F488195
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1013 | 369 | 1998 | 248 |
Family's Representative Sequence
| Representative Sequence | 3300013306|Ga0163162_10036165|Ga0163162_100361657 |
| Length | 276 |
| Sequence | LDEWAAVVVGADGNVAYAESVSEKGMRMVSTDAIRAETITIAGHGGDEIEAYSAVPLAPGSRGGVVWIHHMPGYDRETKEFVRRLAVAGYHAICPNLYSREAPGADPDDAAATVRAAGGVPDDRLVGDVAGAAQYLGNLDGANGKTGVIGHCSGGRQAFLAACSLQLDAAVDCYGAFVVEDPPEGMPASMKPILGLASDLSCPLLGLFGMDDRYPSPEAVSKLDAELNRLGKDHEFHSYDGAGHSFFSVDRPAYRVEAALDGWRRIDDFFAKHLEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 95 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 96 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 130 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 131 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 132 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 134 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028019 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 | Metagenome | Unclassified |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 197 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 198 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 199 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 201 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 203 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 204 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 208 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 209 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 210 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 212 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 222 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 226 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 229 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 230 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 231 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 234 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 235 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 236 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 237 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 238 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 239 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 240 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 241 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 242 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 243 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 244 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 245 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 246 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 247 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 248 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 249 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 250 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 251 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 252 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 253 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 254 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 255 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 256 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 257 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 305 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 306 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 307 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 308 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 309 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 310 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 314 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 315 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 316 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 317 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 318 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 319 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 341 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 342 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 343 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 344 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 351 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 356 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 357 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 358 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 359 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 361 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 362 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 363 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 364 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 365 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 366 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 367 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 368 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 369 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.12 |
| Metatranscriptomes | 1.09 |
| Isolates | 0.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.88 |
| Nodule | 0 |
| Rhizoplane | 3.16 |
| Rhizosphere | 88.94 |
| Stem | 0 |
| Stem Tuber | 0.1 |
| Unclassified | 0.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0163162_10036165 | 3300013306 | Bacteria | 4920 |
| 2 | JGI24746J21847_1002624 | 3300001977 | Bacteria | 2846 |
| 3 | JGI24738J21930_10031127 | 3300002075 | Unclassified | 1088 |
| 4 | JGI24744J21845_10002847 | 3300002077 | Bacteria | 3535 |
| 5 | JGI24744J21845_10005076 | 3300002077 | Bacteria | 2722 |
| 6 | JGI25406J46586_10010135 | 3300003203 | Bacteria | 4193 |
| 7 | JGI25404J52841_10002354 | 3300003659 | Bacteria | 3562 |
| 8 | JGI25405J52794_10030135 | 3300003911 | Bacteria | 1124 |
| 9 | Ga0070658_10000508 | 3300005327 | Bacteria | 33678 |
| 10 | Ga0070658_10012519 | 3300005327 | Bacteria | 6805 |
| 11 | Ga0070658_10020639 | 3300005327 | Bacteria | 5279 |
| 12 | Ga0070658_10074077 | 3300005327 | Bacteria | 2792 |
| 13 | Ga0070658_10095781 | 3300005327 | Bacteria | 2450 |
| 14 | Ga0070658_10102591 | 3300005327 | Bacteria | 2366 |
| 15 | Ga0070676_10014555 | 3300005328 | Bacteria | 4325 |
| 16 | Ga0070676_10063779 | 3300005328 | Bacteria | 2195 |
| 17 | Ga0070676_10098606 | 3300005328 | Bacteria | 1802 |
| 18 | Ga0070683_100003027 | 3300005329 | Bacteria | 13504 |
| 19 | Ga0070683_100042319 | 3300005329 | Bacteria | 4194 |
| 20 | Ga0070683_100051136 | 3300005329 | Bacteria | 3826 |
| 21 | Ga0070683_100138929 | 3300005329 | Bacteria | 2301 |
| 22 | Ga0070690_100020069 | 3300005330 | Bacteria | 4067 |
| 23 | Ga0068869_100081977 | 3300005334 | Bacteria | 2410 |
| 24 | Ga0068869_100166267 | 3300005334 | Bacteria | 1720 |
| 25 | Ga0070666_10000599 | 3300005335 | Bacteria | 21663 |
| 26 | Ga0070666_10109443 | 3300005335 | Bacteria | 1910 |
| 27 | Ga0070680_100075908 | 3300005336 | Bacteria | 2767 |
| 28 | Ga0070680_100145882 | 3300005336 | Bacteria | 1986 |
| 29 | Ga0070680_100213683 | 3300005336 | Bacteria | 1627 |
| 30 | Ga0070682_100008743 | 3300005337 | Bacteria | 5713 |
| 31 | Ga0070682_100026987 | 3300005337 | Bacteria | 3443 |
| 32 | Ga0070682_100097293 | 3300005337 | Bacteria | 1937 |
| 33 | Ga0068868_100014096 | 3300005338 | Bacteria | 5885 |
| 34 | Ga0068868_100061529 | 3300005338 | Bacteria | 2974 |
| 35 | Ga0068868_100347639 | 3300005338 | Bacteria | 1269 |
| 36 | Ga0070660_100025228 | 3300005339 | Bacteria | 4417 |
| 37 | Ga0070660_100092723 | 3300005339 | Bacteria | 2384 |
| 38 | Ga0070660_100297033 | 3300005339 | Bacteria | 1324 |
| 39 | Ga0070660_100559918 | 3300005339 | Bacteria | 954 |
| 40 | Ga0070689_100016357 | 3300005340 | Bacteria | 5428 |
| 41 | Ga0070689_100404460 | 3300005340 | Bacteria | 1154 |
| 42 | Ga0070691_10038306 | 3300005341 | Bacteria | 2263 |
| 43 | Ga0070691_10051466 | 3300005341 | Bacteria | 1967 |
| 44 | Ga0070691_10102724 | 3300005341 | Bacteria | 1422 |
| 45 | Ga0070687_100011299 | 3300005343 | Bacteria | 3903 |
| 46 | Ga0070687_100020506 | 3300005343 | Bacteria | 3091 |
| 47 | Ga0070661_100117955 | 3300005344 | Bacteria | 1986 |
| 48 | Ga0070661_100297434 | 3300005344 | Bacteria | 1256 |
| 49 | Ga0070692_10075952 | 3300005345 | Bacteria | 1800 |
| 50 | Ga0070692_10271126 | 3300005345 | Bacteria | 1025 |
| 51 | Ga0070668_100014966 | 3300005347 | Bacteria | 5797 |
| 52 | Ga0070668_100027507 | 3300005347 | Bacteria | 4318 |
| 53 | Ga0070669_100026232 | 3300005353 | Bacteria | 4191 |
| 54 | Ga0070669_100306491 | 3300005353 | Bacteria | 1279 |
| 55 | Ga0070675_100046139 | 3300005354 | Bacteria | 3568 |
| 56 | Ga0070674_100004962 | 3300005356 | Bacteria | 7626 |
| 57 | Ga0070674_100150542 | 3300005356 | Bacteria | 1756 |
| 58 | Ga0070674_100247597 | 3300005356 | Bacteria | 1398 |
| 59 | Ga0070673_100088883 | 3300005364 | Bacteria | 2521 |
| 60 | Ga0070673_100313801 | 3300005364 | Bacteria | 1383 |
| 61 | Ga0070659_100002245 | 3300005366 | Bacteria | 13746 |
| 62 | Ga0070659_100006711 | 3300005366 | Bacteria | 8322 |
| 63 | Ga0070659_100061327 | 3300005366 | Bacteria | 2972 |
| 64 | Ga0070659_100156084 | 3300005366 | Bacteria | 1864 |
| 65 | Ga0070659_100364006 | 3300005366 | Bacteria | 1215 |
| 66 | Ga0070667_100010948 | 3300005367 | Bacteria | 7501 |
| 67 | Ga0070667_100051599 | 3300005367 | Bacteria | 3469 |
| 68 | Ga0070667_100135634 | 3300005367 | Bacteria | 2152 |
| 69 | Ga0070709_10009918 | 3300005434 | Bacteria | 5265 |
| 70 | Ga0070709_10248591 | 3300005434 | Bacteria | 1280 |
| 71 | Ga0070709_10425772 | 3300005434 | Bacteria | 996 |
| 72 | Ga0070714_100000968 | 3300005435 | Bacteria | 20521 |
| 73 | Ga0070714_100005250 | 3300005435 | Bacteria | 9866 |
| 74 | Ga0070714_100028819 | 3300005435 | Bacteria | 4610 |
| 75 | Ga0070714_100109961 | 3300005435 | Bacteria | 2439 |
| 76 | Ga0070714_100230654 | 3300005435 | Bacteria | 1705 |
| 77 | Ga0070714_100260518 | 3300005435 | Bacteria | 1606 |
| 78 | Ga0070714_100281327 | 3300005435 | Bacteria | 1546 |
| 79 | Ga0070714_100316496 | 3300005435 | Bacteria | 1458 |
| 80 | Ga0070714_100337922 | 3300005435 | Bacteria | 1412 |
| 81 | Ga0070713_100000292 | 3300005436 | Bacteria | 33112 |
| 82 | Ga0070713_100029889 | 3300005436 | Bacteria | 4321 |
| 83 | Ga0070713_100053823 | 3300005436 | Bacteria | 3336 |
| 84 | Ga0070713_100073500 | 3300005436 | Bacteria | 2894 |
| 85 | Ga0070713_100120607 | 3300005436 | Bacteria | 2299 |
| 86 | Ga0070713_100270987 | 3300005436 | Bacteria | 1554 |
| 87 | Ga0070713_100273566 | 3300005436 | Bacteria | 1547 |
| 88 | Ga0070713_100348450 | 3300005436 | Bacteria | 1373 |
| 89 | Ga0070710_10001190 | 3300005437 | Bacteria | 12280 |
| 90 | Ga0070710_10009899 | 3300005437 | Bacteria | 4672 |
| 91 | Ga0070710_10138628 | 3300005437 | Bacteria | 1489 |
| 92 | Ga0070701_10022440 | 3300005438 | Bacteria | 3027 |
| 93 | Ga0070711_100001818 | 3300005439 | Bacteria | 11901 |
| 94 | Ga0070711_100031445 | 3300005439 | Bacteria | 3524 |
| 95 | Ga0070711_100327539 | 3300005439 | Bacteria | 1225 |
| 96 | Ga0070711_100363957 | 3300005439 | Bacteria | 1165 |
| 97 | Ga0070705_100251113 | 3300005440 | Bacteria | 1242 |
| 98 | Ga0070700_100020504 | 3300005441 | Bacteria | 3829 |
| 99 | Ga0070694_100009988 | 3300005444 | Bacteria | 5835 |
| 100 | Ga0070694_100069296 | 3300005444 | Bacteria | 2426 |
| 101 | Ga0070708_100030491 | 3300005445 | Bacteria | 4661 |
| 102 | Ga0070708_100069217 | 3300005445 | Bacteria | 3173 |
| 103 | Ga0070708_100106172 | 3300005445 | Bacteria | 2578 |
| 104 | Ga0070708_100131850 | 3300005445 | Bacteria | 2313 |
| 105 | Ga0070708_100151223 | 3300005445 | Bacteria | 2159 |
| 106 | Ga0070708_100352813 | 3300005445 | Bacteria | 1386 |
| 107 | Ga0070663_100000154 | 3300005455 | Bacteria | 33949 |
| 108 | Ga0070663_100008259 | 3300005455 | Bacteria | 6396 |
| 109 | Ga0070663_100130837 | 3300005455 | Bacteria | 1905 |
| 110 | Ga0070678_100004333 | 3300005456 | Bacteria | 8030 |
| 111 | Ga0070678_100014423 | 3300005456 | Bacteria | 4987 |
| 112 | Ga0070678_100405214 | 3300005456 | Bacteria | 1186 |
| 113 | Ga0070681_10005886 | 3300005458 | Bacteria | 11869 |
| 114 | Ga0070681_10095443 | 3300005458 | Bacteria | 2922 |
| 115 | Ga0070681_10146505 | 3300005458 | Bacteria | 2290 |
| 116 | Ga0070681_10215156 | 3300005458 | Bacteria | 1838 |
| 117 | Ga0070681_10359241 | 3300005458 | Bacteria | 1367 |
| 118 | Ga0068867_100024657 | 3300005459 | Bacteria | 4311 |
| 119 | Ga0068867_100248086 | 3300005459 | Bacteria | 1447 |
| 120 | Ga0068867_100692930 | 3300005459 | Bacteria | 898 |
| 121 | Ga0070685_10033240 | 3300005466 | Bacteria | 2895 |
| 122 | Ga0070706_100001190 | 3300005467 | Bacteria | 27871 |
| 123 | Ga0070706_100010326 | 3300005467 | Bacteria | 8673 |
| 124 | Ga0070706_100193584 | 3300005467 | Bacteria | 1900 |
| 125 | Ga0070706_100339345 | 3300005467 | Bacteria | 1401 |
| 126 | Ga0070706_100648142 | 3300005467 | Bacteria | 981 |
| 127 | Ga0070707_100020033 | 3300005468 | Bacteria | 6307 |
| 128 | Ga0070707_100069666 | 3300005468 | Bacteria | 3387 |
| 129 | Ga0070707_100222863 | 3300005468 | Bacteria | 1836 |
| 130 | Ga0070707_100760377 | 3300005468 | Bacteria | 932 |
| 131 | Ga0070698_100000028 | 3300005471 | Bacteria | 98040 |
| 132 | Ga0070698_100015636 | 3300005471 | Bacteria | 8015 |
| 133 | Ga0070698_100020133 | 3300005471 | Bacteria | 6995 |
| 134 | Ga0070698_100025185 | 3300005471 | Bacteria | 6199 |
| 135 | Ga0070698_100027003 | 3300005471 | Bacteria | 5970 |
| 136 | Ga0070698_100049725 | 3300005471 | Bacteria | 4278 |
| 137 | Ga0070698_100063382 | 3300005471 | Bacteria | 3728 |
| 138 | Ga0070698_100302314 | 3300005471 | Bacteria | 1531 |
| 139 | Ga0070699_100001363 | 3300005518 | Bacteria | 22465 |
| 140 | Ga0070699_100222282 | 3300005518 | Bacteria | 1683 |
| 141 | Ga0070679_100052028 | 3300005530 | Bacteria | 4080 |
| 142 | Ga0070684_100039048 | 3300005535 | Bacteria | 4082 |
| 143 | Ga0070684_100049228 | 3300005535 | Bacteria | 3657 |
| 144 | Ga0070684_100183266 | 3300005535 | Bacteria | 1904 |
| 145 | Ga0070697_100000383 | 3300005536 | Bacteria | 34541 |
| 146 | Ga0070697_100112143 | 3300005536 | Bacteria | 2274 |
| 147 | Ga0068853_100015885 | 3300005539 | Bacteria | 6184 |
| 148 | Ga0068853_100542053 | 3300005539 | Bacteria | 1101 |
| 149 | Ga0070672_100357150 | 3300005543 | Bacteria | 1246 |
| 150 | Ga0070672_100485031 | 3300005543 | Bacteria | 1068 |
| 151 | Ga0070686_100182867 | 3300005544 | Bacteria | 1491 |
| 152 | Ga0070686_100385247 | 3300005544 | Bacteria | 1062 |
| 153 | Ga0070686_100397793 | 3300005544 | Bacteria | 1047 |
| 154 | Ga0070695_100061202 | 3300005545 | Bacteria | 2442 |
| 155 | Ga0070695_100101201 | 3300005545 | Bacteria | 1941 |
| 156 | Ga0070696_100021296 | 3300005546 | Bacteria | 4395 |
| 157 | Ga0070696_100065680 | 3300005546 | Bacteria | 2543 |
| 158 | Ga0070696_100081792 | 3300005546 | Bacteria | 2289 |
| 159 | Ga0070693_100065726 | 3300005547 | Bacteria | 2120 |
| 160 | Ga0070693_100267505 | 3300005547 | Bacteria | 1140 |
| 161 | Ga0070665_100019951 | 3300005548 | Bacteria | 6732 |
| 162 | Ga0070665_100035324 | 3300005548 | Bacteria | 5025 |
| 163 | Ga0070704_100009349 | 3300005549 | Bacteria | 5917 |
| 164 | Ga0070704_100329780 | 3300005549 | Bacteria | 1281 |
| 165 | Ga0068855_100092059 | 3300005563 | Bacteria | 3497 |
| 166 | Ga0068855_100480812 | 3300005563 | Bacteria | 1352 |
| 167 | Ga0068855_100513514 | 3300005563 | Bacteria | 1301 |
| 168 | Ga0070664_100113964 | 3300005564 | Bacteria | 2361 |
| 169 | Ga0070664_100182673 | 3300005564 | Bacteria | 1865 |
| 170 | Ga0070664_100306747 | 3300005564 | Bacteria | 1435 |
| 171 | Ga0068857_100043855 | 3300005577 | Bacteria | 3967 |
| 172 | Ga0068854_100122448 | 3300005578 | Bacteria | 1977 |
| 173 | Ga0068854_100308096 | 3300005578 | Bacteria | 1283 |
| 174 | Ga0068854_100623927 | 3300005578 | Bacteria | 923 |
| 175 | Ga0068856_100543456 | 3300005614 | Bacteria | 1183 |
| 176 | Ga0068856_100685199 | 3300005614 | Bacteria | 1045 |
| 177 | Ga0070702_100085222 | 3300005615 | Bacteria | 1902 |
| 178 | Ga0068852_100123783 | 3300005616 | Bacteria | 2371 |
| 179 | Ga0068852_100154175 | 3300005616 | Bacteria | 2138 |
| 180 | Ga0068859_100002009 | 3300005617 | Bacteria | 20771 |
| 181 | Ga0068859_100028972 | 3300005617 | Bacteria | 5555 |
| 182 | Ga0068859_100046620 | 3300005617 | Bacteria | 4352 |
| 183 | Ga0068859_100198952 | 3300005617 | Bacteria | 2088 |
| 184 | Ga0068859_100582307 | 3300005617 | Unclassified | 1213 |
| 185 | Ga0068864_100049548 | 3300005618 | Bacteria | 3614 |
| 186 | Ga0068866_10008951 | 3300005718 | Bacteria | 4238 |
| 187 | Ga0068866_10035456 | 3300005718 | Bacteria | 2437 |
| 188 | Ga0068866_10048347 | 3300005718 | Bacteria | 2150 |
| 189 | Ga0068861_100300334 | 3300005719 | Bacteria | 1390 |
| 190 | Ga0068851_10066565 | 3300005834 | Bacteria | 1856 |
| 191 | Ga0068851_10086672 | 3300005834 | Bacteria | 1643 |
| 192 | Ga0068870_10025246 | 3300005840 | Bacteria | 2948 |
| 193 | Ga0068863_100400701 | 3300005841 | Bacteria | 1342 |
| 194 | Ga0068858_100018088 | 3300005842 | Bacteria | 6600 |
| 195 | Ga0068858_100166178 | 3300005842 | Bacteria | 2079 |
| 196 | Ga0068860_100000067 | 3300005843 | Bacteria | 180176 |
| 197 | Ga0068860_100079327 | 3300005843 | Bacteria | 3121 |
| 198 | Ga0068862_100025498 | 3300005844 | Bacteria | 4964 |
| 199 | Ga0068862_100051958 | 3300005844 | Bacteria | 3506 |
| 200 | Ga0068862_100283628 | 3300005844 | Bacteria | 1519 |
| 201 | Ga0081455_10000974 | 3300005937 | Bacteria | 36539 |
| 202 | Ga0081455_10065050 | 3300005937 | Bacteria | 3051 |
| 203 | Ga0081455_10072991 | 3300005937 | Bacteria | 2838 |
| 204 | Ga0081455_10218482 | 3300005937 | Bacteria | 1414 |
| 205 | Ga0081538_10148850 | 3300005981 | Bacteria | 1064 |
| 206 | Ga0081539_10000482 | 3300005985 | Bacteria | 84124 |
| 207 | Ga0070717_10001057 | 3300006028 | Bacteria | 18499 |
| 208 | Ga0070717_10039252 | 3300006028 | Bacteria | 3852 |
| 209 | Ga0070717_10056789 | 3300006028 | Bacteria | 3235 |
| 210 | Ga0070717_10056804 | 3300006028 | Bacteria | 3235 |
| 211 | Ga0070717_10073695 | 3300006028 | Bacteria | 2854 |
| 212 | Ga0070717_10204377 | 3300006028 | Bacteria | 1731 |
| 213 | Ga0070717_10331910 | 3300006028 | Bacteria | 1357 |
| 214 | Ga0070717_10385363 | 3300006028 | Bacteria | 1257 |
| 215 | Ga0070717_10492117 | 3300006028 | Bacteria | 1108 |
| 216 | Ga0070717_10912964 | 3300006028 | Bacteria | 800 |
| 217 | Ga0075363_100002024 | 3300006048 | Bacteria | 8086 |
| 218 | Ga0075364_10006138 | 3300006051 | Bacteria | 7033 |
| 219 | Ga0070715_10005940 | 3300006163 | Bacteria | 4116 |
| 220 | Ga0070715_10028906 | 3300006163 | Bacteria | 2229 |
| 221 | Ga0070715_10063627 | 3300006163 | Bacteria | 1627 |
| 222 | Ga0070716_100001660 | 3300006173 | Bacteria | 10034 |
| 223 | Ga0070716_100007955 | 3300006173 | Bacteria | 5248 |
| 224 | Ga0070716_100009500 | 3300006173 | Bacteria | 4850 |
| 225 | Ga0070716_100042011 | 3300006173 | Bacteria | 2550 |
| 226 | Ga0070716_100366101 | 3300006173 | Bacteria | 1025 |
| 227 | Ga0070712_100005616 | 3300006175 | Bacteria | 7761 |
| 228 | Ga0070712_100008614 | 3300006175 | Bacteria | 6420 |
| 229 | Ga0070712_100016635 | 3300006175 | Bacteria | 4752 |
| 230 | Ga0070712_100043097 | 3300006175 | Bacteria | 3105 |
| 231 | Ga0070712_100068474 | 3300006175 | Bacteria | 2529 |
| 232 | Ga0070712_100391871 | 3300006175 | Bacteria | 1145 |
| 233 | Ga0075369_10002093 | 3300006186 | Bacteria | 7043 |
| 234 | Ga0075369_10002645 | 3300006186 | Bacteria | 6411 |
| 235 | Ga0075369_10045826 | 3300006186 | Bacteria | 1881 |
| 236 | Ga0097621_100026048 | 3300006237 | Bacteria | 4583 |
| 237 | Ga0097621_100083376 | 3300006237 | Bacteria | 2664 |
| 238 | Ga0075370_10026358 | 3300006353 | Bacteria | 3219 |
| 239 | Ga0075428_100007121 | 3300006844 | Bacteria | 12387 |
| 240 | Ga0075430_100065719 | 3300006846 | Bacteria | 3047 |
| 241 | Ga0068865_100000387 | 3300006881 | Bacteria | 24426 |
| 242 | Ga0068865_100300452 | 3300006881 | Bacteria | 1285 |
| 243 | Ga0075436_100090274 | 3300006914 | Bacteria | 2130 |
| 244 | Ga0075436_100217509 | 3300006914 | Bacteria | 1355 |
| 245 | Ga0097620_100002008 | 3300006931 | Bacteria | 20771 |
| 246 | Ga0097620_100028971 | 3300006931 | Bacteria | 5555 |
| 247 | Ga0097620_100046623 | 3300006931 | Bacteria | 4352 |
| 248 | Ga0097620_100198946 | 3300006931 | Bacteria | 2088 |
| 249 | Ga0097620_100582307 | 3300006931 | Unclassified | 1213 |
| 250 | Ga0099794_10225006 | 3300007265 | Bacteria | 964 |
| 251 | Ga0099795_10039100 | 3300007788 | Bacteria | 1677 |
| 252 | Ga0105244_10144217 | 3300009036 | Bacteria | 1144 |
| 253 | Ga0105240_10011130 | 3300009093 | Bacteria | 12570 |
| 254 | Ga0105240_10451854 | 3300009093 | Bacteria | 1438 |
| 255 | Ga0105245_10027833 | 3300009098 | Bacteria | 4981 |
| 256 | Ga0105245_10029652 | 3300009098 | Bacteria | 4836 |
| 257 | Ga0105245_10285814 | 3300009098 | Bacteria | 1614 |
| 258 | Ga0105245_10505006 | 3300009098 | Bacteria | 1226 |
| 259 | Ga0105247_10005969 | 3300009101 | Bacteria | 7587 |
| 260 | Ga0105247_10242187 | 3300009101 | Bacteria | 1229 |
| 261 | Ga0114129_10098741 | 3300009147 | Bacteria | 4042 |
| 262 | Ga0114129_10805088 | 3300009147 | Bacteria | 1198 |
| 263 | Ga0105243_10000843 | 3300009148 | Bacteria | 29147 |
| 264 | Ga0105241_10028985 | 3300009174 | Bacteria | 4126 |
| 265 | Ga0105241_10377713 | 3300009174 | Bacteria | 1237 |
| 266 | Ga0105242_10046867 | 3300009176 | Bacteria | 3509 |
| 267 | Ga0105242_10129265 | 3300009176 | Bacteria | 2178 |
| 268 | Ga0105242_10202595 | 3300009176 | Bacteria | 1763 |
| 269 | Ga0105242_10265758 | 3300009176 | Bacteria | 1552 |
| 270 | Ga0105248_10011276 | 3300009177 | Bacteria | 9859 |
| 271 | Ga0105248_10043895 | 3300009177 | Bacteria | 5014 |
| 272 | Ga0105248_10514321 | 3300009177 | Bacteria | 1350 |
| 273 | Ga0105237_10104883 | 3300009545 | Bacteria | 2818 |
| 274 | Ga0105249_10000784 | 3300009553 | Bacteria | 28520 |
| 275 | Ga0105239_10248866 | 3300010375 | Bacteria | 1996 |
| 276 | Ga0105239_10276087 | 3300010375 | Bacteria | 1891 |
| 277 | Ga0105239_10411586 | 3300010375 | Bacteria | 1531 |
| 278 | Ga0105246_10082055 | 3300011119 | Bacteria | 2300 |
| 279 | Ga0105246_10304675 | 3300011119 | Bacteria | 1288 |
| 280 | Ga0157342_1003067 | 3300012507 | Bacteria | 1409 |
| 281 | Ga0157373_10378657 | 3300013100 | Bacteria | 1012 |
| 282 | Ga0157371_10005054 | 3300013102 | Bacteria | 11272 |
| 283 | Ga0157371_10169634 | 3300013102 | Bacteria | 1559 |
| 284 | Ga0157370_10022049 | 3300013104 | Bacteria | 6342 |
| 285 | Ga0157369_10005401 | 3300013105 | Bacteria | 14876 |
| 286 | Ga0157369_10010931 | 3300013105 | Bacteria | 10333 |
| 287 | Ga0157369_10011881 | 3300013105 | Bacteria | 9890 |
| 288 | Ga0157369_10101343 | 3300013105 | Bacteria | 3068 |
| 289 | Ga0157369_10191870 | 3300013105 | Bacteria | 2147 |
| 290 | Ga0157369_10558805 | 3300013105 | Bacteria | 1182 |
| 291 | Ga0157374_10096699 | 3300013296 | Bacteria | 2824 |
| 292 | Ga0157374_10352716 | 3300013296 | Bacteria | 1462 |
| 293 | Ga0157374_10645988 | 3300013296 | Bacteria | 1070 |
| 294 | Ga0157378_10005566 | 3300013297 | Bacteria | 11028 |
| 295 | Ga0157378_10199920 | 3300013297 | Bacteria | 1890 |
| 296 | Ga0157378_10316073 | 3300013297 | Bacteria | 1516 |
| 297 | Ga0163162_10088075 | 3300013306 | Bacteria | 3184 |
| 298 | Ga0163162_10161033 | 3300013306 | Bacteria | 2366 |
| 299 | Ga0163162_10719393 | 3300013306 | Bacteria | 1119 |
| 300 | Ga0157372_10066489 | 3300013307 | Bacteria | 4050 |
| 301 | Ga0157372_10339172 | 3300013307 | Bacteria | 1751 |
| 302 | Ga0157375_10001987 | 3300013308 | Bacteria | 17655 |
| 303 | Ga0163163_10166016 | 3300014325 | Bacteria | 2254 |
| 304 | Ga0163163_10450337 | 3300014325 | Bacteria | 1347 |
| 305 | Ga0163163_10489668 | 3300014325 | Bacteria | 1291 |
| 306 | Ga0157380_10360406 | 3300014326 | Bacteria | 1364 |
| 307 | Ga0157377_10254328 | 3300014745 | Bacteria | 1140 |
| 308 | Ga0157379_10014388 | 3300014968 | Bacteria | 6942 |
| 309 | Ga0157379_10033440 | 3300014968 | Bacteria | 4586 |
| 310 | Ga0157379_10095885 | 3300014968 | Bacteria | 2662 |
| 311 | Ga0157376_10069402 | 3300014969 | Bacteria | 2988 |
| 312 | Ga0163161_10027781 | 3300017792 | Bacteria | 4015 |
| 313 | Ga0163161_10127243 | 3300017792 | Bacteria | 1919 |
| 314 | Ga0197907_10456462 | 3300020069 | Bacteria | 3796 |
| 315 | Ga0206356_10069604 | 3300020070 | Bacteria | 3015 |
| 316 | Ga0206349_1059723 | 3300020075 | Bacteria | 2526 |
| 317 | Ga0206354_10021129 | 3300020081 | Bacteria | 2191 |
| 318 | Ga0206354_10448767 | 3300020081 | Bacteria | 3565 |
| 319 | Ga0206353_11415596 | 3300020082 | Bacteria | 2833 |
| 320 | Ga0206353_11658561 | 3300020082 | Bacteria | 1252 |
| 321 | Ga0206353_11792839 | 3300020082 | Bacteria | 2197 |
| 322 | Ga0213874_10046395 | 3300021377 | Bacteria | 1319 |
| 323 | Ga0213874_10067553 | 3300021377 | Bacteria | 1133 |
| 324 | Ga0213876_10019846 | 3300021384 | Bacteria | 3550 |
| 325 | Ga0213876_10020650 | 3300021384 | Bacteria | 3482 |
| 326 | Ga0213876_10032212 | 3300021384 | Bacteria | 2765 |
| 327 | Ga0213876_10198765 | 3300021384 | Bacteria | 1066 |
| 328 | Ga0213875_10000092 | 3300021388 | Bacteria | 104416 |
| 329 | Ga0213875_10001276 | 3300021388 | Bacteria | 16871 |
| 330 | Ga0213875_10003226 | 3300021388 | Bacteria | 9364 |
| 331 | Ga0213875_10007935 | 3300021388 | Bacteria | 5457 |
| 332 | Ga0213875_10012033 | 3300021388 | Bacteria | 4286 |
| 333 | Ga0213875_10017021 | 3300021388 | Bacteria | 3519 |
| 334 | Ga0213875_10019923 | 3300021388 | Bacteria | 3222 |
| 335 | Ga0213875_10058713 | 3300021388 | Bacteria | 1801 |
| 336 | Ga0213875_10077283 | 3300021388 | Bacteria | 1553 |
| 337 | Ga0224712_10003853 | 3300022467 | Bacteria | 3965 |
| 338 | Ga0224712_10008590 | 3300022467 | Bacteria | 3036 |
| 339 | Ga0224712_10009184 | 3300022467 | Bacteria | 2967 |
| 340 | Ga0228598_1011687 | 3300024227 | Bacteria | 1746 |
| 341 | Ga0209051_1022517 | 3300025303 | Bacteria | 2650 |
| 342 | Ga0207653_10014869 | 3300025885 | Bacteria | 2442 |
| 343 | Ga0207692_10006893 | 3300025898 | Bacteria | 4630 |
| 344 | Ga0207692_10074928 | 3300025898 | Bacteria | 1794 |
| 345 | Ga0207692_10250446 | 3300025898 | Bacteria | 1061 |
| 346 | Ga0207642_10081287 | 3300025899 | Bacteria | 1574 |
| 347 | Ga0207642_10277020 | 3300025899 | Bacteria | 963 |
| 348 | Ga0207710_10207714 | 3300025900 | Bacteria | 969 |
| 349 | Ga0207688_10001071 | 3300025901 | Bacteria | 14010 |
| 350 | Ga0207688_10009517 | 3300025901 | Bacteria | 5289 |
| 351 | Ga0207688_10011202 | 3300025901 | Bacteria | 4882 |
| 352 | Ga0207680_10011616 | 3300025903 | Bacteria | 4455 |
| 353 | Ga0207680_10088708 | 3300025903 | Bacteria | 1961 |
| 354 | Ga0207680_10128630 | 3300025903 | Bacteria | 1666 |
| 355 | Ga0207647_10048321 | 3300025904 | Bacteria | 2643 |
| 356 | Ga0207647_10120485 | 3300025904 | Bacteria | 1547 |
| 357 | Ga0207685_10044700 | 3300025905 | Bacteria | 1676 |
| 358 | Ga0207699_10001559 | 3300025906 | Bacteria | 10861 |
| 359 | Ga0207699_10013348 | 3300025906 | Bacteria | 4202 |
| 360 | Ga0207699_10022711 | 3300025906 | Bacteria | 3404 |
| 361 | Ga0207699_10045557 | 3300025906 | Bacteria | 2561 |
| 362 | Ga0207699_10056345 | 3300025906 | Bacteria | 2342 |
| 363 | Ga0207699_10193283 | 3300025906 | Bacteria | 1374 |
| 364 | Ga0207699_10253633 | 3300025906 | Bacteria | 1213 |
| 365 | Ga0207645_10012105 | 3300025907 | Bacteria | 5863 |
| 366 | Ga0207645_10118995 | 3300025907 | Bacteria | 1714 |
| 367 | Ga0207643_10051128 | 3300025908 | Bacteria | 2345 |
| 368 | Ga0207705_10000605 | 3300025909 | Bacteria | 30085 |
| 369 | Ga0207705_10004465 | 3300025909 | Bacteria | 10569 |
| 370 | Ga0207705_10009551 | 3300025909 | Bacteria | 7057 |
| 371 | Ga0207705_10047926 | 3300025909 | Bacteria | 3073 |
| 372 | Ga0207705_10051655 | 3300025909 | Bacteria | 2959 |
| 373 | Ga0207684_10000479 | 3300025910 | Bacteria | 51757 |
| 374 | Ga0207684_10028810 | 3300025910 | Bacteria | 4730 |
| 375 | Ga0207684_10029056 | 3300025910 | Bacteria | 4709 |
| 376 | Ga0207684_10030881 | 3300025910 | Bacteria | 4560 |
| 377 | Ga0207684_10040321 | 3300025910 | Bacteria | 3959 |
| 378 | Ga0207684_10212932 | 3300025910 | Bacteria | 1667 |
| 379 | Ga0207654_10045265 | 3300025911 | Bacteria | 2503 |
| 380 | Ga0207707_10047626 | 3300025912 | Bacteria | 3733 |
| 381 | Ga0207707_10071856 | 3300025912 | Bacteria | 3016 |
| 382 | Ga0207707_10120458 | 3300025912 | Bacteria | 2294 |
| 383 | Ga0207707_10314515 | 3300025912 | Bacteria | 1353 |
| 384 | Ga0207693_10000423 | 3300025915 | Bacteria | 38487 |
| 385 | Ga0207693_10000616 | 3300025915 | Bacteria | 31851 |
| 386 | Ga0207693_10001314 | 3300025915 | Bacteria | 22042 |
| 387 | Ga0207693_10004511 | 3300025915 | Bacteria | 11775 |
| 388 | Ga0207693_10018340 | 3300025915 | Bacteria | 5575 |
| 389 | Ga0207693_10038999 | 3300025915 | Bacteria | 3740 |
| 390 | Ga0207693_10049911 | 3300025915 | Bacteria | 3286 |
| 391 | Ga0207693_10058767 | 3300025915 | Bacteria | 3012 |
| 392 | Ga0207693_10104137 | 3300025915 | Bacteria | 2225 |
| 393 | Ga0207693_10109999 | 3300025915 | Bacteria | 2161 |
| 394 | Ga0207693_10340512 | 3300025915 | Bacteria | 1174 |
| 395 | Ga0207663_10019079 | 3300025916 | Bacteria | 3855 |
| 396 | Ga0207663_10025457 | 3300025916 | Bacteria | 3421 |
| 397 | Ga0207663_10178884 | 3300025916 | Bacteria | 1513 |
| 398 | Ga0207663_10333011 | 3300025916 | Bacteria | 1144 |
| 399 | Ga0207663_10444822 | 3300025916 | Bacteria | 999 |
| 400 | Ga0207660_10055674 | 3300025917 | Bacteria | 2828 |
| 401 | Ga0207660_10137480 | 3300025917 | Bacteria | 1865 |
| 402 | Ga0207660_10443040 | 3300025917 | Bacteria | 1050 |
| 403 | Ga0207660_10443617 | 3300025917 | Bacteria | 1049 |
| 404 | Ga0207657_10014859 | 3300025919 | Bacteria | 7577 |
| 405 | Ga0207657_10035895 | 3300025919 | Bacteria | 4440 |
| 406 | Ga0207657_10085054 | 3300025919 | Bacteria | 2650 |
| 407 | Ga0207657_10171111 | 3300025919 | Bacteria | 1760 |
| 408 | Ga0207657_10205318 | 3300025919 | Bacteria | 1583 |
| 409 | Ga0207657_10228154 | 3300025919 | Bacteria | 1490 |
| 410 | Ga0207649_10072909 | 3300025920 | Bacteria | 2198 |
| 411 | Ga0207652_10037186 | 3300025921 | Bacteria | 4120 |
| 412 | Ga0207652_10080224 | 3300025921 | Bacteria | 2852 |
| 413 | Ga0207652_10081927 | 3300025921 | Bacteria | 2823 |
| 414 | Ga0207652_10299031 | 3300025921 | Bacteria | 1453 |
| 415 | Ga0207652_10385309 | 3300025921 | Bacteria | 1265 |
| 416 | Ga0207646_10006081 | 3300025922 | Bacteria | 12571 |
| 417 | Ga0207646_10045679 | 3300025922 | Bacteria | 3931 |
| 418 | Ga0207646_10062112 | 3300025922 | Bacteria | 3335 |
| 419 | Ga0207646_10131593 | 3300025922 | Bacteria | 2252 |
| 420 | Ga0207646_10343093 | 3300025922 | Bacteria | 1349 |
| 421 | Ga0207681_10022242 | 3300025923 | Bacteria | 4042 |
| 422 | Ga0207681_10157716 | 3300025923 | Bacteria | 1707 |
| 423 | Ga0207681_10267441 | 3300025923 | Bacteria | 1341 |
| 424 | Ga0207659_10365851 | 3300025926 | Bacteria | 1200 |
| 425 | Ga0207687_10043445 | 3300025927 | Bacteria | 3097 |
| 426 | Ga0207687_10113941 | 3300025927 | Bacteria | 2012 |
| 427 | Ga0207700_10000840 | 3300025928 | Bacteria | 17750 |
| 428 | Ga0207700_10003624 | 3300025928 | Bacteria | 9002 |
| 429 | Ga0207700_10025128 | 3300025928 | Bacteria | 4132 |
| 430 | Ga0207700_10034240 | 3300025928 | Bacteria | 3645 |
| 431 | Ga0207700_10070230 | 3300025928 | Bacteria | 2691 |
| 432 | Ga0207700_10070506 | 3300025928 | Bacteria | 2687 |
| 433 | Ga0207700_10398870 | 3300025928 | Bacteria | 1205 |
| 434 | Ga0207700_10470036 | 3300025928 | Bacteria | 1110 |
| 435 | Ga0207700_10485833 | 3300025928 | Bacteria | 1092 |
| 436 | Ga0207700_10563855 | 3300025928 | Bacteria | 1012 |
| 437 | Ga0207664_10002562 | 3300025929 | Bacteria | 12015 |
| 438 | Ga0207664_10007405 | 3300025929 | Bacteria | 7610 |
| 439 | Ga0207664_10009335 | 3300025929 | Bacteria | 6878 |
| 440 | Ga0207664_10022468 | 3300025929 | Bacteria | 4710 |
| 441 | Ga0207664_10091112 | 3300025929 | Bacteria | 2499 |
| 442 | Ga0207664_10138041 | 3300025929 | Bacteria | 2059 |
| 443 | Ga0207664_10152694 | 3300025929 | Bacteria | 1963 |
| 444 | Ga0207664_10166916 | 3300025929 | Bacteria | 1881 |
| 445 | Ga0207664_10379661 | 3300025929 | Bacteria | 1254 |
| 446 | Ga0207664_10409196 | 3300025929 | Bacteria | 1207 |
| 447 | Ga0207690_10000233 | 3300025932 | Bacteria | 41413 |
| 448 | Ga0207690_10034960 | 3300025932 | Bacteria | 3241 |
| 449 | Ga0207690_10072212 | 3300025932 | Bacteria | 2383 |
| 450 | Ga0207706_10010102 | 3300025933 | Bacteria | 8644 |
| 451 | Ga0207706_10013880 | 3300025933 | Bacteria | 7305 |
| 452 | Ga0207709_10017023 | 3300025935 | Bacteria | 4052 |
| 453 | Ga0207670_10080370 | 3300025936 | Bacteria | 2279 |
| 454 | Ga0207670_10274267 | 3300025936 | Bacteria | 1312 |
| 455 | Ga0207669_10199321 | 3300025937 | Bacteria | 1451 |
| 456 | Ga0207669_10278897 | 3300025937 | Bacteria | 1259 |
| 457 | Ga0207704_10129262 | 3300025938 | Bacteria | 1746 |
| 458 | Ga0207665_10010160 | 3300025939 | Bacteria | 6179 |
| 459 | Ga0207665_10010827 | 3300025939 | Bacteria | 5987 |
| 460 | Ga0207665_10012787 | 3300025939 | Bacteria | 5521 |
| 461 | Ga0207665_10019709 | 3300025939 | Bacteria | 4433 |
| 462 | Ga0207665_10052319 | 3300025939 | Bacteria | 2751 |
| 463 | Ga0207665_10079465 | 3300025939 | Bacteria | 2254 |
| 464 | Ga0207691_10058013 | 3300025940 | Bacteria | 3522 |
| 465 | Ga0207691_10091675 | 3300025940 | Bacteria | 2723 |
| 466 | Ga0207691_10095113 | 3300025940 | Bacteria | 2665 |
| 467 | Ga0207711_10074539 | 3300025941 | Bacteria | 2951 |
| 468 | Ga0207689_10012341 | 3300025942 | Bacteria | 7310 |
| 469 | Ga0207689_10013563 | 3300025942 | Bacteria | 6955 |
| 470 | Ga0207689_10034437 | 3300025942 | Bacteria | 4207 |
| 471 | Ga0207689_10105595 | 3300025942 | Bacteria | 2314 |
| 472 | Ga0207661_10006204 | 3300025944 | Bacteria | 8454 |
| 473 | Ga0207661_10038456 | 3300025944 | Bacteria | 3750 |
| 474 | Ga0207661_10043418 | 3300025944 | Bacteria | 3547 |
| 475 | Ga0207661_10081658 | 3300025944 | Bacteria | 2671 |
| 476 | Ga0207679_10155343 | 3300025945 | Bacteria | 1868 |
| 477 | Ga0207679_10559789 | 3300025945 | Bacteria | 1027 |
| 478 | Ga0207667_10039431 | 3300025949 | Bacteria | 5034 |
| 479 | Ga0207667_10145631 | 3300025949 | Bacteria | 2438 |
| 480 | Ga0207712_10021393 | 3300025961 | Bacteria | 4247 |
| 481 | Ga0207668_10218930 | 3300025972 | Bacteria | 1527 |
| 482 | Ga0207640_10231704 | 3300025981 | Bacteria | 1421 |
| 483 | Ga0207640_10323884 | 3300025981 | Bacteria | 1228 |
| 484 | Ga0207640_10451791 | 3300025981 | Bacteria | 1059 |
| 485 | Ga0207658_10035510 | 3300025986 | Bacteria | 3570 |
| 486 | Ga0207658_10067634 | 3300025986 | Bacteria | 2692 |
| 487 | Ga0207677_10018136 | 3300026023 | Bacteria | 4218 |
| 488 | Ga0207677_10049056 | 3300026023 | Bacteria | 2846 |
| 489 | Ga0207703_10048810 | 3300026035 | Bacteria | 3419 |
| 490 | Ga0207703_10060869 | 3300026035 | Bacteria | 3089 |
| 491 | Ga0207639_10247707 | 3300026041 | Bacteria | 1552 |
| 492 | Ga0207678_10000312 | 3300026067 | Bacteria | 43816 |
| 493 | Ga0207678_10012393 | 3300026067 | Bacteria | 7484 |
| 494 | Ga0207678_10013964 | 3300026067 | Bacteria | 7060 |
| 495 | Ga0207678_10017380 | 3300026067 | Bacteria | 6315 |
| 496 | Ga0207678_10048817 | 3300026067 | Bacteria | 3658 |
| 497 | Ga0207708_10006460 | 3300026075 | Bacteria | 8688 |
| 498 | Ga0207708_10028114 | 3300026075 | Bacteria | 4258 |
| 499 | Ga0207708_10099374 | 3300026075 | Bacteria | 2251 |
| 500 | Ga0207641_10499711 | 3300026088 | Bacteria | 1181 |
| 501 | Ga0207648_10017557 | 3300026089 | Bacteria | 6503 |
| 502 | Ga0207648_10263458 | 3300026089 | Bacteria | 1538 |
| 503 | Ga0207648_10271385 | 3300026089 | Bacteria | 1515 |
| 504 | Ga0207676_10314727 | 3300026095 | Bacteria | 1434 |
| 505 | Ga0207674_10008344 | 3300026116 | Bacteria | 11986 |
| 506 | Ga0207674_10063478 | 3300026116 | Bacteria | 3729 |
| 507 | Ga0207675_100001298 | 3300026118 | Bacteria | 25048 |
| 508 | Ga0207675_100004705 | 3300026118 | Bacteria | 13138 |
| 509 | Ga0207683_10000649 | 3300026121 | Bacteria | 31834 |
| 510 | Ga0207683_10006893 | 3300026121 | Bacteria | 9728 |
| 511 | Ga0207683_10084875 | 3300026121 | Bacteria | 2815 |
| 512 | Ga0207683_10218904 | 3300026121 | Bacteria | 1734 |
| 513 | Ga0207698_10048510 | 3300026142 | Bacteria | 3225 |
| 514 | Ga0207698_10088301 | 3300026142 | Bacteria | 2528 |
| 515 | Ga0209179_1012043 | 3300027512 | Bacteria | 1546 |
| 516 | Ga0224573_1001931 | 3300028019 | Bacteria | 1604 |
| 517 | Ga0268266_10020337 | 3300028379 | Bacteria | 5658 |
| 518 | Ga0268266_10025742 | 3300028379 | Bacteria | 5006 |
| 519 | Ga0268266_10044204 | 3300028379 | Bacteria | 3808 |
| 520 | Ga0268264_10000114 | 3300028381 | Bacteria | 203211 |
| 521 | Ga0265338_10043340 | 3300028800 | Bacteria | 4175 |
| 522 | Ga0265338_10106020 | 3300028800 | Bacteria | 2277 |
| 523 | Ga0307511_10077799 | 3300030521 | Bacteria | 2358 |
| 524 | Ga0307512_10005068 | 3300030522 | Bacteria | 14007 |
| 525 | Ga0265325_10001514 | 3300031241 | Bacteria | 16341 |
| 526 | Ga0265329_10061583 | 3300031242 | Bacteria | 1188 |
| 527 | Ga0265340_10000928 | 3300031247 | Bacteria | 16665 |
| 528 | Ga0265339_10006895 | 3300031249 | Bacteria | 7405 |
| 529 | Ga0265316_10014581 | 3300031344 | Bacteria | 6911 |
| 530 | Ga0307508_10044056 | 3300031616 | Bacteria | 3994 |
| 531 | Ga0307508_10270284 | 3300031616 | Bacteria | 1294 |
| 532 | Ga0307508_10312737 | 3300031616 | Bacteria | 1163 |
| 533 | Ga0265342_10037671 | 3300031712 | Bacteria | 2948 |
| 534 | Ga0307518_10076530 | 3300031838 | Bacteria | 2419 |
| 535 | Ga0307406_10072519 | 3300031901 | Bacteria | 2261 |
| 536 | Ga0307415_100284151 | 3300032126 | Bacteria | 1362 |
| 537 | Ga0307507_10007414 | 3300033179 | Bacteria | 15982 |
| 538 | Ga0307507_10023724 | 3300033179 | Bacteria | 6719 |
| 539 | Ga0307510_10086353 | 3300033180 | Bacteria | 3010 |
| 540 | Ga0307510_10145824 | 3300033180 | Bacteria | 1999 |
| 541 | Ga0373959_0013904 | 3300034820 | Bacteria | 1458 |
| 542 | Ga0373926_0000667 | 3300035083 | Bacteria | 9402 |
| 543 | Ga0373934_0009033 | 3300035086 | Bacteria | 3727 |
| 544 | Ga0373934_0115528 | 3300035086 | Bacteria | 1090 |
| 545 | Ga0373944_0005783 | 3300035089 | Bacteria | 3269 |
| 546 | Ga0373944_0020733 | 3300035089 | Bacteria | 1896 |
| 547 | Ga0373944_0055187 | 3300035089 | Bacteria | 1261 |
| 548 | Ga0373951_0032090 | 3300035091 | Bacteria | 1241 |
| 549 | Ga0373923_0009399 | 3300035111 | Bacteria | 3528 |
| 550 | Ga0373923_0020665 | 3300035111 | Bacteria | 2560 |
| 551 | Ga0373923_0147266 | 3300035111 | Bacteria | 1067 |
| 552 | Ga0373936_0000597 | 3300035113 | Bacteria | 12494 |
| 553 | Ga0373936_0013959 | 3300035113 | Bacteria | 3068 |
| 554 | Ga0373936_0104530 | 3300035113 | Bacteria | 1197 |
| 555 | Ga0373936_0154416 | 3300035113 | Bacteria | 996 |
| 556 | Ga0373936_0284560 | 3300035113 | Bacteria | 743 |
| 557 | Ga0373945_0001009 | 3300035116 | Bacteria | 8420 |
| 558 | Ga0373945_0012897 | 3300035116 | Bacteria | 2783 |
| 559 | Ga0373953_0011944 | 3300035117 | Bacteria | 3061 |
| 560 | Ga0373953_0033364 | 3300035117 | Bacteria | 2013 |
| 561 | Ga0373954_0007461 | 3300035118 | Bacteria | 4786 |
| 562 | Ga0373954_0036395 | 3300035118 | Bacteria | 2285 |
| 563 | Ga0373956_0001023 | 3300035119 | Bacteria | 11549 |
| 564 | Ga0373956_0031742 | 3300035119 | Bacteria | 2316 |
| 565 | Ga0373956_0072342 | 3300035119 | Bacteria | 1574 |
| 566 | Ga0373956_0074141 | 3300035119 | Bacteria | 1555 |
| 567 | Ga0373957_0046125 | 3300035120 | Bacteria | 1653 |
| 568 | Ga0373957_0049648 | 3300035120 | Bacteria | 1602 |
| 569 | Ga0373957_0103488 | 3300035120 | Bacteria | 1141 |
| 570 | Ga0373943_0003599 | 3300035170 | Bacteria | 7050 |
| 571 | Ga0373943_0242661 | 3300035170 | Bacteria | 1010 |
| 572 | Ga0373946_0000489 | 3300035171 | Bacteria | 13111 |
| 573 | Ga0373946_0004311 | 3300035171 | Bacteria | 5084 |
| 574 | Ga0373946_0054315 | 3300035171 | Bacteria | 1685 |
| 575 | Ga0373946_0175312 | 3300035171 | Bacteria | 1014 |
| 576 | Ga0373955_0015974 | 3300035172 | Bacteria | 3686 |
| 577 | Ga0373955_0026007 | 3300035172 | Bacteria | 3010 |
| 578 | Ga0373955_0125258 | 3300035172 | Bacteria | 1496 |
| 579 | Ga0373955_0271875 | 3300035172 | Bacteria | 1018 |
| 580 | Ga0373924_0005932 | 3300035410 | Bacteria | 4353 |
| 581 | Ga0373924_0013799 | 3300035410 | Bacteria | 3041 |
| 582 | Ga0373924_0031541 | 3300035410 | Bacteria | 2131 |
| 583 | Ga0373924_0045623 | 3300035410 | Bacteria | 1803 |
| 584 | Ga0373924_0097369 | 3300035410 | Bacteria | 1263 |
| 585 | Ga0373924_0106918 | 3300035410 | Bacteria | 1206 |
| 586 | Ga0373931_0047027 | 3300035691 | Bacteria | 2283 |
| 587 | Ga0373931_0143514 | 3300035691 | Bacteria | 1385 |
| 588 | Ga0373931_0240431 | 3300035691 | Bacteria | 1097 |
| 589 | Ga0373931_0246744 | 3300035691 | Bacteria | 1084 |
| 590 | Ga0373935_0000490 | 3300035692 | Bacteria | 20488 |
| 591 | Ga0373935_0028478 | 3300035692 | Bacteria | 3453 |
| 592 | Ga0373935_0034971 | 3300035692 | Bacteria | 3134 |
| 593 | Ga0373935_0103837 | 3300035692 | Bacteria | 1877 |
| 594 | Ga0373935_0106863 | 3300035692 | Bacteria | 1852 |
| 595 | Ga0373935_0180472 | 3300035692 | Bacteria | 1449 |
| 596 | Ga0373927_0009224 | 3300035695 | Bacteria | 6619 |
| 597 | Ga0373927_0048886 | 3300035695 | Bacteria | 2735 |
| 598 | Ga0373927_0059376 | 3300035695 | Bacteria | 2473 |
| 599 | Ga0373933_0005326 | 3300035724 | Bacteria | 7011 |
| 600 | Ga0373933_0044479 | 3300035724 | Bacteria | 2630 |
| 601 | Ga0373933_0099998 | 3300035724 | Bacteria | 1798 |
| 602 | Ga0373933_0148064 | 3300035724 | Bacteria | 1485 |
| 603 | Ga0373933_0178812 | 3300035724 | Bacteria | 1352 |
| 604 | Ga0373933_0291362 | 3300035724 | Bacteria | 1055 |
| 605 | Ga0373947_0005336 | 3300035725 | Bacteria | 7509 |
| 606 | Ga0373947_0049079 | 3300035725 | Bacteria | 2533 |
| 607 | Ga0373947_0154150 | 3300035725 | Bacteria | 1481 |
| 608 | Ga0373937_0019941 | 3300036401 | Bacteria | 6005 |
| 609 | Ga0373937_0054768 | 3300036401 | Bacteria | 3660 |
| 610 | Ga0373937_0132730 | 3300036401 | Bacteria | 2326 |
| 611 | Ga0373937_0268952 | 3300036401 | Bacteria | 1608 |
| 612 | Ga0373925_0012478 | 3300037068 | Bacteria | 6154 |
| 613 | Ga0373925_0102763 | 3300037068 | Bacteria | 2199 |
| 614 | Ga0373925_0118787 | 3300037068 | Bacteria | 2050 |
| 615 | Ga0395899_0388439 | 3300037312 | Bacteria | 926 |
| 616 | Ga0395900_0221700 | 3300037418 | Bacteria | 1906 |
| 617 | Ga0395900_0288021 | 3300037418 | Bacteria | 1632 |
| 618 | Ga0436364_0037108 | 3300037853 | Bacteria | 71393 |
| 619 | Ga0436364_0189458 | 3300037853 | Bacteria | 4920 |
| 620 | Ga0436364_0193972 | 3300037853 | Bacteria | 2768 |
| 621 | Ga0436364_0265841 | 3300037853 | Bacteria | 68488 |
| 622 | Ga0436364_0316624 | 3300037853 | Bacteria | 5998 |
| 623 | Ga0436364_0467315 | 3300037853 | Bacteria | 53239 |
| 624 | Ga0436364_0527355 | 3300037853 | Bacteria | 148076 |
| 625 | Ga0436364_0802113 | 3300037853 | Bacteria | 4851 |
| 626 | Ga0436364_0815450 | 3300037853 | Bacteria | 1113 |
| 627 | Ga0436364_0828822 | 3300037853 | Bacteria | 4753 |
| 628 | Ga0436364_1002699 | 3300037853 | Bacteria | 6488 |
| 629 | Ga0436364_1416932 | 3300037853 | Bacteria | 21451 |
| 630 | Ga0436364_1455692 | 3300037853 | Bacteria | 19581 |
| 631 | Ga0395901_0046735 | 3300038443 | Bacteria | 4497 |
| 632 | Ga0395901_0104373 | 3300038443 | Bacteria | 2975 |
| 633 | Ga0436365_0539792 | 3300039437 | Bacteria | 8157 |
| 634 | Ga0436365_0670227 | 3300039437 | Bacteria | 1769 |
| 635 | Ga0436365_1206577 | 3300039437 | Bacteria | 7365 |
| 636 | Ga0436365_1253726 | 3300039437 | Bacteria | 22924 |
| 637 | Ga0436363_0169189 | 3300039450 | Bacteria | 13441 |
| 638 | Ga0436363_0225351 | 3300039450 | Bacteria | 3283 |
| 639 | Ga0436363_0309457 | 3300039450 | Bacteria | 2019 |
| 640 | Ga0436363_0317063 | 3300039450 | Bacteria | 4323 |
| 641 | Ga0436362_0000051 | 3300039453 | Bacteria | 1038 |
| 642 | Ga0436362_0173909 | 3300039453 | Bacteria | 1970 |
| 643 | Ga0439448_0007690 | 3300042005 | Bacteria | 3133 |
| 644 | Ga0439448_0085225 | 3300042005 | Bacteria | 1064 |
| 645 | Ga0439463_010541 | 3300042016 | Bacteria | 2270 |
| 646 | Ga0439460_0000696 | 3300042461 | Bacteria | 7462 |
| 647 | Ga0466969_0015291 | 3300044656 | Bacteria | 4023 |
| 648 | Ga0466969_0102550 | 3300044656 | Bacteria | 1345 |
| 649 | Ga0466972_0109290 | 3300044658 | Bacteria | 1307 |
| 650 | Ga0466965_0143410 | 3300044683 | Bacteria | 1245 |
| 651 | Ga0466966_0011757 | 3300044684 | Bacteria | 5802 |
| 652 | Ga0466966_0044068 | 3300044684 | Bacteria | 2857 |
| 653 | Ga0466961_0011066 | 3300044693 | Bacteria | 5766 |
| 654 | Ga0466963_0024648 | 3300044694 | Bacteria | 3830 |
| 655 | Ga0466963_0055385 | 3300044694 | Bacteria | 2637 |
| 656 | Ga0466963_0063730 | 3300044694 | Bacteria | 2468 |
| 657 | Ga0466963_0240275 | 3300044694 | Bacteria | 1270 |
| 658 | Ga0466964_0121752 | 3300044706 | Bacteria | 1177 |
| 659 | Ga0466971_0001144 | 3300044719 | Bacteria | 11019 |
| 660 | Ga0466971_0082049 | 3300044719 | Bacteria | 1471 |
| 661 | Ga0466971_0181244 | 3300044719 | Unclassified | 990 |
| 662 | Ga0466968_0054608 | 3300044735 | Bacteria | 1713 |
| 663 | Ga0466957_0063349 | 3300044842 | Bacteria | 2273 |
| 664 | Ga0466960_0013128 | 3300044901 | Bacteria | 3512 |
| 665 | Ga0466960_0029520 | 3300044901 | Bacteria | 2517 |
| 666 | Ga0466959_0056285 | 3300045049 | Bacteria | 2869 |
| 667 | Ga0466959_0094925 | 3300045049 | Bacteria | 2139 |
| 668 | Ga0466958_0003222 | 3300045836 | Bacteria | 8418 |
| 669 | Ga0466958_0049571 | 3300045836 | Bacteria | 2541 |
| 670 | Ga0466958_0244481 | 3300045836 | Bacteria | 1147 |
| 671 | Ga0466967_0003944 | 3300045976 | Bacteria | 9865 |
| 672 | Ga0466967_0004464 | 3300045976 | Bacteria | 9440 |
| 673 | Ga0466967_0035721 | 3300045976 | Bacteria | 4234 |
| 674 | Ga0466967_0043727 | 3300045976 | Bacteria | 3880 |
| 675 | Ga0466967_0058459 | 3300045976 | Bacteria | 3409 |
| 676 | Ga0466967_0061983 | 3300045976 | Bacteria | 3319 |
| 677 | Ga0466967_0066989 | 3300045976 | Bacteria | 3201 |
| 678 | Ga0495592_0034357 | 3300046454 | Bacteria | 3822 |
| 679 | Ga0495592_0057729 | 3300046454 | Bacteria | 2864 |
| 680 | Ga0495592_0068721 | 3300046454 | Bacteria | 2585 |
| 681 | Ga0495592_0278547 | 3300046454 | Bacteria | 1094 |
| 682 | Ga0495603_0050085 | 3300046455 | Bacteria | 2484 |
| 683 | Ga0495603_0225644 | 3300046455 | Bacteria | 1080 |
| 684 | Ga0495629_0014236 | 3300046459 | Bacteria | 5728 |
| 685 | Ga0495629_0229545 | 3300046459 | Bacteria | 1279 |
| 686 | Ga0495641_0002946 | 3300046461 | Bacteria | 13111 |
| 687 | Ga0495641_0027757 | 3300046461 | Bacteria | 2747 |
| 688 | Ga0495641_0126664 | 3300046461 | Bacteria | 1140 |
| 689 | Ga0495641_0156387 | 3300046461 | Bacteria | 1019 |
| 690 | Ga0495651_0016782 | 3300046462 | Bacteria | 5671 |
| 691 | Ga0495651_0024364 | 3300046462 | Bacteria | 4708 |
| 692 | Ga0495651_0071352 | 3300046462 | Bacteria | 2640 |
| 693 | Ga0495651_0096301 | 3300046462 | Bacteria | 2211 |
| 694 | Ga0495651_0126208 | 3300046462 | Bacteria | 1873 |
| 695 | Ga0495651_0295461 | 3300046462 | Bacteria | 1088 |
| 696 | Ga0495653_0001335 | 3300046463 | Bacteria | 19148 |
| 697 | Ga0495653_0023619 | 3300046463 | Bacteria | 4963 |
| 698 | Ga0495653_0032698 | 3300046463 | Bacteria | 4128 |
| 699 | Ga0495653_0057148 | 3300046463 | Bacteria | 2971 |
| 700 | Ga0495653_0098223 | 3300046463 | Bacteria | 2126 |
| 701 | Ga0495653_0174842 | 3300046463 | Bacteria | 1478 |
| 702 | Ga0495650_0029405 | 3300046471 | Bacteria | 2505 |
| 703 | Ga0495582_0036850 | 3300046473 | Bacteria | 2690 |
| 704 | Ga0495582_0044141 | 3300046473 | Bacteria | 2455 |
| 705 | Ga0495639_0008326 | 3300046475 | Bacteria | 4449 |
| 706 | Ga0495662_0011936 | 3300046476 | Bacteria | 4245 |
| 707 | Ga0495662_0015085 | 3300046476 | Bacteria | 3754 |
| 708 | Ga0495662_0021641 | 3300046476 | Bacteria | 3107 |
| 709 | Ga0495662_0178166 | 3300046476 | Bacteria | 1047 |
| 710 | Ga0495664_0002865 | 3300046477 | Bacteria | 9295 |
| 711 | Ga0495664_0023176 | 3300046477 | Bacteria | 3601 |
| 712 | Ga0495664_0028754 | 3300046477 | Bacteria | 3247 |
| 713 | Ga0495664_0029378 | 3300046477 | Bacteria | 3214 |
| 714 | Ga0495664_0036647 | 3300046477 | Bacteria | 2891 |
| 715 | Ga0495664_0169753 | 3300046477 | Bacteria | 1323 |
| 716 | Ga0495585_0055708 | 3300046492 | Bacteria | 2184 |
| 717 | Ga0495608_0024286 | 3300046511 | Bacteria | 4147 |
| 718 | Ga0495608_0035829 | 3300046511 | Bacteria | 3343 |
| 719 | Ga0495608_0043656 | 3300046511 | Bacteria | 2994 |
| 720 | Ga0495608_0047430 | 3300046511 | Bacteria | 2856 |
| 721 | Ga0495608_0067321 | 3300046511 | Bacteria | 2342 |
| 722 | Ga0495608_0158385 | 3300046511 | Bacteria | 1440 |
| 723 | Ga0495618_0073017 | 3300046514 | Bacteria | 2183 |
| 724 | Ga0495618_0113163 | 3300046514 | Bacteria | 1737 |
| 725 | Ga0495618_0199255 | 3300046514 | Bacteria | 1267 |
| 726 | Ga0495618_0219203 | 3300046514 | Bacteria | 1200 |
| 727 | Ga0495628_0072387 | 3300046516 | Bacteria | 2685 |
| 728 | Ga0495628_0099592 | 3300046516 | Bacteria | 2244 |
| 729 | Ga0495628_0427396 | 3300046516 | Bacteria | 964 |
| 730 | Ga0495630_0060374 | 3300046517 | Bacteria | 2845 |
| 731 | Ga0495630_0112431 | 3300046517 | Bacteria | 2062 |
| 732 | Ga0495630_0360727 | 3300046517 | Bacteria | 1112 |
| 733 | Ga0495666_0019870 | 3300046526 | Bacteria | 3331 |
| 734 | Ga0495652_0003709 | 3300046529 | Bacteria | 14945 |
| 735 | Ga0495652_0040081 | 3300046529 | Bacteria | 4048 |
| 736 | Ga0495652_0062957 | 3300046529 | Bacteria | 3125 |
| 737 | Ga0495652_0261704 | 3300046529 | Bacteria | 1276 |
| 738 | Ga0495652_0269066 | 3300046529 | Bacteria | 1253 |
| 739 | Ga0495652_0327102 | 3300046529 | Bacteria | 1105 |
| 740 | Ga0495652_0350098 | 3300046529 | Bacteria | 1059 |
| 741 | Ga0495665_0008348 | 3300046531 | Bacteria | 5616 |
| 742 | Ga0495665_0012235 | 3300046531 | Bacteria | 4643 |
| 743 | Ga0495665_0188220 | 3300046531 | Bacteria | 1071 |
| 744 | Ga0495665_0228693 | 3300046531 | Bacteria | 960 |
| 745 | Ga0495640_0013187 | 3300046533 | Bacteria | 6287 |
| 746 | Ga0495640_0064056 | 3300046533 | Bacteria | 2487 |
| 747 | Ga0495640_0067799 | 3300046533 | Bacteria | 2402 |
| 748 | Ga0495640_0109797 | 3300046533 | Bacteria | 1803 |
| 749 | Ga0495640_0173616 | 3300046533 | Bacteria | 1376 |
| 750 | Ga0495640_0248942 | 3300046533 | Bacteria | 1113 |
| 751 | Ga0495586_0148651 | 3300046535 | Bacteria | 1317 |
| 752 | Ga0495587_0024602 | 3300046536 | Bacteria | 3688 |
| 753 | Ga0495587_0045905 | 3300046536 | Bacteria | 2595 |
| 754 | Ga0495587_0097864 | 3300046536 | Bacteria | 1691 |
| 755 | Ga0495587_0164432 | 3300046536 | Bacteria | 1262 |
| 756 | Ga0495587_0197398 | 3300046536 | Bacteria | 1138 |
| 757 | Ga0495587_0208595 | 3300046536 | Bacteria | 1103 |
| 758 | Ga0495645_0033594 | 3300046543 | Bacteria | 3742 |
| 759 | Ga0495645_0075147 | 3300046543 | Bacteria | 2432 |
| 760 | Ga0495645_0101904 | 3300046543 | Bacteria | 2040 |
| 761 | Ga0495645_0114693 | 3300046543 | Bacteria | 1903 |
| 762 | Ga0495645_0252153 | 3300046543 | Bacteria | 1172 |
| 763 | Ga0495645_0305593 | 3300046543 | Bacteria | 1037 |
| 764 | Ga0495667_0003592 | 3300046559 | Bacteria | 10432 |
| 765 | Ga0495667_0004931 | 3300046559 | Bacteria | 9025 |
| 766 | Ga0495667_0094785 | 3300046559 | Bacteria | 1932 |
| 767 | Ga0495667_0118270 | 3300046559 | Bacteria | 1711 |
| 768 | Ga0495667_0171632 | 3300046559 | Bacteria | 1393 |
| 769 | Ga0495667_0210273 | 3300046559 | Bacteria | 1243 |
| 770 | Ga0495634_0013707 | 3300046642 | Bacteria | 5853 |
| 771 | Ga0495634_0020609 | 3300046642 | Bacteria | 4673 |
| 772 | Ga0495634_0039737 | 3300046642 | Bacteria | 3202 |
| 773 | Ga0495634_0081204 | 3300046642 | Bacteria | 2121 |
| 774 | Ga0495634_0103209 | 3300046642 | Bacteria | 1840 |
| 775 | Ga0495634_0104408 | 3300046642 | Bacteria | 1828 |
| 776 | Ga0495634_0131825 | 3300046642 | Bacteria | 1592 |
| 777 | Ga0495635_0000167 | 3300046663 | Bacteria | 40888 |
| 778 | Ga0495635_0003308 | 3300046663 | Bacteria | 11137 |
| 779 | Ga0495635_0021276 | 3300046663 | Bacteria | 4521 |
| 780 | Ga0495635_0034908 | 3300046663 | Bacteria | 3488 |
| 781 | Ga0495635_0163881 | 3300046663 | Bacteria | 1513 |
| 782 | Ga0495635_0184946 | 3300046663 | Bacteria | 1415 |
| 783 | Ga0495635_0283110 | 3300046663 | Bacteria | 1113 |
| 784 | Ga0495588_0095718 | 3300046674 | Bacteria | 1557 |
| 785 | Ga0495657_0009170 | 3300046675 | Bacteria | 7516 |
| 786 | Ga0495657_0014229 | 3300046675 | Bacteria | 5845 |
| 787 | Ga0495657_0019494 | 3300046675 | Bacteria | 4892 |
| 788 | Ga0495657_0033670 | 3300046675 | Bacteria | 3565 |
| 789 | Ga0495657_0047773 | 3300046675 | Bacteria | 2891 |
| 790 | Ga0495657_0061025 | 3300046675 | Bacteria | 2495 |
| 791 | Ga0495657_0251246 | 3300046675 | Bacteria | 1064 |
| 792 | Ga0495599_0013087 | 3300046678 | Bacteria | 5124 |
| 793 | Ga0495599_0017167 | 3300046678 | Bacteria | 4498 |
| 794 | Ga0495599_0036826 | 3300046678 | Bacteria | 3073 |
| 795 | Ga0495599_0126056 | 3300046678 | Bacteria | 1591 |
| 796 | Ga0495599_0139835 | 3300046678 | Bacteria | 1502 |
| 797 | Ga0495599_0337196 | 3300046678 | Bacteria | 905 |
| 798 | Ga0495623_0009884 | 3300046679 | Bacteria | 6179 |
| 799 | Ga0495623_0119571 | 3300046679 | Bacteria | 1587 |
| 800 | Ga0495623_0148027 | 3300046679 | Bacteria | 1390 |
| 801 | Ga0495646_0005026 | 3300046680 | Bacteria | 8342 |
| 802 | Ga0495646_0026821 | 3300046680 | Bacteria | 3616 |
| 803 | Ga0495646_0048742 | 3300046680 | Bacteria | 2572 |
| 804 | Ga0495646_0130271 | 3300046680 | Bacteria | 1416 |
| 805 | Ga0495646_0136677 | 3300046680 | Bacteria | 1374 |
| 806 | Ga0495646_0195336 | 3300046680 | Bacteria | 1104 |
| 807 | Ga0495646_0195831 | 3300046680 | Bacteria | 1102 |
| 808 | Ga0495647_0052981 | 3300046681 | Bacteria | 1581 |
| 809 | Ga0495658_0033886 | 3300046683 | Bacteria | 2800 |
| 810 | Ga0495658_0143748 | 3300046683 | Bacteria | 1460 |
| 811 | Ga0495613_0025552 | 3300046689 | Bacteria | 4400 |
| 812 | Ga0495613_0164157 | 3300046689 | Bacteria | 1579 |
| 813 | Ga0495613_0167987 | 3300046689 | Bacteria | 1558 |
| 814 | Ga0495613_0241634 | 3300046689 | Bacteria | 1262 |
| 815 | Ga0495613_0253533 | 3300046689 | Bacteria | 1227 |
| 816 | Ga0495624_0023389 | 3300046690 | Bacteria | 4075 |
| 817 | Ga0495624_0063148 | 3300046690 | Bacteria | 2315 |
| 818 | Ga0495624_0131799 | 3300046690 | Bacteria | 1532 |
| 819 | Ga0495624_0403089 | 3300046690 | Bacteria | 821 |
| 820 | Ga0495600_0023959 | 3300046809 | Bacteria | 3928 |
| 821 | Ga0495600_0033655 | 3300046809 | Bacteria | 3326 |
| 822 | Ga0495600_0040966 | 3300046809 | Bacteria | 3018 |
| 823 | Ga0495600_0286995 | 3300046809 | Bacteria | 1040 |
| 824 | Ga0495581_0146660 | 3300047315 | Bacteria | 1377 |
| 825 | Ga0495581_0201738 | 3300047315 | Bacteria | 1163 |
| 826 | Ga0495604_0021763 | 3300047317 | Bacteria | 5119 |
| 827 | Ga0495604_0080993 | 3300047317 | Bacteria | 2431 |
| 828 | Ga0495604_0238532 | 3300047317 | Bacteria | 1244 |
| 829 | Ga0495604_0265431 | 3300047317 | Bacteria | 1165 |
| 830 | Ga0495674_0000044 | 3300047319 | Bacteria | 84651 |
| 831 | Ga0495674_0018759 | 3300047319 | Bacteria | 6438 |
| 832 | Ga0495674_0051727 | 3300047319 | Bacteria | 3621 |
| 833 | Ga0495674_0125764 | 3300047319 | Bacteria | 2163 |
| 834 | Ga0495674_0281774 | 3300047319 | Bacteria | 1361 |
| 835 | Ga0495674_0332714 | 3300047319 | Bacteria | 1235 |
| 836 | Ga0495674_0463302 | 3300047319 | Bacteria | 1017 |
| 837 | Ga0495676_0006483 | 3300047321 | Bacteria | 10787 |
| 838 | Ga0495676_0153882 | 3300047321 | Bacteria | 1633 |
| 839 | Ga0495676_0290285 | 3300047321 | Bacteria | 1105 |
| 840 | Ga0495680_0007276 | 3300047322 | Bacteria | 10187 |
| 841 | Ga0495680_0018692 | 3300047322 | Bacteria | 5873 |
| 842 | Ga0495680_0030279 | 3300047322 | Bacteria | 4421 |
| 843 | Ga0495680_0038973 | 3300047322 | Bacteria | 3794 |
| 844 | Ga0495680_0039241 | 3300047322 | Bacteria | 3779 |
| 845 | Ga0495680_0043735 | 3300047322 | Bacteria | 3544 |
| 846 | Ga0495680_0061177 | 3300047322 | Bacteria | 2897 |
| 847 | Ga0495675_0015972 | 3300047444 | Bacteria | 4748 |
| 848 | Ga0495675_0036317 | 3300047444 | Bacteria | 3143 |
| 849 | Ga0495675_0042569 | 3300047444 | Bacteria | 2893 |
| 850 | Ga0495675_0184658 | 3300047444 | Bacteria | 1275 |
| 851 | Ga0495675_0322501 | 3300047444 | Bacteria | 913 |
| 852 | Ga0495684_0005883 | 3300047471 | Bacteria | 9527 |
| 853 | Ga0495684_0014401 | 3300047471 | Bacteria | 6085 |
| 854 | Ga0495684_0015548 | 3300047471 | Bacteria | 5859 |
| 855 | Ga0495684_0034125 | 3300047471 | Bacteria | 3904 |
| 856 | Ga0495684_0054474 | 3300047471 | Bacteria | 3050 |
| 857 | Ga0495684_0107739 | 3300047471 | Bacteria | 2104 |
| 858 | Ga0495684_0137970 | 3300047471 | Bacteria | 1829 |
| 859 | Ga0495593_0035798 | 3300047673 | Bacteria | 2693 |
| 860 | Ga0495593_0191930 | 3300047673 | Bacteria | 1027 |
| 861 | Ga0495602_0033246 | 3300048088 | Bacteria | 4841 |
| 862 | Ga0495602_0033697 | 3300048088 | Bacteria | 4801 |
| 863 | Ga0495602_0076321 | 3300048088 | Bacteria | 2840 |
| 864 | Ga0495602_0102485 | 3300048088 | Bacteria | 2345 |
| 865 | Ga0495602_0216394 | 3300048088 | Bacteria | 1449 |
| 866 | Ga0495602_0282297 | 3300048088 | Bacteria | 1223 |
| 867 | Ga0496100_0110210 | 3300048903 | Bacteria | 1911 |
| 868 | Ga0496100_0513099 | 3300048903 | Bacteria | 925 |
| 869 | Ga0496101_0009532 | 3300048904 | Bacteria | 6383 |
| 870 | Ga0496101_0059487 | 3300048904 | Bacteria | 2769 |
| 871 | Ga0496101_0360857 | 3300048904 | Bacteria | 1142 |
| 872 | Ga0496101_0518056 | 3300048904 | Bacteria | 942 |
| 873 | Ga0496102_0023852 | 3300048905 | Bacteria | 5437 |
| 874 | Ga0496102_0111766 | 3300048905 | Bacteria | 2547 |
| 875 | Ga0496103_0009543 | 3300048906 | Bacteria | 5745 |
| 876 | Ga0496103_0031978 | 3300048906 | Bacteria | 3209 |
| 877 | Ga0496104_0218082 | 3300048907 | Bacteria | 1820 |
| 878 | Ga0496104_0304312 | 3300048907 | Bacteria | 1506 |
| 879 | Ga0496105_0037155 | 3300048908 | Bacteria | 4011 |
| 880 | Ga0496106_0001193 | 3300048909 | Bacteria | 19373 |
| 881 | Ga0496106_0055066 | 3300048909 | Bacteria | 3005 |
| 882 | Ga0496107_0034499 | 3300048910 | Bacteria | 3624 |
| 883 | Ga0496107_0053432 | 3300048910 | Bacteria | 2914 |
| 884 | Ga0496107_0166075 | 3300048910 | Bacteria | 1636 |
| 885 | Ga0496107_0218336 | 3300048910 | Bacteria | 1418 |
| 886 | Ga0496108_0001106 | 3300048911 | Bacteria | 21089 |
| 887 | Ga0496108_0134026 | 3300048911 | Bacteria | 2130 |
| 888 | Ga0496109_0000747 | 3300048912 | Bacteria | 27044 |
| 889 | Ga0496109_0221092 | 3300048912 | Bacteria | 1781 |
| 890 | Ga0496109_0247183 | 3300048912 | Bacteria | 1679 |
| 891 | Ga0496109_0599360 | 3300048912 | Bacteria | 1038 |
| 892 | Ga0496110_0126550 | 3300048913 | Bacteria | 2305 |
| 893 | Ga0496110_0258590 | 3300048913 | Bacteria | 1585 |
| 894 | Ga0496113_0279939 | 3300048916 | Bacteria | 1334 |
| 895 | Ga0496114_0097916 | 3300048917 | Bacteria | 2500 |
| 896 | Ga0496114_0207913 | 3300048917 | Bacteria | 1716 |
| 897 | Ga0496114_0377164 | 3300048917 | Bacteria | 1255 |
| 898 | Ga0496115_0222450 | 3300048918 | Bacteria | 1558 |
| 899 | Ga0496118_0003661 | 3300048921 | Bacteria | 19087 |
| 900 | Ga0496121_0139984 | 3300048924 | Bacteria | 1797 |
| 901 | Ga0496126_0005213 | 3300048929 | Bacteria | 14998 |
| 902 | Ga0496126_0017841 | 3300048929 | Bacteria | 7062 |
| 903 | Ga0496126_0073428 | 3300048929 | Bacteria | 3041 |
| 904 | Ga0496126_0110089 | 3300048929 | Bacteria | 2400 |
| 905 | Ga0496126_0159946 | 3300048929 | Bacteria | 1925 |
| 906 | Ga0501032_0007563 | 3300049569 | Bacteria | 7933 |
| 907 | Ga0501032_0016176 | 3300049569 | Bacteria | 5250 |
| 908 | Ga0501034_0004854 | 3300049571 | Bacteria | 14839 |
| 909 | Ga0501034_0004904 | 3300049571 | Bacteria | 14752 |
| 910 | Ga0501034_0319147 | 3300049571 | Bacteria | 1487 |
| 911 | Ga0501034_0363085 | 3300049571 | Bacteria | 1375 |
| 912 | Ga0501034_0862977 | 3300049571 | Bacteria | 795 |
| 913 | Ga0501036_0000454 | 3300049572 | Bacteria | 29263 |
| 914 | Ga0501036_0092292 | 3300049572 | Bacteria | 2558 |
| 915 | Ga0501037_0201724 | 3300049573 | Bacteria | 1405 |
| 916 | Ga0501038_0013310 | 3300049574 | Bacteria | 7502 |
| 917 | Ga0501039_0012909 | 3300049575 | Bacteria | 6388 |
| 918 | Ga0501039_0565714 | 3300049575 | Bacteria | 892 |
| 919 | Ga0501042_0129725 | 3300049578 | Bacteria | 1817 |
| 920 | Ga0501043_0042995 | 3300049579 | Bacteria | 3552 |
| 921 | Ga0501043_0138775 | 3300049579 | Bacteria | 1904 |
| 922 | Ga0501046_0008990 | 3300049580 | Bacteria | 8671 |
| 923 | Ga0501046_0030084 | 3300049580 | Bacteria | 4410 |
| 924 | Ga0501047_0000072 | 3300049581 | Bacteria | 126542 |
| 925 | Ga0501047_0007135 | 3300049581 | Bacteria | 10496 |
| 926 | Ga0501047_0033093 | 3300049581 | Bacteria | 4991 |
| 927 | Ga0501047_0079709 | 3300049581 | Bacteria | 3148 |
| 928 | Ga0501048_0002246 | 3300049582 | Bacteria | 14720 |
| 929 | Ga0501048_0018471 | 3300049582 | Bacteria | 5127 |
| 930 | Ga0501069_0113217 | 3300049585 | Bacteria | 1546 |
| 931 | Ga0501069_0296354 | 3300049585 | Bacteria | 948 |
| 932 | Ga0501070_0000288 | 3300049586 | Bacteria | 47185 |
| 933 | Ga0501070_0000852 | 3300049586 | Bacteria | 27667 |
| 934 | Ga0501073_0105594 | 3300049589 | Bacteria | 1954 |
| 935 | Ga0501074_0026809 | 3300049590 | Bacteria | 4178 |
| 936 | Ga0501074_0072969 | 3300049590 | Bacteria | 2465 |
| 937 | Ga0501074_0108742 | 3300049590 | Bacteria | 1984 |
| 938 | Ga0501080_0140500 | 3300049742 | Bacteria | 2233 |
| 939 | Ga0501080_0196765 | 3300049742 | Bacteria | 1851 |
| 940 | Ga0501081_0178963 | 3300049743 | Bacteria | 1533 |
| 941 | Ga0501083_0041242 | 3300049744 | Bacteria | 3131 |
| 942 | Ga0501083_0099697 | 3300049744 | Bacteria | 1916 |
| 943 | Ga0501035_0091771 | 3300049822 | Bacteria | 2673 |
| 944 | Ga0501035_0114385 | 3300049822 | Bacteria | 2363 |
| 945 | Ga0501044_0007276 | 3300049823 | Bacteria | 12164 |
| 946 | Ga0501044_0055104 | 3300049823 | Bacteria | 4084 |
| 947 | Ga0501044_0198518 | 3300049823 | Bacteria | 1965 |
| 948 | Ga0501044_0441860 | 3300049823 | Bacteria | 1208 |
| 949 | Ga0501044_0456662 | 3300049823 | Bacteria | 1183 |
| 950 | Ga0501044_0511868 | 3300049823 | Bacteria | 1101 |
| 951 | Ga0501045_0228231 | 3300049824 | Bacteria | 1386 |
| 952 | nmdc:mga03n38_139213_c1 | 3300050490 | Bacteria | 1211 |
| 953 | nmdc:mga00v17_3958_c1 | 3300050491 | Bacteria | 7641 |
| 954 | nmdc:mga0yw44_7088_c1 | 3300050492 | Bacteria | 5487 |
| 955 | nmdc:mga07m45_33161_c1 | 3300050496 | Bacteria | 2867 |
| 956 | nmdc:mga07m45_37395_c1 | 3300050496 | Bacteria | 2707 |
| 957 | nmdc:mga05p37_360675_c1 | 3300050507 | Bacteria | 1709 |
| 958 | nmdc:mga06r32_4119_c1 | 3300050510 | Bacteria | 13015 |
| 959 | nmdc:mga0n895_49351_c1 | 3300050512 | Bacteria | 4123 |
| 960 | nmdc:mga0n895_559180_c1 | 3300050512 | Bacteria | 1149 |
| 961 | nmdc:mga0rr50_20976_c1 | 3300050513 | Bacteria | 4452 |
| 962 | nmdc:mga08x19_66625_c1 | 3300050514 | Bacteria | 2341 |
| 963 | nmdc:mga0a205_185592_c1 | 3300050515 | Bacteria | 1973 |
| 964 | nmdc:mga0sz30_34660_c1 | 3300050516 | Bacteria | 2103 |
| 965 | nmdc:mga0sz30_76074_c1 | 3300050516 | Bacteria | 1449 |
| 966 | Ga0495601_0061607 | 3300053077 | Bacteria | 2381 |
| 967 | Ga0495601_0069571 | 3300053077 | Bacteria | 2245 |
| 968 | Ga0495601_0126962 | 3300053077 | Bacteria | 1659 |
| 969 | Ga0495601_0155639 | 3300053077 | Bacteria | 1492 |
| 970 | Ga0495601_0287154 | 3300053077 | Bacteria | 1072 |
| 971 | Ga0495601_0311927 | 3300053077 | Bacteria | 1024 |
| 972 | Ga0495612_0043819 | 3300053078 | Bacteria | 1829 |
| 973 | Ga0495612_0052909 | 3300053078 | Bacteria | 1671 |
| 974 | Ga0495612_0093197 | 3300053078 | Bacteria | 1277 |
| 975 | Ga0495595_0017355 | 3300053084 | Bacteria | 3096 |
| 976 | Ga0495619_0010567 | 3300053085 | Bacteria | 5809 |
| 977 | Ga0495619_0013573 | 3300053085 | Bacteria | 5133 |
| 978 | Ga0495619_0101237 | 3300053085 | Bacteria | 1961 |
| 979 | Ga0495619_0105622 | 3300053085 | Bacteria | 1920 |
| 980 | Ga0495619_0134783 | 3300053085 | Bacteria | 1698 |
| 981 | Ga0500643_019759 | 3300053087 | Bacteria | 2213 |
| 982 | Ga0500559_0009140 | 3300053136 | Bacteria | 4305 |
| 983 | Ga0500559_0139557 | 3300053136 | Bacteria | 1134 |
| 984 | Ga0500577_0034858 | 3300053142 | Bacteria | 1790 |
| 985 | Ga0500645_000046 | 3300053730 | Bacteria | 106127 |
| 986 | Ga0501084_0018770 | 3300054114 | Bacteria | 5758 |
| 987 | Ga0501084_0961122 | 3300054114 | Bacteria | 718 |
| 988 | Ga0466962_0007327 | 3300061719 | Bacteria | 5294 |
| 989 | Ga0466962_0010782 | 3300061719 | Bacteria | 4392 |
| 990 | Ga0466962_0019043 | 3300061719 | Bacteria | 3297 |
| 991 | Ga0530510_0077687 | 3300061734 | Bacteria | 2413 |
| 992 | 2558910479 | 2558860112 | Bacteria | 9931328 |
| 993 | 2738704856 | 2738541274 | Bacteria | 6909446 |
| 994 | 2739330026 | 2738543028 | Bacteria | 6917070 |
| 995 | 2795786090 | 2795385470 | Bacteria | 8317180 |
| 996 | 2870783191 | 2870782633 | Bacteria | 9624083 |
| 997 | 2899375319 | 2899370129 | Bacteria | 6781179 |
| 998 | 2902803440 | 2902799365 | Bacteria | 5419524 |
| 999 | 8003323465 | 8003314358 | Bacteria | 10575343 |
| 1000 | Ga0163162_10036165 | |||
| 1001 | JGI24746J21847_1002624 | |||
| 1002 | JGI24738J21930_10031127 | |||
| 1003 | JGI24744J21845_10002847 | |||
| 1004 | JGI24744J21845_10005076 | |||
| 1005 | JGI25406J46586_10010135 | |||
| 1006 | JGI25404J52841_10002354 | |||
| 1007 | JGI25405J52794_10030135 | |||
| 1008 | Ga0070658_10000508 | |||
| 1009 | Ga0070658_10012519 | |||
| 1010 | Ga0070658_10020639 | |||
| 1011 | Ga0070658_10074077 | |||
| 1012 | Ga0070658_10095781 | |||
| 1013 | Ga0070658_10102591 | |||
| 1014 | Ga0070676_10014555 | |||
| 1015 | Ga0070676_10063779 | |||
| 1016 | Ga0070676_10098606 | |||
| 1017 | Ga0070683_100003027 | |||
| 1018 | Ga0070683_100042319 | |||
| 1019 | Ga0070683_100051136 | |||
| 1020 | Ga0070683_100138929 | |||
| 1021 | Ga0070690_100020069 | |||
| 1022 | Ga0068869_100081977 | |||
| 1023 | Ga0068869_100166267 | |||
| 1024 | Ga0070666_10000599 | |||
| 1025 | Ga0070666_10109443 | |||
| 1026 | Ga0070680_100075908 | |||
| 1027 | Ga0070680_100145882 | |||
| 1028 | Ga0070680_100213683 | |||
| 1029 | Ga0070682_100008743 | |||
| 1030 | Ga0070682_100026987 | |||
| 1031 | Ga0070682_100097293 | |||
| 1032 | Ga0068868_100014096 | |||
| 1033 | Ga0068868_100061529 | |||
| 1034 | Ga0068868_100347639 | |||
| 1035 | Ga0070660_100025228 | |||
| 1036 | Ga0070660_100092723 | |||
| 1037 | Ga0070660_100297033 | |||
| 1038 | Ga0070660_100559918 | |||
| 1039 | Ga0070689_100016357 | |||
| 1040 | Ga0070689_100404460 | |||
| 1041 | Ga0070691_10038306 | |||
| 1042 | Ga0070691_10051466 | |||
| 1043 | Ga0070691_10102724 | |||
| 1044 | Ga0070687_100011299 | |||
| 1045 | Ga0070687_100020506 | |||
| 1046 | Ga0070661_100117955 | |||
| 1047 | Ga0070661_100297434 | |||
| 1048 | Ga0070692_10075952 | |||
| 1049 | Ga0070692_10271126 | |||
| 1050 | Ga0070668_100014966 | |||
| 1051 | Ga0070668_100027507 | |||
| 1052 | Ga0070669_100026232 | |||
| 1053 | Ga0070669_100306491 | |||
| 1054 | Ga0070675_100046139 | |||
| 1055 | Ga0070674_100004962 | |||
| 1056 | Ga0070674_100150542 | |||
| 1057 | Ga0070674_100247597 | |||
| 1058 | Ga0070673_100088883 | |||
| 1059 | Ga0070673_100313801 | |||
| 1060 | Ga0070659_100002245 | |||
| 1061 | Ga0070659_100006711 | |||
| 1062 | Ga0070659_100061327 | |||
| 1063 | Ga0070659_100156084 | |||
| 1064 | Ga0070659_100364006 | |||
| 1065 | Ga0070667_100010948 | |||
| 1066 | Ga0070667_100051599 | |||
| 1067 | Ga0070667_100135634 | |||
| 1068 | Ga0070709_10009918 | |||
| 1069 | Ga0070709_10248591 | |||
| 1070 | Ga0070709_10425772 | |||
| 1071 | Ga0070714_100000968 | |||
| 1072 | Ga0070714_100005250 | |||
| 1073 | Ga0070714_100028819 | |||
| 1074 | Ga0070714_100109961 | |||
| 1075 | Ga0070714_100230654 | |||
| 1076 | Ga0070714_100260518 | |||
| 1077 | Ga0070714_100281327 | |||
| 1078 | Ga0070714_100316496 | |||
| 1079 | Ga0070714_100337922 | |||
| 1080 | Ga0070713_100000292 | |||
| 1081 | Ga0070713_100029889 | |||
| 1082 | Ga0070713_100053823 | |||
| 1083 | Ga0070713_100073500 | |||
| 1084 | Ga0070713_100120607 | |||
| 1085 | Ga0070713_100270987 | |||
| 1086 | Ga0070713_100273566 | |||
| 1087 | Ga0070713_100348450 | |||
| 1088 | Ga0070710_10001190 | |||
| 1089 | Ga0070710_10009899 | |||
| 1090 | Ga0070710_10138628 | |||
| 1091 | Ga0070701_10022440 | |||
| 1092 | Ga0070711_100001818 | |||
| 1093 | Ga0070711_100031445 | |||
| 1094 | Ga0070711_100327539 | |||
| 1095 | Ga0070711_100363957 | |||
| 1096 | Ga0070705_100251113 | |||
| 1097 | Ga0070700_100020504 | |||
| 1098 | Ga0070694_100009988 | |||
| 1099 | Ga0070694_100069296 | |||
| 1100 | Ga0070708_100030491 | |||
| 1101 | Ga0070708_100069217 | |||
| 1102 | Ga0070708_100106172 | |||
| 1103 | Ga0070708_100131850 | |||
| 1104 | Ga0070708_100151223 | |||
| 1105 | Ga0070708_100352813 | |||
| 1106 | Ga0070663_100000154 | |||
| 1107 | Ga0070663_100008259 | |||
| 1108 | Ga0070663_100130837 | |||
| 1109 | Ga0070678_100004333 | |||
| 1110 | Ga0070678_100014423 | |||
| 1111 | Ga0070678_100405214 | |||
| 1112 | Ga0070681_10005886 | |||
| 1113 | Ga0070681_10095443 | |||
| 1114 | Ga0070681_10146505 | |||
| 1115 | Ga0070681_10215156 | |||
| 1116 | Ga0070681_10359241 | |||
| 1117 | Ga0068867_100024657 | |||
| 1118 | Ga0068867_100248086 | |||
| 1119 | Ga0068867_100692930 | |||
| 1120 | Ga0070685_10033240 | |||
| 1121 | Ga0070706_100001190 | |||
| 1122 | Ga0070706_100010326 | |||
| 1123 | Ga0070706_100193584 | |||
| 1124 | Ga0070706_100339345 | |||
| 1125 | Ga0070706_100648142 | |||
| 1126 | Ga0070707_100020033 | |||
| 1127 | Ga0070707_100069666 | |||
| 1128 | Ga0070707_100222863 | |||
| 1129 | Ga0070707_100760377 | |||
| 1130 | Ga0070698_100000028 | |||
| 1131 | Ga0070698_100015636 | |||
| 1132 | Ga0070698_100020133 | |||
| 1133 | Ga0070698_100025185 | |||
| 1134 | Ga0070698_100027003 | |||
| 1135 | Ga0070698_100049725 | |||
| 1136 | Ga0070698_100063382 | |||
| 1137 | Ga0070698_100302314 | |||
| 1138 | Ga0070699_100001363 | |||
| 1139 | Ga0070699_100222282 | |||
| 1140 | Ga0070679_100052028 | |||
| 1141 | Ga0070684_100039048 | |||
| 1142 | Ga0070684_100049228 | |||
| 1143 | Ga0070684_100183266 | |||
| 1144 | Ga0070697_100000383 | |||
| 1145 | Ga0070697_100112143 | |||
| 1146 | Ga0068853_100015885 | |||
| 1147 | Ga0068853_100542053 | |||
| 1148 | Ga0070672_100357150 | |||
| 1149 | Ga0070672_100485031 | |||
| 1150 | Ga0070686_100182867 | |||
| 1151 | Ga0070686_100385247 | |||
| 1152 | Ga0070686_100397793 | |||
| 1153 | Ga0070695_100061202 | |||
| 1154 | Ga0070695_100101201 | |||
| 1155 | Ga0070696_100021296 | |||
| 1156 | Ga0070696_100065680 | |||
| 1157 | Ga0070696_100081792 | |||
| 1158 | Ga0070693_100065726 | |||
| 1159 | Ga0070693_100267505 | |||
| 1160 | Ga0070665_100019951 | |||
| 1161 | Ga0070665_100035324 | |||
| 1162 | Ga0070704_100009349 | |||
| 1163 | Ga0070704_100329780 | |||
| 1164 | Ga0068855_100092059 | |||
| 1165 | Ga0068855_100480812 | |||
| 1166 | Ga0068855_100513514 | |||
| 1167 | Ga0070664_100113964 | |||
| 1168 | Ga0070664_100182673 | |||
| 1169 | Ga0070664_100306747 | |||
| 1170 | Ga0068857_100043855 | |||
| 1171 | Ga0068854_100122448 | |||
| 1172 | Ga0068854_100308096 | |||
| 1173 | Ga0068854_100623927 | |||
| 1174 | Ga0068856_100543456 | |||
| 1175 | Ga0068856_100685199 | |||
| 1176 | Ga0070702_100085222 | |||
| 1177 | Ga0068852_100123783 | |||
| 1178 | Ga0068852_100154175 | |||
| 1179 | Ga0068859_100002009 | |||
| 1180 | Ga0068859_100028972 | |||
| 1181 | Ga0068859_100046620 | |||
| 1182 | Ga0068859_100198952 | |||
| 1183 | Ga0068859_100582307 | |||
| 1184 | Ga0068864_100049548 | |||
| 1185 | Ga0068866_10008951 | |||
| 1186 | Ga0068866_10035456 | |||
| 1187 | Ga0068866_10048347 | |||
| 1188 | Ga0068861_100300334 | |||
| 1189 | Ga0068851_10066565 | |||
| 1190 | Ga0068851_10086672 | |||
| 1191 | Ga0068870_10025246 | |||
| 1192 | Ga0068863_100400701 | |||
| 1193 | Ga0068858_100018088 | |||
| 1194 | Ga0068858_100166178 | |||
| 1195 | Ga0068860_100000067 | |||
| 1196 | Ga0068860_100079327 | |||
| 1197 | Ga0068862_100025498 | |||
| 1198 | Ga0068862_100051958 | |||
| 1199 | Ga0068862_100283628 | |||
| 1200 | Ga0081455_10000974 | |||
| 1201 | Ga0081455_10065050 | |||
| 1202 | Ga0081455_10072991 | |||
| 1203 | Ga0081455_10218482 | |||
| 1204 | Ga0081538_10148850 | |||
| 1205 | Ga0081539_10000482 | |||
| 1206 | Ga0070717_10001057 | |||
| 1207 | Ga0070717_10039252 | |||
| 1208 | Ga0070717_10056789 | |||
| 1209 | Ga0070717_10056804 | |||
| 1210 | Ga0070717_10073695 | |||
| 1211 | Ga0070717_10204377 | |||
| 1212 | Ga0070717_10331910 | |||
| 1213 | Ga0070717_10385363 | |||
| 1214 | Ga0070717_10492117 | |||
| 1215 | Ga0070717_10912964 | |||
| 1216 | Ga0075363_100002024 | |||
| 1217 | Ga0075364_10006138 | |||
| 1218 | Ga0070715_10005940 | |||
| 1219 | Ga0070715_10028906 | |||
| 1220 | Ga0070715_10063627 | |||
| 1221 | Ga0070716_100001660 | |||
| 1222 | Ga0070716_100007955 | |||
| 1223 | Ga0070716_100009500 | |||
| 1224 | Ga0070716_100042011 | |||
| 1225 | Ga0070716_100366101 | |||
| 1226 | Ga0070712_100005616 | |||
| 1227 | Ga0070712_100008614 | |||
| 1228 | Ga0070712_100016635 | |||
| 1229 | Ga0070712_100043097 | |||
| 1230 | Ga0070712_100068474 | |||
| 1231 | Ga0070712_100391871 | |||
| 1232 | Ga0075369_10002093 | |||
| 1233 | Ga0075369_10002645 | |||
| 1234 | Ga0075369_10045826 | |||
| 1235 | Ga0097621_100026048 | |||
| 1236 | Ga0097621_100083376 | |||
| 1237 | Ga0075370_10026358 | |||
| 1238 | Ga0075428_100007121 | |||
| 1239 | Ga0075430_100065719 | |||
| 1240 | Ga0068865_100000387 | |||
| 1241 | Ga0068865_100300452 | |||
| 1242 | Ga0075436_100090274 | |||
| 1243 | Ga0075436_100217509 | |||
| 1244 | Ga0097620_100002008 | |||
| 1245 | Ga0097620_100028971 | |||
| 1246 | Ga0097620_100046623 | |||
| 1247 | Ga0097620_100198946 | |||
| 1248 | Ga0097620_100582307 | |||
| 1249 | Ga0099794_10225006 | |||
| 1250 | Ga0099795_10039100 | |||
| 1251 | Ga0105244_10144217 | |||
| 1252 | Ga0105240_10011130 | |||
| 1253 | Ga0105240_10451854 | |||
| 1254 | Ga0105245_10027833 | |||
| 1255 | Ga0105245_10029652 | |||
| 1256 | Ga0105245_10285814 | |||
| 1257 | Ga0105245_10505006 | |||
| 1258 | Ga0105247_10005969 | |||
| 1259 | Ga0105247_10242187 | |||
| 1260 | Ga0114129_10098741 | |||
| 1261 | Ga0114129_10805088 | |||
| 1262 | Ga0105243_10000843 | |||
| 1263 | Ga0105241_10028985 | |||
| 1264 | Ga0105241_10377713 | |||
| 1265 | Ga0105242_10046867 | |||
| 1266 | Ga0105242_10129265 | |||
| 1267 | Ga0105242_10202595 | |||
| 1268 | Ga0105242_10265758 | |||
| 1269 | Ga0105248_10011276 | |||
| 1270 | Ga0105248_10043895 | |||
| 1271 | Ga0105248_10514321 | |||
| 1272 | Ga0105237_10104883 | |||
| 1273 | Ga0105249_10000784 | |||
| 1274 | Ga0105239_10248866 | |||
| 1275 | Ga0105239_10276087 | |||
| 1276 | Ga0105239_10411586 | |||
| 1277 | Ga0105246_10082055 | |||
| 1278 | Ga0105246_10304675 | |||
| 1279 | Ga0157342_1003067 | |||
| 1280 | Ga0157373_10378657 | |||
| 1281 | Ga0157371_10005054 | |||
| 1282 | Ga0157371_10169634 | |||
| 1283 | Ga0157370_10022049 | |||
| 1284 | Ga0157369_10005401 | |||
| 1285 | Ga0157369_10010931 | |||
| 1286 | Ga0157369_10011881 | |||
| 1287 | Ga0157369_10101343 | |||
| 1288 | Ga0157369_10191870 | |||
| 1289 | Ga0157369_10558805 | |||
| 1290 | Ga0157374_10096699 | |||
| 1291 | Ga0157374_10352716 | |||
| 1292 | Ga0157374_10645988 | |||
| 1293 | Ga0157378_10005566 | |||
| 1294 | Ga0157378_10199920 | |||
| 1295 | Ga0157378_10316073 | |||
| 1296 | Ga0163162_10088075 | |||
| 1297 | Ga0163162_10161033 | |||
| 1298 | Ga0163162_10719393 | |||
| 1299 | Ga0157372_10066489 | |||
| 1300 | Ga0157372_10339172 | |||
| 1301 | Ga0157375_10001987 | |||
| 1302 | Ga0163163_10166016 | |||
| 1303 | Ga0163163_10450337 | |||
| 1304 | Ga0163163_10489668 | |||
| 1305 | Ga0157380_10360406 | |||
| 1306 | Ga0157377_10254328 | |||
| 1307 | Ga0157379_10014388 | |||
| 1308 | Ga0157379_10033440 | |||
| 1309 | Ga0157379_10095885 | |||
| 1310 | Ga0157376_10069402 | |||
| 1311 | Ga0163161_10027781 | |||
| 1312 | Ga0163161_10127243 | |||
| 1313 | Ga0197907_10456462 | |||
| 1314 | Ga0206356_10069604 | |||
| 1315 | Ga0206349_1059723 | |||
| 1316 | Ga0206354_10021129 | |||
| 1317 | Ga0206354_10448767 | |||
| 1318 | Ga0206353_11415596 | |||
| 1319 | Ga0206353_11658561 | |||
| 1320 | Ga0206353_11792839 | |||
| 1321 | Ga0213874_10046395 | |||
| 1322 | Ga0213874_10067553 | |||
| 1323 | Ga0213876_10019846 | |||
| 1324 | Ga0213876_10020650 | |||
| 1325 | Ga0213876_10032212 | |||
| 1326 | Ga0213876_10198765 | |||
| 1327 | Ga0213875_10000092 | |||
| 1328 | Ga0213875_10001276 | |||
| 1329 | Ga0213875_10003226 | |||
| 1330 | Ga0213875_10007935 | |||
| 1331 | Ga0213875_10012033 | |||
| 1332 | Ga0213875_10017021 | |||
| 1333 | Ga0213875_10019923 | |||
| 1334 | Ga0213875_10058713 | |||
| 1335 | Ga0213875_10077283 | |||
| 1336 | Ga0224712_10003853 | |||
| 1337 | Ga0224712_10008590 | |||
| 1338 | Ga0224712_10009184 | |||
| 1339 | Ga0228598_1011687 | |||
| 1340 | Ga0209051_1022517 | |||
| 1341 | Ga0207653_10014869 | |||
| 1342 | Ga0207692_10006893 | |||
| 1343 | Ga0207692_10074928 | |||
| 1344 | Ga0207692_10250446 | |||
| 1345 | Ga0207642_10081287 | |||
| 1346 | Ga0207642_10277020 | |||
| 1347 | Ga0207710_10207714 | |||
| 1348 | Ga0207688_10001071 | |||
| 1349 | Ga0207688_10009517 | |||
| 1350 | Ga0207688_10011202 | |||
| 1351 | Ga0207680_10011616 | |||
| 1352 | Ga0207680_10088708 | |||
| 1353 | Ga0207680_10128630 | |||
| 1354 | Ga0207647_10048321 | |||
| 1355 | Ga0207647_10120485 | |||
| 1356 | Ga0207685_10044700 | |||
| 1357 | Ga0207699_10001559 | |||
| 1358 | Ga0207699_10013348 | |||
| 1359 | Ga0207699_10022711 | |||
| 1360 | Ga0207699_10045557 | |||
| 1361 | Ga0207699_10056345 | |||
| 1362 | Ga0207699_10193283 | |||
| 1363 | Ga0207699_10253633 | |||
| 1364 | Ga0207645_10012105 | |||
| 1365 | Ga0207645_10118995 | |||
| 1366 | Ga0207643_10051128 | |||
| 1367 | Ga0207705_10000605 | |||
| 1368 | Ga0207705_10004465 | |||
| 1369 | Ga0207705_10009551 | |||
| 1370 | Ga0207705_10047926 | |||
| 1371 | Ga0207705_10051655 | |||
| 1372 | Ga0207684_10000479 | |||
| 1373 | Ga0207684_10028810 | |||
| 1374 | Ga0207684_10029056 | |||
| 1375 | Ga0207684_10030881 | |||
| 1376 | Ga0207684_10040321 | |||
| 1377 | Ga0207684_10212932 | |||
| 1378 | Ga0207654_10045265 | |||
| 1379 | Ga0207707_10047626 | |||
| 1380 | Ga0207707_10071856 | |||
| 1381 | Ga0207707_10120458 | |||
| 1382 | Ga0207707_10314515 | |||
| 1383 | Ga0207693_10000423 | |||
| 1384 | Ga0207693_10000616 | |||
| 1385 | Ga0207693_10001314 | |||
| 1386 | Ga0207693_10004511 | |||
| 1387 | Ga0207693_10018340 | |||
| 1388 | Ga0207693_10038999 | |||
| 1389 | Ga0207693_10049911 | |||
| 1390 | Ga0207693_10058767 | |||
| 1391 | Ga0207693_10104137 | |||
| 1392 | Ga0207693_10109999 | |||
| 1393 | Ga0207693_10340512 | |||
| 1394 | Ga0207663_10019079 | |||
| 1395 | Ga0207663_10025457 | |||
| 1396 | Ga0207663_10178884 | |||
| 1397 | Ga0207663_10333011 | |||
| 1398 | Ga0207663_10444822 | |||
| 1399 | Ga0207660_10055674 | |||
| 1400 | Ga0207660_10137480 | |||
| 1401 | Ga0207660_10443040 | |||
| 1402 | Ga0207660_10443617 | |||
| 1403 | Ga0207657_10014859 | |||
| 1404 | Ga0207657_10035895 | |||
| 1405 | Ga0207657_10085054 | |||
| 1406 | Ga0207657_10171111 | |||
| 1407 | Ga0207657_10205318 | |||
| 1408 | Ga0207657_10228154 | |||
| 1409 | Ga0207649_10072909 | |||
| 1410 | Ga0207652_10037186 | |||
| 1411 | Ga0207652_10080224 | |||
| 1412 | Ga0207652_10081927 | |||
| 1413 | Ga0207652_10299031 | |||
| 1414 | Ga0207652_10385309 | |||
| 1415 | Ga0207646_10006081 | |||
| 1416 | Ga0207646_10045679 | |||
| 1417 | Ga0207646_10062112 | |||
| 1418 | Ga0207646_10131593 | |||
| 1419 | Ga0207646_10343093 | |||
| 1420 | Ga0207681_10022242 | |||
| 1421 | Ga0207681_10157716 | |||
| 1422 | Ga0207681_10267441 | |||
| 1423 | Ga0207659_10365851 | |||
| 1424 | Ga0207687_10043445 | |||
| 1425 | Ga0207687_10113941 | |||
| 1426 | Ga0207700_10000840 | |||
| 1427 | Ga0207700_10003624 | |||
| 1428 | Ga0207700_10025128 | |||
| 1429 | Ga0207700_10034240 | |||
| 1430 | Ga0207700_10070230 | |||
| 1431 | Ga0207700_10070506 | |||
| 1432 | Ga0207700_10398870 | |||
| 1433 | Ga0207700_10470036 | |||
| 1434 | Ga0207700_10485833 | |||
| 1435 | Ga0207700_10563855 | |||
| 1436 | Ga0207664_10002562 | |||
| 1437 | Ga0207664_10007405 | |||
| 1438 | Ga0207664_10009335 | |||
| 1439 | Ga0207664_10022468 | |||
| 1440 | Ga0207664_10091112 | |||
| 1441 | Ga0207664_10138041 | |||
| 1442 | Ga0207664_10152694 | |||
| 1443 | Ga0207664_10166916 | |||
| 1444 | Ga0207664_10379661 | |||
| 1445 | Ga0207664_10409196 | |||
| 1446 | Ga0207690_10000233 | |||
| 1447 | Ga0207690_10034960 | |||
| 1448 | Ga0207690_10072212 | |||
| 1449 | Ga0207706_10010102 | |||
| 1450 | Ga0207706_10013880 | |||
| 1451 | Ga0207709_10017023 | |||
| 1452 | Ga0207670_10080370 | |||
| 1453 | Ga0207670_10274267 | |||
| 1454 | Ga0207669_10199321 | |||
| 1455 | Ga0207669_10278897 | |||
| 1456 | Ga0207704_10129262 | |||
| 1457 | Ga0207665_10010160 | |||
| 1458 | Ga0207665_10010827 | |||
| 1459 | Ga0207665_10012787 | |||
| 1460 | Ga0207665_10019709 | |||
| 1461 | Ga0207665_10052319 | |||
| 1462 | Ga0207665_10079465 | |||
| 1463 | Ga0207691_10058013 | |||
| 1464 | Ga0207691_10091675 | |||
| 1465 | Ga0207691_10095113 | |||
| 1466 | Ga0207711_10074539 | |||
| 1467 | Ga0207689_10012341 | |||
| 1468 | Ga0207689_10013563 | |||
| 1469 | Ga0207689_10034437 | |||
| 1470 | Ga0207689_10105595 | |||
| 1471 | Ga0207661_10006204 | |||
| 1472 | Ga0207661_10038456 | |||
| 1473 | Ga0207661_10043418 | |||
| 1474 | Ga0207661_10081658 | |||
| 1475 | Ga0207679_10155343 | |||
| 1476 | Ga0207679_10559789 | |||
| 1477 | Ga0207667_10039431 | |||
| 1478 | Ga0207667_10145631 | |||
| 1479 | Ga0207712_10021393 | |||
| 1480 | Ga0207668_10218930 | |||
| 1481 | Ga0207640_10231704 | |||
| 1482 | Ga0207640_10323884 | |||
| 1483 | Ga0207640_10451791 | |||
| 1484 | Ga0207658_10035510 | |||
| 1485 | Ga0207658_10067634 | |||
| 1486 | Ga0207677_10018136 | |||
| 1487 | Ga0207677_10049056 | |||
| 1488 | Ga0207703_10048810 | |||
| 1489 | Ga0207703_10060869 | |||
| 1490 | Ga0207639_10247707 | |||
| 1491 | Ga0207678_10000312 | |||
| 1492 | Ga0207678_10012393 | |||
| 1493 | Ga0207678_10013964 | |||
| 1494 | Ga0207678_10017380 | |||
| 1495 | Ga0207678_10048817 | |||
| 1496 | Ga0207708_10006460 | |||
| 1497 | Ga0207708_10028114 | |||
| 1498 | Ga0207708_10099374 | |||
| 1499 | Ga0207641_10499711 | |||
| 1500 | Ga0207648_10017557 | |||
| 1501 | Ga0207648_10263458 | |||
| 1502 | Ga0207648_10271385 | |||
| 1503 | Ga0207676_10314727 | |||
| 1504 | Ga0207674_10008344 | |||
| 1505 | Ga0207674_10063478 | |||
| 1506 | Ga0207675_100001298 | |||
| 1507 | Ga0207675_100004705 | |||
| 1508 | Ga0207683_10000649 | |||
| 1509 | Ga0207683_10006893 | |||
| 1510 | Ga0207683_10084875 | |||
| 1511 | Ga0207683_10218904 | |||
| 1512 | Ga0207698_10048510 | |||
| 1513 | Ga0207698_10088301 | |||
| 1514 | Ga0209179_1012043 | |||
| 1515 | Ga0224573_1001931 | |||
| 1516 | Ga0268266_10020337 | |||
| 1517 | Ga0268266_10025742 | |||
| 1518 | Ga0268266_10044204 | |||
| 1519 | Ga0268264_10000114 | |||
| 1520 | Ga0265338_10043340 | |||
| 1521 | Ga0265338_10106020 | |||
| 1522 | Ga0307511_10077799 | |||
| 1523 | Ga0307512_10005068 | |||
| 1524 | Ga0265325_10001514 | |||
| 1525 | Ga0265329_10061583 | |||
| 1526 | Ga0265340_10000928 | |||
| 1527 | Ga0265339_10006895 | |||
| 1528 | Ga0265316_10014581 | |||
| 1529 | Ga0307508_10044056 | |||
| 1530 | Ga0307508_10270284 | |||
| 1531 | Ga0307508_10312737 | |||
| 1532 | Ga0265342_10037671 | |||
| 1533 | Ga0307518_10076530 | |||
| 1534 | Ga0307406_10072519 | |||
| 1535 | Ga0307415_100284151 | |||
| 1536 | Ga0307507_10007414 | |||
| 1537 | Ga0307507_10023724 | |||
| 1538 | Ga0307510_10086353 | |||
| 1539 | Ga0307510_10145824 | |||
| 1540 | Ga0373959_0013904 | |||
| 1541 | Ga0373926_0000667 | |||
| 1542 | Ga0373934_0009033 | |||
| 1543 | Ga0373934_0115528 | |||
| 1544 | Ga0373944_0005783 | |||
| 1545 | Ga0373944_0020733 | |||
| 1546 | Ga0373944_0055187 | |||
| 1547 | Ga0373951_0032090 | |||
| 1548 | Ga0373923_0009399 | |||
| 1549 | Ga0373923_0020665 | |||
| 1550 | Ga0373923_0147266 | |||
| 1551 | Ga0373936_0000597 | |||
| 1552 | Ga0373936_0013959 | |||
| 1553 | Ga0373936_0104530 | |||
| 1554 | Ga0373936_0154416 | |||
| 1555 | Ga0373936_0284560 | |||
| 1556 | Ga0373945_0001009 | |||
| 1557 | Ga0373945_0012897 | |||
| 1558 | Ga0373953_0011944 | |||
| 1559 | Ga0373953_0033364 | |||
| 1560 | Ga0373954_0007461 | |||
| 1561 | Ga0373954_0036395 | |||
| 1562 | Ga0373956_0001023 | |||
| 1563 | Ga0373956_0031742 | |||
| 1564 | Ga0373956_0072342 | |||
| 1565 | Ga0373956_0074141 | |||
| 1566 | Ga0373957_0046125 | |||
| 1567 | Ga0373957_0049648 | |||
| 1568 | Ga0373957_0103488 | |||
| 1569 | Ga0373943_0003599 | |||
| 1570 | Ga0373943_0242661 | |||
| 1571 | Ga0373946_0000489 | |||
| 1572 | Ga0373946_0004311 | |||
| 1573 | Ga0373946_0054315 | |||
| 1574 | Ga0373946_0175312 | |||
| 1575 | Ga0373955_0015974 | |||
| 1576 | Ga0373955_0026007 | |||
| 1577 | Ga0373955_0125258 | |||
| 1578 | Ga0373955_0271875 | |||
| 1579 | Ga0373924_0005932 | |||
| 1580 | Ga0373924_0013799 | |||
| 1581 | Ga0373924_0031541 | |||
| 1582 | Ga0373924_0045623 | |||
| 1583 | Ga0373924_0097369 | |||
| 1584 | Ga0373924_0106918 | |||
| 1585 | Ga0373931_0047027 | |||
| 1586 | Ga0373931_0143514 | |||
| 1587 | Ga0373931_0240431 | |||
| 1588 | Ga0373931_0246744 | |||
| 1589 | Ga0373935_0000490 | |||
| 1590 | Ga0373935_0028478 | |||
| 1591 | Ga0373935_0034971 | |||
| 1592 | Ga0373935_0103837 | |||
| 1593 | Ga0373935_0106863 | |||
| 1594 | Ga0373935_0180472 | |||
| 1595 | Ga0373927_0009224 | |||
| 1596 | Ga0373927_0048886 | |||
| 1597 | Ga0373927_0059376 | |||
| 1598 | Ga0373933_0005326 | |||
| 1599 | Ga0373933_0044479 | |||
| 1600 | Ga0373933_0099998 | |||
| 1601 | Ga0373933_0148064 | |||
| 1602 | Ga0373933_0178812 | |||
| 1603 | Ga0373933_0291362 | |||
| 1604 | Ga0373947_0005336 | |||
| 1605 | Ga0373947_0049079 | |||
| 1606 | Ga0373947_0154150 | |||
| 1607 | Ga0373937_0019941 | |||
| 1608 | Ga0373937_0054768 | |||
| 1609 | Ga0373937_0132730 | |||
| 1610 | Ga0373937_0268952 | |||
| 1611 | Ga0373925_0012478 | |||
| 1612 | Ga0373925_0102763 | |||
| 1613 | Ga0373925_0118787 | |||
| 1614 | Ga0395899_0388439 | |||
| 1615 | Ga0395900_0221700 | |||
| 1616 | Ga0395900_0288021 | |||
| 1617 | Ga0436364_0037108 | |||
| 1618 | Ga0436364_0189458 | |||
| 1619 | Ga0436364_0193972 | |||
| 1620 | Ga0436364_0265841 | |||
| 1621 | Ga0436364_0316624 | |||
| 1622 | Ga0436364_0467315 | |||
| 1623 | Ga0436364_0527355 | |||
| 1624 | Ga0436364_0802113 | |||
| 1625 | Ga0436364_0815450 | |||
| 1626 | Ga0436364_0828822 | |||
| 1627 | Ga0436364_1002699 | |||
| 1628 | Ga0436364_1416932 | |||
| 1629 | Ga0436364_1455692 | |||
| 1630 | Ga0395901_0046735 | |||
| 1631 | Ga0395901_0104373 | |||
| 1632 | Ga0436365_0539792 | |||
| 1633 | Ga0436365_0670227 | |||
| 1634 | Ga0436365_1206577 | |||
| 1635 | Ga0436365_1253726 | |||
| 1636 | Ga0436363_0169189 | |||
| 1637 | Ga0436363_0225351 | |||
| 1638 | Ga0436363_0309457 | |||
| 1639 | Ga0436363_0317063 | |||
| 1640 | Ga0436362_0000051 | |||
| 1641 | Ga0436362_0173909 | |||
| 1642 | Ga0439448_0007690 | |||
| 1643 | Ga0439448_0085225 | |||
| 1644 | Ga0439463_010541 | |||
| 1645 | Ga0439460_0000696 | |||
| 1646 | Ga0466969_0015291 | |||
| 1647 | Ga0466969_0102550 | |||
| 1648 | Ga0466972_0109290 | |||
| 1649 | Ga0466965_0143410 | |||
| 1650 | Ga0466966_0011757 | |||
| 1651 | Ga0466966_0044068 | |||
| 1652 | Ga0466961_0011066 | |||
| 1653 | Ga0466963_0024648 | |||
| 1654 | Ga0466963_0055385 | |||
| 1655 | Ga0466963_0063730 | |||
| 1656 | Ga0466963_0240275 | |||
| 1657 | Ga0466964_0121752 | |||
| 1658 | Ga0466971_0001144 | |||
| 1659 | Ga0466971_0082049 | |||
| 1660 | Ga0466971_0181244 | |||
| 1661 | Ga0466968_0054608 | |||
| 1662 | Ga0466957_0063349 | |||
| 1663 | Ga0466960_0013128 | |||
| 1664 | Ga0466960_0029520 | |||
| 1665 | Ga0466959_0056285 | |||
| 1666 | Ga0466959_0094925 | |||
| 1667 | Ga0466958_0003222 | |||
| 1668 | Ga0466958_0049571 | |||
| 1669 | Ga0466958_0244481 | |||
| 1670 | Ga0466967_0003944 | |||
| 1671 | Ga0466967_0004464 | |||
| 1672 | Ga0466967_0035721 | |||
| 1673 | Ga0466967_0043727 | |||
| 1674 | Ga0466967_0058459 | |||
| 1675 | Ga0466967_0061983 | |||
| 1676 | Ga0466967_0066989 | |||
| 1677 | Ga0495592_0034357 | |||
| 1678 | Ga0495592_0057729 | |||
| 1679 | Ga0495592_0068721 | |||
| 1680 | Ga0495592_0278547 | |||
| 1681 | Ga0495603_0050085 | |||
| 1682 | Ga0495603_0225644 | |||
| 1683 | Ga0495629_0014236 | |||
| 1684 | Ga0495629_0229545 | |||
| 1685 | Ga0495641_0002946 | |||
| 1686 | Ga0495641_0027757 | |||
| 1687 | Ga0495641_0126664 | |||
| 1688 | Ga0495641_0156387 | |||
| 1689 | Ga0495651_0016782 | |||
| 1690 | Ga0495651_0024364 | |||
| 1691 | Ga0495651_0071352 | |||
| 1692 | Ga0495651_0096301 | |||
| 1693 | Ga0495651_0126208 | |||
| 1694 | Ga0495651_0295461 | |||
| 1695 | Ga0495653_0001335 | |||
| 1696 | Ga0495653_0023619 | |||
| 1697 | Ga0495653_0032698 | |||
| 1698 | Ga0495653_0057148 | |||
| 1699 | Ga0495653_0098223 | |||
| 1700 | Ga0495653_0174842 | |||
| 1701 | Ga0495650_0029405 | |||
| 1702 | Ga0495582_0036850 | |||
| 1703 | Ga0495582_0044141 | |||
| 1704 | Ga0495639_0008326 | |||
| 1705 | Ga0495662_0011936 | |||
| 1706 | Ga0495662_0015085 | |||
| 1707 | Ga0495662_0021641 | |||
| 1708 | Ga0495662_0178166 | |||
| 1709 | Ga0495664_0002865 | |||
| 1710 | Ga0495664_0023176 | |||
| 1711 | Ga0495664_0028754 | |||
| 1712 | Ga0495664_0029378 | |||
| 1713 | Ga0495664_0036647 | |||
| 1714 | Ga0495664_0169753 | |||
| 1715 | Ga0495585_0055708 | |||
| 1716 | Ga0495608_0024286 | |||
| 1717 | Ga0495608_0035829 | |||
| 1718 | Ga0495608_0043656 | |||
| 1719 | Ga0495608_0047430 | |||
| 1720 | Ga0495608_0067321 | |||
| 1721 | Ga0495608_0158385 | |||
| 1722 | Ga0495618_0073017 | |||
| 1723 | Ga0495618_0113163 | |||
| 1724 | Ga0495618_0199255 | |||
| 1725 | Ga0495618_0219203 | |||
| 1726 | Ga0495628_0072387 | |||
| 1727 | Ga0495628_0099592 | |||
| 1728 | Ga0495628_0427396 | |||
| 1729 | Ga0495630_0060374 | |||
| 1730 | Ga0495630_0112431 | |||
| 1731 | Ga0495630_0360727 | |||
| 1732 | Ga0495666_0019870 | |||
| 1733 | Ga0495652_0003709 | |||
| 1734 | Ga0495652_0040081 | |||
| 1735 | Ga0495652_0062957 | |||
| 1736 | Ga0495652_0261704 | |||
| 1737 | Ga0495652_0269066 | |||
| 1738 | Ga0495652_0327102 | |||
| 1739 | Ga0495652_0350098 | |||
| 1740 | Ga0495665_0008348 | |||
| 1741 | Ga0495665_0012235 | |||
| 1742 | Ga0495665_0188220 | |||
| 1743 | Ga0495665_0228693 | |||
| 1744 | Ga0495640_0013187 | |||
| 1745 | Ga0495640_0064056 | |||
| 1746 | Ga0495640_0067799 | |||
| 1747 | Ga0495640_0109797 | |||
| 1748 | Ga0495640_0173616 | |||
| 1749 | Ga0495640_0248942 | |||
| 1750 | Ga0495586_0148651 | |||
| 1751 | Ga0495587_0024602 | |||
| 1752 | Ga0495587_0045905 | |||
| 1753 | Ga0495587_0097864 | |||
| 1754 | Ga0495587_0164432 | |||
| 1755 | Ga0495587_0197398 | |||
| 1756 | Ga0495587_0208595 | |||
| 1757 | Ga0495645_0033594 | |||
| 1758 | Ga0495645_0075147 | |||
| 1759 | Ga0495645_0101904 | |||
| 1760 | Ga0495645_0114693 | |||
| 1761 | Ga0495645_0252153 | |||
| 1762 | Ga0495645_0305593 | |||
| 1763 | Ga0495667_0003592 | |||
| 1764 | Ga0495667_0004931 | |||
| 1765 | Ga0495667_0094785 | |||
| 1766 | Ga0495667_0118270 | |||
| 1767 | Ga0495667_0171632 | |||
| 1768 | Ga0495667_0210273 | |||
| 1769 | Ga0495634_0013707 | |||
| 1770 | Ga0495634_0020609 | |||
| 1771 | Ga0495634_0039737 | |||
| 1772 | Ga0495634_0081204 | |||
| 1773 | Ga0495634_0103209 | |||
| 1774 | Ga0495634_0104408 | |||
| 1775 | Ga0495634_0131825 | |||
| 1776 | Ga0495635_0000167 | |||
| 1777 | Ga0495635_0003308 | |||
| 1778 | Ga0495635_0021276 | |||
| 1779 | Ga0495635_0034908 | |||
| 1780 | Ga0495635_0163881 | |||
| 1781 | Ga0495635_0184946 | |||
| 1782 | Ga0495635_0283110 | |||
| 1783 | Ga0495588_0095718 | |||
| 1784 | Ga0495657_0009170 | |||
| 1785 | Ga0495657_0014229 | |||
| 1786 | Ga0495657_0019494 | |||
| 1787 | Ga0495657_0033670 | |||
| 1788 | Ga0495657_0047773 | |||
| 1789 | Ga0495657_0061025 | |||
| 1790 | Ga0495657_0251246 | |||
| 1791 | Ga0495599_0013087 | |||
| 1792 | Ga0495599_0017167 | |||
| 1793 | Ga0495599_0036826 | |||
| 1794 | Ga0495599_0126056 | |||
| 1795 | Ga0495599_0139835 | |||
| 1796 | Ga0495599_0337196 | |||
| 1797 | Ga0495623_0009884 | |||
| 1798 | Ga0495623_0119571 | |||
| 1799 | Ga0495623_0148027 | |||
| 1800 | Ga0495646_0005026 | |||
| 1801 | Ga0495646_0026821 | |||
| 1802 | Ga0495646_0048742 | |||
| 1803 | Ga0495646_0130271 | |||
| 1804 | Ga0495646_0136677 | |||
| 1805 | Ga0495646_0195336 | |||
| 1806 | Ga0495646_0195831 | |||
| 1807 | Ga0495647_0052981 | |||
| 1808 | Ga0495658_0033886 | |||
| 1809 | Ga0495658_0143748 | |||
| 1810 | Ga0495613_0025552 | |||
| 1811 | Ga0495613_0164157 | |||
| 1812 | Ga0495613_0167987 | |||
| 1813 | Ga0495613_0241634 | |||
| 1814 | Ga0495613_0253533 | |||
| 1815 | Ga0495624_0023389 | |||
| 1816 | Ga0495624_0063148 | |||
| 1817 | Ga0495624_0131799 | |||
| 1818 | Ga0495624_0403089 | |||
| 1819 | Ga0495600_0023959 | |||
| 1820 | Ga0495600_0033655 | |||
| 1821 | Ga0495600_0040966 | |||
| 1822 | Ga0495600_0286995 | |||
| 1823 | Ga0495581_0146660 | |||
| 1824 | Ga0495581_0201738 | |||
| 1825 | Ga0495604_0021763 | |||
| 1826 | Ga0495604_0080993 | |||
| 1827 | Ga0495604_0238532 | |||
| 1828 | Ga0495604_0265431 | |||
| 1829 | Ga0495674_0000044 | |||
| 1830 | Ga0495674_0018759 | |||
| 1831 | Ga0495674_0051727 | |||
| 1832 | Ga0495674_0125764 | |||
| 1833 | Ga0495674_0281774 | |||
| 1834 | Ga0495674_0332714 | |||
| 1835 | Ga0495674_0463302 | |||
| 1836 | Ga0495676_0006483 | |||
| 1837 | Ga0495676_0153882 | |||
| 1838 | Ga0495676_0290285 | |||
| 1839 | Ga0495680_0007276 | |||
| 1840 | Ga0495680_0018692 | |||
| 1841 | Ga0495680_0030279 | |||
| 1842 | Ga0495680_0038973 | |||
| 1843 | Ga0495680_0039241 | |||
| 1844 | Ga0495680_0043735 | |||
| 1845 | Ga0495680_0061177 | |||
| 1846 | Ga0495675_0015972 | |||
| 1847 | Ga0495675_0036317 | |||
| 1848 | Ga0495675_0042569 | |||
| 1849 | Ga0495675_0184658 | |||
| 1850 | Ga0495675_0322501 | |||
| 1851 | Ga0495684_0005883 | |||
| 1852 | Ga0495684_0014401 | |||
| 1853 | Ga0495684_0015548 | |||
| 1854 | Ga0495684_0034125 | |||
| 1855 | Ga0495684_0054474 | |||
| 1856 | Ga0495684_0107739 | |||
| 1857 | Ga0495684_0137970 | |||
| 1858 | Ga0495593_0035798 | |||
| 1859 | Ga0495593_0191930 | |||
| 1860 | Ga0495602_0033246 | |||
| 1861 | Ga0495602_0033697 | |||
| 1862 | Ga0495602_0076321 | |||
| 1863 | Ga0495602_0102485 | |||
| 1864 | Ga0495602_0216394 | |||
| 1865 | Ga0495602_0282297 | |||
| 1866 | Ga0496100_0110210 | |||
| 1867 | Ga0496100_0513099 | |||
| 1868 | Ga0496101_0009532 | |||
| 1869 | Ga0496101_0059487 | |||
| 1870 | Ga0496101_0360857 | |||
| 1871 | Ga0496101_0518056 | |||
| 1872 | Ga0496102_0023852 | |||
| 1873 | Ga0496102_0111766 | |||
| 1874 | Ga0496103_0009543 | |||
| 1875 | Ga0496103_0031978 | |||
| 1876 | Ga0496104_0218082 | |||
| 1877 | Ga0496104_0304312 | |||
| 1878 | Ga0496105_0037155 | |||
| 1879 | Ga0496106_0001193 | |||
| 1880 | Ga0496106_0055066 | |||
| 1881 | Ga0496107_0034499 | |||
| 1882 | Ga0496107_0053432 | |||
| 1883 | Ga0496107_0166075 | |||
| 1884 | Ga0496107_0218336 | |||
| 1885 | Ga0496108_0001106 | |||
| 1886 | Ga0496108_0134026 | |||
| 1887 | Ga0496109_0000747 | |||
| 1888 | Ga0496109_0221092 | |||
| 1889 | Ga0496109_0247183 | |||
| 1890 | Ga0496109_0599360 | |||
| 1891 | Ga0496110_0126550 | |||
| 1892 | Ga0496110_0258590 | |||
| 1893 | Ga0496113_0279939 | |||
| 1894 | Ga0496114_0097916 | |||
| 1895 | Ga0496114_0207913 | |||
| 1896 | Ga0496114_0377164 | |||
| 1897 | Ga0496115_0222450 | |||
| 1898 | Ga0496118_0003661 | |||
| 1899 | Ga0496121_0139984 | |||
| 1900 | Ga0496126_0005213 | |||
| 1901 | Ga0496126_0017841 | |||
| 1902 | Ga0496126_0073428 | |||
| 1903 | Ga0496126_0110089 | |||
| 1904 | Ga0496126_0159946 | |||
| 1905 | Ga0501032_0007563 | |||
| 1906 | Ga0501032_0016176 | |||
| 1907 | Ga0501034_0004854 | |||
| 1908 | Ga0501034_0004904 | |||
| 1909 | Ga0501034_0319147 | |||
| 1910 | Ga0501034_0363085 | |||
| 1911 | Ga0501034_0862977 | |||
| 1912 | Ga0501036_0000454 | |||
| 1913 | Ga0501036_0092292 | |||
| 1914 | Ga0501037_0201724 | |||
| 1915 | Ga0501038_0013310 | |||
| 1916 | Ga0501039_0012909 | |||
| 1917 | Ga0501039_0565714 | |||
| 1918 | Ga0501042_0129725 | |||
| 1919 | Ga0501043_0042995 | |||
| 1920 | Ga0501043_0138775 | |||
| 1921 | Ga0501046_0008990 | |||
| 1922 | Ga0501046_0030084 | |||
| 1923 | Ga0501047_0000072 | |||
| 1924 | Ga0501047_0007135 | |||
| 1925 | Ga0501047_0033093 | |||
| 1926 | Ga0501047_0079709 | |||
| 1927 | Ga0501048_0002246 | |||
| 1928 | Ga0501048_0018471 | |||
| 1929 | Ga0501069_0113217 | |||
| 1930 | Ga0501069_0296354 | |||
| 1931 | Ga0501070_0000288 | |||
| 1932 | Ga0501070_0000852 | |||
| 1933 | Ga0501073_0105594 | |||
| 1934 | Ga0501074_0026809 | |||
| 1935 | Ga0501074_0072969 | |||
| 1936 | Ga0501074_0108742 | |||
| 1937 | Ga0501080_0140500 | |||
| 1938 | Ga0501080_0196765 | |||
| 1939 | Ga0501081_0178963 | |||
| 1940 | Ga0501083_0041242 | |||
| 1941 | Ga0501083_0099697 | |||
| 1942 | Ga0501035_0091771 | |||
| 1943 | Ga0501035_0114385 | |||
| 1944 | Ga0501044_0007276 | |||
| 1945 | Ga0501044_0055104 | |||
| 1946 | Ga0501044_0198518 | |||
| 1947 | Ga0501044_0441860 | |||
| 1948 | Ga0501044_0456662 | |||
| 1949 | Ga0501044_0511868 | |||
| 1950 | Ga0501045_0228231 | |||
| 1951 | nmdc:mga03n38_139213_c1 | |||
| 1952 | nmdc:mga00v17_3958_c1 | |||
| 1953 | nmdc:mga0yw44_7088_c1 | |||
| 1954 | nmdc:mga07m45_33161_c1 | |||
| 1955 | nmdc:mga07m45_37395_c1 | |||
| 1956 | nmdc:mga05p37_360675_c1 | |||
| 1957 | nmdc:mga06r32_4119_c1 | |||
| 1958 | nmdc:mga0n895_49351_c1 | |||
| 1959 | nmdc:mga0n895_559180_c1 | |||
| 1960 | nmdc:mga0rr50_20976_c1 | |||
| 1961 | nmdc:mga08x19_66625_c1 | |||
| 1962 | nmdc:mga0a205_185592_c1 | |||
| 1963 | nmdc:mga0sz30_34660_c1 | |||
| 1964 | nmdc:mga0sz30_76074_c1 | |||
| 1965 | Ga0495601_0061607 | |||
| 1966 | Ga0495601_0069571 | |||
| 1967 | Ga0495601_0126962 | |||
| 1968 | Ga0495601_0155639 | |||
| 1969 | Ga0495601_0287154 | |||
| 1970 | Ga0495601_0311927 | |||
| 1971 | Ga0495612_0043819 | |||
| 1972 | Ga0495612_0052909 | |||
| 1973 | Ga0495612_0093197 | |||
| 1974 | Ga0495595_0017355 | |||
| 1975 | Ga0495619_0010567 | |||
| 1976 | Ga0495619_0013573 | |||
| 1977 | Ga0495619_0101237 | |||
| 1978 | Ga0495619_0105622 | |||
| 1979 | Ga0495619_0134783 | |||
| 1980 | Ga0500643_019759 | |||
| 1981 | Ga0500559_0009140 | |||
| 1982 | Ga0500559_0139557 | |||
| 1983 | Ga0500577_0034858 | |||
| 1984 | Ga0500645_000046 | |||
| 1985 | Ga0501084_0018770 | |||
| 1986 | Ga0501084_0961122 | |||
| 1987 | Ga0466962_0007327 | |||
| 1988 | Ga0466962_0010782 | |||
| 1989 | Ga0466962_0019043 | |||
| 1990 | Ga0530510_0077687 | |||
| 1991 | 2558910479 | |||
| 1992 | 2738704856 | |||
| 1993 | 2739330026 | |||
| 1994 | 2795786090 | |||
| 1995 | 2870783191 | |||
| 1996 | 2899375319 | |||
| 1997 | 2902803440 | |||
| 1998 | 8003323465 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3f67-assembly1.cif.gz_A | crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 | 0.8886 | 6 | 245 |
| 4zv9-assembly6.cif.gz_F | 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai | 0.8836 | 4 | 246 |
| 3f67-assembly1.cif.gz_A | crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 | 0.878 | 6 | 245 |
| 1zic-assembly1.cif.gz_A | crystal structure analysis of the dienelactone hydrolase (c123s, r206a) mutant- 1.7 a | 0.8725 | 12 | 247 |
| 4u2e-assembly1.cif.gz_A | crystal structure of dienelactone hydrolase s-3 variant (q35h, f38l, q110l, c123s, y137c, y145c, n154d, e199g, s208g, g211d and k234n) at 1.70 a resolution | 0.8722 | 12 | 247 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4zv9B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8889 | 4 | 246 | 3.40.50.1820 |
| 3f67A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8781 | 6 | 245 | 3.40.50.1820 |
| 3f67A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8676 | 6 | 245 | 3.40.50.1820 |
| af_I6XF92_3_241_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8649 | 10 | 243 | 3.40.50.1820 |
| af_Q5AI87_1_234_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8548 | 24 | 246 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0C2B4X2-F1-model_v4 | Carboxymethylenebutenolidase | 0.9927 | 5 | 104 |
GO:0016787
|
| AF-A0A1V4PUN1-F1-model_v4 | Carboxymethylenebutenolidase | 0.9874 | 5 | 247 |
GO:0016787
|
| AF-A0A7C7JRL5-F1-model_v4 | Dienelactone hydrolase domain-containing protein | 0.9851 | 167 | 246 |
GO:0016787
|
| AF-A0A1V3XLL5-F1-model_v4 | Dienelactone hydrolase family protein | 0.9848 | 164 | 249 |
GO:0016787
|
| AF-A0A382MJ54-F1-model_v4 | Dienelactone hydrolase domain-containing protein | 0.9843 | 5 | 130 |
GO:0016787
|