_11197528 3300025945 Bacteria 697
359 Ga0207667_10013254 3300025949 Bacteria 9449
360 Ga0207667_10118180 3300025949 Bacteria 2732
361 Ga0207667_10542128 3300025949 Bacteria 1177
362 Ga0207712_10127790 3300025961 Bacteria 1932
363 Ga0207712_10186502 3300025961 Bacteria 1634
364 Ga0207668_10009673 3300025972 Bacteria 5788
365 Ga0207668_10106640 3300025972 Bacteria 2093
366 Ga0207668_10357679 3300025972 Bacteria 1222
367 Ga0207668_10682499 3300025972 Bacteria 901
368 Ga0207640_10312453 3300025981 Bacteria 1248
369 Ga0207640_10846516 3300025981 Bacteria 795
370 Ga0207658_10066884 3300025986 Bacteria 2705
371 Ga0207658_10250446 3300025986 Bacteria 1505
372 Ga0207677_10082131 3300026023 Bacteria 2315
373 Ga0207677_10641405 3300026023 Bacteria 936
374 Ga0207703_10008946 3300026035 Bacteria 7887
375 Ga0207703_10254627 3300026035 Bacteria 1584
376 Ga0207703_10529440 3300026035 Bacteria 1109
377 Ga0207639_10098306 3300026041 Bacteria 2359
378 Ga0207678_10015643 3300026067 Bacteria 6670
379 Ga0207678_10051871 3300026067 Bacteria 3540
380 Ga0207678_10055302 3300026067 Bacteria 3419
381 Ga0207678_10065658 3300026067 Bacteria 3116
382 Ga0207678_10067294 3300026067 Bacteria 3075
383 Ga0207678_10159589 3300026067 Bacteria 1926
384 Ga0207678_10314147 3300026067 Bacteria 1347
385 Ga0207678_10318789 3300026067 Bacteria 1337
386 Ga0207708_10452967 3300026075 Bacteria 1069
387 Ga0207702_10220882 3300026078 Bacteria 1766
388 Ga0207641_10387828 3300026088 Bacteria 1339
389 Ga0207648_10243318 3300026089 Bacteria 1602
390 Ga0207676_10073218 3300026095 Bacteria 2756
391 Ga0207674_10134737 3300026116 Bacteria 2432
392 Ga0207674_10183351 3300026116 Bacteria 2044
393 Ga0207674_10336530 3300026116 Bacteria 1459
394 Ga0207675_100045559 3300026118 Bacteria 4098
395 Ga0207675_100091987 3300026118 Bacteria 2852
396 Ga0207675_100368827 3300026118 Bacteria 1410
397 Ga0207675_100399297 3300026118 Bacteria 1355
398 Ga0207683_10019629 3300026121 Bacteria 5776
399 Ga0207683_10038464 3300026121 Bacteria 4170
400 Ga0207683_10173140 3300026121 Bacteria 1956
401 Ga0207683_10278171 3300026121 Bacteria 1529
402 Ga0209389_1000092 3300027296 Bacteria 82555
403 Ga0209589_1000023 3300027357 Bacteria 177856
404 Ga0209589_1000115 3300027357 Bacteria 82537
405 Ga0209489_100032 3300027361 Bacteria 177856
406 Ga0209489_100340 3300027361 Bacteria 82555
407 Ga0209700_100040 3300027363 Bacteria 177856
408 Ga0207428_10264314 3300027907 Bacteria 1281
409 Ga0268266_10004462 3300028379 Bacteria 13381
410 Ga0268266_10034740 3300028379 Bacteria 4288
411 Ga0268266_10043378 3300028379 Bacteria 3843
412 Ga0268266_10087693 3300028379 Bacteria 2723
413 Ga0268266_10428048 3300028379 Bacteria 1255
414 Ga0268266_10468815 3300028379 Bacteria 1199
415 Ga0268266_10513389 3300028379 Bacteria 1145
416 Ga0268266_10633086 3300028379 Bacteria 1029
417 Ga0268266_10790701 3300028379 Bacteria 916
418 Ga0268265_11155257 3300028380 Bacteria 770
419 Ga0268264_10000084 3300028381 Bacteria 242128
420 Ga0268264_10104692 3300028381 Bacteria 2467
421 Ga0268264_10175815 3300028381 Bacteria 1940
422 Ga0265334_10034037 3300028573 Bacteria 2024
423 Ga0307517_10000369 3300028786 Bacteria 77795
424 Ga0265332_10126114 3300031238 Bacteria 1074
425 Ga0265331_10079078 3300031250 Bacteria 1530
426 Ga0307513_10164848 3300031456 Bacteria 2102
427 Ga0307513_10331853 3300031456 Bacteria 1275
428 Ga0307509_10442132 3300031507 Bacteria 996
429 Ga0307508_10000010 3300031616 Bacteria 255747
430 Ga0307508_10010103 3300031616 Bacteria 8647
431 Ga0265314_10003900 3300031711 Bacteria 14176
432 Ga0307516_10162917 3300031730 Bacteria 1979
433 Ga0307516_10349984 3300031730 Bacteria 1143
434 Ga0307410_10504157 3300031852 Bacteria 996
435 Ga0307406_11167157 3300031901 Bacteria 667
436 Ga0307412_10288433 3300031911 Bacteria 1292
437 Ga0307409_100928846 3300031995 Bacteria 885
438 Ga0307409_100965963 3300031995 Bacteria 868
439 Ga0307416_100936465 3300032002 Bacteria 968
440 Ga0307411_10473415 3300032005 Bacteria 1053
441 Ga0307415_100018822 3300032126 Bacteria 4181
442 Ga0307415_100746077 3300032126 Bacteria 888
443 Ga0307510_10000998 3300033180 Bacteria 30010
444 Ga0307510_10002011 3300033180 Bacteria 22938
445 Ga0307510_10005745 3300033180 Bacteria 14788
446 Ga0307510_10129640 3300033180 Bacteria 2200
447 Ga0373923_0010411 3300035111 Bacteria 3381
448 Ga0373936_0018999 3300035113 Bacteria 2661
449 Ga0373936_0043504 3300035113 Bacteria 1805
450 Ga0373939_0195921 3300035114 Bacteria 761
451 Ga0373953_0111555 3300035117 Bacteria 1156
452 Ga0373954_0000067 3300035118 Bacteria 37060
453 Ga0373956_0006475 3300035119 Bacteria 4694
454 Ga0373957_0015776 3300035120 Bacteria 2605
455 Ga0373946_0003822 3300035171 Bacteria 5346
456 Ga0373955_0005976 3300035172 Bacteria 5517
457 Ga0373962_0092184 3300035242 Bacteria 935
458 Ga0373924_0038716 3300035410 Bacteria 1946
459 Ga0373933_0004250 3300035724 Bacteria 7887
460 Ga0373947_0036502 3300035725 Bacteria 2914
461 Ga0373947_0160643 3300035725 Bacteria 1453
462 Ga0373947_0164024 3300035725 Bacteria 1438
463 Ga0373937_0364651 3300036401 Bacteria 1369
464 Ga0372808_027101 3300036459 Bacteria 823
465 Ga0373925_0003101 3300037068 Bacteria 13044
466 Ga0373925_0030207 3300037068 Bacteria 3977
467 Ga0373925_0351103 3300037068 Bacteria 1198
468 Ga0395900_0694763 3300037418 Bacteria 951
469 Ga0395898_0195553 3300037466 Bacteria 1932
470 Ga0395898_0530459 3300037466 Bacteria 1119
471 Ga0395905_0002179 3300037471 Bacteria 22137
472 Ga0395905_0172000 3300037471 Bacteria 2035
473 Ga0395905_0268508 3300037471 Bacteria 1592
474 Ga0436365_1217869 3300039437 Bacteria 1130
475 Ga0439465_0162219 3300041413 Bacteria 802
476 Ga0451789_1137804 3300041443 Bacteria 816
477 Ga0451793_0679340 3300041452 Bacteria 1045
478 Ga0451798_0910788 3300041458 Bacteria 1070
479 Ga0451807_2243169 3300041486 Bacteria 764
480 Ga0466961_0000506 3300044693 Bacteria 24840
481 Ga0466964_0030385 3300044706 Bacteria 2138
482 Ga0466957_0092607 3300044842 Bacteria 1896
483 Ga0466959_0030081 3300045049 Bacteria 4022
484 Ga0466967_0340354 3300045976 Bacteria 1450
485 Ga0495603_0038328 3300046455 Bacteria 2874
486 Ga0495603_0046296 3300046455 Bacteria 2592
487 Ga0495603_0098320 3300046455 Bacteria 1709
488 Ga0495603_0188149 3300046455 Bacteria 1194
489 Ga0495603_0189408 3300046455 Bacteria 1189
490 Ga0495629_0000398 3300046459 Bacteria 36605
491 Ga0495629_0016283 3300046459 Bacteria 5335
492 Ga0495638_0007240 3300046460 Bacteria 7978
493 Ga0495638_0022505 3300046460 Bacteria 4136
494 Ga0495651_0004166 3300046462 Bacteria 11071
495 Ga0495653_0000598 3300046463 Bacteria 27691
496 Ga0495580_0026091 3300046472 Bacteria 4263
497 Ga0495582_0186018 3300046473 Bacteria 1184
498 Ga0495605_0068749 3300046474 Bacteria 1678
499 Ga0495605_0293865 3300046474 Bacteria 688
500 Ga0495639_0010545 3300046475 Bacteria 3980
501 Ga0495639_0220044 3300046475 Bacteria 933
502 Ga0495662_0207931 3300046476 Bacteria 965
503 Ga0495664_0020455 3300046477 Bacteria 3817
504 Ga0495664_0202435 3300046477 Bacteria 1203
505 Ga0495584_0313628 3300046491 Bacteria 796
506 Ga0495594_0254805 3300046499 Bacteria 1000
507 Ga0495594_0264593 3300046499 Bacteria 979
508 Ga0495596_0109380 3300046500 Bacteria 1073
509 Ga0495607_0048527 3300046501 Bacteria 2482
510 Ga0495583_0048377 3300046506 Bacteria 1952
511 Ga0495606_0023364 3300046507 Bacteria 4480
512 Ga0495606_0230957 3300046507 Bacteria 1037
513 Ga0495608_0004383 3300046511 Bacteria 10114
514 Ga0495610_0148789 3300046512 Bacteria 1001
515 Ga0495616_0168984 3300046513 Bacteria 979
516 Ga0495620_0026601 3300046515 Bacteria 2719
517 Ga0495620_0060123 3300046515 Bacteria 1585
518 Ga0495620_0196667 3300046515 Bacteria 776
519 Ga0495628_0645580 3300046516 Bacteria 752
520 Ga0495631_0052237 3300046518 Bacteria 1785
521 Ga0495637_0096569 3300046520 Bacteria 1159
522 Ga0495643_0041821 3300046522 Bacteria 2498
523 Ga0495644_0089045 3300046523 Bacteria 1164
524 Ga0495648_0030640 3300046524 Bacteria 3553
525 Ga0495648_0083471 3300046524 Bacteria 1810
526 Ga0495648_0090975 3300046524 Bacteria 1708
527 Ga0495648_0146960 3300046524 Bacteria 1234
528 Ga0495666_0021904 3300046526 Bacteria 3164
529 Ga0495652_0023703 3300046529 Bacteria 5439
530 Ga0495652_0139490 3300046529 Bacteria 1908
531 Ga0495652_0227240 3300046529 Bacteria 1398
532 Ga0495654_0053652 3300046530 Bacteria 1958
533 Ga0495640_0009889 3300046533 Bacteria 7398
534 Ga0495640_0011188 3300046533 Bacteria 6908
535 Ga0495640_0132873 3300046533 Bacteria 1609
536 Ga0495587_0097443 3300046536 Bacteria 1695
537 Ga0495598_0097985 3300046537 Bacteria 966
538 Ga0495609_0017505 3300046538 Bacteria 3328
539 Ga0495597_0111452 3300046542 Bacteria 1147
540 Ga0495597_0219625 3300046542 Bacteria 755
541 Ga0495645_0009326 3300046543 Bacteria 6865
542 Ga0495622_0034359 3300046557 Bacteria 2365
543 Ga0495622_0177024 3300046557 Bacteria 957
544 Ga0495656_0144867 3300046615 Bacteria 1142
545 Ga0495656_0157593 3300046615 Bacteria 1101
546 Ga0495656_0246166 3300046615 Bacteria 902
547 Ga0495668_0032967 3300046616 Bacteria 2912
548 Ga0495668_0208321 3300046616 Bacteria 1070
549 Ga0495634_0035380 3300046642 Bacteria 3421
550 Ga0495634_0044095 3300046642 Bacteria 3020
551 Ga0495634_0074829 3300046642 Bacteria 2225
552 Ga0495611_0110246 3300046648 Bacteria 1281
553 Ga0495611_0117468 3300046648 Bacteria 1240
554 Ga0495611_0227655 3300046648 Bacteria 867
555 Ga0495625_0011042 3300046660 Bacteria 7405
556 Ga0495625_0216171 3300046660 Bacteria 1258
557 Ga0495625_0317915 3300046660 Bacteria 992
558 Ga0495635_0000102 3300046663 Bacteria 50623
559 Ga0495635_0261400 3300046663 Bacteria 1165
560 Ga0495661_0020554 3300046665 Bacteria 4308
561 Ga0495661_0074354 3300046665 Bacteria 1978
562 Ga0495588_0002080 3300046674 Bacteria 8576
563 Ga0495588_0056871 3300046674 Bacteria 2020
564 Ga0495657_0000677 3300046675 Bacteria 30671
565 Ga0495599_0004277 3300046678 Bacteria 8439
566 Ga0495623_0000625 3300046679 Bacteria 23594
567 Ga0495623_0187934 3300046679 Bacteria 1196
568 Ga0495623_0201805 3300046679 Bacteria 1143
569 Ga0495646_0011103 3300046680 Bacteria 5718
570 Ga0495646_0198170 3300046680 Bacteria 1095
571 Ga0495647_0275559 3300046681 Bacteria 754
572 Ga0495658_0450343 3300046683 Bacteria 822
573 Ga0495669_0066101 3300046684 Bacteria 1642
574 Ga0495669_0267734 3300046684 Bacteria 821
575 Ga0495669_0351127 3300046684 Bacteria 713
576 Ga0495613_0252896 3300046689 Bacteria 1229
577 Ga0495624_0054765 3300046690 Bacteria 2514
578 Ga0495624_0168959 3300046690 Bacteria 1334
579 Ga0495624_0326148 3300046690 Bacteria 924
580 Ga0495671_0008342 3300046692 Bacteria 5831
581 Ga0495671_0137239 3300046692 Bacteria 1192
582 Ga0495649_0191402 3300046694 Bacteria 1065
583 Ga0495589_0101299 3300046794 Bacteria 1394
584 Ga0495589_0358961 3300046794 Bacteria 671
585 Ga0495600_0012741 3300046809 Bacteria 5265
586 Ga0495600_0103936 3300046809 Bacteria 1851
587 Ga0495660_0088074 3300046810 Bacteria 1618
588 Ga0495581_0028179 3300047315 Bacteria 3256
589 Ga0495581_0433606 3300047315 Bacteria 766
590 Ga0495604_0028450 3300047317 Bacteria 4446
591 Ga0495604_0144377 3300047317 Bacteria 1697
592 Ga0495672_0050211 3300047320 Bacteria 2464
593 Ga0495672_0103753 3300047320 Bacteria 1537
594 Ga0495676_0144086 3300047321 Bacteria 1704
595 Ga0495676_0318932 3300047321 Bacteria 1044
596 Ga0495680_0013796 3300047322 Bacteria 7031
597 Ga0495687_158166 3300047443 Bacteria 766
598 Ga0495675_0000456 3300047444 Bacteria 26992
599 Ga0495673_0039762 3300047469 Bacteria 2132
600 Ga0495673_0089396 3300047469 Bacteria 1261
601 Ga0495673_0131931 3300047469 Bacteria 981
602 Ga0495673_0170618 3300047469 Bacteria 829
603 Ga0495681_0059983 3300047470 Bacteria 1757
604 Ga0495684_0000088 3300047471 Bacteria 64704
605 Ga0495686_0311415 3300047472 Bacteria 866
606 Ga0495686_0477569 3300047472 Bacteria 659
607 Ga0495593_0002275 3300047673 Bacteria 11512
608 Ga0495602_0020576 3300048088 Bacteria 6517
609 Ga0495602_0177927 3300048088 Bacteria 1644
610 Ga0495614_0154088 3300048089 Bacteria 1026
611 Ga0496100_0026351 3300048903 Bacteria 3563
612 Ga0496100_0184746 3300048903 Bacteria 1510
613 Ga0496100_0283745 3300048903 Bacteria 1235
614 Ga0496100_0479098 3300048903 Bacteria 957
615 Ga0496101_0013079 3300048904 Bacteria 5551
616 Ga0496102_0024192 3300048905 Bacteria 5399
617 Ga0496102_0079289 3300048905 Bacteria 3024
618 Ga0496102_0278273 3300048905 Bacteria 1577
619 Ga0496102_0914803 3300048905 Bacteria 799
620 Ga0496102_1176870 3300048905 Bacteria 686
621 Ga0496103_0250271 3300048906 Bacteria 1140
622 Ga0496104_0088095 3300048907 Bacteria 2965
623 Ga0496104_0099267 3300048907 Bacteria 2787
624 Ga0496104_0682852 3300048907 Bacteria 935
625 Ga0496105_0005894 3300048908 Bacteria 9345
626 Ga0496105_0026027 3300048908 Bacteria 4768
627 Ga0496105_0093401 3300048908 Bacteria 2484
628 Ga0496106_0009909 3300048909 Bacteria 7036
629 Ga0496106_0256720 3300048909 Bacteria 1398
630 Ga0496106_0387288 3300048909 Bacteria 1123
631 Ga0496107_0001973 3300048910 Bacteria 13057
632 Ga0496107_0025149 3300048910 Bacteria 4214
633 Ga0496107_0299548 3300048910 Bacteria 1197
634 Ga0496108_0014344 3300048911 Bacteria 6469
635 Ga0496108_0042375 3300048911 Bacteria 3800
636 Ga0496108_0098850 3300048911 Bacteria 2487
637 Ga0496108_0157249 3300048911 Bacteria 1963
638 Ga0496108_0546120 3300048911 Bacteria 1011
639 Ga0496108_0867885 3300048911 Bacteria 776
640 Ga0496109_0051467 3300048912 Bacteria 3751
641 Ga0496109_0120837 3300048912 Bacteria 2440
642 Ga0496109_0625422 3300048912 Bacteria 1013
643 Ga0496109_1178311 3300048912 Bacteria 703
644 Ga0496110_0212745 3300048913 Bacteria 1758
645 Ga0496110_0617395 3300048913 Bacteria 983
646 Ga0496110_0764839 3300048913 Bacteria 870
647 Ga0496111_0139192 3300048914 Bacteria 1798
648 Ga0496111_0377782 3300048914 Bacteria 1048
649 Ga0496111_0711982 3300048914 Bacteria 730
650 Ga0496112_0059867 3300048915 Bacteria 3752
651 Ga0496112_0109052 3300048915 Bacteria 2739
652 Ga0496112_0176759 3300048915 Bacteria 2099
653 Ga0496113_0065731 3300048916 Bacteria 2745
654 Ga0496113_0128837 3300048916 Bacteria 1984
655 Ga0496114_0079530 3300048917 Bacteria 2767
656 Ga0496115_0002110 3300048918 Bacteria 14231
657 Ga0496115_0154394 3300048918 Bacteria 1896
658 Ga0496115_0232288 3300048918 Bacteria 1521
659 Ga0496115_0586750 3300048918 Bacteria 887
660 Ga0496115_0785317 3300048918 Bacteria 742
661 Ga0496118_0124227 3300048921 Bacteria 1675
662 Ga0496118_0209013 3300048921 Bacteria 1147
663 Ga0496119_0011563 3300048922 Bacteria 7285
664 Ga0496119_0029097 3300048922 Bacteria 3755
665 Ga0496120_0118746 3300048923 Bacteria 1370
666 Ga0496120_0132474 3300048923 Bacteria 1275
667 Ga0496121_0000664 3300048924 Bacteria 64277
668 Ga0496121_0001831 3300048924 Bacteria 34280
669 Ga0496121_0004034 3300048924 Bacteria 20175
670 Ga0496121_0013563 3300048924 Bacteria 8740
671 Ga0496121_0078663 3300048924 Bacteria 2621
672 Ga0496121_0086013 3300048924 Bacteria 2472
673 Ga0496121_0100846 3300048924 Bacteria 2228
674 Ga0496121_0129970 3300048924 Bacteria 1887
675 Ga0496122_0004370 3300048925 Bacteria 17629
676 Ga0496122_0105531 3300048925 Bacteria 1868
677 Ga0496123_0046249 3300048926 Bacteria 2953
678 Ga0496123_0222542 3300048926 Bacteria 951
679 Ga0496124_0237465 3300048927 Bacteria 1358
680 Ga0496124_0497030 3300048927 Bacteria 819
681 Ga0496125_0019338 3300048928 Bacteria 6428
682 Ga0496125_0035378 3300048928 Bacteria 4382
683 Ga0496125_0091380 3300048928 Bacteria 2281
684 Ga0496125_0190092 3300048928 Bacteria 1357
685 Ga0496125_0334185 3300048928 Bacteria 912
686 Ga0496126_0007417 3300048929 Bacteria 12031
687 Ga0496126_0010287 3300048929 Bacteria 9826
688 Ga0496126_0055592 3300048929 Bacteria 3580
689 Ga0496126_0076084 3300048929 Bacteria 2978
690 Ga0496126_0091851 3300048929 Bacteria 2668
691 Ga0496126_0107392 3300048929 Bacteria 2434
692 Ga0496126_0107909 3300048929 Bacteria 2428
693 Ga0496126_0142329 3300048929 Bacteria 2063
694 Ga0496126_0143579 3300048929 Bacteria 2052
695 Ga0496126_0170191 3300048929 Bacteria 1856
696 Ga0496126_0213125 3300048929 Bacteria 1625
697 Ga0496126_0217251 3300048929 Bacteria 1608
698 Ga0496126_0461070 3300048929 Bacteria 1021
699 Ga0496126_0490402 3300048929 Bacteria 983
700 Ga0496126_0533130 3300048929 Bacteria 934
701 Ga0496126_0821698 3300048929 Bacteria 711
702 Ga0495682_0023470 3300049460 Bacteria 2302
703 Ga0495682_0059866 3300049460 Bacteria 1376
704 Ga0501042_0250593 3300049578 Bacteria 1278
705 Ga0501067_0244415 3300049583 Bacteria 999
706 Ga0501071_0103684 3300049587 Bacteria 2099
707 Ga0501076_0194231 3300049592 Bacteria 1657
708 Ga0501076_0476218 3300049592 Bacteria 1029
709 Ga0501080_0301200 3300049742 Bacteria 1454
710 Ga0501035_0512841 3300049822 Bacteria 986
711 nmdc:mga03683_143328_c1 3300050489 Bacteria 1075
712 nmdc:mga03683_238662_c1 3300050489 Bacteria 842
713 nmdc:mga03683_38740_c1 3300050489 Bacteria 1272
714 nmdc:mga03n38_900_c1 3300050490 Bacteria 8001
715 nmdc:mga00v17_33403_c1 3300050491 Bacteria 3047
716 nmdc:mga0yw44_244714_c1 3300050492 Bacteria 1193
717 nmdc:mga0yw44_32113_c1 3300050492 Bacteria 3057
718 nmdc:mga0yw44_348863_c1 3300050492 Bacteria 996
719 nmdc:mga0yw44_45839_c1 3300050492 Bacteria 2623
720 nmdc:mga0k408_168683_c1 3300050493 Bacteria 1305
721 nmdc:mga0k408_81659_c1 3300050493 Bacteria 1893
722 nmdc:mga06z11_147670_c1 3300050494 Bacteria 1334
723 nmdc:mga06z11_221921_c1 3300050494 Bacteria 1105
724 nmdc:mga06z11_227206_c1 3300050494 Bacteria 1092
725 nmdc:mga06z11_401958_c1 3300050494 Bacteria 824
726 nmdc:mga06z11_96862_c1 3300050494 Bacteria 1612
727 nmdc:mga04h51_175937_c1 3300050495 Bacteria 831
728 nmdc:mga07m45_122306_c1 3300050496 Bacteria 1503
729 nmdc:mga07m45_20510_c1 3300050496 Bacteria 3590
730 nmdc:mga07m45_218027_c1 3300050496 Bacteria 1110
731 nmdc:mga07m45_34523_c1 3300050496 Bacteria 2811
732 nmdc:mga07m45_3887_c1 3300050496 Bacteria 7253
733 nmdc:mga05p37_721000_c1 3300050507 Bacteria 1104
734 nmdc:mga0qj67_290663_c1 3300050509 Bacteria 1324
735 nmdc:mga0n895_536470_c1 3300050512 Bacteria 1177
736 nmdc:mga0sz30_135787_c1 3300050516 Bacteria 1085
737 nmdc:mga0sz30_215824_c1 3300050516 Bacteria 853
738 nmdc:mga0sz30_64720_c1 3300050516 Bacteria 1567
739 nmdc:mga0sz30_66366_c1 3300050516 Bacteria 1548
740 Ga0495601_0024475 3300053077 Bacteria 3718
741 Ga0495601_0228597 3300053077 Bacteria 1215
742 Ga0495601_0240214 3300053077 Bacteria 1183
743 Ga0500635_0003791 3300053080 Bacteria 3833
744 Ga0495655_0006636 3300053083 Bacteria 2115
745 Ga0495595_0000759 3300053084 Bacteria 12251
746 Ga0495619_0000166 3300053085 Bacteria 48296
747 Ga0500578_0181420 3300053086 Bacteria 1297
748 Ga0500578_0188632 3300053086 Bacteria 1267
749 Ga0500578_0232755 3300053086 Bacteria 1116
750 Ga0500578_0353547 3300053086 Bacteria 858
751 Ga0500578_0431740 3300053086 Bacteria 753
752 Ga0500578_0498506 3300053086 Bacteria 685
753 Ga0500643_000025 3300053087 Bacteria 259605
754 Ga0500643_005118 3300053087 Bacteria 5724
755 Ga0500643_021008 3300053087 Bacteria 2123
756 Ga0500644_0058285 3300053088 Bacteria 1351
757 Ga0500644_0110092 3300053088 Bacteria 1060
758 Ga0500581_189180 3300053089 Bacteria 925
759 Ga0500647_0026225 3300053091 Bacteria 2748
760 Ga0500647_0028552 3300053091 Bacteria 2641
761 Ga0500583_0040306 3300053092 Bacteria 2115
762 Ga0500583_0061256 3300053092 Bacteria 1776
763 Ga0500583_0222275 3300053092 Bacteria 936
764 Ga0500651_0000899 3300053093 Bacteria 14572
765 Ga0500651_0008591 3300053093 Bacteria 6025
766 Ga0500651_0182309 3300053093 Bacteria 1246
767 Ga0500566_0000357 3300053094 Bacteria 24893
768 Ga0500566_0000516 3300053094 Bacteria 21571
769 Ga0500566_0013648 3300053094 Bacteria 4778
770 Ga0500640_002117 3300053095 Bacteria 6424
771 Ga0500640_012088 3300053095 Bacteria 3536
772 Ga0500641_0009259 3300053096 Bacteria 3537
773 Ga0500641_0010600 3300053096 Bacteria 3334
774 Ga0500641_0146908 3300053096 Bacteria 1018
775 Ga0500641_0161722 3300053096 Bacteria 965
776 Ga0500650_0000436 3300053098 Bacteria 10425
777 Ga0500650_0073664 3300053098 Bacteria 1597
778 Ga0500650_0158741 3300053098 Bacteria 1043
779 Ga0500554_090941 3300053102 Bacteria 1014
780 Ga0500555_000313 3300053103 Bacteria 20918
781 Ga0500556_0000030 3300053104 Bacteria 165098
782 Ga0500556_0031463 3300053104 Bacteria 1805
783 Ga0500557_000001 3300053105 Bacteria 241298
784 Ga0500562_006327 3300053108 Bacteria 2986
785 Ga0500562_013904 3300053108 Bacteria 2058
786 Ga0500569_000906 3300053109 Bacteria 5312
787 Ga0500572_000055 3300053111 Bacteria 34260
788 Ga0500591_036842 3300053115 Bacteria 2345
789 Ga0500592_000451 3300053116 Bacteria 6869
790 Ga0500592_022180 3300053116 Bacteria 1024
791 Ga0500593_126805 3300053117 Bacteria 1026
792 Ga0500595_000159 3300053119 Bacteria 44312
793 Ga0500595_005547 3300053119 Bacteria 5497
794 Ga0500595_007227 3300053119 Bacteria 4621
795 Ga0500595_009326 3300053119 Bacteria 3964
796 Ga0500595_016266 3300053119 Bacteria 2774
797 Ga0500595_019420 3300053119 Bacteria 2466
798 Ga0500595_033476 3300053119 Bacteria 1705
799 Ga0500607_031237 3300053121 Bacteria 2931
800 Ga0500607_035660 3300053121 Bacteria 2719
801 Ga0500608_006046 3300053122 Bacteria 4882
802 Ga0500614_002236 3300053123 Bacteria 4369
803 Ga0500642_0000028 3300053130 Bacteria 117281
804 Ga0500642_0000800 3300053130 Bacteria 9239
805 Ga0500642_0003409 3300053130 Bacteria 4805
806 Ga0500652_000170 3300053131 Bacteria 25102
807 Ga0500652_259082 3300053131 Bacteria 686
808 Ga0500658_0060537 3300053134 Bacteria 1573
809 Ga0500658_0101424 3300053134 Bacteria 1257
810 Ga0500559_0000947 3300053136 Bacteria 18267
811 Ga0500559_0042724 3300053136 Bacteria 1978
812 Ga0500559_0170685 3300053136 Bacteria 1023
813 Ga0500561_0010866 3300053137 Bacteria 1897
814 Ga0500568_0036269 3300053139 Bacteria 2007
815 Ga0500586_020182 3300053145 Bacteria 2083
816 Ga0500588_0033876 3300053146 Bacteria 1493
817 Ga0500588_0101685 3300053146 Bacteria 991
818 Ga0500588_0122610 3300053146 Bacteria 918
819 Ga0500589_242254 3300053147 Bacteria 666
820 Ga0500590_072221 3300053148 Bacteria 1713
821 Ga0500590_133646 3300053148 Bacteria 1144
822 Ga0500603_000052 3300053150 Bacteria 28617
823 Ga0500603_001546 3300053150 Bacteria 5227
824 Ga0500603_092089 3300053150 Bacteria 891
825 Ga0500604_0006225 3300053151 Bacteria 3152
826 Ga0500604_0045319 3300053151 Bacteria 1342
827 Ga0500616_0000413 3300053153 Bacteria 57779
828 Ga0500616_0019833 3300053153 Bacteria 3786
829 Ga0500622_0003375 3300053156 Bacteria 10747
830 Ga0500622_0026645 3300053156 Bacteria 3049
831 Ga0500622_0117926 3300053156 Bacteria 1290
832 Ga0500627_0150927 3300053158 Bacteria 1050
833 Ga0500630_001061 3300053159 Bacteria 12856
834 Ga0500634_0159834 3300053161 Bacteria 1041
835 Ga0500638_001268 3300053162 Bacteria 7729
836 Ga0500638_098921 3300053162 Bacteria 1363
837 Ga0500638_151530 3300053162 Bacteria 1031
838 Ga0500638_169742 3300053162 Bacteria 951
839 Ga0500639_000004 3300053163 Bacteria 216921
840 Ga0500636_0000518 3300053177 Bacteria 20952
841 Ga0500636_0034455 3300053177 Bacteria 2997
842 Ga0500636_0042062 3300053177 Bacteria 2702
843 Ga0500637_0000349 3300053178 Bacteria 17523
844 Ga0500637_0197587 3300053178 Bacteria 1146
845 Ga0500637_0210981 3300053178 Bacteria 1102
846 Ga0500649_075770 3300053722 Bacteria 1379
847 Ga0500570_136515 3300053724 Bacteria 915
848 Ga0500611_004084 3300053727 Bacteria 1937
849 Ga0500611_101437 3300053727 Bacteria 746
850 Ga0500625_001073 3300053729 Bacteria 8832
851 Ga0500645_050059 3300053730 Bacteria 1220
852 Ga0500645_060917 3300053730 Bacteria 1091
853 Ga0500596_001961 3300053735 Bacteria 4125
854 Ga0500599_005507 3300053736 Bacteria 1591
855 Ga0500601_002070 3300053737 Bacteria 2153
856 Ga0500661_000413 3300055283 Bacteria 7898
857 Ga0500661_004375 3300055283 Bacteria 2645
858 Ga0500661_007243 3300055283 Bacteria 2058
859 Ga0530510_0429357 3300061734 Bacteria 998

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047320 Ga0495672_0050211 Ga0495672_0050211_325_933 190
2 3300025914 Ga0207671_10231673 Ga0207671_102316733 191
3 3300046529 Ga0495652_0227240 Ga0495652_0227240_700_1308 191
4 3300053139 Ga0500568_0036269 Ga0500568_0036269_663_1271 191
5 3300007788 Ga0099795_10104338 Ga0099795_101043381 193
6 3300048918 Ga0496115_0785317 Ga0496115_0785317_10_591 193
7 3300006846 Ga0075430_100237715 Ga0075430_1002377152 194
8 3300050509 nmdc:mga0qj67_290663_c1 nmdc:mga0qj67_290663_c1_307_915 194
9 3300046477 Ga0495664_0202435 Ga0495664_0202435_537_1145 195
10 3300046516 Ga0495628_0645580 Ga0495628_0645580_11_619 195
11 3300046523 Ga0495644_0089045 Ga0495644_0089045_320_934 195
12 3300047315 Ga0495581_0433606 Ga0495581_0433606_40_648 195
13 3300053094 Ga0500566_0013648 Ga0500566_0013648_851_1459 195
14 3300053119 Ga0500595_000159 Ga0500595_000159_8377_8985 195
15 3300053162 Ga0500638_001268 Ga0500638_001268_4156_4764 195
16 3300053178 Ga0500637_0000349 Ga0500637_0000349_3435_4043 195
17 3300055283 Ga0500661_000413 Ga0500661_000413_1915_2523 195
18 iso_pu_bacteria 2513237104 2513717612 197
19 iso_pu_bacteria 2744054633 2745082168 197
20 iso_pu_bacteria 2841957949 2841962440 197
21 iso_pu_bacteria 2874620515 2874626992 197
22 iso_pu_bacteria 2885366525 2885373416 197
23 iso_pu_bacteria 2904666416 2904669693 197
24 iso_pu_bacteria 2507262055 2507509522 198
25 iso_pu_bacteria 2508501009 2508543567 198
26 iso_pu_bacteria 2508501042 2508698645 198
27 iso_pu_bacteria 2511231028 2511398585 198
28 iso_pu_bacteria 2513237092 2513624649 198
29 iso_pu_bacteria 2513237094 2513638087 198
30 iso_pu_bacteria 2513237095 2513646462 198
31 iso_pu_bacteria 2513237098 2513676838 198
32 iso_pu_bacteria 2513237101 2513691652 198
33 iso_pu_bacteria 2513237102 2513706943 198
34 iso_pu_bacteria 2513237139 2513879363 198
35 iso_pu_bacteria 2513237161 2514016672 198
36 iso_pu_bacteria 2515154112 2515631227 198
37 iso_pu_bacteria 2517093001 2517106599 198
38 iso_pu_bacteria 2524023205 2524439712 198
39 iso_pu_bacteria 2524023210 2524469897 198
40 iso_pu_bacteria 2528768022 2528856162 198
41 iso_pu_bacteria 2617270735 2617354027 198
42 iso_pu_bacteria 2721755755 2723845928 198
43 iso_pu_bacteria 2728368998 2728754491 198
44 iso_pu_bacteria 2791355196 2793064722 198
45 iso_pu_bacteria 2791355199 2793079750 198
46 iso_pu_bacteria 2802429603 2805920261 198
47 iso_pu_bacteria 2816332527 2818240347 198
48 iso_pu_bacteria 2824661429 2824667330 198
49 iso_pu_bacteria 2824671348 2824676241 198
50 iso_pu_bacteria 2824679649 2824682537 198
51 iso_pu_bacteria 2824687955 2824692301 198
52 iso_pu_bacteria 2824704595 2824707255 198
53 iso_pu_bacteria 2824753945 2824756657 198
54 iso_pu_bacteria 2824763712 2824767300 198
55 iso_pu_bacteria 2824773399 2824779057 198
56 iso_pu_bacteria 2838122688 2838128684 198
57 iso_pu_bacteria 2841941048 2841948515 198
58 iso_pu_bacteria 2841949485 2841956371 198
59 iso_pu_bacteria 2841966195 2841967144 198
60 iso_pu_bacteria 2841974524 2841979455 198
61 iso_pu_bacteria 2841983080 2841989935 198
62 iso_pu_bacteria 2842038055 2842039934 198
63 iso_pu_bacteria 2842045827 2842047121 198
64 iso_pu_bacteria 2844315083 2844318217 198
65 iso_pu_bacteria 2847939898 2847945649 198
66 iso_pu_bacteria 2849076700 2849080178 198
67 iso_pu_bacteria 2857509624 2857510438 198
68 iso_pu_bacteria 2857524615 2857530628 198
69 iso_pu_bacteria 2874590934 2874591883 198
70 iso_pu_bacteria 2874604998 2874609416 198
71 iso_pu_bacteria 2874628541 2874636437 198
72 iso_pu_bacteria 2874645413 2874651208 198
73 iso_pu_bacteria 2876771140 2876771601 198
74 iso_pu_bacteria 2876808645 2876813197 198
75 iso_pu_bacteria 2876818435 2876819427 198
76 iso_pu_bacteria 2879074833 2879075879 198
77 iso_pu_bacteria 2879099564 2879100681 198
78 iso_pu_bacteria 2879110137 2879110361 198
79 iso_pu_bacteria 2879127579 2879134673 198
80 iso_pu_bacteria 2879142872 2879143156 198
81 iso_pu_bacteria 2881364244 2881366538 198
82 iso_pu_bacteria 2881665667 2881673087 198
83 iso_pu_bacteria 2885383462 2885386630 198
84 iso_pu_bacteria 2888378607 2888383074 198
85 iso_pu_bacteria 2888388044 2888394756 198
86 iso_pu_bacteria 2889033259 2889040786 198
87 iso_pu_bacteria 2903727486 2903733001 198
88 iso_pu_bacteria 2903768456 2903774618 198
89 iso_pu_bacteria 2904711408 2904716983 198
90 iso_pu_bacteria 2906602504 2906605110 198
91 iso_pu_bacteria 2906626472 2906627985 198
92 iso_pu_bacteria 2919073203 2919076223 198
93 iso_pu_bacteria 2922361189 2922367880 198
94 iso_pu_bacteria 2922368715 2922373271 198
95 iso_pu_bacteria 2922386360 2922392229 198
96 iso_pu_bacteria 2929615660 2929615695 198
97 iso_pu_bacteria 2929624759 2929630310 198
98 iso_pu_bacteria 2932784394 2932791861 198
99 iso_pu_bacteria 2932794094 2932796331 198
100 iso_pu_bacteria 2932801729 2932804363 198
101 iso_pu_bacteria 2932809354 2932815602 198
102 iso_pu_bacteria 2932818245 2932819325 198
103 iso_pu_bacteria 2932828146 2932836015 198
104 iso_pu_bacteria 2933577622 2933579018 198
105 iso_pu_bacteria 2935608549 2935611600 198
106 iso_pu_bacteria 2935616580 2935624263 198
107 iso_pu_bacteria 2935638405 2935647765 198
108 iso_pu_bacteria 2935648319 2935648978 198
109 iso_pu_bacteria 2935656913 2935656940 198
110 iso_pu_bacteria 2935665750 2935674788 198
111 iso_pu_bacteria 2935675223 2935678347 198
112 iso_pu_bacteria 2935684952 2935688227 198
113 iso_pu_bacteria 2935694250 2935698889 198
114 iso_pu_bacteria 2935713505 2935715246 198
115 iso_pu_bacteria 2935722832 2935726189 198
116 iso_pu_bacteria 2935732158 2935734065 198
117 iso_pu_bacteria 2935741537 2935743444 198
118 iso_pu_bacteria 2935750917 2935754518 198
119 iso_pu_bacteria 2935760218 2935768290 198
120 iso_pu_bacteria 2935801545 2935809340 198
121 iso_pu_bacteria 2935810662 2935819444 198
122 iso_pu_bacteria 2935819856 2935821077 198
123 iso_pu_bacteria 2935827899 2935837249 198
124 iso_pu_bacteria 2935837841 2935846508 198
125 iso_pu_bacteria 2935847175 2935850663 198
126 iso_pu_bacteria 2935855204 2935862703 198
127 iso_pu_bacteria 2935864058 2935871700 198
128 iso_pu_bacteria 2935873716 2935881933 198
129 iso_pu_bacteria 2935883170 2935888774 198
130 iso_pu_bacteria 2935916978 2935921437 198
131 iso_pu_bacteria 2935959822 2935964488 198
132 iso_pu_bacteria 2935975950 2935980792 198
133 iso_pu_bacteria 2935984226 2935989159 198
134 iso_pu_bacteria 2935992306 2935998797 198
135 iso_pu_bacteria 2936002035 2936007353 198
136 iso_pu_bacteria 2936011229 2936011887 198
137 iso_pu_bacteria 2936019824 2936027992 198
138 iso_pu_bacteria 2936028420 2936029176 198
139 iso_pu_bacteria 2936037263 2936046289 198
140 iso_pu_bacteria 2936046547 2936054870 198
141 iso_pu_bacteria 2936055302 2936061433 198
142 iso_pu_bacteria 2940556831 2940560105 198
143 iso_pu_bacteria 2941531003 2941533974 198
144 iso_pu_bacteria 2941538514 2941546927 198
145 iso_pu_bacteria 3005483717 3005490058 198
146 iso_pu_bacteria 3005506211 3005511711 198
147 iso_pu_bacteria 3005587118 3005590838 198
148 iso_pu_bacteria 3005594810 3005598284 198
149 iso_pu_bacteria 3005710791 3005713999 198
150 iso_pu_bacteria 3005718088 3005721450 198
151 iso_pu_bacteria 8006926726 8006927997 198
152 iso_pu_bacteria 8006964411 8006968713 198
153 iso_pu_bacteria 8006984368 8006990546 198
154 iso_pu_bacteria 8006994254 8006996300 198
155 iso_pu_bacteria 8016511872 8016514462 198
156 iso_pu_bacteria 8016583857 8016592990 198
157 iso_pu_bacteria 8017057580 8017061962 198
158 iso_pu_bacteria 8019576017 8019581500 198
159 iso_pu_bacteria 8019586578 8019589128 198
160 iso_pu_bacteria 8019597564 8019602103 198
161 iso_pu_bacteria 8019608314 8019616451 198
162 iso_pu_bacteria 8019619141 8019627124 198
163 iso_pu_bacteria 8019629233 8019635424 198
164 iso_pu_bacteria 8019648815 8019657334 198
165 iso_pu_bacteria 8019659431 8019663235 198
166 iso_pu_bacteria 8019668869 8019672848 198
167 iso_pu_bacteria 8019678201 8019683295 198
168 iso_pu_bacteria 8055742211 8055747343 198
169 iso_pu_bacteria 8056673599 8056678119 198
170 iso_pu_bacteria 8056681323 8056684081 198
171 iso_pu_bacteria 8056967851 8056972572 198
172 3300005563 Ga0068855_100460457 Ga0068855_1004604571 200
173 3300048918 Ga0496115_0232288 Ga0496115_0232288_463_1065 200
174 3300003659 JGI25404J52841_10031403 JGI25404J52841_100314032 201
175 3300005983 Ga0081540_1000916 Ga0081540_100091612 201
176 3300009174 Ga0105241_10062569 Ga0105241_100625692 201
177 3300010375 Ga0105239_10364518 Ga0105239_103645181 201
178 3300031507 Ga0307509_10442132 Ga0307509_104421321 201
179 3300033180 Ga0307510_10005745 Ga0307510_1000574510 201
180 3300037471 Ga0395905_0002179 Ga0395905_0002179_7488_8093 201
181 3300039437 Ga0436365_1217869 Ga0436365_1217869_25_633 201
182 3300046455 Ga0495603_0046296 Ga0495603_0046296_34_639 201
183 3300048929 Ga0496126_0461070 Ga0496126_0461070_397_1002 201
184 3300050489 nmdc:mga03683_238662_c1 nmdc:mga03683_238662_c1_95_700 201
185 3300053102 Ga0500554_090941 Ga0500554_090941_392_997 201
186 3300053150 Ga0500603_001546 Ga0500603_001546_2950_3555 201
187 3300053178 Ga0500637_0197587 Ga0500637_0197587_365_970 201
188 3300003203 JGI25406J46586_10011169 JGI25406J46586_100111693 202
189 3300003215 JGI25153J46596_10000691 JGI25153J46596_100006917 202
190 3300003215 JGI25153J46596_10020279 JGI25153J46596_100202792 202
191 3300003354 JGI25160J50197_1001658 JGI25160J50197_100165811 202
192 3300003354 JGI25160J50197_1002198 JGI25160J50197_10021986 202
193 3300003354 JGI25160J50197_1010357 JGI25160J50197_10103576 202
194 3300003659 JGI25404J52841_10002001 JGI25404J52841_100020013 202
195 3300003659 JGI25404J52841_10014633 JGI25404J52841_100146331 202
196 3300003762 Ga0055542_1011817 Ga0055542_10118171 202
197 3300003763 Ga0055529_1007273 Ga0055529_10072732 202
198 3300003794 Ga0055531_10005197 Ga0055531_100051977 202
199 3300004625 Ga0055543_1002937 Ga0055543_10029375 202
200 3300005262 Ga0065165_1000871 Ga0065165_10008718 202
201 3300005262 Ga0065165_1003314 Ga0065165_10033148 202
202 3300005262 Ga0065165_1004734 Ga0065165_10047345 202
203 3300005327 Ga0070658_10065242 Ga0070658_100652423 202
204 3300005327 Ga0070658_10080843 Ga0070658_100808432 202
205 3300005328 Ga0070676_10550678 Ga0070676_105506781 202
206 3300005329 Ga0070683_100074272 Ga0070683_1000742722 202
207 3300005329 Ga0070683_101016651 Ga0070683_1010166511 202
208 3300005331 Ga0070670_100189040 Ga0070670_1001890403 202
209 3300005334 Ga0068869_100101596 Ga0068869_1001015963 202
210 3300005334 Ga0068869_100266656 Ga0068869_1002666562 202
211 3300005334 Ga0068869_100510706 Ga0068869_1005107061 202
212 3300005335 Ga0070666_10143913 Ga0070666_101439133 202
213 3300005336 Ga0070680_100021259 Ga0070680_1000212594 202
214 3300005336 Ga0070680_100194989 Ga0070680_1001949891 202
215 3300005337 Ga0070682_100207748 Ga0070682_1002077482 202
216 3300005338 Ga0068868_100054226 Ga0068868_1000542264 202
217 3300005338 Ga0068868_100100372 Ga0068868_1001003721 202
218 3300005338 Ga0068868_100940573 Ga0068868_1009405731 202
219 3300005339 Ga0070660_100541367 Ga0070660_1005413671 202
220 3300005340 Ga0070689_100255623 Ga0070689_1002556232 202
221 3300005340 Ga0070689_100341143 Ga0070689_1003411431 202
222 3300005344 Ga0070661_100301297 Ga0070661_1003012972 202
223 3300005345 Ga0070692_10582204 Ga0070692_105822041 202
224 3300005347 Ga0070668_100028639 Ga0070668_1000286393 202
225 3300005347 Ga0070668_101064669 Ga0070668_1010646691 202
226 3300005353 Ga0070669_100135775 Ga0070669_1001357753 202
227 3300005353 Ga0070669_100348404 Ga0070669_1003484041 202
228 3300005353 Ga0070669_100474224 Ga0070669_1004742242 202
229 3300005356 Ga0070674_100131524 Ga0070674_1001315243 202
230 3300005356 Ga0070674_100236283 Ga0070674_1002362832 202
231 3300005356 Ga0070674_100607843 Ga0070674_1006078432 202
232 3300005364 Ga0070673_100320170 Ga0070673_1003201703 202
233 3300005364 Ga0070673_100890453 Ga0070673_1008904531 202
234 3300005366 Ga0070659_100210868 Ga0070659_1002108683 202
235 3300005366 Ga0070659_100269750 Ga0070659_1002697502 202
236 3300005366 Ga0070659_100730734 Ga0070659_1007307341 202
237 3300005367 Ga0070667_100203164 Ga0070667_1002031643 202
238 3300005367 Ga0070667_100322355 Ga0070667_1003223553 202
239 3300005367 Ga0070667_100496308 Ga0070667_1004963082 202
240 3300005434 Ga0070709_10125065 Ga0070709_101250651 202
241 3300005436 Ga0070713_100021265 Ga0070713_1000212655 202
242 3300005437 Ga0070710_10008327 Ga0070710_100083273 202
243 3300005439 Ga0070711_100008935 Ga0070711_1000089353 202
244 3300005439 Ga0070711_100203872 Ga0070711_1002038722 202
245 3300005445 Ga0070708_100493821 Ga0070708_1004938211 202
246 3300005455 Ga0070663_100034664 Ga0070663_1000346644 202
247 3300005455 Ga0070663_100045007 Ga0070663_1000450072 202
248 3300005455 Ga0070663_100070219 Ga0070663_1000702193 202
249 3300005455 Ga0070663_100084859 Ga0070663_1000848593 202
250 3300005455 Ga0070663_100119176 Ga0070663_1001191761 202
251 3300005455 Ga0070663_100148880 Ga0070663_1001488803 202
252 3300005455 Ga0070663_100154936 Ga0070663_1001549363 202
253 3300005455 Ga0070663_100221808 Ga0070663_1002218082 202
254 3300005455 Ga0070663_100688911 Ga0070663_1006889111 202
255 3300005456 Ga0070678_100055122 Ga0070678_1000551224 202
256 3300005456 Ga0070678_100156851 Ga0070678_1001568512 202
257 3300005456 Ga0070678_100289234 Ga0070678_1002892342 202
258 3300005457 Ga0070662_100054866 Ga0070662_1000548664 202
259 3300005457 Ga0070662_100125614 Ga0070662_1001256143 202
260 3300005457 Ga0070662_100444034 Ga0070662_1004440342 202
261 3300005458 Ga0070681_10141978 Ga0070681_101419784 202
262 3300005459 Ga0068867_100042809 Ga0068867_1000428095 202
263 3300005471 Ga0070698_100128545 Ga0070698_1001285452 202
264 3300005471 Ga0070698_100853208 Ga0070698_1008532081 202
265 3300005530 Ga0070679_100025377 Ga0070679_1000253773 202
266 3300005530 Ga0070679_100155125 Ga0070679_1001551253 202
267 3300005530 Ga0070679_100164929 Ga0070679_1001649291 202
268 3300005535 Ga0070684_100043252 Ga0070684_1000432523 202
269 3300005535 Ga0070684_100044414 Ga0070684_1000444145 202
270 3300005539 Ga0068853_100212051 Ga0068853_1002120513 202
271 3300005539 Ga0068853_100235696 Ga0068853_1002356963 202
272 3300005539 Ga0068853_101133520 Ga0068853_1011335201 202
273 3300005543 Ga0070672_100289025 Ga0070672_1002890252 202
274 3300005544 Ga0070686_100516978 Ga0070686_1005169781 202
275 3300005546 Ga0070696_100049519 Ga0070696_1000495193 202
276 3300005548 Ga0070665_100015770 Ga0070665_1000157703 202
277 3300005548 Ga0070665_100031231 Ga0070665_1000312313 202
278 3300005548 Ga0070665_100058777 Ga0070665_1000587774 202
279 3300005548 Ga0070665_100154528 Ga0070665_1001545284 202
280 3300005548 Ga0070665_100216220 Ga0070665_1002162202 202
281 3300005548 Ga0070665_100639881 Ga0070665_1006398811 202
282 3300005563 Ga0068855_100031798 Ga0068855_1000317984 202
283 3300005563 Ga0068855_100084909 Ga0068855_1000849091 202
284 3300005563 Ga0068855_100248640 Ga0068855_1002486402 202
285 3300005578 Ga0068854_100345821 Ga0068854_1003458212 202
286 3300005578 Ga0068854_100480975 Ga0068854_1004809751 202
287 3300005614 Ga0068856_100118716 Ga0068856_1001187163 202
288 3300005615 Ga0070702_100161837 Ga0070702_1001618372 202
289 3300005616 Ga0068852_100340861 Ga0068852_1003408612 202
290 3300005616 Ga0068852_100425356 Ga0068852_1004253561 202
291 3300005617 Ga0068859_100090404 Ga0068859_1000904044 202
292 3300005617 Ga0068859_100248610 Ga0068859_1002486103 202
293 3300005618 Ga0068864_100171668 Ga0068864_1001716683 202
294 3300005618 Ga0068864_100291493 Ga0068864_1002914933 202
295 3300005719 Ga0068861_100066340 Ga0068861_1000663405 202
296 3300005719 Ga0068861_100087457 Ga0068861_1000874573 202
297 3300005719 Ga0068861_101574326 Ga0068861_1015743261 202
298 3300005842 Ga0068858_100192416 Ga0068858_1001924162 202
299 3300005842 Ga0068858_100331943 Ga0068858_1003319433 202
300 3300005842 Ga0068858_100652876 Ga0068858_1006528761 202
301 3300005843 Ga0068860_100000268 Ga0068860_10000026872 202
302 3300005843 Ga0068860_100129164 Ga0068860_1001291641 202
303 3300005843 Ga0068860_100209751 Ga0068860_1002097513 202
304 3300005843 Ga0068860_100677745 Ga0068860_1006777452 202
305 3300005844 Ga0068862_100120992 Ga0068862_1001209923 202
306 3300005844 Ga0068862_100157004 Ga0068862_1001570044 202
307 3300005844 Ga0068862_100248753 Ga0068862_1002487533 202
308 3300005844 Ga0068862_101063622 Ga0068862_1010636221 202
309 3300005937 Ga0081455_10015453 Ga0081455_100154536 202
310 3300005937 Ga0081455_10016132 Ga0081455_100161325 202
311 3300005937 Ga0081455_10046470 Ga0081455_100464702 202
312 3300005981 Ga0081538_10040658 Ga0081538_100406583 202
313 3300005981 Ga0081538_10086463 Ga0081538_100864633 202
314 3300005983 Ga0081540_1001739 Ga0081540_100173913 202
315 3300005983 Ga0081540_1002076 Ga0081540_100207615 202
316 3300005983 Ga0081540_1005549 Ga0081540_10055496 202
317 3300005983 Ga0081540_1008801 Ga0081540_10088015 202
318 3300005983 Ga0081540_1010073 Ga0081540_10100736 202
319 3300005983 Ga0081540_1013619 Ga0081540_10136196 202
320 3300005983 Ga0081540_1031349 Ga0081540_10313495 202
321 3300005983 Ga0081540_1037846 Ga0081540_10378463 202
322 3300005983 Ga0081540_1042536 Ga0081540_10425363 202
323 3300005983 Ga0081540_1092709 Ga0081540_10927091 202
324 3300005985 Ga0081539_10000231 Ga0081539_10000231115 202
325 3300005985 Ga0081539_10064938 Ga0081539_100649383 202
326 3300006028 Ga0070717_10839531 Ga0070717_108395311 202
327 3300006038 Ga0075365_10012972 Ga0075365_100129724 202
328 3300006038 Ga0075365_10021295 Ga0075365_100212954 202
329 3300006038 Ga0075365_10024860 Ga0075365_100248602 202
330 3300006038 Ga0075365_10038356 Ga0075365_100383565 202
331 3300006038 Ga0075365_10122701 Ga0075365_101227012 202
332 3300006038 Ga0075365_10150914 Ga0075365_101509143 202
333 3300006038 Ga0075365_10195036 Ga0075365_101950362 202
334 3300006042 Ga0075368_10048377 Ga0075368_100483771 202
335 3300006042 Ga0075368_10177735 Ga0075368_101777352 202
336 3300006048 Ga0075363_100002157 Ga0075363_1000021576 202
337 3300006051 Ga0075364_10128577 Ga0075364_101285773 202
338 3300006058 Ga0075432_10157205 Ga0075432_101572052 202
339 3300006175 Ga0070712_100001161 Ga0070712_10000116114 202
340 3300006175 Ga0070712_100101015 Ga0070712_1001010154 202
341 3300006178 Ga0075367_10051638 Ga0075367_100516382 202
342 3300006178 Ga0075367_10107241 Ga0075367_101072413 202
343 3300006178 Ga0075367_10126318 Ga0075367_101263181 202
344 3300006178 Ga0075367_10167700 Ga0075367_101677003 202
345 3300006178 Ga0075367_10219603 Ga0075367_102196032 202
346 3300006178 Ga0075367_10242799 Ga0075367_102427992 202
347 3300006186 Ga0075369_10021279 Ga0075369_100212794 202
348 3300006195 Ga0075366_10011107 Ga0075366_100111073 202
349 3300006195 Ga0075366_10012033 Ga0075366_100120334 202
350 3300006195 Ga0075366_10120711 Ga0075366_101207112 202
351 3300006195 Ga0075366_10298344 Ga0075366_102983442 202
352 3300006237 Ga0097621_100271359 Ga0097621_1002713593 202
353 3300006353 Ga0075370_10020470 Ga0075370_100204703 202
354 3300006353 Ga0075370_10022532 Ga0075370_100225325 202
355 3300006353 Ga0075370_10040894 Ga0075370_100408941 202
356 3300006353 Ga0075370_10070591 Ga0075370_100705913 202
357 3300006358 Ga0068871_100178148 Ga0068871_1001781481 202
358 3300006358 Ga0068871_100527984 Ga0068871_1005279842 202
359 3300006852 Ga0075433_10334199 Ga0075433_103341992 202
360 3300006881 Ga0068865_100035885 Ga0068865_1000358853 202
361 3300006881 Ga0068865_100157128 Ga0068865_1001571282 202
362 3300006931 Ga0097620_100090405 Ga0097620_1000904054 202
363 3300006931 Ga0097620_100248610 Ga0097620_1002486102 202
364 3300006941 Ga0099825_1041212 Ga0099825_10412122 202
365 3300006942 Ga0099824_1007084 Ga0099824_100708413 202
366 3300006943 Ga0099822_1001392 Ga0099822_100139215 202
367 3300007265 Ga0099794_10013241 Ga0099794_100132411 202
368 3300007265 Ga0099794_10067899 Ga0099794_100678991 202
369 3300007265 Ga0099794_10248759 Ga0099794_102487591 202
370 3300007788 Ga0099795_10041394 Ga0099795_100413942 202
371 3300007788 Ga0099795_10287178 Ga0099795_102871781 202
372 3300009093 Ga0105240_10066371 Ga0105240_100663713 202
373 3300009094 Ga0111539_10183852 Ga0111539_101838523 202
374 3300009094 Ga0111539_10640908 Ga0111539_106409081 202
375 3300009098 Ga0105245_10014670 Ga0105245_100146705 202
376 3300009098 Ga0105245_10963258 Ga0105245_109632582 202
377 3300009101 Ga0105247_10019050 Ga0105247_100190505 202
378 3300009101 Ga0105247_10105203 Ga0105247_101052032 202
379 3300009101 Ga0105247_10149644 Ga0105247_101496442 202
380 3300009147 Ga0114129_10739095 Ga0114129_107390952 202
381 3300009148 Ga0105243_10030714 Ga0105243_100307143 202
382 3300009148 Ga0105243_10113943 Ga0105243_101139433 202
383 3300009176 Ga0105242_10127131 Ga0105242_101271312 202
384 3300009176 Ga0105242_10203945 Ga0105242_102039453 202
385 3300009177 Ga0105248_10064647 Ga0105248_100646472 202
386 3300009177 Ga0105248_10097284 Ga0105248_100972842 202
387 3300009177 Ga0105248_10123377 Ga0105248_101233773 202
388 3300009177 Ga0105248_10715832 Ga0105248_107158322 202
389 3300009545 Ga0105237_10108665 Ga0105237_101086652 202
390 3300009545 Ga0105237_10148136 Ga0105237_101481362 202
391 3300009545 Ga0105237_10163537 Ga0105237_101635373 202
392 3300009545 Ga0105237_10469951 Ga0105237_104699511 202
393 3300009545 Ga0105237_10679482 Ga0105237_106794821 202
394 3300009551 Ga0105238_10073340 Ga0105238_100733406 202
395 3300009551 Ga0105238_10140887 Ga0105238_101408873 202
396 3300009551 Ga0105238_10643534 Ga0105238_106435342 202
397 3300009551 Ga0105238_11214917 Ga0105238_112149171 202
398 3300009553 Ga0105249_10135471 Ga0105249_101354712 202
399 3300010159 Ga0099796_10010834 Ga0099796_100108343 202
400 3300010159 Ga0099796_10035897 Ga0099796_100358973 202
401 3300010159 Ga0099796_10060007 Ga0099796_100600072 202
402 3300010159 Ga0099796_10099381 Ga0099796_100993811 202
403 3300010159 Ga0099796_10198276 Ga0099796_101982761 202
404 3300010375 Ga0105239_10095851 Ga0105239_100958513 202
405 3300010375 Ga0105239_10195349 Ga0105239_101953493 202
406 3300010375 Ga0105239_10221900 Ga0105239_102219003 202
407 3300010375 Ga0105239_10227269 Ga0105239_102272693 202
408 3300010375 Ga0105239_10846048 Ga0105239_108460481 202
409 3300011119 Ga0105246_10021251 Ga0105246_100212514 202
410 3300011119 Ga0105246_10033786 Ga0105246_100337863 202
411 3300011119 Ga0105246_10253100 Ga0105246_102531003 202
412 3300013104 Ga0157370_10019096 Ga0157370_100190964 202
413 3300013104 Ga0157370_10424671 Ga0157370_104246713 202
414 3300013104 Ga0157370_10778278 Ga0157370_107782781 202
415 3300013105 Ga0157369_10006177 Ga0157369_100061776 202
416 3300013296 Ga0157374_10048968 Ga0157374_100489684 202
417 3300013296 Ga0157374_10063854 Ga0157374_100638547 202
418 3300013297 Ga0157378_10010133 Ga0157378_100101337 202
419 3300013297 Ga0157378_10132303 Ga0157378_101323032 202
420 3300013297 Ga0157378_10836249 Ga0157378_108362492 202
421 3300013306 Ga0163162_10039097 Ga0163162_100390973 202
422 3300013306 Ga0163162_10287707 Ga0163162_102877073 202
423 3300013306 Ga0163162_10416811 Ga0163162_104168111 202
424 3300013306 Ga0163162_10493363 Ga0163162_104933634 202
425 3300013306 Ga0163162_10508501 Ga0163162_105085013 202
426 3300013306 Ga0163162_10549362 Ga0163162_105493621 202
427 3300013308 Ga0157375_10094493 Ga0157375_100944934 202
428 3300013308 Ga0157375_10218511 Ga0157375_102185113 202
429 3300013308 Ga0157375_10258013 Ga0157375_102580133 202
430 3300013308 Ga0157375_11516640 Ga0157375_115166401 202
431 3300014325 Ga0163163_10078767 Ga0163163_100787676 202
432 3300014325 Ga0163163_10138716 Ga0163163_101387162 202
433 3300014325 Ga0163163_10382429 Ga0163163_103824292 202
434 3300014325 Ga0163163_10475031 Ga0163163_104750311 202
435 3300014325 Ga0163163_10699508 Ga0163163_106995082 202
436 3300014326 Ga0157380_10114271 Ga0157380_101142714 202
437 3300014326 Ga0157380_10252682 Ga0157380_102526823 202
438 3300014326 Ga0157380_10445725 Ga0157380_104457251 202
439 3300014968 Ga0157379_10161903 Ga0157379_101619032 202
440 3300014968 Ga0157379_10224480 Ga0157379_102244802 202
441 3300014968 Ga0157379_10272655 Ga0157379_102726553 202
442 3300014968 Ga0157379_10464677 Ga0157379_104646771 202
443 3300014968 Ga0157379_10550558 Ga0157379_105505582 202
444 3300014969 Ga0157376_10009717 Ga0157376_100097172 202
445 3300014969 Ga0157376_10226114 Ga0157376_102261142 202
446 3300017792 Ga0163161_10492539 Ga0163161_104925391 202
447 3300017792 Ga0163161_10606418 Ga0163161_106064182 202
448 3300021320 Ga0214544_1025681 Ga0214544_10256812 202
449 3300025245 Ga0207425_1006603 Ga0207425_10066033 202
450 3300025253 Ga0209677_100646 Ga0209677_1006467 202
451 3300025254 Ga0209148_1000493 Ga0209148_100049338 202
452 3300025261 Ga0209233_1002669 Ga0209233_10026693 202
453 3300025261 Ga0209233_1005867 Ga0209233_10058676 202
454 3300025261 Ga0209233_1025979 Ga0209233_10259792 202
455 3300025272 Ga0209455_1001622 Ga0209455_10016226 202
456 3300025294 Ga0209025_1072018 Ga0209025_10720182 202
457 3300025295 Ga0209564_1000405 Ga0209564_10004057 202
458 3300025295 Ga0209564_1004955 Ga0209564_10049554 202
459 3300025295 Ga0209564_1005132 Ga0209564_10051329 202
460 3300025297 Ga0209758_1000100 Ga0209758_1000100153 202
461 3300025297 Ga0209758_1002189 Ga0209758_100218913 202
462 3300025297 Ga0209758_1003333 Ga0209758_10033333 202
463 3300025297 Ga0209758_1003494 Ga0209758_10034946 202
464 3300025297 Ga0209758_1003786 Ga0209758_10037861 202
465 3300025297 Ga0209758_1011629 Ga0209758_10116296 202
466 3300025299 Ga0209256_1007360 Ga0209256_10073607 202
467 3300025302 Ga0207426_1000382 Ga0207426_100038250 202
468 3300025302 Ga0207426_1001403 Ga0207426_10014032 202
469 3300025302 Ga0207426_1069001 Ga0207426_10690012 202
470 3300025304 Ga0209257_1001443 Ga0209257_100144313 202
471 3300025304 Ga0209257_1023874 Ga0209257_10238742 202
472 3300025315 Ga0207697_10056760 Ga0207697_100567603 202
473 3300025321 Ga0207656_10124718 Ga0207656_101247181 202
474 3300025885 Ga0207653_10077242 Ga0207653_100772421 202
475 3300025898 Ga0207692_10009740 Ga0207692_100097403 202
476 3300025899 Ga0207642_10258729 Ga0207642_102587292 202
477 3300025899 Ga0207642_10449332 Ga0207642_104493321 202
478 3300025900 Ga0207710_10080913 Ga0207710_100809132 202
479 3300025900 Ga0207710_10084640 Ga0207710_100846402 202
480 3300025900 Ga0207710_10241106 Ga0207710_102411061 202
481 3300025901 Ga0207688_10020113 Ga0207688_100201134 202
482 3300025901 Ga0207688_10219745 Ga0207688_102197452 202
483 3300025903 Ga0207680_10351041 Ga0207680_103510411 202
484 3300025906 Ga0207699_10002755 Ga0207699_100027553 202
485 3300025908 Ga0207643_10121909 Ga0207643_101219091 202
486 3300025909 Ga0207705_10108138 Ga0207705_101081381 202
487 3300025909 Ga0207705_10132107 Ga0207705_101321073 202
488 3300025911 Ga0207654_10026295 Ga0207654_100262951 202
489 3300025912 Ga0207707_10010734 Ga0207707_100107343 202
490 3300025912 Ga0207707_10057302 Ga0207707_100573023 202
491 3300025913 Ga0207695_10063748 Ga0207695_100637482 202
492 3300025913 Ga0207695_10106347 Ga0207695_101063474 202
493 3300025914 Ga0207671_10094373 Ga0207671_100943732 202
494 3300025914 Ga0207671_10155518 Ga0207671_101555183 202
495 3300025915 Ga0207693_10008054 Ga0207693_100080544 202
496 3300025915 Ga0207693_10064517 Ga0207693_100645174 202
497 3300025915 Ga0207693_10126731 Ga0207693_101267313 202
498 3300025916 Ga0207663_10001581 Ga0207663_100015814 202
499 3300025917 Ga0207660_10072909 Ga0207660_100729092 202
500 3300025917 Ga0207660_10217537 Ga0207660_102175371 202
501 3300025919 Ga0207657_10073860 Ga0207657_100738604 202
502 3300025919 Ga0207657_10346113 Ga0207657_103461132 202
503 3300025920 Ga0207649_10272214 Ga0207649_102722142 202
504 3300025921 Ga0207652_10007801 Ga0207652_100078018 202
505 3300025921 Ga0207652_10120967 Ga0207652_101209673 202
506 3300025924 Ga0207694_10059861 Ga0207694_100598614 202
507 3300025924 Ga0207694_10136325 Ga0207694_101363251 202
508 3300025925 Ga0207650_10348803 Ga0207650_103488031 202
509 3300025927 Ga0207687_10017344 Ga0207687_100173445 202
510 3300025927 Ga0207687_10051048 Ga0207687_100510484 202
511 3300025928 Ga0207700_10072458 Ga0207700_100724583 202
512 3300025928 Ga0207700_10579547 Ga0207700_105795471 202
513 3300025929 Ga0207664_10065254 Ga0207664_100652543 202
514 3300025931 Ga0207644_10544380 Ga0207644_105443801 202
515 3300025932 Ga0207690_10297683 Ga0207690_102976832 202
516 3300025932 Ga0207690_10784710 Ga0207690_107847101 202
517 3300025933 Ga0207706_10032326 Ga0207706_100323263 202
518 3300025933 Ga0207706_10109322 Ga0207706_101093224 202
519 3300025933 Ga0207706_10125503 Ga0207706_101255033 202
520 3300025933 Ga0207706_10149026 Ga0207706_101490263 202
521 3300025933 Ga0207706_10184663 Ga0207706_101846633 202
522 3300025934 Ga0207686_10590643 Ga0207686_105906431 202
523 3300025935 Ga0207709_10125907 Ga0207709_101259073 202
524 3300025935 Ga0207709_10264905 Ga0207709_102649052 202
525 3300025936 Ga0207670_10364995 Ga0207670_103649951 202
526 3300025937 Ga0207669_10056135 Ga0207669_100561352 202
527 3300025938 Ga0207704_10065332 Ga0207704_100653323 202
528 3300025938 Ga0207704_10956968 Ga0207704_109569681 202
529 3300025940 Ga0207691_10021301 Ga0207691_100213013 202
530 3300025940 Ga0207691_10165129 Ga0207691_101651292 202
531 3300025941 Ga0207711_10156486 Ga0207711_101564862 202
532 3300025941 Ga0207711_10189033 Ga0207711_101890333 202
533 3300025942 Ga0207689_10013204 Ga0207689_100132045 202
534 3300025942 Ga0207689_10023880 Ga0207689_100238806 202
535 3300025944 Ga0207661_10025924 Ga0207661_100259244 202
536 3300025944 Ga0207661_10165195 Ga0207661_101651953 202
537 3300025945 Ga0207679_11197528 Ga0207679_111975281 202
538 3300025949 Ga0207667_10013254 Ga0207667_100132541 202
539 3300025949 Ga0207667_10118180 Ga0207667_101181803 202
540 3300025949 Ga0207667_10542128 Ga0207667_105421282 202
541 3300025961 Ga0207712_10127790 Ga0207712_101277903 202
542 3300025961 Ga0207712_10186502 Ga0207712_101865023 202
543 3300025972 Ga0207668_10009673 Ga0207668_100096736 202
544 3300025972 Ga0207668_10106640 Ga0207668_101066402 202
545 3300025972 Ga0207668_10357679 Ga0207668_103576792 202
546 3300025972 Ga0207668_10682499 Ga0207668_106824991 202
547 3300025981 Ga0207640_10312453 Ga0207640_103124531 202
548 3300025981 Ga0207640_10846516 Ga0207640_108465161 202
549 3300025986 Ga0207658_10066884 Ga0207658_100668844 202
550 3300025986 Ga0207658_10250446 Ga0207658_102504463 202
551 3300026023 Ga0207677_10082131 Ga0207677_100821312 202
552 3300026023 Ga0207677_10641405 Ga0207677_106414051 202
553 3300026035 Ga0207703_10008946 Ga0207703_100089466 202
554 3300026035 Ga0207703_10254627 Ga0207703_102546272 202
555 3300026035 Ga0207703_10529440 Ga0207703_105294403 202
556 3300026041 Ga0207639_10098306 Ga0207639_100983063 202
557 3300026067 Ga0207678_10015643 Ga0207678_100156436 202
558 3300026067 Ga0207678_10051871 Ga0207678_100518713 202
559 3300026067 Ga0207678_10055302 Ga0207678_100553023 202
560 3300026067 Ga0207678_10065658 Ga0207678_100656586 202
561 3300026067 Ga0207678_10067294 Ga0207678_100672946 202
562 3300026067 Ga0207678_10159589 Ga0207678_101595891 202
563 3300026067 Ga0207678_10314147 Ga0207678_103141472 202
564 3300026067 Ga0207678_10318789 Ga0207678_103187893 202
565 3300026075 Ga0207708_10452967 Ga0207708_104529671 202
566 3300026078 Ga0207702_10220882 Ga0207702_102208822 202
567 3300026088 Ga0207641_10387828 Ga0207641_103878282 202
568 3300026089 Ga0207648_10243318 Ga0207648_102433183 202
569 3300026095 Ga0207676_10073218 Ga0207676_100732183 202
570 3300026116 Ga0207674_10134737 Ga0207674_101347373 202
571 3300026116 Ga0207674_10183351 Ga0207674_101833513 202
572 3300026116 Ga0207674_10336530 Ga0207674_103365301 202
573 3300026118 Ga0207675_100045559 Ga0207675_1000455595 202
574 3300026118 Ga0207675_100091987 Ga0207675_1000919875 202
575 3300026118 Ga0207675_100368827 Ga0207675_1003688271 202
576 3300026118 Ga0207675_100399297 Ga0207675_1003992971 202
577 3300026121 Ga0207683_10019629 Ga0207683_100196295 202
578 3300026121 Ga0207683_10038464 Ga0207683_100384645 202
579 3300026121 Ga0207683_10173140 Ga0207683_101731403 202
580 3300026121 Ga0207683_10278171 Ga0207683_102781712 202
581 3300027296 Ga0209389_1000092 Ga0209389_100009258 202
582 3300027357 Ga0209589_1000023 Ga0209589_1000023168 202
583 3300027357 Ga0209589_1000115 Ga0209589_100011558 202
584 3300027361 Ga0209489_100032 Ga0209489_100032168 202
585 3300027361 Ga0209489_100340 Ga0209489_10034058 202
586 3300027363 Ga0209700_100040 Ga0209700_100040168 202
587 3300027907 Ga0207428_10264314 Ga0207428_102643142 202
588 3300028379 Ga0268266_10004462 Ga0268266_1000446210 202
589 3300028379 Ga0268266_10034740 Ga0268266_100347403 202
590 3300028379 Ga0268266_10043378 Ga0268266_100433783 202
591 3300028379 Ga0268266_10087693 Ga0268266_100876933 202
592 3300028379 Ga0268266_10428048 Ga0268266_104280483 202
593 3300028379 Ga0268266_10468815 Ga0268266_104688152 202
594 3300028379 Ga0268266_10513389 Ga0268266_105133892 202
595 3300028379 Ga0268266_10633086 Ga0268266_106330862 202
596 3300028379 Ga0268266_10790701 Ga0268266_107907012 202
597 3300028380 Ga0268265_11155257 Ga0268265_111552571 202
598 3300028381 Ga0268264_10000084 Ga0268264_10000084168 202
599 3300028381 Ga0268264_10104692 Ga0268264_101046924 202
600 3300028381 Ga0268264_10175815 Ga0268264_101758153 202
601 3300028573 Ga0265334_10034037 Ga0265334_100340373 202
602 3300028786 Ga0307517_10000369 Ga0307517_1000036930 202
603 3300031238 Ga0265332_10126114 Ga0265332_101261142 202
604 3300031250 Ga0265331_10079078 Ga0265331_100790783 202
605 3300031456 Ga0307513_10164848 Ga0307513_101648481 202
606 3300031456 Ga0307513_10331853 Ga0307513_103318532 202
607 3300031616 Ga0307508_10000010 Ga0307508_10000010235 202
608 3300031616 Ga0307508_10010103 Ga0307508_100101034 202
609 3300031711 Ga0265314_10003900 Ga0265314_100039009 202
610 3300031730 Ga0307516_10162917 Ga0307516_101629173 202
611 3300031730 Ga0307516_10349984 Ga0307516_103499842 202
612 3300031852 Ga0307410_10504157 Ga0307410_105041571 202
613 3300031901 Ga0307406_11167157 Ga0307406_111671571 202
614 3300031911 Ga0307412_10288433 Ga0307412_102884331 202
615 3300031995 Ga0307409_100928846 Ga0307409_1009288462 202
616 3300031995 Ga0307409_100965963 Ga0307409_1009659631 202
617 3300032002 Ga0307416_100936465 Ga0307416_1009364652 202
618 3300032005 Ga0307411_10473415 Ga0307411_104734152 202
619 3300032126 Ga0307415_100018822 Ga0307415_1000188225 202
620 3300032126 Ga0307415_100746077 Ga0307415_1007460771 202
621 3300033180 Ga0307510_10000998 Ga0307510_1000099828 202
622 3300033180 Ga0307510_10002011 Ga0307510_100020117 202
623 3300033180 Ga0307510_10129640 Ga0307510_101296401 202
624 3300035111 Ga0373923_0010411 Ga0373923_0010411_1053_1661 202
625 3300035113 Ga0373936_0018999 Ga0373936_0018999_1394_2002 202
626 3300035113 Ga0373936_0043504 Ga0373936_0043504_134_742 202
627 3300035114 Ga0373939_0195921 Ga0373939_0195921_60_668 202
628 3300035117 Ga0373953_0111555 Ga0373953_0111555_222_830 202
629 3300035118 Ga0373954_0000067 Ga0373954_0000067_3570_4178 202
630 3300035119 Ga0373956_0006475 Ga0373956_0006475_3854_4474 202
631 3300035120 Ga0373957_0015776 Ga0373957_0015776_1274_1882 202
632 3300035171 Ga0373946_0003822 Ga0373946_0003822_745_1353 202
633 3300035172 Ga0373955_0005976 Ga0373955_0005976_256_864 202
634 3300035242 Ga0373962_0092184 Ga0373962_0092184_283_891 202
635 3300035410 Ga0373924_0038716 Ga0373924_0038716_376_984 202
636 3300035724 Ga0373933_0004250 Ga0373933_0004250_6460_7068 202
637 3300035725 Ga0373947_0036502 Ga0373947_0036502_2194_2802 202
638 3300035725 Ga0373947_0160643 Ga0373947_0160643_761_1369 202
639 3300035725 Ga0373947_0164024 Ga0373947_0164024_736_1344 202
640 3300036401 Ga0373937_0364651 Ga0373937_0364651_510_1118 202
641 3300036459 Ga0372808_027101 Ga0372808_027101_127_735 202
642 3300037068 Ga0373925_0003101 Ga0373925_0003101_7296_7904 202
643 3300037068 Ga0373925_0030207 Ga0373925_0030207_1606_2214 202
644 3300037068 Ga0373925_0351103 Ga0373925_0351103_388_996 202
645 3300037418 Ga0395900_0694763 Ga0395900_0694763_195_803 202
646 3300037466 Ga0395898_0195553 Ga0395898_0195553_284_898 202
647 3300037466 Ga0395898_0530459 Ga0395898_0530459_33_641 202
648 3300037471 Ga0395905_0172000 Ga0395905_0172000_1091_1699 202
649 3300037471 Ga0395905_0268508 Ga0395905_0268508_393_1001 202
650 3300041413 Ga0439465_0162219 Ga0439465_0162219_164_772 202
651 3300041443 Ga0451789_1137804 Ga0451789_1137804_21_629 202
652 3300041452 Ga0451793_0679340 Ga0451793_0679340_208_816 202
653 3300041458 Ga0451798_0910788 Ga0451798_0910788_394_1002 202
654 3300041486 Ga0451807_2243169 Ga0451807_2243169_26_634 202
655 3300044693 Ga0466961_0000506 Ga0466961_0000506_1866_2474 202
656 3300044706 Ga0466964_0030385 Ga0466964_0030385_17_781 202
657 3300044842 Ga0466957_0092607 Ga0466957_0092607_219_833 202
658 3300045049 Ga0466959_0030081 Ga0466959_0030081_2162_2770 202
659 3300045976 Ga0466967_0340354 Ga0466967_0340354_681_1289 202
660 3300046455 Ga0495603_0038328 Ga0495603_0038328_2120_2728 202
661 3300046455 Ga0495603_0098320 Ga0495603_0098320_820_1428 202
662 3300046455 Ga0495603_0188149 Ga0495603_0188149_80_688 202
663 3300046455 Ga0495603_0189408 Ga0495603_0189408_255_863 202
664 3300046459 Ga0495629_0000398 Ga0495629_0000398_15212_15820 202
665 3300046459 Ga0495629_0016283 Ga0495629_0016283_3822_4430 202
666 3300046460 Ga0495638_0007240 Ga0495638_0007240_6477_7085 202
667 3300046460 Ga0495638_0022505 Ga0495638_0022505_2637_3245 202
668 3300046462 Ga0495651_0004166 Ga0495651_0004166_10232_10840 202
669 3300046463 Ga0495653_0000598 Ga0495653_0000598_17707_18315 202
670 3300046472 Ga0495580_0026091 Ga0495580_0026091_770_1378 202
671 3300046473 Ga0495582_0186018 Ga0495582_0186018_90_698 202
672 3300046474 Ga0495605_0068749 Ga0495605_0068749_592_1200 202
673 3300046474 Ga0495605_0293865 Ga0495605_0293865_18_626 202
674 3300046475 Ga0495639_0010545 Ga0495639_0010545_2216_2824 202
675 3300046475 Ga0495639_0220044 Ga0495639_0220044_145_753 202
676 3300046476 Ga0495662_0207931 Ga0495662_0207931_266_874 202
677 3300046477 Ga0495664_0020455 Ga0495664_0020455_2464_3072 202
678 3300046491 Ga0495584_0313628 Ga0495584_0313628_79_687 202
679 3300046499 Ga0495594_0254805 Ga0495594_0254805_75_683 202
680 3300046499 Ga0495594_0264593 Ga0495594_0264593_41_649 202
681 3300046500 Ga0495596_0109380 Ga0495596_0109380_11_619 202
682 3300046501 Ga0495607_0048527 Ga0495607_0048527_667_1275 202
683 3300046506 Ga0495583_0048377 Ga0495583_0048377_1251_1859 202
684 3300046507 Ga0495606_0023364 Ga0495606_0023364_2600_3208 202
685 3300046507 Ga0495606_0230957 Ga0495606_0230957_132_740 202
686 3300046511 Ga0495608_0004383 Ga0495608_0004383_1990_2598 202
687 3300046512 Ga0495610_0148789 Ga0495610_0148789_249_857 202
688 3300046513 Ga0495616_0168984 Ga0495616_0168984_291_899 202
689 3300046515 Ga0495620_0026601 Ga0495620_0026601_1837_2445 202
690 3300046515 Ga0495620_0060123 Ga0495620_0060123_904_1512 202
691 3300046515 Ga0495620_0196667 Ga0495620_0196667_62_670 202
692 3300046518 Ga0495631_0052237 Ga0495631_0052237_800_1408 202
693 3300046520 Ga0495637_0096569 Ga0495637_0096569_199_807 202
694 3300046522 Ga0495643_0041821 Ga0495643_0041821_181_789 202
695 3300046524 Ga0495648_0030640 Ga0495648_0030640_2490_3098 202
696 3300046524 Ga0495648_0083471 Ga0495648_0083471_896_1504 202
697 3300046524 Ga0495648_0090975 Ga0495648_0090975_454_1062 202
698 3300046524 Ga0495648_0146960 Ga0495648_0146960_463_1071 202
699 3300046526 Ga0495666_0021904 Ga0495666_0021904_583_1191 202
700 3300046529 Ga0495652_0023703 Ga0495652_0023703_416_1024 202
701 3300046529 Ga0495652_0139490 Ga0495652_0139490_95_703 202
702 3300046530 Ga0495654_0053652 Ga0495654_0053652_118_726 202
703 3300046533 Ga0495640_0009889 Ga0495640_0009889_650_1258 202
704 3300046533 Ga0495640_0011188 Ga0495640_0011188_6143_6751 202
705 3300046533 Ga0495640_0132873 Ga0495640_0132873_956_1564 202
706 3300046536 Ga0495587_0097443 Ga0495587_0097443_223_831 202
707 3300046537 Ga0495598_0097985 Ga0495598_0097985_163_771 202
708 3300046538 Ga0495609_0017505 Ga0495609_0017505_184_792 202
709 3300046542 Ga0495597_0111452 Ga0495597_0111452_526_1134 202
710 3300046542 Ga0495597_0219625 Ga0495597_0219625_57_665 202
711 3300046543 Ga0495645_0009326 Ga0495645_0009326_1583_2191 202
712 3300046557 Ga0495622_0034359 Ga0495622_0034359_1408_2016 202
713 3300046557 Ga0495622_0177024 Ga0495622_0177024_249_857 202
714 3300046615 Ga0495656_0144867 Ga0495656_0144867_206_814 202
715 3300046615 Ga0495656_0157593 Ga0495656_0157593_429_1037 202
716 3300046615 Ga0495656_0246166 Ga0495656_0246166_53_661 202
717 3300046616 Ga0495668_0032967 Ga0495668_0032967_81_689 202
718 3300046616 Ga0495668_0208321 Ga0495668_0208321_112_720 202
719 3300046642 Ga0495634_0035380 Ga0495634_0035380_718_1326 202
720 3300046642 Ga0495634_0044095 Ga0495634_0044095_1724_2332 202
721 3300046642 Ga0495634_0074829 Ga0495634_0074829_425_1033 202
722 3300046648 Ga0495611_0110246 Ga0495611_0110246_198_806 202
723 3300046648 Ga0495611_0117468 Ga0495611_0117468_325_933 202
724 3300046648 Ga0495611_0227655 Ga0495611_0227655_223_831 202
725 3300046660 Ga0495625_0011042 Ga0495625_0011042_1183_1791 202
726 3300046660 Ga0495625_0216171 Ga0495625_0216171_634_1242 202
727 3300046660 Ga0495625_0317915 Ga0495625_0317915_268_876 202
728 3300046663 Ga0495635_0000102 Ga0495635_0000102_19337_19945 202
729 3300046663 Ga0495635_0261400 Ga0495635_0261400_183_791 202
730 3300046665 Ga0495661_0020554 Ga0495661_0020554_2304_2912 202
731 3300046665 Ga0495661_0074354 Ga0495661_0074354_970_1578 202
732 3300046674 Ga0495588_0002080 Ga0495588_0002080_5278_5886 202
733 3300046674 Ga0495588_0056871 Ga0495588_0056871_751_1359 202
734 3300046675 Ga0495657_0000677 Ga0495657_0000677_20687_21295 202
735 3300046678 Ga0495599_0004277 Ga0495599_0004277_4288_4896 202
736 3300046679 Ga0495623_0000625 Ga0495623_0000625_4370_4978 202
737 3300046679 Ga0495623_0187934 Ga0495623_0187934_110_718 202
738 3300046679 Ga0495623_0201805 Ga0495623_0201805_123_830 202
739 3300046680 Ga0495646_0011103 Ga0495646_0011103_376_984 202
740 3300046680 Ga0495646_0198170 Ga0495646_0198170_47_655 202
741 3300046681 Ga0495647_0275559 Ga0495647_0275559_108_716 202
742 3300046683 Ga0495658_0450343 Ga0495658_0450343_190_798 202
743 3300046684 Ga0495669_0066101 Ga0495669_0066101_894_1502 202
744 3300046684 Ga0495669_0267734 Ga0495669_0267734_123_731 202
745 3300046684 Ga0495669_0351127 Ga0495669_0351127_92_700 202
746 3300046689 Ga0495613_0252896 Ga0495613_0252896_235_843 202
747 3300046690 Ga0495624_0054765 Ga0495624_0054765_1235_1843 202
748 3300046690 Ga0495624_0168959 Ga0495624_0168959_187_795 202
749 3300046690 Ga0495624_0326148 Ga0495624_0326148_138_746 202
750 3300046692 Ga0495671_0008342 Ga0495671_0008342_4307_4915 202
751 3300046692 Ga0495671_0137239 Ga0495671_0137239_511_1119 202
752 3300046694 Ga0495649_0191402 Ga0495649_0191402_429_1037 202
753 3300046794 Ga0495589_0101299 Ga0495589_0101299_330_938 202
754 3300046794 Ga0495589_0358961 Ga0495589_0358961_27_635 202
755 3300046809 Ga0495600_0012741 Ga0495600_0012741_3793_4401 202
756 3300046809 Ga0495600_0103936 Ga0495600_0103936_487_1095 202
757 3300046810 Ga0495660_0088074 Ga0495660_0088074_973_1581 202
758 3300047315 Ga0495581_0028179 Ga0495581_0028179_292_900 202
759 3300047317 Ga0495604_0028450 Ga0495604_0028450_144_752 202
760 3300047317 Ga0495604_0144377 Ga0495604_0144377_225_833 202
761 3300047320 Ga0495672_0103753 Ga0495672_0103753_363_971 202
762 3300047321 Ga0495676_0144086 Ga0495676_0144086_744_1352 202
763 3300047321 Ga0495676_0318932 Ga0495676_0318932_66_674 202
764 3300047322 Ga0495680_0013796 Ga0495680_0013796_1990_2598 202
765 3300047443 Ga0495687_158166 Ga0495687_158166_25_633 202
766 3300047444 Ga0495675_0000456 Ga0495675_0000456_5698_6306 202
767 3300047469 Ga0495673_0039762 Ga0495673_0039762_650_1258 202
768 3300047469 Ga0495673_0089396 Ga0495673_0089396_107_715 202
769 3300047469 Ga0495673_0131931 Ga0495673_0131931_107_715 202
770 3300047469 Ga0495673_0170618 Ga0495673_0170618_134_742 202
771 3300047470 Ga0495681_0059983 Ga0495681_0059983_250_858 202
772 3300047471 Ga0495684_0000088 Ga0495684_0000088_17849_18457 202
773 3300047472 Ga0495686_0311415 Ga0495686_0311415_139_747 202
774 3300047472 Ga0495686_0477569 Ga0495686_0477569_20_628 202
775 3300047673 Ga0495593_0002275 Ga0495593_0002275_4312_4920 202
776 3300048088 Ga0495602_0020576 Ga0495602_0020576_3793_4401 202
777 3300048088 Ga0495602_0177927 Ga0495602_0177927_920_1528 202
778 3300048089 Ga0495614_0154088 Ga0495614_0154088_385_993 202
779 3300048903 Ga0496100_0026351 Ga0496100_0026351_64_672 202
780 3300048903 Ga0496100_0184746 Ga0496100_0184746_835_1443 202
781 3300048903 Ga0496100_0283745 Ga0496100_0283745_241_849 202
782 3300048903 Ga0496100_0479098 Ga0496100_0479098_328_936 202
783 3300048904 Ga0496101_0013079 Ga0496101_0013079_3491_4099 202
784 3300048905 Ga0496102_0024192 Ga0496102_0024192_2107_2715 202
785 3300048905 Ga0496102_0079289 Ga0496102_0079289_2285_2893 202
786 3300048905 Ga0496102_0278273 Ga0496102_0278273_859_1467 202
787 3300048905 Ga0496102_0914803 Ga0496102_0914803_119_727 202
788 3300048905 Ga0496102_1176870 Ga0496102_1176870_64_672 202
789 3300048906 Ga0496103_0250271 Ga0496103_0250271_51_659 202
790 3300048907 Ga0496104_0088095 Ga0496104_0088095_2137_2745 202
791 3300048907 Ga0496104_0099267 Ga0496104_0099267_1180_1788 202
792 3300048907 Ga0496104_0682852 Ga0496104_0682852_102_710 202
793 3300048908 Ga0496105_0005894 Ga0496105_0005894_4252_4860 202
794 3300048908 Ga0496105_0026027 Ga0496105_0026027_2998_3606 202
795 3300048908 Ga0496105_0093401 Ga0496105_0093401_1853_2461 202
796 3300048909 Ga0496106_0009909 Ga0496106_0009909_6146_6754 202
797 3300048909 Ga0496106_0256720 Ga0496106_0256720_53_733 202
798 3300048909 Ga0496106_0387288 Ga0496106_0387288_39_647 202
799 3300048910 Ga0496107_0001973 Ga0496107_0001973_8245_8853 202
800 3300048910 Ga0496107_0025149 Ga0496107_0025149_2764_3372 202
801 3300048910 Ga0496107_0299548 Ga0496107_0299548_564_1172 202
802 3300048911 Ga0496108_0014344 Ga0496108_0014344_1467_2075 202
803 3300048911 Ga0496108_0042375 Ga0496108_0042375_373_981 202
804 3300048911 Ga0496108_0098850 Ga0496108_0098850_1200_1808 202
805 3300048911 Ga0496108_0157249 Ga0496108_0157249_1028_1636 202
806 3300048911 Ga0496108_0546120 Ga0496108_0546120_163_771 202
807 3300048911 Ga0496108_0867885 Ga0496108_0867885_66_674 202
808 3300048912 Ga0496109_0051467 Ga0496109_0051467_257_865 202
809 3300048912 Ga0496109_0120837 Ga0496109_0120837_1572_2180 202
810 3300048912 Ga0496109_0625422 Ga0496109_0625422_132_740 202
811 3300048912 Ga0496109_1178311 Ga0496109_1178311_38_646 202
812 3300048913 Ga0496110_0212745 Ga0496110_0212745_118_726 202
813 3300048913 Ga0496110_0617395 Ga0496110_0617395_143_751 202
814 3300048913 Ga0496110_0764839 Ga0496110_0764839_37_645 202
815 3300048914 Ga0496111_0139192 Ga0496111_0139192_646_1254 202
816 3300048914 Ga0496111_0377782 Ga0496111_0377782_211_819 202
817 3300048914 Ga0496111_0711982 Ga0496111_0711982_85_693 202
818 3300048915 Ga0496112_0059867 Ga0496112_0059867_950_1558 202
819 3300048915 Ga0496112_0109052 Ga0496112_0109052_1135_1743 202
820 3300048915 Ga0496112_0176759 Ga0496112_0176759_590_1198 202
821 3300048916 Ga0496113_0065731 Ga0496113_0065731_58_666 202
822 3300048916 Ga0496113_0128837 Ga0496113_0128837_1230_1838 202
823 3300048917 Ga0496114_0079530 Ga0496114_0079530_1437_2045 202
824 3300048918 Ga0496115_0002110 Ga0496115_0002110_3594_4202 202
825 3300048918 Ga0496115_0154394 Ga0496115_0154394_391_999 202
826 3300048918 Ga0496115_0586750 Ga0496115_0586750_17_625 202
827 3300048921 Ga0496118_0124227 Ga0496118_0124227_705_1313 202
828 3300048921 Ga0496118_0209013 Ga0496118_0209013_64_672 202
829 3300048922 Ga0496119_0011563 Ga0496119_0011563_2468_3076 202
830 3300048922 Ga0496119_0029097 Ga0496119_0029097_2857_3465 202
831 3300048923 Ga0496120_0118746 Ga0496120_0118746_257_865 202
832 3300048923 Ga0496120_0132474 Ga0496120_0132474_412_1020 202
833 3300048924 Ga0496121_0000664 Ga0496121_0000664_16333_16941 202
834 3300048924 Ga0496121_0001831 Ga0496121_0001831_1279_1887 202
835 3300048924 Ga0496121_0004034 Ga0496121_0004034_16788_17396 202
836 3300048924 Ga0496121_0013563 Ga0496121_0013563_8100_8708 202
837 3300048924 Ga0496121_0078663 Ga0496121_0078663_1005_1613 202
838 3300048924 Ga0496121_0086013 Ga0496121_0086013_1048_1656 202
839 3300048924 Ga0496121_0100846 Ga0496121_0100846_165_779 202
840 3300048924 Ga0496121_0129970 Ga0496121_0129970_1236_1844 202
841 3300048925 Ga0496122_0004370 Ga0496122_0004370_10226_10834 202
842 3300048925 Ga0496122_0105531 Ga0496122_0105531_419_1027 202
843 3300048926 Ga0496123_0046249 Ga0496123_0046249_1670_2278 202
844 3300048926 Ga0496123_0222542 Ga0496123_0222542_241_849 202
845 3300048927 Ga0496124_0237465 Ga0496124_0237465_576_1184 202
846 3300048927 Ga0496124_0497030 Ga0496124_0497030_95_703 202
847 3300048928 Ga0496125_0019338 Ga0496125_0019338_69_677 202
848 3300048928 Ga0496125_0035378 Ga0496125_0035378_1890_2498 202
849 3300048928 Ga0496125_0091380 Ga0496125_0091380_702_1310 202
850 3300048928 Ga0496125_0190092 Ga0496125_0190092_343_951 202
851 3300048928 Ga0496125_0334185 Ga0496125_0334185_94_702 202
852 3300048929 Ga0496126_0007417 Ga0496126_0007417_3775_4383 202
853 3300048929 Ga0496126_0010287 Ga0496126_0010287_2592_3200 202
854 3300048929 Ga0496126_0055592 Ga0496126_0055592_2563_3171 202
855 3300048929 Ga0496126_0076084 Ga0496126_0076084_305_913 202
856 3300048929 Ga0496126_0091851 Ga0496126_0091851_903_1511 202
857 3300048929 Ga0496126_0107392 Ga0496126_0107392_1454_2062 202
858 3300048929 Ga0496126_0107909 Ga0496126_0107909_799_1407 202
859 3300048929 Ga0496126_0142329 Ga0496126_0142329_645_1253 202
860 3300048929 Ga0496126_0143579 Ga0496126_0143579_1220_1828 202
861 3300048929 Ga0496126_0170191 Ga0496126_0170191_1177_1785 202
862 3300048929 Ga0496126_0213125 Ga0496126_0213125_577_1185 202
863 3300048929 Ga0496126_0217251 Ga0496126_0217251_779_1387 202
864 3300048929 Ga0496126_0490402 Ga0496126_0490402_11_619 202
865 3300048929 Ga0496126_0533130 Ga0496126_0533130_63_677 202
866 3300048929 Ga0496126_0821698 Ga0496126_0821698_67_675 202
867 3300049460 Ga0495682_0023470 Ga0495682_0023470_113_721 202
868 3300049460 Ga0495682_0059866 Ga0495682_0059866_378_986 202
869 3300049578 Ga0501042_0250593 Ga0501042_0250593_396_1004 202
870 3300049583 Ga0501067_0244415 Ga0501067_0244415_204_812 202
871 3300049587 Ga0501071_0103684 Ga0501071_0103684_697_1305 202
872 3300049592 Ga0501076_0194231 Ga0501076_0194231_799_1407 202
873 3300049592 Ga0501076_0476218 Ga0501076_0476218_122_730 202
874 3300049742 Ga0501080_0301200 Ga0501080_0301200_193_801 202
875 3300049822 Ga0501035_0512841 Ga0501035_0512841_278_886 202
876 3300050489 nmdc:mga03683_143328_c1 nmdc:mga03683_143328_c1_349_957 202
877 3300050489 nmdc:mga03683_38740_c1 nmdc:mga03683_38740_c1_87_695 202
878 3300050490 nmdc:mga03n38_900_c1 nmdc:mga03n38_900_c1_4533_5141 202
879 3300050491 nmdc:mga00v17_33403_c1 nmdc:mga00v17_33403_c1_920_1528 202
880 3300050492 nmdc:mga0yw44_244714_c1 nmdc:mga0yw44_244714_c1_92_700 202
881 3300050492 nmdc:mga0yw44_32113_c1 nmdc:mga0yw44_32113_c1_283_891 202
882 3300050492 nmdc:mga0yw44_348863_c1 nmdc:mga0yw44_348863_c1_24_632 202
883 3300050492 nmdc:mga0yw44_45839_c1 nmdc:mga0yw44_45839_c1_206_814 202
884 3300050493 nmdc:mga0k408_168683_c1 nmdc:mga0k408_168683_c1_150_758 202
885 3300050493 nmdc:mga0k408_81659_c1 nmdc:mga0k408_81659_c1_511_1119 202
886 3300050494 nmdc:mga06z11_147670_c1 nmdc:mga06z11_147670_c1_462_1070 202
887 3300050494 nmdc:mga06z11_221921_c1 nmdc:mga06z11_221921_c1_439_1047 202
888 3300050494 nmdc:mga06z11_227206_c1 nmdc:mga06z11_227206_c1_104_712 202
889 3300050494 nmdc:mga06z11_401958_c1 nmdc:mga06z11_401958_c1_168_776 202
890 3300050494 nmdc:mga06z11_96862_c1 nmdc:mga06z11_96862_c1_163_771 202
891 3300050495 nmdc:mga04h51_175937_c1 nmdc:mga04h51_175937_c1_210_818 202
892 3300050496 nmdc:mga07m45_122306_c1 nmdc:mga07m45_122306_c1_27_635 202
893 3300050496 nmdc:mga07m45_20510_c1 nmdc:mga07m45_20510_c1_2347_2955 202
894 3300050496 nmdc:mga07m45_218027_c1 nmdc:mga07m45_218027_c1_124_732 202
895 3300050496 nmdc:mga07m45_34523_c1 nmdc:mga07m45_34523_c1_585_1193 202
896 3300050496 nmdc:mga07m45_3887_c1 nmdc:mga07m45_3887_c1_62_670 202
897 3300050507 nmdc:mga05p37_721000_c1 nmdc:mga05p37_721000_c1_25_633 202
898 3300050512 nmdc:mga0n895_536470_c1 nmdc:mga0n895_536470_c1_553_1161 202
899 3300050516 nmdc:mga0sz30_135787_c1 nmdc:mga0sz30_135787_c1_386_994 202
900 3300050516 nmdc:mga0sz30_215824_c1 nmdc:mga0sz30_215824_c1_156_764 202
901 3300050516 nmdc:mga0sz30_64720_c1 nmdc:mga0sz30_64720_c1_783_1391 202
902 3300050516 nmdc:mga0sz30_66366_c1 nmdc:mga0sz30_66366_c1_447_1055 202
903 3300053077 Ga0495601_0024475 Ga0495601_0024475_1804_2412 202
904 3300053077 Ga0495601_0228597 Ga0495601_0228597_352_960 202
905 3300053077 Ga0495601_0240214 Ga0495601_0240214_207_815 202
906 3300053080 Ga0500635_0003791 Ga0500635_0003791_48_656 202
907 3300053083 Ga0495655_0006636 Ga0495655_0006636_1461_2069 202
908 3300053084 Ga0495595_0000759 Ga0495595_0000759_2973_3581 202
909 3300053085 Ga0495619_0000166 Ga0495619_0000166_2118_2726 202
910 3300053086 Ga0500578_0181420 Ga0500578_0181420_570_1178 202
911 3300053086 Ga0500578_0188632 Ga0500578_0188632_286_894 202
912 3300053086 Ga0500578_0232755 Ga0500578_0232755_18_626 202
913 3300053086 Ga0500578_0353547 Ga0500578_0353547_188_796 202
914 3300053086 Ga0500578_0431740 Ga0500578_0431740_72_680 202
915 3300053086 Ga0500578_0498506 Ga0500578_0498506_58_666 202
916 3300053087 Ga0500643_000025 Ga0500643_000025_60031_60639 202
917 3300053087 Ga0500643_005118 Ga0500643_005118_3930_4538 202
918 3300053087 Ga0500643_021008 Ga0500643_021008_413_1021 202
919 3300053088 Ga0500644_0058285 Ga0500644_0058285_59_667 202
920 3300053088 Ga0500644_0110092 Ga0500644_0110092_348_956 202
921 3300053089 Ga0500581_189180 Ga0500581_189180_172_780 202
922 3300053091 Ga0500647_0026225 Ga0500647_0026225_937_1545 202
923 3300053091 Ga0500647_0028552 Ga0500647_0028552_129_737 202
924 3300053092 Ga0500583_0040306 Ga0500583_0040306_860_1468 202
925 3300053092 Ga0500583_0061256 Ga0500583_0061256_1045_1653 202
926 3300053092 Ga0500583_0222275 Ga0500583_0222275_82_690 202
927 3300053093 Ga0500651_0000899 Ga0500651_0000899_12519_13127 202
928 3300053093 Ga0500651_0008591 Ga0500651_0008591_1921_2529 202
929 3300053093 Ga0500651_0182309 Ga0500651_0182309_377_985 202
930 3300053094 Ga0500566_0000357 Ga0500566_0000357_13780_14388 202
931 3300053094 Ga0500566_0000516 Ga0500566_0000516_8069_8677 202
932 3300053095 Ga0500640_002117 Ga0500640_002117_1817_2425 202
933 3300053095 Ga0500640_012088 Ga0500640_012088_1655_2263 202
934 3300053096 Ga0500641_0009259 Ga0500641_0009259_171_779 202
935 3300053096 Ga0500641_0010600 Ga0500641_0010600_1089_1697 202
936 3300053096 Ga0500641_0146908 Ga0500641_0146908_381_989 202
937 3300053096 Ga0500641_0161722 Ga0500641_0161722_37_645 202
938 3300053098 Ga0500650_0000436 Ga0500650_0000436_92_700 202
939 3300053098 Ga0500650_0073664 Ga0500650_0073664_651_1259 202
940 3300053098 Ga0500650_0158741 Ga0500650_0158741_350_958 202
941 3300053103 Ga0500555_000313 Ga0500555_000313_13490_14098 202
942 3300053104 Ga0500556_0000030 Ga0500556_0000030_137052_137660 202
943 3300053104 Ga0500556_0031463 Ga0500556_0031463_274_882 202
944 3300053105 Ga0500557_000001 Ga0500557_000001_125156_125764 202
945 3300053108 Ga0500562_006327 Ga0500562_006327_1917_2525 202
946 3300053108 Ga0500562_013904 Ga0500562_013904_695_1303 202
947 3300053109 Ga0500569_000906 Ga0500569_000906_3058_3666 202
948 3300053111 Ga0500572_000055 Ga0500572_000055_8069_8677 202
949 3300053115 Ga0500591_036842 Ga0500591_036842_113_721 202
950 3300053116 Ga0500592_000451 Ga0500592_000451_1751_2359 202
951 3300053116 Ga0500592_022180 Ga0500592_022180_394_1002 202
952 3300053117 Ga0500593_126805 Ga0500593_126805_258_866 202
953 3300053119 Ga0500595_005547 Ga0500595_005547_360_968 202
954 3300053119 Ga0500595_007227 Ga0500595_007227_654_1262 202
955 3300053119 Ga0500595_009326 Ga0500595_009326_2093_2701 202
956 3300053119 Ga0500595_016266 Ga0500595_016266_1850_2458 202
957 3300053119 Ga0500595_019420 Ga0500595_019420_1672_2280 202
958 3300053119 Ga0500595_033476 Ga0500595_033476_263_871 202
959 3300053121 Ga0500607_031237 Ga0500607_031237_866_1474 202
960 3300053121 Ga0500607_035660 Ga0500607_035660_475_1092 202
961 3300053122 Ga0500608_006046 Ga0500608_006046_2867_3475 202
962 3300053123 Ga0500614_002236 Ga0500614_002236_2959_3567 202
963 3300053130 Ga0500642_0000028 Ga0500642_0000028_31839_32447 202
964 3300053130 Ga0500642_0000800 Ga0500642_0000800_6701_7309 202
965 3300053130 Ga0500642_0003409 Ga0500642_0003409_2677_3285 202
966 3300053131 Ga0500652_000170 Ga0500652_000170_2383_2991 202
967 3300053131 Ga0500652_259082 Ga0500652_259082_40_648 202
968 3300053134 Ga0500658_0060537 Ga0500658_0060537_933_1541 202
969 3300053134 Ga0500658_0101424 Ga0500658_0101424_133_741 202
970 3300053136 Ga0500559_0000947 Ga0500559_0000947_16359_16967 202
971 3300053136 Ga0500559_0042724 Ga0500559_0042724_1185_1793 202
972 3300053136 Ga0500559_0170685 Ga0500559_0170685_295_903 202
973 3300053137 Ga0500561_0010866 Ga0500561_0010866_812_1420 202
974 3300053145 Ga0500586_020182 Ga0500586_020182_741_1358 202
975 3300053146 Ga0500588_0033876 Ga0500588_0033876_259_867 202
976 3300053146 Ga0500588_0101685 Ga0500588_0101685_157_765 202
977 3300053146 Ga0500588_0122610 Ga0500588_0122610_283_891 202
978 3300053147 Ga0500589_242254 Ga0500589_242254_36_644 202
979 3300053148 Ga0500590_072221 Ga0500590_072221_50_658 202
980 3300053148 Ga0500590_133646 Ga0500590_133646_240_848 202
981 3300053150 Ga0500603_000052 Ga0500603_000052_21529_22137 202
982 3300053150 Ga0500603_092089 Ga0500603_092089_134_748 202
983 3300053151 Ga0500604_0006225 Ga0500604_0006225_1957_2565 202
984 3300053151 Ga0500604_0045319 Ga0500604_0045319_26_634 202
985 3300053153 Ga0500616_0000413 Ga0500616_0000413_29709_30317 202
986 3300053153 Ga0500616_0019833 Ga0500616_0019833_1318_1926 202
987 3300053156 Ga0500622_0003375 Ga0500622_0003375_5087_5695 202
988 3300053156 Ga0500622_0026645 Ga0500622_0026645_1809_2417 202
989 3300053156 Ga0500622_0117926 Ga0500622_0117926_96_704 202
990 3300053158 Ga0500627_0150927 Ga0500627_0150927_96_704 202
991 3300053159 Ga0500630_001061 Ga0500630_001061_3088_3696 202
992 3300053161 Ga0500634_0159834 Ga0500634_0159834_381_989 202
993 3300053162 Ga0500638_098921 Ga0500638_098921_351_959 202
994 3300053162 Ga0500638_151530 Ga0500638_151530_241_849 202
995 3300053162 Ga0500638_169742 Ga0500638_169742_332_940 202
996 3300053163 Ga0500639_000004 Ga0500639_000004_143161_143769 202
997 3300053177 Ga0500636_0000518 Ga0500636_0000518_2509_3117 202
998 3300053177 Ga0500636_0034455 Ga0500636_0034455_2029_2643 202
999 3300053177 Ga0500636_0042062 Ga0500636_0042062_633_1241 202
1000 3300053178 Ga0500637_0210981 Ga0500637_0210981_437_1045 202
1001 3300053722 Ga0500649_075770 Ga0500649_075770_44_652 202
1002 3300053724 Ga0500570_136515 Ga0500570_136515_179_796 202
1003 3300053727 Ga0500611_004084 Ga0500611_004084_991_1599 202
1004 3300053727 Ga0500611_101437 Ga0500611_101437_29_637 202
1005 3300053729 Ga0500625_001073 Ga0500625_001073_7419_8027 202
1006 3300053730 Ga0500645_050059 Ga0500645_050059_319_927 202
1007 3300053730 Ga0500645_060917 Ga0500645_060917_462_1070 202
1008 3300053735 Ga0500596_001961 Ga0500596_001961_1416_2024 202
1009 3300053736 Ga0500599_005507 Ga0500599_005507_278_886 202
1010 3300053737 Ga0500601_002070 Ga0500601_002070_168_776 202
1011 3300055283 Ga0500661_004375 Ga0500661_004375_1825_2433 202
1012 3300055283 Ga0500661_007243 Ga0500661_007243_798_1406 202
1013 3300061734 Ga0530510_0429357 Ga0530510_0429357_380_988 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02525

Flavodoxin_2

Flavodoxin-like fold

1

189

0.89

PF03358

FMN_red

NADPH-dependent FMN reductase

1

177

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
4c0w-assembly1.cif.gz_A the crystal strucuture of native ppazor 0.9479 1 200
4c0w-assembly1.cif.gz_A the crystal strucuture of native ppazor 0.9388 1 200
1t5b-assembly1.cif.gz_A structural genomics, a protein from salmonella typhimurium similar to e. coli acyl carrier protein phosphodiesterase 0.938 2 197
2z9b-assembly1.cif.gz_A-2 the crystal structure of azor (azoreductase) from escherichia coli: reduced azor in tetragonal crystals 0.9365 1 197
2z9c-assembly1.cif.gz_A-2 the crystal structure of azor (azoreductase) from escherichia coli: azor in complex with dicoumarol 0.9322 1 197
ID Description Score Start End Superfamily
4c0wA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9423 1 202 3.40.50.360
4c0wA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9377 1 202 3.40.50.360
1tikA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9278 2 197 3.40.50.360
af_Q2G1F2_1_208_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9028 2 198 3.40.50.360
6dxpB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8988 2 202 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A0D7DW55-F1-model_v4 FMN-dependent NADH-azoreductase 0.9771 1 141
AF-A0A4R3U143-F1-model_v4 FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) 0.9754 1 202 GO:0009055
GO:0010181
GO:0016652
GO:0016655
AF-A0A7L8VYY2-F1-model_v4 deleted 0.9733 1 202
AF-A0A257KJX5-F1-model_v4 FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) 0.9733 1 202 GO:0009055
GO:0010181
GO:0016652
GO:0016655
AF-A0A6N0DUS9-F1-model_v4 FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) 0.9729 1 196 GO:0009055
GO:0010181
GO:0016652
GO:0016655

Feature Viewer

pLDDT pTM Quality
92.28 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map