F488195

General Info

Members Datasets Scaffolds Average Seq Length
1013 369 1998 248

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10036165|Ga0163162_100361657
Length 276
Sequence LDEWAAVVVGADGNVAYAESVSEKGMRMVSTDAIRAETITIAGHGGDEIEAYSAVPLAPGSRGGVVWIHHMPGYDRETKEFVRRLAVAGYHAICPNLYSREAPGADPDDAAATVRAAGGVPDDRLVGDVAGAAQYLGNLDGANGKTGVIGHCSGGRQAFLAACSLQLDAAVDCYGAFVVEDPPEGMPASMKPILGLASDLSCPLLGLFGMDDRYPSPEAVSKLDAELNRLGKDHEFHSYDGAGHSFFSVDRPAYRVEAALDGWRRIDDFFAKHLEA

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
132 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
134 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028019 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 Metagenome Unclassified
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
197 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
198 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
199 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
200 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
201 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
202 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
203 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
204 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
205 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
209 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
210 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
211 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
212 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
213 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
214 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
218 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
219 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
220 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
221 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
222 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
223 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
224 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
225 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
227 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
229 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
230 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
239 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
240 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
241 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
242 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
243 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
244 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
245 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
246 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
247 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
248 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
249 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
250 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
251 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
252 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
253 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
254 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
255 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
256 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
257 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
258 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
261 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
262 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
263 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
264 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
265 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
266 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
267 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
268 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
269 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
270 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
271 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
272 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
273 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
274 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
275 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
276 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
277 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
278 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
279 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
280 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
281 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
282 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
283 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
284 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
285 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
286 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
287 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
288 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
289 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
292 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
293 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
299 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
300 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
301 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
302 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
317 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
318 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
319 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
331 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
332 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
333 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
336 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
337 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
340 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
341 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
342 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
343 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
347 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
348 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
349 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
350 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
351 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
352 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
353 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
354 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
355 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
356 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
357 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
358 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
359 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
360 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
361 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
362 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
363 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
364 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
365 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
366 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
367 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
368 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
369 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.12
Metatranscriptomes 1.09
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.88
Nodule 0
Rhizoplane 3.16
Rhizosphere 88.94
Stem 0
Stem Tuber 0.1
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10036165 3300013306 Bacteria 4920
2 JGI24746J21847_1002624 3300001977 Bacteria 2846
3 JGI24738J21930_10031127 3300002075 Unclassified 1088
4 JGI24744J21845_10002847 3300002077 Bacteria 3535
5 JGI24744J21845_10005076 3300002077 Bacteria 2722
6 JGI25406J46586_10010135 3300003203 Bacteria 4193
7 JGI25404J52841_10002354 3300003659 Bacteria 3562
8 JGI25405J52794_10030135 3300003911 Bacteria 1124
9 Ga0070658_10000508 3300005327 Bacteria 33678
10 Ga0070658_10012519 3300005327 Bacteria 6805
11 Ga0070658_10020639 3300005327 Bacteria 5279
12 Ga0070658_10074077 3300005327 Bacteria 2792
13 Ga0070658_10095781 3300005327 Bacteria 2450
14 Ga0070658_10102591 3300005327 Bacteria 2366
15 Ga0070676_10014555 3300005328 Bacteria 4325
16 Ga0070676_10063779 3300005328 Bacteria 2195
17 Ga0070676_10098606 3300005328 Bacteria 1802
18 Ga0070683_100003027 3300005329 Bacteria 13504
19 Ga0070683_100042319 3300005329 Bacteria 4194
20 Ga0070683_100051136 3300005329 Bacteria 3826
21 Ga0070683_100138929 3300005329 Bacteria 2301
22 Ga0070690_100020069 3300005330 Bacteria 4067
23 Ga0068869_100081977 3300005334 Bacteria 2410
24 Ga0068869_100166267 3300005334 Bacteria 1720
25 Ga0070666_10000599 3300005335 Bacteria 21663
26 Ga0070666_10109443 3300005335 Bacteria 1910
27 Ga0070680_100075908 3300005336 Bacteria 2767
28 Ga0070680_100145882 3300005336 Bacteria 1986
29 Ga0070680_100213683 3300005336 Bacteria 1627
30 Ga0070682_100008743 3300005337 Bacteria 5713
31 Ga0070682_100026987 3300005337 Bacteria 3443
32 Ga0070682_100097293 3300005337 Bacteria 1937
33 Ga0068868_100014096 3300005338 Bacteria 5885
34 Ga0068868_100061529 3300005338 Bacteria 2974
35 Ga0068868_100347639 3300005338 Bacteria 1269
36 Ga0070660_100025228 3300005339 Bacteria 4417
37 Ga0070660_100092723 3300005339 Bacteria 2384
38 Ga0070660_100297033 3300005339 Bacteria 1324
39 Ga0070660_100559918 3300005339 Bacteria 954
40 Ga0070689_100016357 3300005340 Bacteria 5428
41 Ga0070689_100404460 3300005340 Bacteria 1154
42 Ga0070691_10038306 3300005341 Bacteria 2263
43 Ga0070691_10051466 3300005341 Bacteria 1967
44 Ga0070691_10102724 3300005341 Bacteria 1422
45 Ga0070687_100011299 3300005343 Bacteria 3903
46 Ga0070687_100020506 3300005343 Bacteria 3091
47 Ga0070661_100117955 3300005344 Bacteria 1986
48 Ga0070661_100297434 3300005344 Bacteria 1256
49 Ga0070692_10075952 3300005345 Bacteria 1800
50 Ga0070692_10271126 3300005345 Bacteria 1025
51 Ga0070668_100014966 3300005347 Bacteria 5797
52 Ga0070668_100027507 3300005347 Bacteria 4318
53 Ga0070669_100026232 3300005353 Bacteria 4191
54 Ga0070669_100306491 3300005353 Bacteria 1279
55 Ga0070675_100046139 3300005354 Bacteria 3568
56 Ga0070674_100004962 3300005356 Bacteria 7626
57 Ga0070674_100150542 3300005356 Bacteria 1756
58 Ga0070674_100247597 3300005356 Bacteria 1398
59 Ga0070673_100088883 3300005364 Bacteria 2521
60 Ga0070673_100313801 3300005364 Bacteria 1383
61 Ga0070659_100002245 3300005366 Bacteria 13746
62 Ga0070659_100006711 3300005366 Bacteria 8322
63 Ga0070659_100061327 3300005366 Bacteria 2972
64 Ga0070659_100156084 3300005366 Bacteria 1864
65 Ga0070659_100364006 3300005366 Bacteria 1215
66 Ga0070667_100010948 3300005367 Bacteria 7501
67 Ga0070667_100051599 3300005367 Bacteria 3469
68 Ga0070667_100135634 3300005367 Bacteria 2152
69 Ga0070709_10009918 3300005434 Bacteria 5265
70 Ga0070709_10248591 3300005434 Bacteria 1280
71 Ga0070709_10425772 3300005434 Bacteria 996
72 Ga0070714_100000968 3300005435 Bacteria 20521
73 Ga0070714_100005250 3300005435 Bacteria 9866
74 Ga0070714_100028819 3300005435 Bacteria 4610
75 Ga0070714_100109961 3300005435 Bacteria 2439
76 Ga0070714_100230654 3300005435 Bacteria 1705
77 Ga0070714_100260518 3300005435 Bacteria 1606
78 Ga0070714_100281327 3300005435 Bacteria 1546
79 Ga0070714_100316496 3300005435 Bacteria 1458
80 Ga0070714_100337922 3300005435 Bacteria 1412
81 Ga0070713_100000292 3300005436 Bacteria 33112
82 Ga0070713_100029889 3300005436 Bacteria 4321
83 Ga0070713_100053823 3300005436 Bacteria 3336
84 Ga0070713_100073500 3300005436 Bacteria 2894
85 Ga0070713_100120607 3300005436 Bacteria 2299
86 Ga0070713_100270987 3300005436 Bacteria 1554
87 Ga0070713_100273566 3300005436 Bacteria 1547
88 Ga0070713_100348450 3300005436 Bacteria 1373
89 Ga0070710_10001190 3300005437 Bacteria 12280
90 Ga0070710_10009899 3300005437 Bacteria 4672
91 Ga0070710_10138628 3300005437 Bacteria 1489
92 Ga0070701_10022440 3300005438 Bacteria 3027
93 Ga0070711_100001818 3300005439 Bacteria 11901
94 Ga0070711_100031445 3300005439 Bacteria 3524
95 Ga0070711_100327539 3300005439 Bacteria 1225
96 Ga0070711_100363957 3300005439 Bacteria 1165
97 Ga0070705_100251113 3300005440 Bacteria 1242
98 Ga0070700_100020504 3300005441 Bacteria 3829
99 Ga0070694_100009988 3300005444 Bacteria 5835
100 Ga0070694_100069296 3300005444 Bacteria 2426
101 Ga0070708_100030491 3300005445 Bacteria 4661
102 Ga0070708_100069217 3300005445 Bacteria 3173
103 Ga0070708_100106172 3300005445 Bacteria 2578
104 Ga0070708_100131850 3300005445 Bacteria 2313
105 Ga0070708_100151223 3300005445 Bacteria 2159
106 Ga0070708_100352813 3300005445 Bacteria 1386
107 Ga0070663_100000154 3300005455 Bacteria 33949
108 Ga0070663_100008259 3300005455 Bacteria 6396
109 Ga0070663_100130837 3300005455 Bacteria 1905
110 Ga0070678_100004333 3300005456 Bacteria 8030
111 Ga0070678_100014423 3300005456 Bacteria 4987
112 Ga0070678_100405214 3300005456 Bacteria 1186
113 Ga0070681_10005886 3300005458 Bacteria 11869
114 Ga0070681_10095443 3300005458 Bacteria 2922
115 Ga0070681_10146505 3300005458 Bacteria 2290
116 Ga0070681_10215156 3300005458 Bacteria 1838
117 Ga0070681_10359241 3300005458 Bacteria 1367
118 Ga0068867_100024657 3300005459 Bacteria 4311
119 Ga0068867_100248086 3300005459 Bacteria 1447
120 Ga0068867_100692930 3300005459 Bacteria 898
121 Ga0070685_10033240 3300005466 Bacteria 2895
122 Ga0070706_100001190 3300005467 Bacteria 27871
123 Ga0070706_100010326 3300005467 Bacteria 8673
124 Ga0070706_100193584 3300005467 Bacteria 1900
125 Ga0070706_100339345 3300005467 Bacteria 1401
126 Ga0070706_100648142 3300005467 Bacteria 981
127 Ga0070707_100020033 3300005468 Bacteria 6307
128 Ga0070707_100069666 3300005468 Bacteria 3387
129 Ga0070707_100222863 3300005468 Bacteria 1836
130 Ga0070707_100760377 3300005468 Bacteria 932
131 Ga0070698_100000028 3300005471 Bacteria 98040
132 Ga0070698_100015636 3300005471 Bacteria 8015
133 Ga0070698_100020133 3300005471 Bacteria 6995
134 Ga0070698_100025185 3300005471 Bacteria 6199
135 Ga0070698_100027003 3300005471 Bacteria 5970
136 Ga0070698_100049725 3300005471 Bacteria 4278
137 Ga0070698_100063382 3300005471 Bacteria 3728
138 Ga0070698_100302314 3300005471 Bacteria 1531
139 Ga0070699_100001363 3300005518 Bacteria 22465
140 Ga0070699_100222282 3300005518 Bacteria 1683
141 Ga0070679_100052028 3300005530 Bacteria 4080
142 Ga0070684_100039048 3300005535 Bacteria 4082
143 Ga0070684_100049228 3300005535 Bacteria 3657
144 Ga0070684_100183266 3300005535 Bacteria 1904
145 Ga0070697_100000383 3300005536 Bacteria 34541
146 Ga0070697_100112143 3300005536 Bacteria 2274
147 Ga0068853_100015885 3300005539 Bacteria 6184
148 Ga0068853_100542053 3300005539 Bacteria 1101
149 Ga0070672_100357150 3300005543 Bacteria 1246
150 Ga0070672_100485031 3300005543 Bacteria 1068
151 Ga0070686_100182867 3300005544 Bacteria 1491
152 Ga0070686_100385247 3300005544 Bacteria 1062
153 Ga0070686_100397793 3300005544 Bacteria 1047
154 Ga0070695_100061202 3300005545 Bacteria 2442
155 Ga0070695_100101201 3300005545 Bacteria 1941
156 Ga0070696_100021296 3300005546 Bacteria 4395
157 Ga0070696_100065680 3300005546 Bacteria 2543
158 Ga0070696_100081792 3300005546 Bacteria 2289
159 Ga0070693_100065726 3300005547 Bacteria 2120
160 Ga0070693_100267505 3300005547 Bacteria 1140
161 Ga0070665_100019951 3300005548 Bacteria 6732
162 Ga0070665_100035324 3300005548 Bacteria 5025
163 Ga0070704_100009349 3300005549 Bacteria 5917
164 Ga0070704_100329780 3300005549 Bacteria 1281
165 Ga0068855_100092059 3300005563 Bacteria 3497
166 Ga0068855_100480812 3300005563 Bacteria 1352
167 Ga0068855_100513514 3300005563 Bacteria 1301
168 Ga0070664_100113964 3300005564 Bacteria 2361
169 Ga0070664_100182673 3300005564 Bacteria 1865
170 Ga0070664_100306747 3300005564 Bacteria 1435
171 Ga0068857_100043855 3300005577 Bacteria 3967
172 Ga0068854_100122448 3300005578 Bacteria 1977
173 Ga0068854_100308096 3300005578 Bacteria 1283
174 Ga0068854_100623927 3300005578 Bacteria 923
175 Ga0068856_100543456 3300005614 Bacteria 1183
176 Ga0068856_100685199 3300005614 Bacteria 1045
177 Ga0070702_100085222 3300005615 Bacteria 1902
178 Ga0068852_100123783 3300005616 Bacteria 2371
179 Ga0068852_100154175 3300005616 Bacteria 2138
180 Ga0068859_100002009 3300005617 Bacteria 20771
181 Ga0068859_100028972 3300005617 Bacteria 5555
182 Ga0068859_100046620 3300005617 Bacteria 4352
183 Ga0068859_100198952 3300005617 Bacteria 2088
184 Ga0068859_100582307 3300005617 Unclassified 1213
185 Ga0068864_100049548 3300005618 Bacteria 3614
186 Ga0068866_10008951 3300005718 Bacteria 4238
187 Ga0068866_10035456 3300005718 Bacteria 2437
188 Ga0068866_10048347 3300005718 Bacteria 2150
189 Ga0068861_100300334 3300005719 Bacteria 1390
190 Ga0068851_10066565 3300005834 Bacteria 1856
191 Ga0068851_10086672 3300005834 Bacteria 1643
192 Ga0068870_10025246 3300005840 Bacteria 2948
193 Ga0068863_100400701 3300005841 Bacteria 1342
194 Ga0068858_100018088 3300005842 Bacteria 6600
195 Ga0068858_100166178 3300005842 Bacteria 2079
196 Ga0068860_100000067 3300005843 Bacteria 180176
197 Ga0068860_100079327 3300005843 Bacteria 3121
198 Ga0068862_100025498 3300005844 Bacteria 4964
199 Ga0068862_100051958 3300005844 Bacteria 3506
200 Ga0068862_100283628 3300005844 Bacteria 1519
201 Ga0081455_10000974 3300005937 Bacteria 36539
202 Ga0081455_10065050 3300005937 Bacteria 3051
203 Ga0081455_10072991 3300005937 Bacteria 2838
204 Ga0081455_10218482 3300005937 Bacteria 1414
205 Ga0081538_10148850 3300005981 Bacteria 1064
206 Ga0081539_10000482 3300005985 Bacteria 84124
207 Ga0070717_10001057 3300006028 Bacteria 18499
208 Ga0070717_10039252 3300006028 Bacteria 3852
209 Ga0070717_10056789 3300006028 Bacteria 3235
210 Ga0070717_10056804 3300006028 Bacteria 3235
211 Ga0070717_10073695 3300006028 Bacteria 2854
212 Ga0070717_10204377 3300006028 Bacteria 1731
213 Ga0070717_10331910 3300006028 Bacteria 1357
214 Ga0070717_10385363 3300006028 Bacteria 1257
215 Ga0070717_10492117 3300006028 Bacteria 1108
216 Ga0070717_10912964 3300006028 Bacteria 800
217 Ga0075363_100002024 3300006048 Bacteria 8086
218 Ga0075364_10006138 3300006051 Bacteria 7033
219 Ga0070715_10005940 3300006163 Bacteria 4116
220 Ga0070715_10028906 3300006163 Bacteria 2229
221 Ga0070715_10063627 3300006163 Bacteria 1627
222 Ga0070716_100001660 3300006173 Bacteria 10034
223 Ga0070716_100007955 3300006173 Bacteria 5248
224 Ga0070716_100009500 3300006173 Bacteria 4850
225 Ga0070716_100042011 3300006173 Bacteria 2550
226 Ga0070716_100366101 3300006173 Bacteria 1025
227 Ga0070712_100005616 3300006175 Bacteria 7761
228 Ga0070712_100008614 3300006175 Bacteria 6420
229 Ga0070712_100016635 3300006175 Bacteria 4752
230 Ga0070712_100043097 3300006175 Bacteria 3105
231 Ga0070712_100068474 3300006175 Bacteria 2529
232 Ga0070712_100391871 3300006175 Bacteria 1145
233 Ga0075369_10002093 3300006186 Bacteria 7043
234 Ga0075369_10002645 3300006186 Bacteria 6411
235 Ga0075369_10045826 3300006186 Bacteria 1881
236 Ga0097621_100026048 3300006237 Bacteria 4583
237 Ga0097621_100083376 3300006237 Bacteria 2664
238 Ga0075370_10026358 3300006353 Bacteria 3219
239 Ga0075428_100007121 3300006844 Bacteria 12387
240 Ga0075430_100065719 3300006846 Bacteria 3047
241 Ga0068865_100000387 3300006881 Bacteria 24426
242 Ga0068865_100300452 3300006881 Bacteria 1285
243 Ga0075436_100090274 3300006914 Bacteria 2130
244 Ga0075436_100217509 3300006914 Bacteria 1355
245 Ga0097620_100002008 3300006931 Bacteria 20771
246 Ga0097620_100028971 3300006931 Bacteria 5555
247 Ga0097620_100046623 3300006931 Bacteria 4352
248 Ga0097620_100198946 3300006931 Bacteria 2088
249 Ga0097620_100582307 3300006931 Unclassified 1213
250 Ga0099794_10225006 3300007265 Bacteria 964
251 Ga0099795_10039100 3300007788 Bacteria 1677
252 Ga0105244_10144217 3300009036 Bacteria 1144
253 Ga0105240_10011130 3300009093 Bacteria 12570
254 Ga0105240_10451854 3300009093 Bacteria 1438
255 Ga0105245_10027833 3300009098 Bacteria 4981
256 Ga0105245_10029652 3300009098 Bacteria 4836
257 Ga0105245_10285814 3300009098 Bacteria 1614
258 Ga0105245_10505006 3300009098 Bacteria 1226
259 Ga0105247_10005969 3300009101 Bacteria 7587
260 Ga0105247_10242187 3300009101 Bacteria 1229
261 Ga0114129_10098741 3300009147 Bacteria 4042
262 Ga0114129_10805088 3300009147 Bacteria 1198
263 Ga0105243_10000843 3300009148 Bacteria 29147
264 Ga0105241_10028985 3300009174 Bacteria 4126
265 Ga0105241_10377713 3300009174 Bacteria 1237
266 Ga0105242_10046867 3300009176 Bacteria 3509
267 Ga0105242_10129265 3300009176 Bacteria 2178
268 Ga0105242_10202595 3300009176 Bacteria 1763
269 Ga0105242_10265758 3300009176 Bacteria 1552
270 Ga0105248_10011276 3300009177 Bacteria 9859
271 Ga0105248_10043895 3300009177 Bacteria 5014
272 Ga0105248_10514321 3300009177 Bacteria 1350
273 Ga0105237_10104883 3300009545 Bacteria 2818
274 Ga0105249_10000784 3300009553 Bacteria 28520
275 Ga0105239_10248866 3300010375 Bacteria 1996
276 Ga0105239_10276087 3300010375 Bacteria 1891
277 Ga0105239_10411586 3300010375 Bacteria 1531
278 Ga0105246_10082055 3300011119 Bacteria 2300
279 Ga0105246_10304675 3300011119 Bacteria 1288
280 Ga0157342_1003067 3300012507 Bacteria 1409
281 Ga0157373_10378657 3300013100 Bacteria 1012
282 Ga0157371_10005054 3300013102 Bacteria 11272
283 Ga0157371_10169634 3300013102 Bacteria 1559
284 Ga0157370_10022049 3300013104 Bacteria 6342
285 Ga0157369_10005401 3300013105 Bacteria 14876
286 Ga0157369_10010931 3300013105 Bacteria 10333
287 Ga0157369_10011881 3300013105 Bacteria 9890
288 Ga0157369_10101343 3300013105 Bacteria 3068
289 Ga0157369_10191870 3300013105 Bacteria 2147
290 Ga0157369_10558805 3300013105 Bacteria 1182
291 Ga0157374_10096699 3300013296 Bacteria 2824
292 Ga0157374_10352716 3300013296 Bacteria 1462
293 Ga0157374_10645988 3300013296 Bacteria 1070
294 Ga0157378_10005566 3300013297 Bacteria 11028
295 Ga0157378_10199920 3300013297 Bacteria 1890
296 Ga0157378_10316073 3300013297 Bacteria 1516
297 Ga0163162_10088075 3300013306 Bacteria 3184
298 Ga0163162_10161033 3300013306 Bacteria 2366
299 Ga0163162_10719393 3300013306 Bacteria 1119
300 Ga0157372_10066489 3300013307 Bacteria 4050
301 Ga0157372_10339172 3300013307 Bacteria 1751
302 Ga0157375_10001987 3300013308 Bacteria 17655
303 Ga0163163_10166016 3300014325 Bacteria 2254
304 Ga0163163_10450337 3300014325 Bacteria 1347
305 Ga0163163_10489668 3300014325 Bacteria 1291
306 Ga0157380_10360406 3300014326 Bacteria 1364
307 Ga0157377_10254328 3300014745 Bacteria 1140
308 Ga0157379_10014388 3300014968 Bacteria 6942
309 Ga0157379_10033440 3300014968 Bacteria 4586
310 Ga0157379_10095885 3300014968 Bacteria 2662
311 Ga0157376_10069402 3300014969 Bacteria 2988
312 Ga0163161_10027781 3300017792 Bacteria 4015
313 Ga0163161_10127243 3300017792 Bacteria 1919
314 Ga0197907_10456462 3300020069 Bacteria 3796
315 Ga0206356_10069604 3300020070 Bacteria 3015
316 Ga0206349_1059723 3300020075 Bacteria 2526
317 Ga0206354_10021129 3300020081 Bacteria 2191
318 Ga0206354_10448767 3300020081 Bacteria 3565
319 Ga0206353_11415596 3300020082 Bacteria 2833
320 Ga0206353_11658561 3300020082 Bacteria 1252
321 Ga0206353_11792839 3300020082 Bacteria 2197
322 Ga0213874_10046395 3300021377 Bacteria 1319
323 Ga0213874_10067553 3300021377 Bacteria 1133
324 Ga0213876_10019846 3300021384 Bacteria 3550
325 Ga0213876_10020650 3300021384 Bacteria 3482
326 Ga0213876_10032212 3300021384 Bacteria 2765
327 Ga0213876_10198765 3300021384 Bacteria 1066
328 Ga0213875_10000092 3300021388 Bacteria 104416
329 Ga0213875_10001276 3300021388 Bacteria 16871
330 Ga0213875_10003226 3300021388 Bacteria 9364
331 Ga0213875_10007935 3300021388 Bacteria 5457
332 Ga0213875_10012033 3300021388 Bacteria 4286
333 Ga0213875_10017021 3300021388 Bacteria 3519
334 Ga0213875_10019923 3300021388 Bacteria 3222
335 Ga0213875_10058713 3300021388 Bacteria 1801
336 Ga0213875_10077283 3300021388 Bacteria 1553
337 Ga0224712_10003853 3300022467 Bacteria 3965
338 Ga0224712_10008590 3300022467 Bacteria 3036
339 Ga0224712_10009184 3300022467 Bacteria 2967
340 Ga0228598_1011687 3300024227 Bacteria 1746
341 Ga0209051_1022517 3300025303 Bacteria 2650
342 Ga0207653_10014869 3300025885 Bacteria 2442
343 Ga0207692_10006893 3300025898 Bacteria 4630
344 Ga0207692_10074928 3300025898 Bacteria 1794
345 Ga0207692_10250446 3300025898 Bacteria 1061
346 Ga0207642_10081287 3300025899 Bacteria 1574
347 Ga0207642_10277020 3300025899 Bacteria 963
348 Ga0207710_10207714 3300025900 Bacteria 969
349 Ga0207688_10001071 3300025901 Bacteria 14010
350 Ga0207688_10009517 3300025901 Bacteria 5289
351 Ga0207688_10011202 3300025901 Bacteria 4882
352 Ga0207680_10011616 3300025903 Bacteria 4455
353 Ga0207680_10088708 3300025903 Bacteria 1961
354 Ga0207680_10128630 3300025903 Bacteria 1666
355 Ga0207647_10048321 3300025904 Bacteria 2643
356 Ga0207647_10120485 3300025904 Bacteria 1547
357 Ga0207685_10044700 3300025905 Bacteria 1676
358 Ga0207699_10001559 3300025906 Bacteria 10861
359 Ga0207699_10013348 3300025906 Bacteria 4202
360 Ga0207699_10022711 3300025906 Bacteria 3404
361 Ga0207699_10045557 3300025906 Bacteria 2561
362 Ga0207699_10056345 3300025906 Bacteria 2342
363 Ga0207699_10193283 3300025906 Bacteria 1374
364 Ga0207699_10253633 3300025906 Bacteria 1213
365 Ga0207645_10012105 3300025907 Bacteria 5863
366 Ga0207645_10118995 3300025907 Bacteria 1714
367 Ga0207643_10051128 3300025908 Bacteria 2345
368 Ga0207705_10000605 3300025909 Bacteria 30085
369 Ga0207705_10004465 3300025909 Bacteria 10569
370 Ga0207705_10009551 3300025909 Bacteria 7057
371 Ga0207705_10047926 3300025909 Bacteria 3073
372 Ga0207705_10051655 3300025909 Bacteria 2959
373 Ga0207684_10000479 3300025910 Bacteria 51757
374 Ga0207684_10028810 3300025910 Bacteria 4730
375 Ga0207684_10029056 3300025910 Bacteria 4709
376 Ga0207684_10030881 3300025910 Bacteria 4560
377 Ga0207684_10040321 3300025910 Bacteria 3959
378 Ga0207684_10212932 3300025910 Bacteria 1667
379 Ga0207654_10045265 3300025911 Bacteria 2503
380 Ga0207707_10047626 3300025912 Bacteria 3733
381 Ga0207707_10071856 3300025912 Bacteria 3016
382 Ga0207707_10120458 3300025912 Bacteria 2294
383 Ga0207707_10314515 3300025912 Bacteria 1353
384 Ga0207693_10000423 3300025915 Bacteria 38487
385 Ga0207693_10000616 3300025915 Bacteria 31851
386 Ga0207693_10001314 3300025915 Bacteria 22042
387 Ga0207693_10004511 3300025915 Bacteria 11775
388 Ga0207693_10018340 3300025915 Bacteria 5575
389 Ga0207693_10038999 3300025915 Bacteria 3740
390 Ga0207693_10049911 3300025915 Bacteria 3286
391 Ga0207693_10058767 3300025915 Bacteria 3012
392 Ga0207693_10104137 3300025915 Bacteria 2225
393 Ga0207693_10109999 3300025915 Bacteria 2161
394 Ga0207693_10340512 3300025915 Bacteria 1174
395 Ga0207663_10019079 3300025916 Bacteria 3855
396 Ga0207663_10025457 3300025916 Bacteria 3421
397 Ga0207663_10178884 3300025916 Bacteria 1513
398 Ga0207663_10333011 3300025916 Bacteria 1144
399 Ga0207663_10444822 3300025916 Bacteria 999
400 Ga0207660_10055674 3300025917 Bacteria 2828
401 Ga0207660_10137480 3300025917 Bacteria 1865
402 Ga0207660_10443040 3300025917 Bacteria 1050
403 Ga0207660_10443617 3300025917 Bacteria 1049
404 Ga0207657_10014859 3300025919 Bacteria 7577
405 Ga0207657_10035895 3300025919 Bacteria 4440
406 Ga0207657_10085054 3300025919 Bacteria 2650
407 Ga0207657_10171111 3300025919 Bacteria 1760
408 Ga0207657_10205318 3300025919 Bacteria 1583
409 Ga0207657_10228154 3300025919 Bacteria 1490
410 Ga0207649_10072909 3300025920 Bacteria 2198
411 Ga0207652_10037186 3300025921 Bacteria 4120
412 Ga0207652_10080224 3300025921 Bacteria 2852
413 Ga0207652_10081927 3300025921 Bacteria 2823
414 Ga0207652_10299031 3300025921 Bacteria 1453
415 Ga0207652_10385309 3300025921 Bacteria 1265
416 Ga0207646_10006081 3300025922 Bacteria 12571
417 Ga0207646_10045679 3300025922 Bacteria 3931
418 Ga0207646_10062112 3300025922 Bacteria 3335
419 Ga0207646_10131593 3300025922 Bacteria 2252
420 Ga0207646_10343093 3300025922 Bacteria 1349
421 Ga0207681_10022242 3300025923 Bacteria 4042
422 Ga0207681_10157716 3300025923 Bacteria 1707
423 Ga0207681_10267441 3300025923 Bacteria 1341
424 Ga0207659_10365851 3300025926 Bacteria 1200
425 Ga0207687_10043445 3300025927 Bacteria 3097
426 Ga0207687_10113941 3300025927 Bacteria 2012
427 Ga0207700_10000840 3300025928 Bacteria 17750
428 Ga0207700_10003624 3300025928 Bacteria 9002
429 Ga0207700_10025128 3300025928 Bacteria 4132
430 Ga0207700_10034240 3300025928 Bacteria 3645
431 Ga0207700_10070230 3300025928 Bacteria 2691
432 Ga0207700_10070506 3300025928 Bacteria 2687
433 Ga0207700_10398870 3300025928 Bacteria 1205
434 Ga0207700_10470036 3300025928 Bacteria 1110
435 Ga0207700_10485833 3300025928 Bacteria 1092
436 Ga0207700_10563855 3300025928 Bacteria 1012
437 Ga0207664_10002562 3300025929 Bacteria 12015
438 Ga0207664_10007405 3300025929 Bacteria 7610
439 Ga0207664_10009335 3300025929 Bacteria 6878
440 Ga0207664_10022468 3300025929 Bacteria 4710
441 Ga0207664_10091112 3300025929 Bacteria 2499
442 Ga0207664_10138041 3300025929 Bacteria 2059
443 Ga0207664_10152694 3300025929 Bacteria 1963
444 Ga0207664_10166916 3300025929 Bacteria 1881
445 Ga0207664_10379661 3300025929 Bacteria 1254
446 Ga0207664_10409196 3300025929 Bacteria 1207
447 Ga0207690_10000233 3300025932 Bacteria 41413
448 Ga0207690_10034960 3300025932 Bacteria 3241
449 Ga0207690_10072212 3300025932 Bacteria 2383
450 Ga0207706_10010102 3300025933 Bacteria 8644
451 Ga0207706_10013880 3300025933 Bacteria 7305
452 Ga0207709_10017023 3300025935 Bacteria 4052
453 Ga0207670_10080370 3300025936 Bacteria 2279
454 Ga0207670_10274267 3300025936 Bacteria 1312
455 Ga0207669_10199321 3300025937 Bacteria 1451
456 Ga0207669_10278897 3300025937 Bacteria 1259
457 Ga0207704_10129262 3300025938 Bacteria 1746
458 Ga0207665_10010160 3300025939 Bacteria 6179
459 Ga0207665_10010827 3300025939 Bacteria 5987
460 Ga0207665_10012787 3300025939 Bacteria 5521
461 Ga0207665_10019709 3300025939 Bacteria 4433
462 Ga0207665_10052319 3300025939 Bacteria 2751
463 Ga0207665_10079465 3300025939 Bacteria 2254
464 Ga0207691_10058013 3300025940 Bacteria 3522
465 Ga0207691_10091675 3300025940 Bacteria 2723
466 Ga0207691_10095113 3300025940 Bacteria 2665
467 Ga0207711_10074539 3300025941 Bacteria 2951
468 Ga0207689_10012341 3300025942 Bacteria 7310
469 Ga0207689_10013563 3300025942 Bacteria 6955
470 Ga0207689_10034437 3300025942 Bacteria 4207
471 Ga0207689_10105595 3300025942 Bacteria 2314
472 Ga0207661_10006204 3300025944 Bacteria 8454
473 Ga0207661_10038456 3300025944 Bacteria 3750
474 Ga0207661_10043418 3300025944 Bacteria 3547
475 Ga0207661_10081658 3300025944 Bacteria 2671
476 Ga0207679_10155343 3300025945 Bacteria 1868
477 Ga0207679_10559789 3300025945 Bacteria 1027
478 Ga0207667_10039431 3300025949 Bacteria 5034
479 Ga0207667_10145631 3300025949 Bacteria 2438
480 Ga0207712_10021393 3300025961 Bacteria 4247
481 Ga0207668_10218930 3300025972 Bacteria 1527
482 Ga0207640_10231704 3300025981 Bacteria 1421
483 Ga0207640_10323884 3300025981 Bacteria 1228
484 Ga0207640_10451791 3300025981 Bacteria 1059
485 Ga0207658_10035510 3300025986 Bacteria 3570
486 Ga0207658_10067634 3300025986 Bacteria 2692
487 Ga0207677_10018136 3300026023 Bacteria 4218
488 Ga0207677_10049056 3300026023 Bacteria 2846
489 Ga0207703_10048810 3300026035 Bacteria 3419
490 Ga0207703_10060869 3300026035 Bacteria 3089
491 Ga0207639_10247707 3300026041 Bacteria 1552
492 Ga0207678_10000312 3300026067 Bacteria 43816
493 Ga0207678_10012393 3300026067 Bacteria 7484
494 Ga0207678_10013964 3300026067 Bacteria 7060
495 Ga0207678_10017380 3300026067 Bacteria 6315
496 Ga0207678_10048817 3300026067 Bacteria 3658
497 Ga0207708_10006460 3300026075 Bacteria 8688
498 Ga0207708_10028114 3300026075 Bacteria 4258
499 Ga0207708_10099374 3300026075 Bacteria 2251
500 Ga0207641_10499711 3300026088 Bacteria 1181
501 Ga0207648_10017557 3300026089 Bacteria 6503
502 Ga0207648_10263458 3300026089 Bacteria 1538
503 Ga0207648_10271385 3300026089 Bacteria 1515
504 Ga0207676_10314727 3300026095 Bacteria 1434
505 Ga0207674_10008344 3300026116 Bacteria 11986
506 Ga0207674_10063478 3300026116 Bacteria 3729
507 Ga0207675_100001298 3300026118 Bacteria 25048
508 Ga0207675_100004705 3300026118 Bacteria 13138
509 Ga0207683_10000649 3300026121 Bacteria 31834
510 Ga0207683_10006893 3300026121 Bacteria 9728
511 Ga0207683_10084875 3300026121 Bacteria 2815
512 Ga0207683_10218904 3300026121 Bacteria 1734
513 Ga0207698_10048510 3300026142 Bacteria 3225
514 Ga0207698_10088301 3300026142 Bacteria 2528
515 Ga0209179_1012043 3300027512 Bacteria 1546
516 Ga0224573_1001931 3300028019 Bacteria 1604
517 Ga0268266_10020337 3300028379 Bacteria 5658
518 Ga0268266_10025742 3300028379 Bacteria 5006
519 Ga0268266_10044204 3300028379 Bacteria 3808
520 Ga0268264_10000114 3300028381 Bacteria 203211
521 Ga0265338_10043340 3300028800 Bacteria 4175
522 Ga0265338_10106020 3300028800 Bacteria 2277
523 Ga0307511_10077799 3300030521 Bacteria 2358
524 Ga0307512_10005068 3300030522 Bacteria 14007
525 Ga0265325_10001514 3300031241 Bacteria 16341
526 Ga0265329_10061583 3300031242 Bacteria 1188
527 Ga0265340_10000928 3300031247 Bacteria 16665
528 Ga0265339_10006895 3300031249 Bacteria 7405
529 Ga0265316_10014581 3300031344 Bacteria 6911
530 Ga0307508_10044056 3300031616 Bacteria 3994
531 Ga0307508_10270284 3300031616 Bacteria 1294
532 Ga0307508_10312737 3300031616 Bacteria 1163
533 Ga0265342_10037671 3300031712 Bacteria 2948
534 Ga0307518_10076530 3300031838 Bacteria 2419
535 Ga0307406_10072519 3300031901 Bacteria 2261
536 Ga0307415_100284151 3300032126 Bacteria 1362
537 Ga0307507_10007414 3300033179 Bacteria 15982
538 Ga0307507_10023724 3300033179 Bacteria 6719
539 Ga0307510_10086353 3300033180 Bacteria 3010
540 Ga0307510_10145824 3300033180 Bacteria 1999
541 Ga0373959_0013904 3300034820 Bacteria 1458
542 Ga0373926_0000667 3300035083 Bacteria 9402
543 Ga0373934_0009033 3300035086 Bacteria 3727
544 Ga0373934_0115528 3300035086 Bacteria 1090
545 Ga0373944_0005783 3300035089 Bacteria 3269
546 Ga0373944_0020733 3300035089 Bacteria 1896
547 Ga0373944_0055187 3300035089 Bacteria 1261
548 Ga0373951_0032090 3300035091 Bacteria 1241
549 Ga0373923_0009399 3300035111 Bacteria 3528
550 Ga0373923_0020665 3300035111 Bacteria 2560
551 Ga0373923_0147266 3300035111 Bacteria 1067
552 Ga0373936_0000597 3300035113 Bacteria 12494
553 Ga0373936_0013959 3300035113 Bacteria 3068
554 Ga0373936_0104530 3300035113 Bacteria 1197
555 Ga0373936_0154416 3300035113 Bacteria 996
556 Ga0373936_0284560 3300035113 Bacteria 743
557 Ga0373945_0001009 3300035116 Bacteria 8420
558 Ga0373945_0012897 3300035116 Bacteria 2783
559 Ga0373953_0011944 3300035117 Bacteria 3061
560 Ga0373953_0033364 3300035117 Bacteria 2013
561 Ga0373954_0007461 3300035118 Bacteria 4786
562 Ga0373954_0036395 3300035118 Bacteria 2285
563 Ga0373956_0001023 3300035119 Bacteria 11549
564 Ga0373956_0031742 3300035119 Bacteria 2316
565 Ga0373956_0072342 3300035119 Bacteria 1574
566 Ga0373956_0074141 3300035119 Bacteria 1555
567 Ga0373957_0046125 3300035120 Bacteria 1653
568 Ga0373957_0049648 3300035120 Bacteria 1602
569 Ga0373957_0103488 3300035120 Bacteria 1141
570 Ga0373943_0003599 3300035170 Bacteria 7050
571 Ga0373943_0242661 3300035170 Bacteria 1010
572 Ga0373946_0000489 3300035171 Bacteria 13111
573 Ga0373946_0004311 3300035171 Bacteria 5084
574 Ga0373946_0054315 3300035171 Bacteria 1685
575 Ga0373946_0175312 3300035171 Bacteria 1014
576 Ga0373955_0015974 3300035172 Bacteria 3686
577 Ga0373955_0026007 3300035172 Bacteria 3010
578 Ga0373955_0125258 3300035172 Bacteria 1496
579 Ga0373955_0271875 3300035172 Bacteria 1018
580 Ga0373924_0005932 3300035410 Bacteria 4353
581 Ga0373924_0013799 3300035410 Bacteria 3041
582 Ga0373924_0031541 3300035410 Bacteria 2131
583 Ga0373924_0045623 3300035410 Bacteria 1803
584 Ga0373924_0097369 3300035410 Bacteria 1263
585 Ga0373924_0106918 3300035410 Bacteria 1206
586 Ga0373931_0047027 3300035691 Bacteria 2283
587 Ga0373931_0143514 3300035691 Bacteria 1385
588 Ga0373931_0240431 3300035691 Bacteria 1097
589 Ga0373931_0246744 3300035691 Bacteria 1084
590 Ga0373935_0000490 3300035692 Bacteria 20488
591 Ga0373935_0028478 3300035692 Bacteria 3453
592 Ga0373935_0034971 3300035692 Bacteria 3134
593 Ga0373935_0103837 3300035692 Bacteria 1877
594 Ga0373935_0106863 3300035692 Bacteria 1852
595 Ga0373935_0180472 3300035692 Bacteria 1449
596 Ga0373927_0009224 3300035695 Bacteria 6619
597 Ga0373927_0048886 3300035695 Bacteria 2735
598 Ga0373927_0059376 3300035695 Bacteria 2473
599 Ga0373933_0005326 3300035724 Bacteria 7011
600 Ga0373933_0044479 3300035724 Bacteria 2630
601 Ga0373933_0099998 3300035724 Bacteria 1798
602 Ga0373933_0148064 3300035724 Bacteria 1485
603 Ga0373933_0178812 3300035724 Bacteria 1352
604 Ga0373933_0291362 3300035724 Bacteria 1055
605 Ga0373947_0005336 3300035725 Bacteria 7509
606 Ga0373947_0049079 3300035725 Bacteria 2533
607 Ga0373947_0154150 3300035725 Bacteria 1481
608 Ga0373937_0019941 3300036401 Bacteria 6005
609 Ga0373937_0054768 3300036401 Bacteria 3660
610 Ga0373937_0132730 3300036401 Bacteria 2326
611 Ga0373937_0268952 3300036401 Bacteria 1608
612 Ga0373925_0012478 3300037068 Bacteria 6154
613 Ga0373925_0102763 3300037068 Bacteria 2199
614 Ga0373925_0118787 3300037068 Bacteria 2050
615 Ga0395899_0388439 3300037312 Bacteria 926
616 Ga0395900_0221700 3300037418 Bacteria 1906
617 Ga0395900_0288021 3300037418 Bacteria 1632
618 Ga0436364_0037108 3300037853 Bacteria 71393
619 Ga0436364_0189458 3300037853 Bacteria 4920
620 Ga0436364_0193972 3300037853 Bacteria 2768
621 Ga0436364_0265841 3300037853 Bacteria 68488
622 Ga0436364_0316624 3300037853 Bacteria 5998
623 Ga0436364_0467315 3300037853 Bacteria 53239
624 Ga0436364_0527355 3300037853 Bacteria 148076
625 Ga0436364_0802113 3300037853 Bacteria 4851
626 Ga0436364_0815450 3300037853 Bacteria 1113
627 Ga0436364_0828822 3300037853 Bacteria 4753
628 Ga0436364_1002699 3300037853 Bacteria 6488
629 Ga0436364_1416932 3300037853 Bacteria 21451
630 Ga0436364_1455692 3300037853 Bacteria 19581
631 Ga0395901_0046735 3300038443 Bacteria 4497
632 Ga0395901_0104373 3300038443 Bacteria 2975
633 Ga0436365_0539792 3300039437 Bacteria 8157
634 Ga0436365_0670227 3300039437 Bacteria 1769
635 Ga0436365_1206577 3300039437 Bacteria 7365
636 Ga0436365_1253726 3300039437 Bacteria 22924
637 Ga0436363_0169189 3300039450 Bacteria 13441
638 Ga0436363_0225351 3300039450 Bacteria 3283
639 Ga0436363_0309457 3300039450 Bacteria 2019
640 Ga0436363_0317063 3300039450 Bacteria 4323
641 Ga0436362_0000051 3300039453 Bacteria 1038
642 Ga0436362_0173909 3300039453 Bacteria 1970
643 Ga0439448_0007690 3300042005 Bacteria 3133
644 Ga0439448_0085225 3300042005 Bacteria 1064
645 Ga0439463_010541 3300042016 Bacteria 2270
646 Ga0439460_0000696 3300042461 Bacteria 7462
647 Ga0466969_0015291 3300044656 Bacteria 4023
648 Ga0466969_0102550 3300044656 Bacteria 1345
649 Ga0466972_0109290 3300044658 Bacteria 1307
650 Ga0466965_0143410 3300044683 Bacteria 1245
651 Ga0466966_0011757 3300044684 Bacteria 5802
652 Ga0466966_0044068 3300044684 Bacteria 2857
653 Ga0466961_0011066 3300044693 Bacteria 5766
654 Ga0466963_0024648 3300044694 Bacteria 3830
655 Ga0466963_0055385 3300044694 Bacteria 2637
656 Ga0466963_0063730 3300044694 Bacteria 2468
657 Ga0466963_0240275 3300044694 Bacteria 1270
658 Ga0466964_0121752 3300044706 Bacteria 1177
659 Ga0466971_0001144 3300044719 Bacteria 11019
660 Ga0466971_0082049 3300044719 Bacteria 1471
661 Ga0466971_0181244 3300044719 Unclassified 990
662 Ga0466968_0054608 3300044735 Bacteria 1713
663 Ga0466957_0063349 3300044842 Bacteria 2273
664 Ga0466960_0013128 3300044901 Bacteria 3512
665 Ga0466960_0029520 3300044901 Bacteria 2517
666 Ga0466959_0056285 3300045049 Bacteria 2869
667 Ga0466959_0094925 3300045049 Bacteria 2139
668 Ga0466958_0003222 3300045836 Bacteria 8418
669 Ga0466958_0049571 3300045836 Bacteria 2541
670 Ga0466958_0244481 3300045836 Bacteria 1147
671 Ga0466967_0003944 3300045976 Bacteria 9865
672 Ga0466967_0004464 3300045976 Bacteria 9440
673 Ga0466967_0035721 3300045976 Bacteria 4234
674 Ga0466967_0043727 3300045976 Bacteria 3880
675 Ga0466967_0058459 3300045976 Bacteria 3409
676 Ga0466967_0061983 3300045976 Bacteria 3319
677 Ga0466967_0066989 3300045976 Bacteria 3201
678 Ga0495592_0034357 3300046454 Bacteria 3822
679 Ga0495592_0057729 3300046454 Bacteria 2864
680 Ga0495592_0068721 3300046454 Bacteria 2585
681 Ga0495592_0278547 3300046454 Bacteria 1094
682 Ga0495603_0050085 3300046455 Bacteria 2484
683 Ga0495603_0225644 3300046455 Bacteria 1080
684 Ga0495629_0014236 3300046459 Bacteria 5728
685 Ga0495629_0229545 3300046459 Bacteria 1279
686 Ga0495641_0002946 3300046461 Bacteria 13111
687 Ga0495641_0027757 3300046461 Bacteria 2747
688 Ga0495641_0126664 3300046461 Bacteria 1140
689 Ga0495641_0156387 3300046461 Bacteria 1019
690 Ga0495651_0016782 3300046462 Bacteria 5671
691 Ga0495651_0024364 3300046462 Bacteria 4708
692 Ga0495651_0071352 3300046462 Bacteria 2640
693 Ga0495651_0096301 3300046462 Bacteria 2211
694 Ga0495651_0126208 3300046462 Bacteria 1873
695 Ga0495651_0295461 3300046462 Bacteria 1088
696 Ga0495653_0001335 3300046463 Bacteria 19148
697 Ga0495653_0023619 3300046463 Bacteria 4963
698 Ga0495653_0032698 3300046463 Bacteria 4128
699 Ga0495653_0057148 3300046463 Bacteria 2971
700 Ga0495653_0098223 3300046463 Bacteria 2126
701 Ga0495653_0174842 3300046463 Bacteria 1478
702 Ga0495650_0029405 3300046471 Bacteria 2505
703 Ga0495582_0036850 3300046473 Bacteria 2690
704 Ga0495582_0044141 3300046473 Bacteria 2455
705 Ga0495639_0008326 3300046475 Bacteria 4449
706 Ga0495662_0011936 3300046476 Bacteria 4245
707 Ga0495662_0015085 3300046476 Bacteria 3754
708 Ga0495662_0021641 3300046476 Bacteria 3107
709 Ga0495662_0178166 3300046476 Bacteria 1047
710 Ga0495664_0002865 3300046477 Bacteria 9295
711 Ga0495664_0023176 3300046477 Bacteria 3601
712 Ga0495664_0028754 3300046477 Bacteria 3247
713 Ga0495664_0029378 3300046477 Bacteria 3214
714 Ga0495664_0036647 3300046477 Bacteria 2891
715 Ga0495664_0169753 3300046477 Bacteria 1323
716 Ga0495585_0055708 3300046492 Bacteria 2184
717 Ga0495608_0024286 3300046511 Bacteria 4147
718 Ga0495608_0035829 3300046511 Bacteria 3343
719 Ga0495608_0043656 3300046511 Bacteria 2994
720 Ga0495608_0047430 3300046511 Bacteria 2856
721 Ga0495608_0067321 3300046511 Bacteria 2342
722 Ga0495608_0158385 3300046511 Bacteria 1440
723 Ga0495618_0073017 3300046514 Bacteria 2183
724 Ga0495618_0113163 3300046514 Bacteria 1737
725 Ga0495618_0199255 3300046514 Bacteria 1267
726 Ga0495618_0219203 3300046514 Bacteria 1200
727 Ga0495628_0072387 3300046516 Bacteria 2685
728 Ga0495628_0099592 3300046516 Bacteria 2244
729 Ga0495628_0427396 3300046516 Bacteria 964
730 Ga0495630_0060374 3300046517 Bacteria 2845
731 Ga0495630_0112431 3300046517 Bacteria 2062
732 Ga0495630_0360727 3300046517 Bacteria 1112
733 Ga0495666_0019870 3300046526 Bacteria 3331
734 Ga0495652_0003709 3300046529 Bacteria 14945
735 Ga0495652_0040081 3300046529 Bacteria 4048
736 Ga0495652_0062957 3300046529 Bacteria 3125
737 Ga0495652_0261704 3300046529 Bacteria 1276
738 Ga0495652_0269066 3300046529 Bacteria 1253
739 Ga0495652_0327102 3300046529 Bacteria 1105
740 Ga0495652_0350098 3300046529 Bacteria 1059
741 Ga0495665_0008348 3300046531 Bacteria 5616
742 Ga0495665_0012235 3300046531 Bacteria 4643
743 Ga0495665_0188220 3300046531 Bacteria 1071
744 Ga0495665_0228693 3300046531 Bacteria 960
745 Ga0495640_0013187 3300046533 Bacteria 6287
746 Ga0495640_0064056 3300046533 Bacteria 2487
747 Ga0495640_0067799 3300046533 Bacteria 2402
748 Ga0495640_0109797 3300046533 Bacteria 1803
749 Ga0495640_0173616 3300046533 Bacteria 1376
750 Ga0495640_0248942 3300046533 Bacteria 1113
751 Ga0495586_0148651 3300046535 Bacteria 1317
752 Ga0495587_0024602 3300046536 Bacteria 3688
753 Ga0495587_0045905 3300046536 Bacteria 2595
754 Ga0495587_0097864 3300046536 Bacteria 1691
755 Ga0495587_0164432 3300046536 Bacteria 1262
756 Ga0495587_0197398 3300046536 Bacteria 1138
757 Ga0495587_0208595 3300046536 Bacteria 1103
758 Ga0495645_0033594 3300046543 Bacteria 3742
759 Ga0495645_0075147 3300046543 Bacteria 2432
760 Ga0495645_0101904 3300046543 Bacteria 2040
761 Ga0495645_0114693 3300046543 Bacteria 1903
762 Ga0495645_0252153 3300046543 Bacteria 1172
763 Ga0495645_0305593 3300046543 Bacteria 1037
764 Ga0495667_0003592 3300046559 Bacteria 10432
765 Ga0495667_0004931 3300046559 Bacteria 9025
766 Ga0495667_0094785 3300046559 Bacteria 1932
767 Ga0495667_0118270 3300046559 Bacteria 1711
768 Ga0495667_0171632 3300046559 Bacteria 1393
769 Ga0495667_0210273 3300046559 Bacteria 1243
770 Ga0495634_0013707 3300046642 Bacteria 5853
771 Ga0495634_0020609 3300046642 Bacteria 4673
772 Ga0495634_0039737 3300046642 Bacteria 3202
773 Ga0495634_0081204 3300046642 Bacteria 2121
774 Ga0495634_0103209 3300046642 Bacteria 1840
775 Ga0495634_0104408 3300046642 Bacteria 1828
776 Ga0495634_0131825 3300046642 Bacteria 1592
777 Ga0495635_0000167 3300046663 Bacteria 40888
778 Ga0495635_0003308 3300046663 Bacteria 11137
779 Ga0495635_0021276 3300046663 Bacteria 4521
780 Ga0495635_0034908 3300046663 Bacteria 3488
781 Ga0495635_0163881 3300046663 Bacteria 1513
782 Ga0495635_0184946 3300046663 Bacteria 1415
783 Ga0495635_0283110 3300046663 Bacteria 1113
784 Ga0495588_0095718 3300046674 Bacteria 1557
785 Ga0495657_0009170 3300046675 Bacteria 7516
786 Ga0495657_0014229 3300046675 Bacteria 5845
787 Ga0495657_0019494 3300046675 Bacteria 4892
788 Ga0495657_0033670 3300046675 Bacteria 3565
789 Ga0495657_0047773 3300046675 Bacteria 2891
790 Ga0495657_0061025 3300046675 Bacteria 2495
791 Ga0495657_0251246 3300046675 Bacteria 1064
792 Ga0495599_0013087 3300046678 Bacteria 5124
793 Ga0495599_0017167 3300046678 Bacteria 4498
794 Ga0495599_0036826 3300046678 Bacteria 3073
795 Ga0495599_0126056 3300046678 Bacteria 1591
796 Ga0495599_0139835 3300046678 Bacteria 1502
797 Ga0495599_0337196 3300046678 Bacteria 905
798 Ga0495623_0009884 3300046679 Bacteria 6179
799 Ga0495623_0119571 3300046679 Bacteria 1587
800 Ga0495623_0148027 3300046679 Bacteria 1390
801 Ga0495646_0005026 3300046680 Bacteria 8342
802 Ga0495646_0026821 3300046680 Bacteria 3616
803 Ga0495646_0048742 3300046680 Bacteria 2572
804 Ga0495646_0130271 3300046680 Bacteria 1416
805 Ga0495646_0136677 3300046680 Bacteria 1374
806 Ga0495646_0195336 3300046680 Bacteria 1104
807 Ga0495646_0195831 3300046680 Bacteria 1102
808 Ga0495647_0052981 3300046681 Bacteria 1581
809 Ga0495658_0033886 3300046683 Bacteria 2800
810 Ga0495658_0143748 3300046683 Bacteria 1460
811 Ga0495613_0025552 3300046689 Bacteria 4400
812 Ga0495613_0164157 3300046689 Bacteria 1579
813 Ga0495613_0167987 3300046689 Bacteria 1558
814 Ga0495613_0241634 3300046689 Bacteria 1262
815 Ga0495613_0253533 3300046689 Bacteria 1227
816 Ga0495624_0023389 3300046690 Bacteria 4075
817 Ga0495624_0063148 3300046690 Bacteria 2315
818 Ga0495624_0131799 3300046690 Bacteria 1532
819 Ga0495624_0403089 3300046690 Bacteria 821
820 Ga0495600_0023959 3300046809 Bacteria 3928
821 Ga0495600_0033655 3300046809 Bacteria 3326
822 Ga0495600_0040966 3300046809 Bacteria 3018
823 Ga0495600_0286995 3300046809 Bacteria 1040
824 Ga0495581_0146660 3300047315 Bacteria 1377
825 Ga0495581_0201738 3300047315 Bacteria 1163
826 Ga0495604_0021763 3300047317 Bacteria 5119
827 Ga0495604_0080993 3300047317 Bacteria 2431
828 Ga0495604_0238532 3300047317 Bacteria 1244
829 Ga0495604_0265431 3300047317 Bacteria 1165
830 Ga0495674_0000044 3300047319 Bacteria 84651
831 Ga0495674_0018759 3300047319 Bacteria 6438
832 Ga0495674_0051727 3300047319 Bacteria 3621
833 Ga0495674_0125764 3300047319 Bacteria 2163
834 Ga0495674_0281774 3300047319 Bacteria 1361
835 Ga0495674_0332714 3300047319 Bacteria 1235
836 Ga0495674_0463302 3300047319 Bacteria 1017
837 Ga0495676_0006483 3300047321 Bacteria 10787
838 Ga0495676_0153882 3300047321 Bacteria 1633
839 Ga0495676_0290285 3300047321 Bacteria 1105
840 Ga0495680_0007276 3300047322 Bacteria 10187
841 Ga0495680_0018692 3300047322 Bacteria 5873
842 Ga0495680_0030279 3300047322 Bacteria 4421
843 Ga0495680_0038973 3300047322 Bacteria 3794
844 Ga0495680_0039241 3300047322 Bacteria 3779
845 Ga0495680_0043735 3300047322 Bacteria 3544
846 Ga0495680_0061177 3300047322 Bacteria 2897
847 Ga0495675_0015972 3300047444 Bacteria 4748
848 Ga0495675_0036317 3300047444 Bacteria 3143
849 Ga0495675_0042569 3300047444 Bacteria 2893
850 Ga0495675_0184658 3300047444 Bacteria 1275
851 Ga0495675_0322501 3300047444 Bacteria 913
852 Ga0495684_0005883 3300047471 Bacteria 9527
853 Ga0495684_0014401 3300047471 Bacteria 6085
854 Ga0495684_0015548 3300047471 Bacteria 5859
855 Ga0495684_0034125 3300047471 Bacteria 3904
856 Ga0495684_0054474 3300047471 Bacteria 3050
857 Ga0495684_0107739 3300047471 Bacteria 2104
858 Ga0495684_0137970 3300047471 Bacteria 1829
859 Ga0495593_0035798 3300047673 Bacteria 2693
860 Ga0495593_0191930 3300047673 Bacteria 1027
861 Ga0495602_0033246 3300048088 Bacteria 4841
862 Ga0495602_0033697 3300048088 Bacteria 4801
863 Ga0495602_0076321 3300048088 Bacteria 2840
864 Ga0495602_0102485 3300048088 Bacteria 2345
865 Ga0495602_0216394 3300048088 Bacteria 1449
866 Ga0495602_0282297 3300048088 Bacteria 1223
867 Ga0496100_0110210 3300048903 Bacteria 1911
868 Ga0496100_0513099 3300048903 Bacteria 925
869 Ga0496101_0009532 3300048904 Bacteria 6383
870 Ga0496101_0059487 3300048904 Bacteria 2769
871 Ga0496101_0360857 3300048904 Bacteria 1142
872 Ga0496101_0518056 3300048904 Bacteria 942
873 Ga0496102_0023852 3300048905 Bacteria 5437
874 Ga0496102_0111766 3300048905 Bacteria 2547
875 Ga0496103_0009543 3300048906 Bacteria 5745
876 Ga0496103_0031978 3300048906 Bacteria 3209
877 Ga0496104_0218082 3300048907 Bacteria 1820
878 Ga0496104_0304312 3300048907 Bacteria 1506
879 Ga0496105_0037155 3300048908 Bacteria 4011
880 Ga0496106_0001193 3300048909 Bacteria 19373
881 Ga0496106_0055066 3300048909 Bacteria 3005
882 Ga0496107_0034499 3300048910 Bacteria 3624
883 Ga0496107_0053432 3300048910 Bacteria 2914
884 Ga0496107_0166075 3300048910 Bacteria 1636
885 Ga0496107_0218336 3300048910 Bacteria 1418
886 Ga0496108_0001106 3300048911 Bacteria 21089
887 Ga0496108_0134026 3300048911 Bacteria 2130
888 Ga0496109_0000747 3300048912 Bacteria 27044
889 Ga0496109_0221092 3300048912 Bacteria 1781
890 Ga0496109_0247183 3300048912 Bacteria 1679
891 Ga0496109_0599360 3300048912 Bacteria 1038
892 Ga0496110_0126550 3300048913 Bacteria 2305
893 Ga0496110_0258590 3300048913 Bacteria 1585
894 Ga0496113_0279939 3300048916 Bacteria 1334
895 Ga0496114_0097916 3300048917 Bacteria 2500
896 Ga0496114_0207913 3300048917 Bacteria 1716
897 Ga0496114_0377164 3300048917 Bacteria 1255
898 Ga0496115_0222450 3300048918 Bacteria 1558
899 Ga0496118_0003661 3300048921 Bacteria 19087
900 Ga0496121_0139984 3300048924 Bacteria 1797
901 Ga0496126_0005213 3300048929 Bacteria 14998
902 Ga0496126_0017841 3300048929 Bacteria 7062
903 Ga0496126_0073428 3300048929 Bacteria 3041
904 Ga0496126_0110089 3300048929 Bacteria 2400
905 Ga0496126_0159946 3300048929 Bacteria 1925
906 Ga0501032_0007563 3300049569 Bacteria 7933
907 Ga0501032_0016176 3300049569 Bacteria 5250
908 Ga0501034_0004854 3300049571 Bacteria 14839
909 Ga0501034_0004904 3300049571 Bacteria 14752
910 Ga0501034_0319147 3300049571 Bacteria 1487
911 Ga0501034_0363085 3300049571 Bacteria 1375
912 Ga0501034_0862977 3300049571 Bacteria 795
913 Ga0501036_0000454 3300049572 Bacteria 29263
914 Ga0501036_0092292 3300049572 Bacteria 2558
915 Ga0501037_0201724 3300049573 Bacteria 1405
916 Ga0501038_0013310 3300049574 Bacteria 7502
917 Ga0501039_0012909 3300049575 Bacteria 6388
918 Ga0501039_0565714 3300049575 Bacteria 892
919 Ga0501042_0129725 3300049578 Bacteria 1817
920 Ga0501043_0042995 3300049579 Bacteria 3552
921 Ga0501043_0138775 3300049579 Bacteria 1904
922 Ga0501046_0008990 3300049580 Bacteria 8671
923 Ga0501046_0030084 3300049580 Bacteria 4410
924 Ga0501047_0000072 3300049581 Bacteria 126542
925 Ga0501047_0007135 3300049581 Bacteria 10496
926 Ga0501047_0033093 3300049581 Bacteria 4991
927 Ga0501047_0079709 3300049581 Bacteria 3148
928 Ga0501048_0002246 3300049582 Bacteria 14720
929 Ga0501048_0018471 3300049582 Bacteria 5127
930 Ga0501069_0113217 3300049585 Bacteria 1546
931 Ga0501069_0296354 3300049585 Bacteria 948
932 Ga0501070_0000288 3300049586 Bacteria 47185
933 Ga0501070_0000852 3300049586 Bacteria 27667
934 Ga0501073_0105594 3300049589 Bacteria 1954
935 Ga0501074_0026809 3300049590 Bacteria 4178
936 Ga0501074_0072969 3300049590 Bacteria 2465
937 Ga0501074_0108742 3300049590 Bacteria 1984
938 Ga0501080_0140500 3300049742 Bacteria 2233
939 Ga0501080_0196765 3300049742 Bacteria 1851
940 Ga0501081_0178963 3300049743 Bacteria 1533
941 Ga0501083_0041242 3300049744 Bacteria 3131
942 Ga0501083_0099697 3300049744 Bacteria 1916
943 Ga0501035_0091771 3300049822 Bacteria 2673
944 Ga0501035_0114385 3300049822 Bacteria 2363
945 Ga0501044_0007276 3300049823 Bacteria 12164
946 Ga0501044_0055104 3300049823 Bacteria 4084
947 Ga0501044_0198518 3300049823 Bacteria 1965
948 Ga0501044_0441860 3300049823 Bacteria 1208
949 Ga0501044_0456662 3300049823 Bacteria 1183
950 Ga0501044_0511868 3300049823 Bacteria 1101
951 Ga0501045_0228231 3300049824 Bacteria 1386
952 nmdc:mga03n38_139213_c1 3300050490 Bacteria 1211
953 nmdc:mga00v17_3958_c1 3300050491 Bacteria 7641
954 nmdc:mga0yw44_7088_c1 3300050492 Bacteria 5487
955 nmdc:mga07m45_33161_c1 3300050496 Bacteria 2867
956 nmdc:mga07m45_37395_c1 3300050496 Bacteria 2707
957 nmdc:mga05p37_360675_c1 3300050507 Bacteria 1709
958 nmdc:mga06r32_4119_c1 3300050510 Bacteria 13015
959 nmdc:mga0n895_49351_c1 3300050512 Bacteria 4123
960 nmdc:mga0n895_559180_c1 3300050512 Bacteria 1149
961 nmdc:mga0rr50_20976_c1 3300050513 Bacteria 4452
962 nmdc:mga08x19_66625_c1 3300050514 Bacteria 2341
963 nmdc:mga0a205_185592_c1 3300050515 Bacteria 1973
964 nmdc:mga0sz30_34660_c1 3300050516 Bacteria 2103
965 nmdc:mga0sz30_76074_c1 3300050516 Bacteria 1449
966 Ga0495601_0061607 3300053077 Bacteria 2381
967 Ga0495601_0069571 3300053077 Bacteria 2245
968 Ga0495601_0126962 3300053077 Bacteria 1659
969 Ga0495601_0155639 3300053077 Bacteria 1492
970 Ga0495601_0287154 3300053077 Bacteria 1072
971 Ga0495601_0311927 3300053077 Bacteria 1024
972 Ga0495612_0043819 3300053078 Bacteria 1829
973 Ga0495612_0052909 3300053078 Bacteria 1671
974 Ga0495612_0093197 3300053078 Bacteria 1277
975 Ga0495595_0017355 3300053084 Bacteria 3096
976 Ga0495619_0010567 3300053085 Bacteria 5809
977 Ga0495619_0013573 3300053085 Bacteria 5133
978 Ga0495619_0101237 3300053085 Bacteria 1961
979 Ga0495619_0105622 3300053085 Bacteria 1920
980 Ga0495619_0134783 3300053085 Bacteria 1698
981 Ga0500643_019759 3300053087 Bacteria 2213
982 Ga0500559_0009140 3300053136 Bacteria 4305
983 Ga0500559_0139557 3300053136 Bacteria 1134
984 Ga0500577_0034858 3300053142 Bacteria 1790
985 Ga0500645_000046 3300053730 Bacteria 106127
986 Ga0501084_0018770 3300054114 Bacteria 5758
987 Ga0501084_0961122 3300054114 Bacteria 718
988 Ga0466962_0007327 3300061719 Bacteria 5294
989 Ga0466962_0010782 3300061719 Bacteria 4392
990 Ga0466962_0019043 3300061719 Bacteria 3297
991 Ga0530510_0077687 3300061734 Bacteria 2413
992 2558910479 2558860112 Bacteria 9931328
993 2738704856 2738541274 Bacteria 6909446
994 2739330026 2738543028 Bacteria 6917070
995 2795786090 2795385470 Bacteria 8317180
996 2870783191 2870782633 Bacteria 9624083
997 2899375319 2899370129 Bacteria 6781179
998 2902803440 2902799365 Bacteria 5419524
999 8003323465 8003314358 Bacteria 10575343
1000 Ga0163162_10036165
1001 JGI24746J21847_1002624
1002 JGI24738J21930_10031127
1003 JGI24744J21845_10002847
1004 JGI24744J21845_10005076
1005 JGI25406J46586_10010135
1006 JGI25404J52841_10002354
1007 JGI25405J52794_10030135
1008 Ga0070658_10000508
1009 Ga0070658_10012519
1010 Ga0070658_10020639
1011 Ga0070658_10074077
1012 Ga0070658_10095781
1013 Ga0070658_10102591
1014 Ga0070676_10014555
1015 Ga0070676_10063779
1016 Ga0070676_10098606
1017 Ga0070683_100003027
1018 Ga0070683_100042319
1019 Ga0070683_100051136
1020 Ga0070683_100138929
1021 Ga0070690_100020069
1022 Ga0068869_100081977
1023 Ga0068869_100166267
1024 Ga0070666_10000599
1025 Ga0070666_10109443
1026 Ga0070680_100075908
1027 Ga0070680_100145882
1028 Ga0070680_100213683
1029 Ga0070682_100008743
1030 Ga0070682_100026987
1031 Ga0070682_100097293
1032 Ga0068868_100014096
1033 Ga0068868_100061529
1034 Ga0068868_100347639
1035 Ga0070660_100025228
1036 Ga0070660_100092723
1037 Ga0070660_100297033
1038 Ga0070660_100559918
1039 Ga0070689_100016357
1040 Ga0070689_100404460
1041 Ga0070691_10038306
1042 Ga0070691_10051466
1043 Ga0070691_10102724
1044 Ga0070687_100011299
1045 Ga0070687_100020506
1046 Ga0070661_100117955
1047 Ga0070661_100297434
1048 Ga0070692_10075952
1049 Ga0070692_10271126
1050 Ga0070668_100014966
1051 Ga0070668_100027507
1052 Ga0070669_100026232
1053 Ga0070669_100306491
1054 Ga0070675_100046139
1055 Ga0070674_100004962
1056 Ga0070674_100150542
1057 Ga0070674_100247597
1058 Ga0070673_100088883
1059 Ga0070673_100313801
1060 Ga0070659_100002245
1061 Ga0070659_100006711
1062 Ga0070659_100061327
1063 Ga0070659_100156084
1064 Ga0070659_100364006
1065 Ga0070667_100010948
1066 Ga0070667_100051599
1067 Ga0070667_100135634
1068 Ga0070709_10009918
1069 Ga0070709_10248591
1070 Ga0070709_10425772
1071 Ga0070714_100000968
1072 Ga0070714_100005250
1073 Ga0070714_100028819
1074 Ga0070714_100109961
1075 Ga0070714_100230654
1076 Ga0070714_100260518
1077 Ga0070714_100281327
1078 Ga0070714_100316496
1079 Ga0070714_100337922
1080 Ga0070713_100000292
1081 Ga0070713_100029889
1082 Ga0070713_100053823
1083 Ga0070713_100073500
1084 Ga0070713_100120607
1085 Ga0070713_100270987
1086 Ga0070713_100273566
1087 Ga0070713_100348450
1088 Ga0070710_10001190
1089 Ga0070710_10009899
1090 Ga0070710_10138628
1091 Ga0070701_10022440
1092 Ga0070711_100001818
1093 Ga0070711_100031445
1094 Ga0070711_100327539
1095 Ga0070711_100363957
1096 Ga0070705_100251113
1097 Ga0070700_100020504
1098 Ga0070694_100009988
1099 Ga0070694_100069296
1100 Ga0070708_100030491
1101 Ga0070708_100069217
1102 Ga0070708_100106172
1103 Ga0070708_100131850
1104 Ga0070708_100151223
1105 Ga0070708_100352813
1106 Ga0070663_100000154
1107 Ga0070663_100008259
1108 Ga0070663_100130837
1109 Ga0070678_100004333
1110 Ga0070678_100014423
1111 Ga0070678_100405214
1112 Ga0070681_10005886
1113 Ga0070681_10095443
1114 Ga0070681_10146505
1115 Ga0070681_10215156
1116 Ga0070681_10359241
1117 Ga0068867_100024657
1118 Ga0068867_100248086
1119 Ga0068867_100692930
1120 Ga0070685_10033240
1121 Ga0070706_100001190
1122 Ga0070706_100010326
1123 Ga0070706_100193584
1124 Ga0070706_100339345
1125 Ga0070706_100648142
1126 Ga0070707_100020033
1127 Ga0070707_100069666
1128 Ga0070707_100222863
1129 Ga0070707_100760377
1130 Ga0070698_100000028
1131 Ga0070698_100015636
1132 Ga0070698_100020133
1133 Ga0070698_100025185
1134 Ga0070698_100027003
1135 Ga0070698_100049725
1136 Ga0070698_100063382
1137 Ga0070698_100302314
1138 Ga0070699_100001363
1139 Ga0070699_100222282
1140 Ga0070679_100052028
1141 Ga0070684_100039048
1142 Ga0070684_100049228
1143 Ga0070684_100183266
1144 Ga0070697_100000383
1145 Ga0070697_100112143
1146 Ga0068853_100015885
1147 Ga0068853_100542053
1148 Ga0070672_100357150
1149 Ga0070672_100485031
1150 Ga0070686_100182867
1151 Ga0070686_100385247
1152 Ga0070686_100397793
1153 Ga0070695_100061202
1154 Ga0070695_100101201
1155 Ga0070696_100021296
1156 Ga0070696_100065680
1157 Ga0070696_100081792
1158 Ga0070693_100065726
1159 Ga0070693_100267505
1160 Ga0070665_100019951
1161 Ga0070665_100035324
1162 Ga0070704_100009349
1163 Ga0070704_100329780
1164 Ga0068855_100092059
1165 Ga0068855_100480812
1166 Ga0068855_100513514
1167 Ga0070664_100113964
1168 Ga0070664_100182673
1169 Ga0070664_100306747
1170 Ga0068857_100043855
1171 Ga0068854_100122448
1172 Ga0068854_100308096
1173 Ga0068854_100623927
1174 Ga0068856_100543456
1175 Ga0068856_100685199
1176 Ga0070702_100085222
1177 Ga0068852_100123783
1178 Ga0068852_100154175
1179 Ga0068859_100002009
1180 Ga0068859_100028972
1181 Ga0068859_100046620
1182 Ga0068859_100198952
1183 Ga0068859_100582307
1184 Ga0068864_100049548
1185 Ga0068866_10008951
1186 Ga0068866_10035456
1187 Ga0068866_10048347
1188 Ga0068861_100300334
1189 Ga0068851_10066565
1190 Ga0068851_10086672
1191 Ga0068870_10025246
1192 Ga0068863_100400701
1193 Ga0068858_100018088
1194 Ga0068858_100166178
1195 Ga0068860_100000067
1196 Ga0068860_100079327
1197 Ga0068862_100025498
1198 Ga0068862_100051958
1199 Ga0068862_100283628
1200 Ga0081455_10000974
1201 Ga0081455_10065050
1202 Ga0081455_10072991
1203 Ga0081455_10218482
1204 Ga0081538_10148850
1205 Ga0081539_10000482
1206 Ga0070717_10001057
1207 Ga0070717_10039252
1208 Ga0070717_10056789
1209 Ga0070717_10056804
1210 Ga0070717_10073695
1211 Ga0070717_10204377
1212 Ga0070717_10331910
1213 Ga0070717_10385363
1214 Ga0070717_10492117
1215 Ga0070717_10912964
1216 Ga0075363_100002024
1217 Ga0075364_10006138
1218 Ga0070715_10005940
1219 Ga0070715_10028906
1220 Ga0070715_10063627
1221 Ga0070716_100001660
1222 Ga0070716_100007955
1223 Ga0070716_100009500
1224 Ga0070716_100042011
1225 Ga0070716_100366101
1226 Ga0070712_100005616
1227 Ga0070712_100008614
1228 Ga0070712_100016635
1229 Ga0070712_100043097
1230 Ga0070712_100068474
1231 Ga0070712_100391871
1232 Ga0075369_10002093
1233 Ga0075369_10002645
1234 Ga0075369_10045826
1235 Ga0097621_100026048
1236 Ga0097621_100083376
1237 Ga0075370_10026358
1238 Ga0075428_100007121
1239 Ga0075430_100065719
1240 Ga0068865_100000387
1241 Ga0068865_100300452
1242 Ga0075436_100090274
1243 Ga0075436_100217509
1244 Ga0097620_100002008
1245 Ga0097620_100028971
1246 Ga0097620_100046623
1247 Ga0097620_100198946
1248 Ga0097620_100582307
1249 Ga0099794_10225006
1250 Ga0099795_10039100
1251 Ga0105244_10144217
1252 Ga0105240_10011130
1253 Ga0105240_10451854
1254 Ga0105245_10027833
1255 Ga0105245_10029652
1256 Ga0105245_10285814
1257 Ga0105245_10505006
1258 Ga0105247_10005969
1259 Ga0105247_10242187
1260 Ga0114129_10098741
1261 Ga0114129_10805088
1262 Ga0105243_10000843
1263 Ga0105241_10028985
1264 Ga0105241_10377713
1265 Ga0105242_10046867
1266 Ga0105242_10129265
1267 Ga0105242_10202595
1268 Ga0105242_10265758
1269 Ga0105248_10011276
1270 Ga0105248_10043895
1271 Ga0105248_10514321
1272 Ga0105237_10104883
1273 Ga0105249_10000784
1274 Ga0105239_10248866
1275 Ga0105239_10276087
1276 Ga0105239_10411586
1277 Ga0105246_10082055
1278 Ga0105246_10304675
1279 Ga0157342_1003067
1280 Ga0157373_10378657
1281 Ga0157371_10005054
1282 Ga0157371_10169634
1283 Ga0157370_10022049
1284 Ga0157369_10005401
1285 Ga0157369_10010931
1286 Ga0157369_10011881
1287 Ga0157369_10101343
1288 Ga0157369_10191870
1289 Ga0157369_10558805
1290 Ga0157374_10096699
1291 Ga0157374_10352716
1292 Ga0157374_10645988
1293 Ga0157378_10005566
1294 Ga0157378_10199920
1295 Ga0157378_10316073
1296 Ga0163162_10088075
1297 Ga0163162_10161033
1298 Ga0163162_10719393
1299 Ga0157372_10066489
1300 Ga0157372_10339172
1301 Ga0157375_10001987
1302 Ga0163163_10166016
1303 Ga0163163_10450337
1304 Ga0163163_10489668
1305 Ga0157380_10360406
1306 Ga0157377_10254328
1307 Ga0157379_10014388
1308 Ga0157379_10033440
1309 Ga0157379_10095885
1310 Ga0157376_10069402
1311 Ga0163161_10027781
1312 Ga0163161_10127243
1313 Ga0197907_10456462
1314 Ga0206356_10069604
1315 Ga0206349_1059723
1316 Ga0206354_10021129
1317 Ga0206354_10448767
1318 Ga0206353_11415596
1319 Ga0206353_11658561
1320 Ga0206353_11792839
1321 Ga0213874_10046395
1322 Ga0213874_10067553
1323 Ga0213876_10019846
1324 Ga0213876_10020650
1325 Ga0213876_10032212
1326 Ga0213876_10198765
1327 Ga0213875_10000092
1328 Ga0213875_10001276
1329 Ga0213875_10003226
1330 Ga0213875_10007935
1331 Ga0213875_10012033
1332 Ga0213875_10017021
1333 Ga0213875_10019923
1334 Ga0213875_10058713
1335 Ga0213875_10077283
1336 Ga0224712_10003853
1337 Ga0224712_10008590
1338 Ga0224712_10009184
1339 Ga0228598_1011687
1340 Ga0209051_1022517
1341 Ga0207653_10014869
1342 Ga0207692_10006893
1343 Ga0207692_10074928
1344 Ga0207692_10250446
1345 Ga0207642_10081287
1346 Ga0207642_10277020
1347 Ga0207710_10207714
1348 Ga0207688_10001071
1349 Ga0207688_10009517
1350 Ga0207688_10011202
1351 Ga0207680_10011616
1352 Ga0207680_10088708
1353 Ga0207680_10128630
1354 Ga0207647_10048321
1355 Ga0207647_10120485
1356 Ga0207685_10044700
1357 Ga0207699_10001559
1358 Ga0207699_10013348
1359 Ga0207699_10022711
1360 Ga0207699_10045557
1361 Ga0207699_10056345
1362 Ga0207699_10193283
1363 Ga0207699_10253633
1364 Ga0207645_10012105
1365 Ga0207645_10118995
1366 Ga0207643_10051128
1367 Ga0207705_10000605
1368 Ga0207705_10004465
1369 Ga0207705_10009551
1370 Ga0207705_10047926
1371 Ga0207705_10051655
1372 Ga0207684_10000479
1373 Ga0207684_10028810
1374 Ga0207684_10029056
1375 Ga0207684_10030881
1376 Ga0207684_10040321
1377 Ga0207684_10212932
1378 Ga0207654_10045265
1379 Ga0207707_10047626
1380 Ga0207707_10071856
1381 Ga0207707_10120458
1382 Ga0207707_10314515
1383 Ga0207693_10000423
1384 Ga0207693_10000616
1385 Ga0207693_10001314
1386 Ga0207693_10004511
1387 Ga0207693_10018340
1388 Ga0207693_10038999
1389 Ga0207693_10049911
1390 Ga0207693_10058767
1391 Ga0207693_10104137
1392 Ga0207693_10109999
1393 Ga0207693_10340512
1394 Ga0207663_10019079
1395 Ga0207663_10025457
1396 Ga0207663_10178884
1397 Ga0207663_10333011
1398 Ga0207663_10444822
1399 Ga0207660_10055674
1400 Ga0207660_10137480
1401 Ga0207660_10443040
1402 Ga0207660_10443617
1403 Ga0207657_10014859
1404 Ga0207657_10035895
1405 Ga0207657_10085054
1406 Ga0207657_10171111
1407 Ga0207657_10205318
1408 Ga0207657_10228154
1409 Ga0207649_10072909
1410 Ga0207652_10037186
1411 Ga0207652_10080224
1412 Ga0207652_10081927
1413 Ga0207652_10299031
1414 Ga0207652_10385309
1415 Ga0207646_10006081
1416 Ga0207646_10045679
1417 Ga0207646_10062112
1418 Ga0207646_10131593
1419 Ga0207646_10343093
1420 Ga0207681_10022242
1421 Ga0207681_10157716
1422 Ga0207681_10267441
1423 Ga0207659_10365851
1424 Ga0207687_10043445
1425 Ga0207687_10113941
1426 Ga0207700_10000840
1427 Ga0207700_10003624
1428 Ga0207700_10025128
1429 Ga0207700_10034240
1430 Ga0207700_10070230
1431 Ga0207700_10070506
1432 Ga0207700_10398870
1433 Ga0207700_10470036
1434 Ga0207700_10485833
1435 Ga0207700_10563855
1436 Ga0207664_10002562
1437 Ga0207664_10007405
1438 Ga0207664_10009335
1439 Ga0207664_10022468
1440 Ga0207664_10091112
1441 Ga0207664_10138041
1442 Ga0207664_10152694
1443 Ga0207664_10166916
1444 Ga0207664_10379661
1445 Ga0207664_10409196
1446 Ga0207690_10000233
1447 Ga0207690_10034960
1448 Ga0207690_10072212
1449 Ga0207706_10010102
1450 Ga0207706_10013880
1451 Ga0207709_10017023
1452 Ga0207670_10080370
1453 Ga0207670_10274267
1454 Ga0207669_10199321
1455 Ga0207669_10278897
1456 Ga0207704_10129262
1457 Ga0207665_10010160
1458 Ga0207665_10010827
1459 Ga0207665_10012787
1460 Ga0207665_10019709
1461 Ga0207665_10052319
1462 Ga0207665_10079465
1463 Ga0207691_10058013
1464 Ga0207691_10091675
1465 Ga0207691_10095113
1466 Ga0207711_10074539
1467 Ga0207689_10012341
1468 Ga0207689_10013563
1469 Ga0207689_10034437
1470 Ga0207689_10105595
1471 Ga0207661_10006204
1472 Ga0207661_10038456
1473 Ga0207661_10043418
1474 Ga0207661_10081658
1475 Ga0207679_10155343
1476 Ga0207679_10559789
1477 Ga0207667_10039431
1478 Ga0207667_10145631
1479 Ga0207712_10021393
1480 Ga0207668_10218930
1481 Ga0207640_10231704
1482 Ga0207640_10323884
1483 Ga0207640_10451791
1484 Ga0207658_10035510
1485 Ga0207658_10067634
1486 Ga0207677_10018136
1487 Ga0207677_10049056
1488 Ga0207703_10048810
1489 Ga0207703_10060869
1490 Ga0207639_10247707
1491 Ga0207678_10000312
1492 Ga0207678_10012393
1493 Ga0207678_10013964
1494 Ga0207678_10017380
1495 Ga0207678_10048817
1496 Ga0207708_10006460
1497 Ga0207708_10028114
1498 Ga0207708_10099374
1499 Ga0207641_10499711
1500 Ga0207648_10017557
1501 Ga0207648_10263458
1502 Ga0207648_10271385
1503 Ga0207676_10314727
1504 Ga0207674_10008344
1505 Ga0207674_10063478
1506 Ga0207675_100001298
1507 Ga0207675_100004705
1508 Ga0207683_10000649
1509 Ga0207683_10006893
1510 Ga0207683_10084875
1511 Ga0207683_10218904
1512 Ga0207698_10048510
1513 Ga0207698_10088301
1514 Ga0209179_1012043
1515 Ga0224573_1001931
1516 Ga0268266_10020337
1517 Ga0268266_10025742
1518 Ga0268266_10044204
1519 Ga0268264_10000114
1520 Ga0265338_10043340
1521 Ga0265338_10106020
1522 Ga0307511_10077799
1523 Ga0307512_10005068
1524 Ga0265325_10001514
1525 Ga0265329_10061583
1526 Ga0265340_10000928
1527 Ga0265339_10006895
1528 Ga0265316_10014581
1529 Ga0307508_10044056
1530 Ga0307508_10270284
1531 Ga0307508_10312737
1532 Ga0265342_10037671
1533 Ga0307518_10076530
1534 Ga0307406_10072519
1535 Ga0307415_100284151
1536 Ga0307507_10007414
1537 Ga0307507_10023724
1538 Ga0307510_10086353
1539 Ga0307510_10145824
1540 Ga0373959_0013904
1541 Ga0373926_0000667
1542 Ga0373934_0009033
1543 Ga0373934_0115528
1544 Ga0373944_0005783
1545 Ga0373944_0020733
1546 Ga0373944_0055187
1547 Ga0373951_0032090
1548 Ga0373923_0009399
1549 Ga0373923_0020665
1550 Ga0373923_0147266
1551 Ga0373936_0000597
1552 Ga0373936_0013959
1553 Ga0373936_0104530
1554 Ga0373936_0154416
1555 Ga0373936_0284560
1556 Ga0373945_0001009
1557 Ga0373945_0012897
1558 Ga0373953_0011944
1559 Ga0373953_0033364
1560 Ga0373954_0007461
1561 Ga0373954_0036395
1562 Ga0373956_0001023
1563 Ga0373956_0031742
1564 Ga0373956_0072342
1565 Ga0373956_0074141
1566 Ga0373957_0046125
1567 Ga0373957_0049648
1568 Ga0373957_0103488
1569 Ga0373943_0003599
1570 Ga0373943_0242661
1571 Ga0373946_0000489
1572 Ga0373946_0004311
1573 Ga0373946_0054315
1574 Ga0373946_0175312
1575 Ga0373955_0015974
1576 Ga0373955_0026007
1577 Ga0373955_0125258
1578 Ga0373955_0271875
1579 Ga0373924_0005932
1580 Ga0373924_0013799
1581 Ga0373924_0031541
1582 Ga0373924_0045623
1583 Ga0373924_0097369
1584 Ga0373924_0106918
1585 Ga0373931_0047027
1586 Ga0373931_0143514
1587 Ga0373931_0240431
1588 Ga0373931_0246744
1589 Ga0373935_0000490
1590 Ga0373935_0028478
1591 Ga0373935_0034971
1592 Ga0373935_0103837
1593 Ga0373935_0106863
1594 Ga0373935_0180472
1595 Ga0373927_0009224
1596 Ga0373927_0048886
1597 Ga0373927_0059376
1598 Ga0373933_0005326
1599 Ga0373933_0044479
1600 Ga0373933_0099998
1601 Ga0373933_0148064
1602 Ga0373933_0178812
1603 Ga0373933_0291362
1604 Ga0373947_0005336
1605 Ga0373947_0049079
1606 Ga0373947_0154150
1607 Ga0373937_0019941
1608 Ga0373937_0054768
1609 Ga0373937_0132730
1610 Ga0373937_0268952
1611 Ga0373925_0012478
1612 Ga0373925_0102763
1613 Ga0373925_0118787
1614 Ga0395899_0388439
1615 Ga0395900_0221700
1616 Ga0395900_0288021
1617 Ga0436364_0037108
1618 Ga0436364_0189458
1619 Ga0436364_0193972
1620 Ga0436364_0265841
1621 Ga0436364_0316624
1622 Ga0436364_0467315
1623 Ga0436364_0527355
1624 Ga0436364_0802113
1625 Ga0436364_0815450
1626 Ga0436364_0828822
1627 Ga0436364_1002699
1628 Ga0436364_1416932
1629 Ga0436364_1455692
1630 Ga0395901_0046735
1631 Ga0395901_0104373
1632 Ga0436365_0539792
1633 Ga0436365_0670227
1634 Ga0436365_1206577
1635 Ga0436365_1253726
1636 Ga0436363_0169189
1637 Ga0436363_0225351
1638 Ga0436363_0309457
1639 Ga0436363_0317063
1640 Ga0436362_0000051
1641 Ga0436362_0173909
1642 Ga0439448_0007690
1643 Ga0439448_0085225
1644 Ga0439463_010541
1645 Ga0439460_0000696
1646 Ga0466969_0015291
1647 Ga0466969_0102550
1648 Ga0466972_0109290
1649 Ga0466965_0143410
1650 Ga0466966_0011757
1651 Ga0466966_0044068
1652 Ga0466961_0011066
1653 Ga0466963_0024648
1654 Ga0466963_0055385
1655 Ga0466963_0063730
1656 Ga0466963_0240275
1657 Ga0466964_0121752
1658 Ga0466971_0001144
1659 Ga0466971_0082049
1660 Ga0466971_0181244
1661 Ga0466968_0054608
1662 Ga0466957_0063349
1663 Ga0466960_0013128
1664 Ga0466960_0029520
1665 Ga0466959_0056285
1666 Ga0466959_0094925
1667 Ga0466958_0003222
1668 Ga0466958_0049571
1669 Ga0466958_0244481
1670 Ga0466967_0003944
1671 Ga0466967_0004464
1672 Ga0466967_0035721
1673 Ga0466967_0043727
1674 Ga0466967_0058459
1675 Ga0466967_0061983
1676 Ga0466967_0066989
1677 Ga0495592_0034357
1678 Ga0495592_0057729
1679 Ga0495592_0068721
1680 Ga0495592_0278547
1681 Ga0495603_0050085
1682 Ga0495603_0225644
1683 Ga0495629_0014236
1684 Ga0495629_0229545
1685 Ga0495641_0002946
1686 Ga0495641_0027757
1687 Ga0495641_0126664
1688 Ga0495641_0156387
1689 Ga0495651_0016782
1690 Ga0495651_0024364
1691 Ga0495651_0071352
1692 Ga0495651_0096301
1693 Ga0495651_0126208
1694 Ga0495651_0295461
1695 Ga0495653_0001335
1696 Ga0495653_0023619
1697 Ga0495653_0032698
1698 Ga0495653_0057148
1699 Ga0495653_0098223
1700 Ga0495653_0174842
1701 Ga0495650_0029405
1702 Ga0495582_0036850
1703 Ga0495582_0044141
1704 Ga0495639_0008326
1705 Ga0495662_0011936
1706 Ga0495662_0015085
1707 Ga0495662_0021641
1708 Ga0495662_0178166
1709 Ga0495664_0002865
1710 Ga0495664_0023176
1711 Ga0495664_0028754
1712 Ga0495664_0029378
1713 Ga0495664_0036647
1714 Ga0495664_0169753
1715 Ga0495585_0055708
1716 Ga0495608_0024286
1717 Ga0495608_0035829
1718 Ga0495608_0043656
1719 Ga0495608_0047430
1720 Ga0495608_0067321
1721 Ga0495608_0158385
1722 Ga0495618_0073017
1723 Ga0495618_0113163
1724 Ga0495618_0199255
1725 Ga0495618_0219203
1726 Ga0495628_0072387
1727 Ga0495628_0099592
1728 Ga0495628_0427396
1729 Ga0495630_0060374
1730 Ga0495630_0112431
1731 Ga0495630_0360727
1732 Ga0495666_0019870
1733 Ga0495652_0003709
1734 Ga0495652_0040081
1735 Ga0495652_0062957
1736 Ga0495652_0261704
1737 Ga0495652_0269066
1738 Ga0495652_0327102
1739 Ga0495652_0350098
1740 Ga0495665_0008348
1741 Ga0495665_0012235
1742 Ga0495665_0188220
1743 Ga0495665_0228693
1744 Ga0495640_0013187
1745 Ga0495640_0064056
1746 Ga0495640_0067799
1747 Ga0495640_0109797
1748 Ga0495640_0173616
1749 Ga0495640_0248942
1750 Ga0495586_0148651
1751 Ga0495587_0024602
1752 Ga0495587_0045905
1753 Ga0495587_0097864
1754 Ga0495587_0164432
1755 Ga0495587_0197398
1756 Ga0495587_0208595
1757 Ga0495645_0033594
1758 Ga0495645_0075147
1759 Ga0495645_0101904
1760 Ga0495645_0114693
1761 Ga0495645_0252153
1762 Ga0495645_0305593
1763 Ga0495667_0003592
1764 Ga0495667_0004931
1765 Ga0495667_0094785
1766 Ga0495667_0118270
1767 Ga0495667_0171632
1768 Ga0495667_0210273
1769 Ga0495634_0013707
1770 Ga0495634_0020609
1771 Ga0495634_0039737
1772 Ga0495634_0081204
1773 Ga0495634_0103209
1774 Ga0495634_0104408
1775 Ga0495634_0131825
1776 Ga0495635_0000167
1777 Ga0495635_0003308
1778 Ga0495635_0021276
1779 Ga0495635_0034908
1780 Ga0495635_0163881
1781 Ga0495635_0184946
1782 Ga0495635_0283110
1783 Ga0495588_0095718
1784 Ga0495657_0009170
1785 Ga0495657_0014229
1786 Ga0495657_0019494
1787 Ga0495657_0033670
1788 Ga0495657_0047773
1789 Ga0495657_0061025
1790 Ga0495657_0251246
1791 Ga0495599_0013087
1792 Ga0495599_0017167
1793 Ga0495599_0036826
1794 Ga0495599_0126056
1795 Ga0495599_0139835
1796 Ga0495599_0337196
1797 Ga0495623_0009884
1798 Ga0495623_0119571
1799 Ga0495623_0148027
1800 Ga0495646_0005026
1801 Ga0495646_0026821
1802 Ga0495646_0048742
1803 Ga0495646_0130271
1804 Ga0495646_0136677
1805 Ga0495646_0195336
1806 Ga0495646_0195831
1807 Ga0495647_0052981
1808 Ga0495658_0033886
1809 Ga0495658_0143748
1810 Ga0495613_0025552
1811 Ga0495613_0164157
1812 Ga0495613_0167987
1813 Ga0495613_0241634
1814 Ga0495613_0253533
1815 Ga0495624_0023389
1816 Ga0495624_0063148
1817 Ga0495624_0131799
1818 Ga0495624_0403089
1819 Ga0495600_0023959
1820 Ga0495600_0033655
1821 Ga0495600_0040966
1822 Ga0495600_0286995
1823 Ga0495581_0146660
1824 Ga0495581_0201738
1825 Ga0495604_0021763
1826 Ga0495604_0080993
1827 Ga0495604_0238532
1828 Ga0495604_0265431
1829 Ga0495674_0000044
1830 Ga0495674_0018759
1831 Ga0495674_0051727
1832 Ga0495674_0125764
1833 Ga0495674_0281774
1834 Ga0495674_0332714
1835 Ga0495674_0463302
1836 Ga0495676_0006483
1837 Ga0495676_0153882
1838 Ga0495676_0290285
1839 Ga0495680_0007276
1840 Ga0495680_0018692
1841 Ga0495680_0030279
1842 Ga0495680_0038973
1843 Ga0495680_0039241
1844 Ga0495680_0043735
1845 Ga0495680_0061177
1846 Ga0495675_0015972
1847 Ga0495675_0036317
1848 Ga0495675_0042569
1849 Ga0495675_0184658
1850 Ga0495675_0322501
1851 Ga0495684_0005883
1852 Ga0495684_0014401
1853 Ga0495684_0015548
1854 Ga0495684_0034125
1855 Ga0495684_0054474
1856 Ga0495684_0107739
1857 Ga0495684_0137970
1858 Ga0495593_0035798
1859 Ga0495593_0191930
1860 Ga0495602_0033246
1861 Ga0495602_0033697
1862 Ga0495602_0076321
1863 Ga0495602_0102485
1864 Ga0495602_0216394
1865 Ga0495602_0282297
1866 Ga0496100_0110210
1867 Ga0496100_0513099
1868 Ga0496101_0009532
1869 Ga0496101_0059487
1870 Ga0496101_0360857
1871 Ga0496101_0518056
1872 Ga0496102_0023852
1873 Ga0496102_0111766
1874 Ga0496103_0009543
1875 Ga0496103_0031978
1876 Ga0496104_0218082
1877 Ga0496104_0304312
1878 Ga0496105_0037155
1879 Ga0496106_0001193
1880 Ga0496106_0055066
1881 Ga0496107_0034499
1882 Ga0496107_0053432
1883 Ga0496107_0166075
1884 Ga0496107_0218336
1885 Ga0496108_0001106
1886 Ga0496108_0134026
1887 Ga0496109_0000747
1888 Ga0496109_0221092
1889 Ga0496109_0247183
1890 Ga0496109_0599360
1891 Ga0496110_0126550
1892 Ga0496110_0258590
1893 Ga0496113_0279939
1894 Ga0496114_0097916
1895 Ga0496114_0207913
1896 Ga0496114_0377164
1897 Ga0496115_0222450
1898 Ga0496118_0003661
1899 Ga0496121_0139984
1900 Ga0496126_0005213
1901 Ga0496126_0017841
1902 Ga0496126_0073428
1903 Ga0496126_0110089
1904 Ga0496126_0159946
1905 Ga0501032_0007563
1906 Ga0501032_0016176
1907 Ga0501034_0004854
1908 Ga0501034_0004904
1909 Ga0501034_0319147
1910 Ga0501034_0363085
1911 Ga0501034_0862977
1912 Ga0501036_0000454
1913 Ga0501036_0092292
1914 Ga0501037_0201724
1915 Ga0501038_0013310
1916 Ga0501039_0012909
1917 Ga0501039_0565714
1918 Ga0501042_0129725
1919 Ga0501043_0042995
1920 Ga0501043_0138775
1921 Ga0501046_0008990
1922 Ga0501046_0030084
1923 Ga0501047_0000072
1924 Ga0501047_0007135
1925 Ga0501047_0033093
1926 Ga0501047_0079709
1927 Ga0501048_0002246
1928 Ga0501048_0018471
1929 Ga0501069_0113217
1930 Ga0501069_0296354
1931 Ga0501070_0000288
1932 Ga0501070_0000852
1933 Ga0501073_0105594
1934 Ga0501074_0026809
1935 Ga0501074_0072969
1936 Ga0501074_0108742
1937 Ga0501080_0140500
1938 Ga0501080_0196765
1939 Ga0501081_0178963
1940 Ga0501083_0041242
1941 Ga0501083_0099697
1942 Ga0501035_0091771
1943 Ga0501035_0114385
1944 Ga0501044_0007276
1945 Ga0501044_0055104
1946 Ga0501044_0198518
1947 Ga0501044_0441860
1948 Ga0501044_0456662
1949 Ga0501044_0511868
1950 Ga0501045_0228231
1951 nmdc:mga03n38_139213_c1
1952 nmdc:mga00v17_3958_c1
1953 nmdc:mga0yw44_7088_c1
1954 nmdc:mga07m45_33161_c1
1955 nmdc:mga07m45_37395_c1
1956 nmdc:mga05p37_360675_c1
1957 nmdc:mga06r32_4119_c1
1958 nmdc:mga0n895_49351_c1
1959 nmdc:mga0n895_559180_c1
1960 nmdc:mga0rr50_20976_c1
1961 nmdc:mga08x19_66625_c1
1962 nmdc:mga0a205_185592_c1
1963 nmdc:mga0sz30_34660_c1
1964 nmdc:mga0sz30_76074_c1
1965 Ga0495601_0061607
1966 Ga0495601_0069571
1967 Ga0495601_0126962
1968 Ga0495601_0155639
1969 Ga0495601_0287154
1970 Ga0495601_0311927
1971 Ga0495612_0043819
1972 Ga0495612_0052909
1973 Ga0495612_0093197
1974 Ga0495595_0017355
1975 Ga0495619_0010567
1976 Ga0495619_0013573
1977 Ga0495619_0101237
1978 Ga0495619_0105622
1979 Ga0495619_0134783
1980 Ga0500643_019759
1981 Ga0500559_0009140
1982 Ga0500559_0139557
1983 Ga0500577_0034858
1984 Ga0500645_000046
1985 Ga0501084_0018770
1986 Ga0501084_0961122
1987 Ga0466962_0007327
1988 Ga0466962_0010782
1989 Ga0466962_0019043
1990 Ga0530510_0077687
1991 2558910479
1992 2738704856
1993 2739330026
1994 2795786090
1995 2870783191
1996 2899375319
1997 2902803440
1998 8003323465

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

49

274

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.8886 6 245
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.8836 4 246
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.878 6 245
1zic-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (c123s, r206a) mutant- 1.7 a 0.8725 12 247
4u2e-assembly1.cif.gz_A crystal structure of dienelactone hydrolase s-3 variant (q35h, f38l, q110l, c123s, y137c, y145c, n154d, e199g, s208g, g211d and k234n) at 1.70 a resolution 0.8722 12 247
ID Description Score Start End Superfamily
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8889 4 246 3.40.50.1820
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8781 6 245 3.40.50.1820
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8676 6 245 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8649 10 243 3.40.50.1820
af_Q5AI87_1_234_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8548 24 246 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A0C2B4X2-F1-model_v4 Carboxymethylenebutenolidase 0.9927 5 104 GO:0016787
AF-A0A1V4PUN1-F1-model_v4 Carboxymethylenebutenolidase 0.9874 5 247 GO:0016787
AF-A0A7C7JRL5-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9851 167 246 GO:0016787
AF-A0A1V3XLL5-F1-model_v4 Dienelactone hydrolase family protein 0.9848 164 249 GO:0016787
AF-A0A382MJ54-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9843 5 130 GO:0016787

Map