F488189

General Info

Members Datasets Scaffolds Average Seq Length
1013 377 1011 463

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100051325|Ga0070711_1000513254
Length 452
Sequence MDFDPVLLARLQFAFTIIFHIIFPSFTIGLSAYIATLGALWLRSGEERHQLLMRFWVKIFAVSFAMGVVSGIVLSYQFGTNWSRFSVATGNVLGPLLGYEVLAAFFLEATFLGILLFGFNKVPPWLYVLSAIVVAIGTMTSAFWILAANSWMQTPAGHEFRDGVAYPLDWLHIVFNPSFPYRFAHMLNAAYLTTAFVVIAVGARYLIRTMLRMGIGLAAILAPLQLIIGDQHGLNTLAHQPLKVAAMEAHWDGSKPGDFHIFAWPDEKAGVNHFELSIPKGASLILTHKMNGLFPGLLSVPEADRPPVKVVFFGFRIMLGVGLFMIASALFGAFLWWRGTLFETRWYLRIMAQSWWVGFVAVIAGWVVTESGRQPWIVYGVMRTADATSPVPGATIAGTLALFVLAYGVVFSFGIYYMNRLIANGPDQGTETGGEFSGNPLSTTQDAGRGPL

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
3 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
95 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
96 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
97 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
98 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
99 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
100 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
105 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
106 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
107 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
108 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
109 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
113 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
142 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
216 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
217 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
218 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
219 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
220 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
221 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
222 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
223 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
224 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
225 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
226 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
227 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
228 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
229 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
230 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
233 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
234 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
235 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
236 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
237 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
238 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
239 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
240 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
241 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
242 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
243 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
244 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
245 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
246 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
247 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
248 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
249 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
250 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
252 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
253 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
254 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
255 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
256 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
257 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
260 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
261 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
262 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
263 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
264 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
265 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
266 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
267 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
268 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
269 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
270 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
271 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
272 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
275 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
276 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
277 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
278 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
279 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
280 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
281 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
282 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
283 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
284 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
285 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
286 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
287 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
288 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
289 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
290 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
291 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
292 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
293 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
294 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
295 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
296 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
297 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
298 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
299 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
300 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
301 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
302 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
303 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
304 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
305 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
306 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
307 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
308 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
309 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
310 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
311 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
312 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
313 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
314 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
315 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
316 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
317 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
318 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
319 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
320 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
321 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
322 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
323 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
324 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
325 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
326 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
327 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
340 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
341 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
342 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
343 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
344 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
345 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
346 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
347 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
348 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
349 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
350 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
351 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
352 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
353 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
355 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
356 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
357 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
358 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
359 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
360 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
361 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
362 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
363 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
364 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
365 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
366 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
367 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
368 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
369 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
370 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
371 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
372 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
373 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
374 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
375 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
376 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
377 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.68
Nodule 0
Rhizoplane 9.38
Rhizosphere 88.55
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214745202 2209111006 Bacteria 16175
2 ARSoilYngRDRAFT_c00086 3300000042 Bacteria 15520
3 ARcpr5yngRDRAFT_c000084 3300000043 Bacteria 15520
4 ARSoilOldRDRAFT_c000050 3300000044 Bacteria 25074
5 ARCol0yngRDRAFT_1000023 3300000652 Bacteria 28722
6 JGI24739J22299_10000209 3300001989 Bacteria 19461
7 JGI24739J22299_10002430 3300001989 Bacteria 7191
8 JGI24737J22298_10000739 3300001990 Bacteria 11509
9 JGI24737J22298_10003173 3300001990 Bacteria 5839
10 JGI24750J21931_1000551 3300002070 Bacteria 5744
11 JGI24748J21848_1000695 3300002074 Bacteria 3616
12 JGI24738J21930_10001189 3300002075 Bacteria 7282
13 JGI24749J21850_1000283 3300002076 Bacteria 7793
14 JGI24744J21845_10000810 3300002077 Bacteria 5872
15 JGI24035J26624_1000365 3300002126 Bacteria 4267
16 JGI24742J22300_10000279 3300002244 Bacteria 7687
17 JGI25153J46596_10004383 3300003215 Bacteria 7615
18 JGI25404J52841_10002701 3300003659 Bacteria 3395
19 Ga0065714_10095322 3300005288 Bacteria 1790
20 Ga0065704_10073133 3300005289 Bacteria 7551
21 Ga0065712_10070789 3300005290 Bacteria 5705
22 Ga0065715_10000519 3300005293 Bacteria 20489
23 Ga0065715_10004456 3300005293 Bacteria 3808
24 Ga0070676_10002633 3300005328 Bacteria 9237
25 Ga0070676_10041250 3300005328 Bacteria 2675
26 Ga0070683_100010864 3300005329 Bacteria 7839
27 Ga0070683_100035491 3300005329 Bacteria 4558
28 Ga0070690_100001459 3300005330 Bacteria 12359
29 Ga0070670_100012949 3300005331 Bacteria 7141
30 Ga0070670_100027821 3300005331 Bacteria 4864
31 Ga0070677_10000109 3300005333 Bacteria 26990
32 Ga0068869_100004148 3300005334 Bacteria 8986
33 Ga0068869_100035836 3300005334 Bacteria 3520
34 Ga0068869_100146055 3300005334 Bacteria 1830
35 Ga0070680_100018038 3300005336 Bacteria 5574
36 Ga0070680_100019164 3300005336 Bacteria 5420
37 Ga0070680_100063179 3300005336 Bacteria 3032
38 Ga0070682_100000459 3300005337 Bacteria 25698
39 Ga0070682_100034055 3300005337 Bacteria 3099
40 Ga0070682_100040299 3300005337 Bacteria 2874
41 Ga0068868_100000443 3300005338 Bacteria 27815
42 Ga0068868_100006452 3300005338 Bacteria 8300
43 Ga0070660_100034923 3300005339 Bacteria 3802
44 Ga0070660_100046626 3300005339 Bacteria 3322
45 Ga0070689_100000423 3300005340 Bacteria 24943
46 Ga0070689_100001662 3300005340 Bacteria 14205
47 Ga0070689_100020869 3300005340 Bacteria 4868
48 Ga0070689_100043276 3300005340 Bacteria 3460
49 Ga0070689_100131548 3300005340 Bacteria 2007
50 Ga0070691_10001927 3300005341 Bacteria 9119
51 Ga0070691_10011614 3300005341 Bacteria 4023
52 Ga0070691_10011885 3300005341 Bacteria 3984
53 Ga0070691_10019580 3300005341 Bacteria 3125
54 Ga0070687_100000706 3300005343 Bacteria 11178
55 Ga0070687_100005176 3300005343 Bacteria 5266
56 Ga0070687_100006831 3300005343 Bacteria 4706
57 Ga0070687_100022617 3300005343 Bacteria 2976
58 Ga0070661_100001619 3300005344 Bacteria 15572
59 Ga0070692_10000262 3300005345 Bacteria 14685
60 Ga0070692_10046098 3300005345 Bacteria 2251
61 Ga0070668_100001027 3300005347 Bacteria 19571
62 Ga0070668_100051371 3300005347 Bacteria 3176
63 Ga0070668_100092303 3300005347 Bacteria 2388
64 Ga0070669_100002329 3300005353 Bacteria 13729
65 Ga0070669_100064546 3300005353 Bacteria 2697
66 Ga0070675_100040634 3300005354 Bacteria 3798
67 Ga0070671_100017038 3300005355 Bacteria 5877
68 Ga0070671_100019919 3300005355 Bacteria 5465
69 Ga0070671_100031446 3300005355 Bacteria 4384
70 Ga0070674_100001251 3300005356 Bacteria 13361
71 Ga0070674_100009547 3300005356 Bacteria 5810
72 Ga0070674_100027485 3300005356 Bacteria 3729
73 Ga0070674_100043841 3300005356 Bacteria 3045
74 Ga0070673_100000050 3300005364 Bacteria 49499
75 Ga0070673_100006576 3300005364 Bacteria 7565
76 Ga0070673_100016705 3300005364 Bacteria 5200
77 Ga0070688_100001640 3300005365 Bacteria 11206
78 Ga0070688_100007074 3300005365 Bacteria 6036
79 Ga0070688_100036737 3300005365 Bacteria 2981
80 Ga0070659_100012533 3300005366 Bacteria 6285
81 Ga0070659_100037940 3300005366 Bacteria 3756
82 Ga0070659_100039712 3300005366 Bacteria 3675
83 Ga0070659_100042832 3300005366 Bacteria 3540
84 Ga0070667_100006734 3300005367 Bacteria 9546
85 Ga0070667_100015429 3300005367 Bacteria 6316
86 Ga0070667_100033083 3300005367 Bacteria 4317
87 Ga0070703_10001729 3300005406 Bacteria 6477
88 Ga0070703_10002210 3300005406 Bacteria 5657
89 Ga0070709_10000525 3300005434 Bacteria 22547
90 Ga0070714_100005095 3300005435 Bacteria 9993
91 Ga0070713_100001754 3300005436 Bacteria 13984
92 Ga0070713_100178398 3300005436 Bacteria 1907
93 Ga0070710_10001598 3300005437 Bacteria 10686
94 Ga0070710_10069031 3300005437 Bacteria 2032
95 Ga0070701_10000093 3300005438 Bacteria 25004
96 Ga0070701_10021819 3300005438 Bacteria 3063
97 Ga0070701_10022612 3300005438 Bacteria 3015
98 Ga0070711_100016501 3300005439 Bacteria 4692
99 Ga0070711_100051325 3300005439 Bacteria 2832
100 Ga0070705_100003411 3300005440 Bacteria 7790
101 Ga0070705_100009540 3300005440 Bacteria 4829
102 Ga0070705_100101189 3300005440 Bacteria 1820
103 Ga0070700_100009936 3300005441 Bacteria 5236
104 Ga0070700_100010471 3300005441 Bacteria 5122
105 Ga0070700_100014595 3300005441 Bacteria 4437
106 Ga0070700_100016882 3300005441 Bacteria 4165
107 Ga0070694_100009576 3300005444 Bacteria 5943
108 Ga0070694_100019701 3300005444 Bacteria 4293
109 Ga0070663_100030724 3300005455 Bacteria 3685
110 Ga0070663_100090611 3300005455 Bacteria 2265
111 Ga0070678_100001756 3300005456 Bacteria 11671
112 Ga0070678_100015618 3300005456 Bacteria 4832
113 Ga0070678_100133004 3300005456 Bacteria 1979
114 Ga0070662_100003987 3300005457 Bacteria 9250
115 Ga0070662_100009135 3300005457 Bacteria 6472
116 Ga0070681_10001525 3300005458 Bacteria 20520
117 Ga0070681_10001623 3300005458 Bacteria 20035
118 Ga0070681_10030838 3300005458 Bacteria 5381
119 Ga0070681_10149529 3300005458 Bacteria 2263
120 Ga0068867_100001138 3300005459 Bacteria 18176
121 Ga0068867_100012280 3300005459 Bacteria 6056
122 Ga0068867_100035703 3300005459 Bacteria 3606
123 Ga0070685_10000984 3300005466 Bacteria 15313
124 Ga0070685_10007517 3300005466 Bacteria 5578
125 Ga0070685_10017650 3300005466 Bacteria 3823
126 Ga0070685_10029019 3300005466 Bacteria 3071
127 Ga0070699_100001809 3300005518 Bacteria 19434
128 Ga0070679_100012735 3300005530 Bacteria 8043
129 Ga0070679_100054193 3300005530 Bacteria 3992
130 Ga0070679_100091379 3300005530 Bacteria 3032
131 Ga0070679_100139212 3300005530 Bacteria 2407
132 Ga0070684_100029522 3300005535 Bacteria 4648
133 Ga0070684_100035117 3300005535 Bacteria 4289
134 Ga0070684_100067827 3300005535 Bacteria 3134
135 Ga0070684_100076688 3300005535 Bacteria 2951
136 Ga0070684_100086779 3300005535 Bacteria 2778
137 Ga0070684_100090738 3300005535 Bacteria 2718
138 Ga0068853_100002995 3300005539 Bacteria 12889
139 Ga0068853_100073321 3300005539 Bacteria 2984
140 Ga0070672_100003943 3300005543 Bacteria 9675
141 Ga0070686_100009031 3300005544 Bacteria 5590
142 Ga0070686_100016714 3300005544 Bacteria 4272
143 Ga0070686_100021350 3300005544 Bacteria 3847
144 Ga0070695_100000824 3300005545 Bacteria 16725
145 Ga0070695_100002921 3300005545 Bacteria 9944
146 Ga0070695_100017465 3300005545 Bacteria 4351
147 Ga0070696_100000856 3300005546 Bacteria 19655
148 Ga0070693_100001975 3300005547 Bacteria 9380
149 Ga0070665_100244531 3300005548 Bacteria 1795
150 Ga0070704_100002335 3300005549 Bacteria 10635
151 Ga0070704_100002836 3300005549 Bacteria 9819
152 Ga0070704_100006569 3300005549 Bacteria 6858
153 Ga0070704_100039281 3300005549 Bacteria 3248
154 Ga0068855_100015755 3300005563 Bacteria 9093
155 Ga0070664_100024583 3300005564 Bacteria 4985
156 Ga0070664_100037892 3300005564 Bacteria 4055
157 Ga0070664_100079318 3300005564 Bacteria 2826
158 Ga0068857_100008305 3300005577 Bacteria 8971
159 Ga0068857_100043792 3300005577 Bacteria 3970
160 Ga0068854_100003868 3300005578 Bacteria 9383
161 Ga0068854_100015449 3300005578 Bacteria 5057
162 Ga0068854_100063690 3300005578 Bacteria 2677
163 Ga0068854_100072375 3300005578 Bacteria 2524
164 Ga0068856_100003821 3300005614 Bacteria 15095
165 Ga0068856_100058666 3300005614 Bacteria 3801
166 Ga0070702_100000497 3300005615 Bacteria 14109
167 Ga0070702_100006109 3300005615 Bacteria 5676
168 Ga0070702_100084461 3300005615 Bacteria 1909
169 Ga0068852_100001222 3300005616 Bacteria 17091
170 Ga0068852_100063725 3300005616 Bacteria 3210
171 Ga0068859_100021148 3300005617 Bacteria 6529
172 Ga0068859_100023550 3300005617 Bacteria 6179
173 Ga0068859_100025814 3300005617 Bacteria 5895
174 Ga0068859_100034357 3300005617 Bacteria 5089
175 Ga0068859_100038671 3300005617 Bacteria 4786
176 Ga0068864_100001074 3300005618 Bacteria 22938
177 Ga0068864_100006339 3300005618 Bacteria 9703
178 Ga0068864_100012258 3300005618 Bacteria 7084
179 Ga0068864_100042649 3300005618 Bacteria 3883
180 Ga0068864_100048003 3300005618 Bacteria 3670
181 Ga0068864_100157672 3300005618 Bacteria 2061
182 Ga0068866_10005659 3300005718 Bacteria 5176
183 Ga0068866_10006999 3300005718 Bacteria 4713
184 Ga0068866_10068047 3300005718 Bacteria 1871
185 Ga0068861_100001328 3300005719 Bacteria 15509
186 Ga0068861_100016726 3300005719 Bacteria 5195
187 Ga0068861_100017632 3300005719 Bacteria 5074
188 Ga0068870_10000051 3300005840 Bacteria 36782
189 Ga0068870_10015842 3300005840 Bacteria 3587
190 Ga0068863_100008364 3300005841 Bacteria 10106
191 Ga0068863_100013387 3300005841 Bacteria 7909
192 Ga0068863_100026590 3300005841 Bacteria 5518
193 Ga0068863_100075045 3300005841 Bacteria 3199
194 Ga0068858_100005147 3300005842 Bacteria 12813
195 Ga0068858_100006251 3300005842 Bacteria 11604
196 Ga0068858_100034414 3300005842 Bacteria 4699
197 Ga0068858_100092885 3300005842 Bacteria 2809
198 Ga0068860_100001825 3300005843 Bacteria 22684
199 Ga0068860_100008760 3300005843 Bacteria 10078
200 Ga0068860_100010661 3300005843 Bacteria 9077
201 Ga0068860_100023546 3300005843 Bacteria 5951
202 Ga0068860_100104445 3300005843 Bacteria 2705
203 Ga0068860_100144787 3300005843 Bacteria 2286
204 Ga0068862_100001949 3300005844 Bacteria 18707
205 Ga0068862_100016670 3300005844 Bacteria 6117
206 Ga0068862_100039768 3300005844 Bacteria 3996
207 Ga0081455_10000081 3300005937 Bacteria 103752
208 Ga0081455_10002198 3300005937 Bacteria 23233
209 Ga0081538_10059304 3300005981 Bacteria 2211
210 Ga0081538_10081004 3300005981 Bacteria 1729
211 Ga0081540_1000007 3300005983 Bacteria 205328
212 Ga0081540_1004024 3300005983 Bacteria 11383
213 Ga0075365_10126900 3300006038 Bacteria 1763
214 Ga0075368_10005879 3300006042 Bacteria 4248
215 Ga0075368_10014120 3300006042 Bacteria 2945
216 Ga0070715_10000551 3300006163 Bacteria 9852
217 Ga0070716_100001287 3300006173 Bacteria 11081
218 Ga0070712_100004737 3300006175 Bacteria 8411
219 Ga0075367_10018956 3300006178 Bacteria 3806
220 Ga0075427_10000603 3300006194 Bacteria 4197
221 Ga0075366_10012326 3300006195 Bacteria 4847
222 Ga0097621_100001496 3300006237 Bacteria 16030
223 Ga0075370_10042438 3300006353 Bacteria 2570
224 Ga0068871_100003134 3300006358 Bacteria 11345
225 Ga0068871_100023904 3300006358 Bacteria 4735
226 Ga0068871_100065268 3300006358 Bacteria 2981
227 Ga0068871_100081876 3300006358 Bacteria 2675
228 Ga0068871_100251808 3300006358 Bacteria 1539
229 Ga0075428_100000740 3300006844 Bacteria 33927
230 Ga0075428_100024539 3300006844 Bacteria 6672
231 Ga0075430_100006097 3300006846 Bacteria 10161
232 Ga0075430_100013350 3300006846 Bacteria 7000
233 Ga0075430_100016809 3300006846 Bacteria 6231
234 Ga0075431_100000870 3300006847 Bacteria 26533
235 Ga0075431_100001076 3300006847 Bacteria 24422
236 Ga0075431_100007719 3300006847 Bacteria 10714
237 Ga0075431_100042948 3300006847 Bacteria 4664
238 Ga0075431_100149874 3300006847 Bacteria 2402
239 Ga0075431_100195337 3300006847 Bacteria 2072
240 Ga0075433_10000012 3300006852 Bacteria 71065
241 Ga0075433_10025668 3300006852 Bacteria 4983
242 Ga0075434_100003201 3300006871 Bacteria 14596
243 Ga0075434_100007032 3300006871 Bacteria 10380
244 Ga0075434_100008056 3300006871 Bacteria 9773
245 Ga0075434_100012519 3300006871 Bacteria 8046
246 Ga0075434_100054628 3300006871 Bacteria 3967
247 Ga0075429_100000098 3300006880 Bacteria 47888
248 Ga0075429_100004032 3300006880 Bacteria 12577
249 Ga0068865_100003854 3300006881 Bacteria 8992
250 Ga0068865_100016325 3300006881 Bacteria 4750
251 Ga0097620_100021146 3300006931 Bacteria 6529
252 Ga0097620_100023550 3300006931 Bacteria 6179
253 Ga0097620_100025814 3300006931 Bacteria 5895
254 Ga0097620_100034355 3300006931 Bacteria 5089
255 Ga0097620_100038673 3300006931 Bacteria 4786
256 Ga0075435_100028671 3300007076 Bacteria 4367
257 Ga0075435_100069072 3300007076 Bacteria 2880
258 Ga0105250_10040014 3300009092 Bacteria 1880
259 Ga0111539_10000757 3300009094 Bacteria 42016
260 Ga0111539_10001671 3300009094 Bacteria 29561
261 Ga0111539_10005127 3300009094 Bacteria 16990
262 Ga0111539_10008480 3300009094 Bacteria 13063
263 Ga0111539_10051044 3300009094 Bacteria 4927
264 Ga0111539_10100128 3300009094 Bacteria 3403
265 Ga0111539_10150020 3300009094 Bacteria 2729
266 Ga0105245_10002488 3300009098 Bacteria 16638
267 Ga0105245_10050094 3300009098 Bacteria 3741
268 Ga0105245_10182552 3300009098 Bacteria 2005
269 Ga0105247_10006103 3300009101 Bacteria 7490
270 Ga0105247_10008404 3300009101 Bacteria 6293
271 Ga0105247_10016894 3300009101 Bacteria 4375
272 Ga0105247_10036684 3300009101 Bacteria 2988
273 Ga0114129_10000025 3300009147 Bacteria 116480
274 Ga0114129_10008949 3300009147 Bacteria 14268
275 Ga0114129_10016369 3300009147 Bacteria 10556
276 Ga0114129_10019966 3300009147 Bacteria 9538
277 Ga0114129_10023567 3300009147 Bacteria 8725
278 Ga0114129_10050640 3300009147 Bacteria 5833
279 Ga0114129_10233598 3300009147 Bacteria 2476
280 Ga0105243_10003214 3300009148 Bacteria 13370
281 Ga0105243_10009303 3300009148 Bacteria 7494
282 Ga0105243_10031611 3300009148 Bacteria 4081
283 Ga0105241_10004876 3300009174 Bacteria 9894
284 Ga0105241_10005826 3300009174 Bacteria 9097
285 Ga0105241_10065776 3300009174 Bacteria 2802
286 Ga0105242_10002016 3300009176 Bacteria 15990
287 Ga0105242_10003519 3300009176 Bacteria 12173
288 Ga0105242_10041795 3300009176 Bacteria 3699
289 Ga0105242_10069916 3300009176 Bacteria 2909
290 Ga0105242_10108685 3300009176 Bacteria 2361
291 Ga0105248_10003871 3300009177 Bacteria 16548
292 Ga0105248_10099691 3300009177 Bacteria 3273
293 Ga0105248_10315006 3300009177 Bacteria 1762
294 Ga0105237_10006016 3300009545 Bacteria 13574
295 Ga0105237_10043192 3300009545 Bacteria 4542
296 Ga0105237_10078801 3300009545 Bacteria 3284
297 Ga0105237_10095030 3300009545 Bacteria 2970
298 Ga0105238_10054187 3300009551 Bacteria 4029
299 Ga0105238_10054673 3300009551 Bacteria 4008
300 Ga0105249_10001193 3300009553 Bacteria 22912
301 Ga0105249_10001979 3300009553 Bacteria 17784
302 Ga0105249_10108889 3300009553 Bacteria 2616
303 Ga0105239_10027649 3300010375 Bacteria 6241
304 Ga0105239_10035856 3300010375 Bacteria 5446
305 Ga0105239_10038572 3300010375 Bacteria 5236
306 Ga0105239_10041876 3300010375 Bacteria 5019
307 Ga0105246_10000231 3300011119 Bacteria 28580
308 Ga0105246_10015760 3300011119 Bacteria 4778
309 Ga0105246_10117462 3300011119 Bacteria 1965
310 Ga0157373_10010248 3300013100 Bacteria 6904
311 Ga0157373_10102676 3300013100 Bacteria 2012
312 Ga0157373_10111698 3300013100 Bacteria 1921
313 Ga0157371_10025479 3300013102 Bacteria 4310
314 Ga0157370_10150497 3300013104 Bacteria 2166
315 Ga0157374_10003239 3300013296 Bacteria 13672
316 Ga0157374_10013309 3300013296 Bacteria 7178
317 Ga0157374_10017421 3300013296 Bacteria 6324
318 Ga0157374_10031696 3300013296 Bacteria 4807
319 Ga0157378_10004453 3300013297 Bacteria 12317
320 Ga0157378_10010612 3300013297 Bacteria 8051
321 Ga0157378_10020673 3300013297 Bacteria 5790
322 Ga0157378_10021915 3300013297 Bacteria 5619
323 Ga0163162_10006149 3300013306 Bacteria 11621
324 Ga0163162_10020738 3300013306 Bacteria 6461
325 Ga0163162_10026579 3300013306 Bacteria 5722
326 Ga0157372_10025465 3300013307 Bacteria 6433
327 Ga0157372_10121031 3300013307 Bacteria 3006
328 Ga0157375_10006518 3300013308 Bacteria 10160
329 Ga0157375_10033972 3300013308 Bacteria 4853
330 Ga0157375_10053687 3300013308 Bacteria 3967
331 Ga0157375_10100999 3300013308 Bacteria 2966
332 Ga0157375_10119222 3300013308 Bacteria 2746
333 Ga0157375_10237394 3300013308 Bacteria 1982
334 Ga0163163_10001320 3300014325 Bacteria 20935
335 Ga0163163_10015790 3300014325 Bacteria 6993
336 Ga0163163_10051326 3300014325 Bacteria 4067
337 Ga0163163_10093775 3300014325 Bacteria 3019
338 Ga0163163_10168581 3300014325 Bacteria 2236
339 Ga0157380_10002744 3300014326 Bacteria 11948
340 Ga0157380_10065721 3300014326 Bacteria 2916
341 Ga0157380_10195500 3300014326 Bacteria 1790
342 Ga0157377_10000164 3300014745 Bacteria 39592
343 Ga0157379_10020078 3300014968 Bacteria 5905
344 Ga0157379_10030909 3300014968 Bacteria 4770
345 Ga0157379_10061490 3300014968 Bacteria 3358
346 Ga0157379_10064966 3300014968 Bacteria 3261
347 Ga0157376_10002102 3300014969 Bacteria 13394
348 Ga0157376_10036456 3300014969 Bacteria 3984
349 Ga0157376_10036479 3300014969 Bacteria 3983
350 Ga0157376_10088277 3300014969 Bacteria 2678
351 Ga0157376_10204657 3300014969 Bacteria 1819
352 Ga0163161_10002837 3300017792 Bacteria 12295
353 Ga0163161_10114468 3300017792 Bacteria 2020
354 Ga0163161_10131060 3300017792 Bacteria 1891
355 Ga0213876_10025328 3300021384 Bacteria 3130
356 Ga0207666_1000051 3300025271 Bacteria 21813
357 Ga0209758_1000125 3300025297 Bacteria 189869
358 Ga0207697_10000662 3300025315 Bacteria 19563
359 Ga0207653_10000546 3300025885 Bacteria 13918
360 Ga0207653_10001467 3300025885 Bacteria 7655
361 Ga0207682_10000072 3300025893 Bacteria 44659
362 Ga0207692_10002147 3300025898 Bacteria 7536
363 Ga0207642_10001909 3300025899 Bacteria 6431
364 Ga0207642_10039428 3300025899 Bacteria 2052
365 Ga0207710_10000558 3300025900 Bacteria 22251
366 Ga0207710_10004313 3300025900 Bacteria 6228
367 Ga0207710_10035227 3300025900 Bacteria 2202
368 Ga0207688_10000229 3300025901 Bacteria 25389
369 Ga0207688_10000998 3300025901 Bacteria 14427
370 Ga0207688_10004677 3300025901 Bacteria 7461
371 Ga0207680_10001283 3300025903 Bacteria 11893
372 Ga0207680_10092650 3300025903 Bacteria 1925
373 Ga0207647_10003353 3300025904 Bacteria 12014
374 Ga0207647_10010679 3300025904 Bacteria 6473
375 Ga0207647_10011089 3300025904 Bacteria 6334
376 Ga0207685_10001607 3300025905 Bacteria 4832
377 Ga0207685_10003975 3300025905 Bacteria 3682
378 Ga0207699_10002080 3300025906 Bacteria 9455
379 Ga0207699_10015546 3300025906 Bacteria 3956
380 Ga0207645_10000966 3300025907 Bacteria 23780
381 Ga0207645_10007388 3300025907 Bacteria 7770
382 Ga0207645_10023155 3300025907 Bacteria 4037
383 Ga0207645_10059737 3300025907 Bacteria 2435
384 Ga0207643_10000004 3300025908 Bacteria 187006
385 Ga0207643_10000794 3300025908 Bacteria 19261
386 Ga0207643_10004896 3300025908 Bacteria 7167
387 Ga0207643_10031046 3300025908 Bacteria 2977
388 Ga0207643_10065728 3300025908 Bacteria 2078
389 Ga0207654_10001472 3300025911 Bacteria 12448
390 Ga0207654_10007425 3300025911 Bacteria 5521
391 Ga0207707_10007028 3300025912 Bacteria 9814
392 Ga0207707_10065564 3300025912 Bacteria 3163
393 Ga0207671_10013159 3300025914 Bacteria 6607
394 Ga0207671_10020766 3300025914 Bacteria 4995
395 Ga0207671_10048003 3300025914 Bacteria 3159
396 Ga0207693_10006880 3300025915 Bacteria 9393
397 Ga0207693_10027450 3300025915 Bacteria 4501
398 Ga0207693_10161096 3300025915 Bacteria 1765
399 Ga0207663_10010875 3300025916 Bacteria 4861
400 Ga0207663_10017354 3300025916 Bacteria 4009
401 Ga0207660_10000648 3300025917 Bacteria 23454
402 Ga0207660_10092613 3300025917 Bacteria 2243
403 Ga0207662_10000317 3300025918 Bacteria 21877
404 Ga0207662_10000424 3300025918 Bacteria 18665
405 Ga0207662_10013378 3300025918 Bacteria 4589
406 Ga0207662_10023881 3300025918 Bacteria 3515
407 Ga0207662_10032770 3300025918 Bacteria 3026
408 Ga0207662_10064039 3300025918 Bacteria 2211
409 Ga0207662_10091114 3300025918 Bacteria 1875
410 Ga0207657_10002047 3300025919 Bacteria 21819
411 Ga0207657_10028849 3300025919 Bacteria 5056
412 Ga0207649_10000262 3300025920 Bacteria 41689
413 Ga0207649_10090257 3300025920 Bacteria 2005
414 Ga0207652_10000911 3300025921 Bacteria 27891
415 Ga0207652_10067950 3300025921 Bacteria 3091
416 Ga0207681_10010634 3300025923 Bacteria 5643
417 Ga0207694_10024208 3300025924 Bacteria 4609
418 Ga0207650_10013694 3300025925 Bacteria 5623
419 Ga0207650_10019548 3300025925 Bacteria 4762
420 Ga0207659_10001684 3300025926 Bacteria 13118
421 Ga0207659_10012218 3300025926 Bacteria 5451
422 Ga0207659_10024969 3300025926 Bacteria 4011
423 Ga0207687_10001501 3300025927 Bacteria 15981
424 Ga0207687_10006389 3300025927 Bacteria 7789
425 Ga0207687_10017936 3300025927 Bacteria 4670
426 Ga0207700_10001264 3300025928 Bacteria 14408
427 Ga0207700_10218925 3300025928 Bacteria 1613
428 Ga0207664_10002547 3300025929 Bacteria 12049
429 Ga0207664_10183287 3300025929 Bacteria 1798
430 Ga0207644_10000467 3300025931 Bacteria 26087
431 Ga0207644_10001961 3300025931 Bacteria 13297
432 Ga0207644_10015484 3300025931 Bacteria 5120
433 Ga0207644_10025194 3300025931 Bacteria 4089
434 Ga0207644_10092872 3300025931 Bacteria 2252
435 Ga0207690_10001228 3300025932 Bacteria 16182
436 Ga0207690_10009138 3300025932 Bacteria 5883
437 Ga0207690_10137132 3300025932 Bacteria 1798
438 Ga0207706_10001679 3300025933 Bacteria 21866
439 Ga0207706_10007881 3300025933 Bacteria 9829
440 Ga0207706_10018822 3300025933 Bacteria 6211
441 Ga0207706_10054074 3300025933 Bacteria 3543
442 Ga0207706_10203437 3300025933 Bacteria 1736
443 Ga0207686_10002040 3300025934 Bacteria 11131
444 Ga0207686_10009318 3300025934 Bacteria 5323
445 Ga0207686_10017951 3300025934 Bacteria 3998
446 Ga0207686_10099188 3300025934 Bacteria 1941
447 Ga0207709_10035318 3300025935 Bacteria 2954
448 Ga0207709_10102649 3300025935 Bacteria 1894
449 Ga0207670_10000377 3300025936 Bacteria 25697
450 Ga0207670_10002370 3300025936 Bacteria 9867
451 Ga0207670_10003054 3300025936 Bacteria 8831
452 Ga0207670_10037467 3300025936 Bacteria 3160
453 Ga0207670_10170453 3300025936 Bacteria 1632
454 Ga0207669_10001912 3300025937 Bacteria 8835
455 Ga0207669_10015439 3300025937 Bacteria 3851
456 Ga0207669_10017896 3300025937 Bacteria 3648
457 Ga0207669_10031185 3300025937 Bacteria 2975
458 Ga0207704_10002613 3300025938 Bacteria 8128
459 Ga0207704_10174333 3300025938 Bacteria 1546
460 Ga0207665_10001035 3300025939 Bacteria 18728
461 Ga0207665_10043619 3300025939 Bacteria 2999
462 Ga0207665_10056180 3300025939 Bacteria 2657
463 Ga0207665_10067562 3300025939 Bacteria 2434
464 Ga0207691_10002691 3300025940 Bacteria 17379
465 Ga0207691_10002874 3300025940 Bacteria 16780
466 Ga0207711_10003410 3300025941 Bacteria 13758
467 Ga0207711_10006776 3300025941 Bacteria 9628
468 Ga0207711_10022868 3300025941 Bacteria 5232
469 Ga0207711_10030274 3300025941 Bacteria 4565
470 Ga0207689_10000203 3300025942 Bacteria 52425
471 Ga0207689_10022711 3300025942 Bacteria 5270
472 Ga0207689_10044138 3300025942 Bacteria 3685
473 Ga0207689_10045948 3300025942 Bacteria 3610
474 Ga0207661_10002165 3300025944 Bacteria 13530
475 Ga0207661_10014563 3300025944 Bacteria 5769
476 Ga0207679_10000157 3300025945 Bacteria 56166
477 Ga0207679_10015012 3300025945 Bacteria 5106
478 Ga0207679_10158473 3300025945 Bacteria 1851
479 Ga0207667_10220437 3300025949 Bacteria 1943
480 Ga0207651_10008897 3300025960 Bacteria 5454
481 Ga0207712_10002224 3300025961 Bacteria 12622
482 Ga0207712_10003965 3300025961 Bacteria 9349
483 Ga0207712_10039070 3300025961 Bacteria 3250
484 Ga0207668_10017144 3300025972 Bacteria 4532
485 Ga0207668_10055993 3300025972 Bacteria 2744
486 Ga0207668_10109409 3300025972 Bacteria 2070
487 Ga0207640_10043680 3300025981 Bacteria 2866
488 Ga0207658_10005748 3300025986 Bacteria 8483
489 Ga0207658_10008052 3300025986 Bacteria 7181
490 Ga0207658_10048495 3300025986 Bacteria 3114
491 Ga0207658_10167123 3300025986 Bacteria 1808
492 Ga0207677_10001675 3300026023 Bacteria 11738
493 Ga0207677_10006260 3300026023 Bacteria 6510
494 Ga0207703_10001346 3300026035 Bacteria 22503
495 Ga0207703_10001852 3300026035 Bacteria 18819
496 Ga0207703_10032158 3300026035 Bacteria 4151
497 Ga0207639_10008211 3300026041 Bacteria 7147
498 Ga0207678_10001809 3300026067 Bacteria 19589
499 Ga0207678_10001884 3300026067 Bacteria 19130
500 Ga0207678_10011488 3300026067 Bacteria 7777
501 Ga0207678_10013053 3300026067 Bacteria 7289
502 Ga0207678_10034212 3300026067 Bacteria 4426
503 Ga0207678_10034731 3300026067 Bacteria 4391
504 Ga0207678_10041672 3300026067 Bacteria 3981
505 Ga0207708_10000784 3300026075 Bacteria 23952
506 Ga0207708_10001199 3300026075 Bacteria 19559
507 Ga0207708_10003067 3300026075 Bacteria 12308
508 Ga0207708_10004901 3300026075 Bacteria 9865
509 Ga0207708_10014093 3300026075 Bacteria 5974
510 Ga0207702_10003404 3300026078 Bacteria 14557
511 Ga0207702_10068697 3300026078 Bacteria 3045
512 Ga0207641_10006871 3300026088 Bacteria 9524
513 Ga0207641_10011257 3300026088 Bacteria 7337
514 Ga0207641_10041334 3300026088 Bacteria 3863
515 Ga0207648_10002073 3300026089 Bacteria 21861
516 Ga0207648_10002310 3300026089 Bacteria 20581
517 Ga0207648_10016984 3300026089 Bacteria 6632
518 Ga0207648_10027663 3300026089 Bacteria 5032
519 Ga0207676_10000990 3300026095 Bacteria 21882
520 Ga0207676_10002295 3300026095 Bacteria 13719
521 Ga0207676_10002940 3300026095 Bacteria 12143
522 Ga0207676_10048845 3300026095 Bacteria 3287
523 Ga0207676_10184700 3300026095 Bacteria 1829
524 Ga0207674_10000897 3300026116 Bacteria 38907
525 Ga0207674_10011740 3300026116 Bacteria 9828
526 Ga0207675_100001726 3300026118 Bacteria 21899
527 Ga0207675_100002371 3300026118 Bacteria 18651
528 Ga0207675_100005453 3300026118 Bacteria 12188
529 Ga0207683_10000824 3300026121 Bacteria 28453
530 Ga0207683_10001176 3300026121 Bacteria 23694
531 Ga0207683_10014019 3300026121 Bacteria 6834
532 Ga0207683_10018096 3300026121 Bacteria 6008
533 Ga0207683_10081706 3300026121 Bacteria 2869
534 Ga0207683_10185428 3300026121 Bacteria 1888
535 Ga0207698_10003743 3300026142 Bacteria 9193
536 Ga0207698_10024746 3300026142 Bacteria 4219
537 Ga0210002_1003362 3300027617 Bacteria 2352
538 Ga0209966_1000247 3300027695 Bacteria 19895
539 Ga0209998_10000255 3300027717 Bacteria 17497
540 Ga0209998_10001128 3300027717 Bacteria 6625
541 Ga0209974_10001489 3300027876 Bacteria 8511
542 Ga0207428_10000137 3300027907 Bacteria 98535
543 Ga0207428_10000792 3300027907 Bacteria 35769
544 Ga0207428_10003106 3300027907 Bacteria 16320
545 Ga0207428_10004572 3300027907 Bacteria 13115
546 Ga0207428_10033074 3300027907 Bacteria 4249
547 Ga0207428_10072105 3300027907 Bacteria 2712
548 Ga0268266_10005095 3300028379 Bacteria 12383
549 Ga0268266_10023244 3300028379 Bacteria 5278
550 Ga0268266_10046625 3300028379 Bacteria 3710
551 Ga0268265_10012344 3300028380 Bacteria 5788
552 Ga0268265_10029470 3300028380 Bacteria 3939
553 Ga0268265_10085418 3300028380 Bacteria 2504
554 Ga0268264_10002039 3300028381 Bacteria 18053
555 Ga0268264_10016623 3300028381 Bacteria 6024
556 Ga0268264_10062447 3300028381 Bacteria 3128
557 Ga0268264_10081157 3300028381 Bacteria 2771
558 Ga0265330_10047685 3300031235 Bacteria 1885
559 Ga0265325_10000073 3300031241 Bacteria 70109
560 Ga0265325_10000234 3300031241 Bacteria 39472
561 Ga0265325_10002177 3300031241 Bacteria 13332
562 Ga0265325_10004094 3300031241 Bacteria 9289
563 Ga0265340_10021850 3300031247 Bacteria 3277
564 Ga0265339_10001513 3300031249 Bacteria 17175
565 Ga0265316_10024489 3300031344 Bacteria 5056
566 Ga0265313_10000326 3300031595 Bacteria 51836
567 Ga0265313_10008870 3300031595 Bacteria 6619
568 Ga0265313_10040748 3300031595 Bacteria 2293
569 Ga0373948_0000061 3300034817 Bacteria 11538
570 Ga0373958_0000048 3300034819 Bacteria 11955
571 Ga0373958_0001634 3300034819 Bacteria 3043
572 Ga0373926_0003985 3300035083 Bacteria 4827
573 Ga0373928_0000291 3300035084 Bacteria 9922
574 Ga0373928_0008797 3300035084 Bacteria 1965
575 Ga0373929_0000564 3300035085 Bacteria 7143
576 Ga0373929_0005244 3300035085 Bacteria 2331
577 Ga0373934_0020853 3300035086 Bacteria 2522
578 Ga0373940_0000023 3300035088 Bacteria 16767
579 Ga0373940_0010533 3300035088 Bacteria 2176
580 Ga0373940_0012296 3300035088 Bacteria 2049
581 Ga0373949_0001146 3300035090 Bacteria 7970
582 Ga0373951_0000876 3300035091 Bacteria 8125
583 Ga0373951_0005478 3300035091 Bacteria 2948
584 Ga0373923_0000851 3300035111 Bacteria 8076
585 Ga0373923_0003216 3300035111 Bacteria 5195
586 Ga0373936_0001660 3300035113 Bacteria 8158
587 Ga0373939_0000663 3300035114 Bacteria 8540
588 Ga0373939_0002651 3300035114 Bacteria 4201
589 Ga0373941_0000309 3300035115 Bacteria 9451
590 Ga0373945_0000277 3300035116 Bacteria 14473
591 Ga0373945_0001390 3300035116 Bacteria 7348
592 Ga0373953_0068438 3300035117 Bacteria 1461
593 Ga0373954_0005333 3300035118 Bacteria 5557
594 Ga0373954_0014688 3300035118 Bacteria 3493
595 Ga0373960_0001082 3300035121 Bacteria 5885
596 Ga0373960_0003571 3300035121 Bacteria 3527
597 Ga0373960_0003751 3300035121 Bacteria 3453
598 Ga0373943_0004971 3300035170 Bacteria 6002
599 Ga0373943_0005512 3300035170 Bacteria 5690
600 Ga0373943_0009916 3300035170 Bacteria 4268
601 Ga0373946_0001856 3300035171 Bacteria 7374
602 Ga0373946_0002330 3300035171 Bacteria 6718
603 Ga0373955_0002403 3300035172 Bacteria 8160
604 Ga0373942_0000081 3300035207 Bacteria 20661
605 Ga0373942_0003417 3300035207 Bacteria 3733
606 Ga0373942_0009249 3300035207 Bacteria 2304
607 Ga0373942_0016658 3300035207 Bacteria 1805
608 Ga0373961_0000743 3300035241 Bacteria 11267
609 Ga0373961_0002954 3300035241 Bacteria 4297
610 Ga0373961_0032726 3300035241 Bacteria 1460
611 Ga0373962_0000194 3300035242 Bacteria 12882
612 Ga0373924_0000490 3300035410 Bacteria 12118
613 Ga0373924_0004810 3300035410 Bacteria 4747
614 Ga0373931_0001008 3300035691 Bacteria 11924
615 Ga0373931_0001564 3300035691 Bacteria 9881
616 Ga0373931_0002975 3300035691 Bacteria 7569
617 Ga0373931_0007918 3300035691 Bacteria 5027
618 Ga0373931_0016578 3300035691 Bacteria 3629
619 Ga0373935_0000291 3300035692 Bacteria 24802
620 Ga0373935_0013547 3300035692 Bacteria 4922
621 Ga0373935_0057106 3300035692 Bacteria 2490
622 Ga0373927_0005343 3300035695 Bacteria 8880
623 Ga0373927_0009000 3300035695 Bacteria 6703
624 Ga0373927_0034546 3300035695 Bacteria 3289
625 Ga0373927_0051606 3300035695 Bacteria 2659
626 Ga0373927_0054373 3300035695 Bacteria 2590
627 Ga0373927_0055119 3300035695 Bacteria 2571
628 Ga0373933_0010185 3300035724 Bacteria 5149
629 Ga0373933_0012833 3300035724 Bacteria 4633
630 Ga0373947_0000424 3300035725 Bacteria 23999
631 Ga0373947_0005730 3300035725 Bacteria 7243
632 Ga0373947_0010154 3300035725 Bacteria 5407
633 Ga0373947_0041253 3300035725 Bacteria 2751
634 Ga0373947_0048954 3300035725 Bacteria 2537
635 Ga0373937_0000004 3300036401 Bacteria 212269
636 Ga0373937_0003680 3300036401 Bacteria 12949
637 Ga0373937_0005263 3300036401 Bacteria 11048
638 Ga0373937_0006030 3300036401 Bacteria 10436
639 Ga0373925_0000460 3300037068 Bacteria 41057
640 Ga0373925_0003391 3300037068 Bacteria 12354
641 Ga0373925_0017524 3300037068 Bacteria 5192
642 Ga0373925_0127647 3300037068 Bacteria 1980
643 Ga0436365_0349099 3300039437 Bacteria 3604
644 Ga0436365_1169665 3300039437 Bacteria 1720
645 Ga0439464_0005396 3300042439 Bacteria 3304
646 Ga0451576_0006650 3300045051 Bacteria 14107
647 Ga0495592_0000029 3300046454 Bacteria 131879
648 Ga0495592_0001215 3300046454 Bacteria 17883
649 Ga0495592_0005508 3300046454 Bacteria 9360
650 Ga0495592_0136552 3300046454 Bacteria 1710
651 Ga0495592_0149021 3300046454 Bacteria 1620
652 Ga0495590_0028653 3300046457 Bacteria 1953
653 Ga0495629_0000447 3300046459 Bacteria 34326
654 Ga0495629_0016571 3300046459 Bacteria 5290
655 Ga0495629_0016805 3300046459 Bacteria 5251
656 Ga0495638_0028434 3300046460 Bacteria 3611
657 Ga0495641_0001697 3300046461 Bacteria 18404
658 Ga0495641_0015734 3300046461 Bacteria 4019
659 Ga0495641_0027911 3300046461 Bacteria 2737
660 Ga0495651_0002424 3300046462 Bacteria 14396
661 Ga0495651_0038986 3300046462 Bacteria 3699
662 Ga0495653_0000012 3300046463 Bacteria 266880
663 Ga0495653_0003231 3300046463 Bacteria 13066
664 Ga0495653_0006931 3300046463 Bacteria 9309
665 Ga0495653_0078354 3300046463 Bacteria 2451
666 Ga0495580_0006747 3300046472 Bacteria 9313
667 Ga0495580_0085877 3300046472 Bacteria 2191
668 Ga0495582_0007072 3300046473 Bacteria 6234
669 Ga0495582_0010997 3300046473 Bacteria 4982
670 Ga0495582_0013202 3300046473 Bacteria 4545
671 Ga0495639_0006165 3300046475 Bacteria 5148
672 Ga0495662_0003904 3300046476 Bacteria 7520
673 Ga0495662_0010406 3300046476 Bacteria 4557
674 Ga0495664_0000004 3300046477 Bacteria 489411
675 Ga0495664_0009959 3300046477 Bacteria 5332
676 Ga0495664_0105171 3300046477 Bacteria 1702
677 Ga0495584_0002735 3300046491 Bacteria 9877
678 Ga0495584_0056557 3300046491 Bacteria 1974
679 Ga0495585_0003199 3300046492 Bacteria 11181
680 Ga0495585_0073720 3300046492 Bacteria 1858
681 Ga0495594_0013045 3300046499 Bacteria 4333
682 Ga0495594_0021869 3300046499 Bacteria 3416
683 Ga0495607_0029184 3300046501 Bacteria 3397
684 Ga0495608_0000017 3300046511 Bacteria 192929
685 Ga0495618_0000006 3300046514 Bacteria 229906
686 Ga0495628_0000001 3300046516 Bacteria 917742
687 Ga0495628_0009640 3300046516 Bacteria 8239
688 Ga0495628_0019168 3300046516 Bacteria 5658
689 Ga0495628_0035835 3300046516 Bacteria 3985
690 Ga0495630_0008370 3300046517 Bacteria 7424
691 Ga0495637_0042998 3300046520 Bacteria 1931
692 Ga0495644_0002426 3300046523 Bacteria 7434
693 Ga0495666_0001305 3300046526 Bacteria 12056
694 Ga0495652_0000002 3300046529 Bacteria 946606
695 Ga0495652_0018154 3300046529 Bacteria 6278
696 Ga0495665_0004009 3300046531 Bacteria 7939
697 Ga0495665_0025407 3300046531 Bacteria 3182
698 Ga0495640_0000001 3300046533 Bacteria 853827
699 Ga0495640_0017355 3300046533 Bacteria 5366
700 Ga0495586_0007089 3300046535 Bacteria 5973
701 Ga0495587_0000008 3300046536 Bacteria 271097
702 Ga0495587_0001490 3300046536 Bacteria 15605
703 Ga0495598_0001556 3300046537 Bacteria 4597
704 Ga0495645_0000002 3300046543 Bacteria 651644
705 Ga0495645_0000954 3300046543 Bacteria 19779
706 Ga0495645_0050356 3300046543 Bacteria 3032
707 Ga0495633_0014899 3300046558 Bacteria 4044
708 Ga0495667_0000029 3300046559 Bacteria 151568
709 Ga0495667_0014263 3300046559 Bacteria 5367
710 Ga0495667_0043731 3300046559 Bacteria 2967
711 Ga0495656_0000941 3300046615 Bacteria 9423
712 Ga0495634_0006280 3300046642 Bacteria 9051
713 Ga0495634_0035463 3300046642 Bacteria 3416
714 Ga0495634_0058157 3300046642 Bacteria 2578
715 Ga0495611_0005829 3300046648 Bacteria 5256
716 Ga0495635_0000002 3300046663 Bacteria 490490
717 Ga0495635_0013015 3300046663 Bacteria 5824
718 Ga0495588_0000318 3300046674 Bacteria 32296
719 Ga0495588_0012717 3300046674 Bacteria 3987
720 Ga0495588_0029685 3300046674 Bacteria 2745
721 Ga0495657_0000459 3300046675 Bacteria 38116
722 Ga0495657_0086718 3300046675 Bacteria 2016
723 Ga0495599_0000104 3300046678 Bacteria 59442
724 Ga0495599_0001047 3300046678 Bacteria 15552
725 Ga0495599_0034637 3300046678 Bacteria 3171
726 Ga0495623_0000691 3300046679 Bacteria 22400
727 Ga0495623_0003897 3300046679 Bacteria 9840
728 Ga0495646_0000064 3300046680 Bacteria 50992
729 Ga0495646_0005442 3300046680 Bacteria 8047
730 Ga0495646_0006507 3300046680 Bacteria 7412
731 Ga0495647_0001576 3300046681 Bacteria 7039
732 Ga0495658_0007929 3300046683 Bacteria 5258
733 Ga0495658_0008212 3300046683 Bacteria 5170
734 Ga0495658_0008346 3300046683 Bacteria 5130
735 Ga0495658_0035592 3300046683 Bacteria 2741
736 Ga0495613_0000793 3300046689 Bacteria 24573
737 Ga0495613_0047786 3300046689 Bacteria 3161
738 Ga0495624_0023831 3300046690 Bacteria 4032
739 Ga0495600_0000010 3300046809 Bacteria 143675
740 Ga0495600_0032708 3300046809 Bacteria 3375
741 Ga0495581_0002305 3300047315 Bacteria 10746
742 Ga0495604_0000009 3300047317 Bacteria 326341
743 Ga0495604_0003660 3300047317 Bacteria 12247
744 Ga0495604_0017295 3300047317 Bacteria 5770
745 Ga0495604_0017691 3300047317 Bacteria 5705
746 Ga0495674_0000002 3300047319 Bacteria 642785
747 Ga0495674_0042474 3300047319 Bacteria 4055
748 Ga0495674_0080853 3300047319 Bacteria 2788
749 Ga0495676_0084271 3300047321 Bacteria 2398
750 Ga0495676_0178846 3300047321 Bacteria 1488
751 Ga0495680_0000752 3300047322 Bacteria 36296
752 Ga0495680_0014315 3300047322 Bacteria 6877
753 Ga0495680_0014551 3300047322 Bacteria 6811
754 Ga0495680_0022273 3300047322 Bacteria 5284
755 Ga0495680_0028687 3300047322 Bacteria 4562
756 Ga0495675_0000028 3300047444 Bacteria 105848
757 Ga0495675_0026696 3300047444 Bacteria 3682
758 Ga0495684_0000006 3300047471 Bacteria 247568
759 Ga0495684_0003934 3300047471 Bacteria 11578
760 Ga0495593_0008360 3300047673 Bacteria 6022
761 Ga0495602_0000005 3300048088 Bacteria 325957
762 Ga0495602_0000776 3300048088 Bacteria 30394
763 Ga0495602_0002995 3300048088 Bacteria 17317
764 Ga0495614_0004539 3300048089 Bacteria 6257
765 Ga0496100_0002107 3300048903 Bacteria 10021
766 Ga0496100_0008177 3300048903 Bacteria 5824
767 Ga0496100_0008677 3300048903 Bacteria 5676
768 Ga0496100_0010419 3300048903 Bacteria 5260
769 Ga0496100_0057614 3300048903 Bacteria 2545
770 Ga0496101_0002976 3300048904 Bacteria 10437
771 Ga0496101_0005170 3300048904 Bacteria 8300
772 Ga0496101_0005327 3300048904 Bacteria 8192
773 Ga0496101_0028769 3300048904 Bacteria 3882
774 Ga0496101_0045004 3300048904 Bacteria 3159
775 Ga0496101_0099036 3300048904 Bacteria 2179
776 Ga0496102_0008464 3300048905 Bacteria 8820
777 Ga0496102_0009880 3300048905 Bacteria 8205
778 Ga0496102_0017733 3300048905 Bacteria 6241
779 Ga0496102_0024215 3300048905 Bacteria 5395
780 Ga0496102_0029685 3300048905 Bacteria 4893
781 Ga0496102_0097214 3300048905 Bacteria 2731
782 Ga0496103_0001696 3300048906 Bacteria 14405
783 Ga0496103_0005658 3300048906 Bacteria 7469
784 Ga0496103_0005922 3300048906 Bacteria 7307
785 Ga0496103_0011431 3300048906 Bacteria 5262
786 Ga0496103_0036194 3300048906 Bacteria 3022
787 Ga0496103_0076217 3300048906 Bacteria 2104
788 Ga0496104_0000092 3300048907 Bacteria 87232
789 Ga0496104_0004402 3300048907 Bacteria 12265
790 Ga0496104_0013405 3300048907 Bacteria 7385
791 Ga0496104_0033638 3300048907 Bacteria 4777
792 Ga0496104_0069565 3300048907 Bacteria 3345
793 Ga0496104_0112817 3300048907 Bacteria 2607
794 Ga0496104_0269510 3300048907 Bacteria 1615
795 Ga0496105_0001436 3300048908 Bacteria 16761
796 Ga0496105_0001736 3300048908 Bacteria 15574
797 Ga0496105_0002164 3300048908 Bacteria 14224
798 Ga0496105_0002208 3300048908 Bacteria 14097
799 Ga0496105_0018426 3300048908 Bacteria 5611
800 Ga0496105_0125052 3300048908 Bacteria 2120
801 Ga0496105_0125239 3300048908 Bacteria 2118
802 Ga0496106_0003134 3300048909 Bacteria 12340
803 Ga0496106_0006593 3300048909 Bacteria 8594
804 Ga0496106_0019784 3300048909 Bacteria 4992
805 Ga0496106_0026317 3300048909 Bacteria 4330
806 Ga0496106_0043487 3300048909 Bacteria 3370
807 Ga0496106_0149234 3300048909 Bacteria 1843
808 Ga0496107_0000809 3300048910 Bacteria 18171
809 Ga0496107_0003490 3300048910 Bacteria 10516
810 Ga0496107_0007194 3300048910 Bacteria 7667
811 Ga0496107_0012097 3300048910 Bacteria 6018
812 Ga0496107_0013417 3300048910 Bacteria 5726
813 Ga0496107_0026710 3300048910 Bacteria 4095
814 Ga0496107_0029822 3300048910 Bacteria 3884
815 Ga0496108_0003371 3300048911 Bacteria 12827
816 Ga0496108_0005285 3300048911 Bacteria 10421
817 Ga0496108_0012368 3300048911 Bacteria 6944
818 Ga0496108_0014164 3300048911 Bacteria 6506
819 Ga0496108_0082309 3300048911 Bacteria 2729
820 Ga0496108_0090770 3300048911 Bacteria 2597
821 Ga0496108_0097512 3300048911 Bacteria 2505
822 Ga0496109_0000543 3300048912 Bacteria 31945
823 Ga0496109_0016420 3300048912 Bacteria 6472
824 Ga0496109_0026427 3300048912 Bacteria 5177
825 Ga0496109_0031491 3300048912 Bacteria 4759
826 Ga0496109_0118773 3300048912 Bacteria 2461
827 Ga0496109_0200601 3300048912 Bacteria 1875
828 Ga0496110_0004426 3300048913 Bacteria 10885
829 Ga0496110_0015744 3300048913 Bacteria 6301
830 Ga0496110_0053918 3300048913 Bacteria 3536
831 Ga0496110_0112154 3300048913 Bacteria 2451
832 Ga0496110_0190509 3300048913 Bacteria 1862
833 Ga0496111_0000388 3300048914 Bacteria 21996
834 Ga0496111_0002814 3300048914 Bacteria 10601
835 Ga0496111_0010441 3300048914 Bacteria 6231
836 Ga0496111_0012071 3300048914 Bacteria 5841
837 Ga0496111_0028753 3300048914 Bacteria 3940
838 Ga0496112_0003072 3300048915 Bacteria 13667
839 Ga0496112_0009140 3300048915 Bacteria 8904
840 Ga0496112_0014688 3300048915 Bacteria 7278
841 Ga0496112_0061370 3300048915 Bacteria 3705
842 Ga0496112_0195521 3300048915 Bacteria 1983
843 Ga0496113_0000043 3300048916 Bacteria 52544
844 Ga0496113_0003436 3300048916 Bacteria 9480
845 Ga0496113_0004954 3300048916 Bacteria 8248
846 Ga0496113_0015314 3300048916 Bacteria 5266
847 Ga0496113_0047129 3300048916 Bacteria 3202
848 Ga0496113_0133408 3300048916 Bacteria 1950
849 Ga0496113_0189022 3300048916 Bacteria 1634
850 Ga0496114_0003641 3300048917 Bacteria 11847
851 Ga0496114_0013464 3300048917 Bacteria 6558
852 Ga0496114_0023885 3300048917 Bacteria 4988
853 Ga0496114_0040439 3300048917 Bacteria 3860
854 Ga0496114_0052998 3300048917 Bacteria 3381
855 Ga0496115_0009341 3300048918 Bacteria 7286
856 Ga0496115_0018321 3300048918 Bacteria 5373
857 Ga0496115_0046900 3300048918 Bacteria 3455
858 Ga0496115_0054203 3300048918 Bacteria 3220
859 Ga0496115_0109009 3300048918 Bacteria 2273
860 Ga0501031_0022932 3300049568 Bacteria 4071
861 Ga0501032_0028467 3300049569 Bacteria 3839
862 Ga0501032_0049939 3300049569 Bacteria 2821
863 Ga0501033_0011567 3300049570 Bacteria 6751
864 Ga0501033_0017357 3300049570 Bacteria 5439
865 Ga0501033_0038589 3300049570 Bacteria 3569
866 Ga0501034_0006205 3300049571 Bacteria 12870
867 Ga0501034_0008624 3300049571 Bacteria 10756
868 Ga0501034_0018337 3300049571 Bacteria 7180
869 Ga0501034_0086671 3300049571 Bacteria 3132
870 Ga0501034_0105165 3300049571 Bacteria 2816
871 Ga0501034_0157288 3300049571 Bacteria 2246
872 Ga0501034_0304648 3300049571 Bacteria 1529
873 Ga0501036_0000372 3300049572 Bacteria 31588
874 Ga0501036_0017605 3300049572 Bacteria 5977
875 Ga0501036_0025867 3300049572 Bacteria 4952
876 Ga0501036_0055564 3300049572 Bacteria 3354
877 Ga0501037_0008325 3300049573 Bacteria 7601
878 Ga0501037_0020689 3300049573 Bacteria 4858
879 Ga0501037_0020812 3300049573 Bacteria 4843
880 Ga0501037_0026077 3300049573 Bacteria 4319
881 Ga0501038_0017530 3300049574 Bacteria 6472
882 Ga0501038_0026512 3300049574 Bacteria 5161
883 Ga0501038_0031263 3300049574 Bacteria 4705
884 Ga0501038_0062127 3300049574 Bacteria 3192
885 Ga0501038_0096680 3300049574 Bacteria 2464
886 Ga0501039_0015326 3300049575 Bacteria 5867
887 Ga0501043_0005267 3300049579 Bacteria 10454
888 Ga0501043_0023206 3300049579 Bacteria 4866
889 Ga0501043_0030487 3300049579 Bacteria 4239
890 Ga0501046_0066195 3300049580 Bacteria 2817
891 Ga0501046_0066278 3300049580 Bacteria 2814
892 Ga0501047_0000164 3300049581 Bacteria 81200
893 Ga0501047_0025565 3300049581 Bacteria 5676
894 Ga0501047_0079486 3300049581 Bacteria 3153
895 Ga0501047_0087179 3300049581 Bacteria 2999
896 Ga0501047_0109023 3300049581 Bacteria 2651
897 Ga0501047_0110282 3300049581 Bacteria 2634
898 Ga0501048_0003459 3300049582 Bacteria 12003
899 Ga0501067_0006409 3300049583 Bacteria 6519
900 Ga0501069_0000561 3300049585 Bacteria 17113
901 Ga0501070_0003220 3300049586 Bacteria 14202
902 Ga0501070_0020311 3300049586 Bacteria 5572
903 Ga0501070_0020404 3300049586 Bacteria 5560
904 Ga0501070_0021489 3300049586 Bacteria 5414
905 Ga0501070_0022513 3300049586 Bacteria 5278
906 Ga0501070_0035382 3300049586 Bacteria 4173
907 Ga0501070_0044117 3300049586 Bacteria 3711
908 Ga0501070_0143033 3300049586 Bacteria 1975
909 Ga0501070_0162714 3300049586 Bacteria 1839
910 Ga0501071_0054311 3300049587 Bacteria 2891
911 Ga0501072_0065822 3300049588 Bacteria 2858
912 Ga0501072_0147428 3300049588 Bacteria 1876
913 Ga0501073_0026466 3300049589 Bacteria 4156
914 Ga0501074_0014496 3300049590 Bacteria 5735
915 Ga0501074_0016572 3300049590 Bacteria 5349
916 Ga0501074_0184462 3300049590 Bacteria 1488
917 Ga0501075_0044258 3300049591 Bacteria 3340
918 Ga0501076_0118405 3300049592 Bacteria 2144
919 Ga0501076_0167041 3300049592 Bacteria 1794
920 Ga0501077_0025278 3300049593 Bacteria 3772
921 Ga0501079_0004533 3300049741 Bacteria 10304
922 Ga0501079_0047540 3300049741 Bacteria 3310
923 Ga0501079_0047569 3300049741 Bacteria 3309
924 Ga0501079_0096901 3300049741 Bacteria 2287
925 Ga0501080_0000235 3300049742 Bacteria 41534
926 Ga0501080_0043320 3300049742 Bacteria 4191
927 Ga0501080_0048885 3300049742 Bacteria 3935
928 Ga0501081_0034408 3300049743 Bacteria 3447
929 Ga0501083_0016539 3300049744 Bacteria 5159
930 Ga0501083_0022677 3300049744 Bacteria 4356
931 Ga0501083_0066250 3300049744 Bacteria 2405
932 Ga0501035_0016521 3300049822 Bacteria 6805
933 Ga0501035_0046252 3300049822 Bacteria 3914
934 Ga0501044_0000707 3300049823 Bacteria 40284
935 Ga0501044_0004015 3300049823 Bacteria 16492
936 Ga0501044_0033812 3300049823 Bacteria 5368
937 Ga0501044_0043740 3300049823 Bacteria 4651
938 Ga0501044_0127556 3300049823 Bacteria 2540
939 Ga0501044_0144177 3300049823 Bacteria 2368
940 Ga0501044_0293820 3300049823 Bacteria 1556
941 Ga0501044_0310905 3300049823 Bacteria 1502
942 nmdc:mga0yw44_46679_c1 3300050492 Bacteria 2602
943 nmdc:mga0k408_5532_c1 3300050493 Bacteria 6726
944 nmdc:mga06z11_72629_c1 3300050494 Bacteria 1824
945 nmdc:mga05p37_143795_c1 3300050507 Bacteria 2921
946 nmdc:mga05p37_201_c1 3300050507 Bacteria 59705
947 nmdc:mga05p37_309031_c1 3300050507 Bacteria 1875
948 nmdc:mga05p37_44522_c1 3300050507 Bacteria 5460
949 nmdc:mga05p37_62368_c1 3300050507 Bacteria 4587
950 nmdc:mga05p37_6242_c1 3300050507 Bacteria 14032
951 nmdc:mga05p37_66_c1 3300050507 Bacteria 91764
952 nmdc:mga05p37_92206_c1 3300050507 Bacteria 3733
953 nmdc:mga09592_30035_c1 3300050508 Bacteria 4523
954 nmdc:mga09592_7876_c1 3300050508 Bacteria 8660
955 nmdc:mga0qj67_24563_c1 3300050509 Bacteria 4647
956 nmdc:mga0qj67_26699_c1 3300050509 Bacteria 4471
957 nmdc:mga0qj67_512_c1 3300050509 Bacteria 26543
958 nmdc:mga0qj67_7_c1 3300050509 Bacteria 146944
959 nmdc:mga06r32_177654_c1 3300050510 Bacteria 2114
960 nmdc:mga06r32_25746_c1 3300050510 Bacteria 3867
961 nmdc:mga06r32_451_c1 3300050510 Bacteria 34946
962 nmdc:mga06r32_7326_c1 3300050510 Bacteria 9931
963 nmdc:mga06r32_7911_c1 3300050510 Bacteria 9557
964 nmdc:mga08y16_1809_c1 3300050511 Bacteria 21689
965 nmdc:mga08y16_253276_c1 3300050511 Bacteria 1819
966 nmdc:mga08y16_31568_c1 3300050511 Bacteria 5571
967 nmdc:mga08y16_4145_c1 3300050511 Bacteria 15133
968 nmdc:mga08y16_48_c1 3300050511 Bacteria 111306
969 nmdc:mga08y16_56670_c1 3300050511 Bacteria 4095
970 nmdc:mga0n895_43_c1 3300050512 Bacteria 74924
971 nmdc:mga0n895_74467_c1 3300050512 Bacteria 3373
972 nmdc:mga0n895_78577_c1 3300050512 Bacteria 3284
973 nmdc:mga0n895_82465_c1 3300050512 Bacteria 3206
974 nmdc:mga0rr50_21285_c1 3300050513 Bacteria 4423
975 nmdc:mga0rr50_43928_c1 3300050513 Bacteria 3274
976 nmdc:mga0rr50_5412_c1 3300050513 Bacteria 7612
977 nmdc:mga0a205_13273_c1 3300050515 Bacteria 7662
978 nmdc:mga0a205_2982_c1 3300050515 Bacteria 15012
979 nmdc:mga0a205_3268_c1 3300050515 Bacteria 14416
980 Ga0495601_0000002 3300053077 Bacteria 528704
981 Ga0495601_0000107 3300053077 Bacteria 45730
982 Ga0495601_0005039 3300053077 Bacteria 7668
983 Ga0495601_0027688 3300053077 Bacteria 3505
984 Ga0495601_0035231 3300053077 Bacteria 3123
985 Ga0495601_0122728 3300053077 Bacteria 1688
986 Ga0495612_0000010 3300053078 Bacteria 227618
987 Ga0495612_0001623 3300053078 Bacteria 9246
988 Ga0495612_0002221 3300053078 Bacteria 7987
989 Ga0495612_0005028 3300053078 Bacteria 5475
990 Ga0495595_0000777 3300053084 Bacteria 12093
991 Ga0495595_0004037 3300053084 Bacteria 5874
992 Ga0495595_0010557 3300053084 Bacteria 3840
993 Ga0495595_0019908 3300053084 Bacteria 2915
994 Ga0495619_0000019 3300053085 Bacteria 209518
995 Ga0495619_0000045 3300053085 Bacteria 108543
996 Ga0495619_0002374 3300053085 Bacteria 12380
997 Ga0495619_0002899 3300053085 Bacteria 11139
998 Ga0495619_0004604 3300053085 Bacteria 8803
999 Ga0495619_0044260 3300053085 Bacteria 2922
1000 Ga0495619_0110761 3300053085 Bacteria 1876
1001 Ga0500644_0001293 3300053088 Bacteria 6806
1002 Ga0500651_0006213 3300053093 Bacteria 6869
1003 Ga0500595_000002 3300053119 Bacteria 1074388
1004 Ga0500616_0000002 3300053153 Bacteria 1611257
1005 Ga0500616_0007357 3300053153 Bacteria 7014
1006 Ga0500645_000099 3300053730 Bacteria 68426
1007 Ga0501084_0126233 3300054114 Bacteria 2153
1008 Ga0501082_0000074 3300060353 Bacteria 73246
1009 Ga0501082_0040262 3300060353 Bacteria 4031
1010 Ga0501082_0043132 3300060353 Bacteria 3888
1011 Ga0530510_0045710 3300061734 Bacteria 3163

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025933 Ga0207706_10203437 Ga0207706_102034372 401
2 3300049588 Ga0501072_0147428 Ga0501072_0147428_640_1863 406
3 3300049823 Ga0501044_0310905 Ga0501044_0310905_249_1487 409
4 3300035725 Ga0373947_0048954 Ga0373947_0048954_708_2126 410
5 3300037068 Ga0373925_0127647 Ga0373925_0127647_473_1891 410
6 3300046678 Ga0495599_0034637 Ga0495599_0034637_10_1248 410
7 3300048908 Ga0496105_0002164 Ga0496105_0002164_8296_9534 410
8 3300048916 Ga0496113_0189022 Ga0496113_0189022_28_1260 410
9 3300050511 nmdc:mga08y16_253276_c1 nmdc:mga08y16_253276_c1_10_1242 410
10 3300026095 Ga0207676_10048845 Ga0207676_100488453 412
11 3300009094 Ga0111539_10150020 Ga0111539_101500202 422
12 3300026023 Ga0207677_10006260 Ga0207677_100062606 422
13 3300035207 Ga0373942_0003417 Ga0373942_0003417_19_1290 423
14 3300049581 Ga0501047_0079486 Ga0501047_0079486_735_2120 425
15 3300031247 Ga0265340_10021850 Ga0265340_100218501 427
16 3300053088 Ga0500644_0001293 Ga0500644_0001293_1942_3339 427
17 3300053153 Ga0500616_0000002 Ga0500616_0000002_1042204_1043601 427
18 3300053730 Ga0500645_000099 Ga0500645_000099_14264_15661 431
19 3300053093 Ga0500651_0006213 Ga0500651_0006213_4071_5471 433
20 3300005356 Ga0070674_100009547 Ga0070674_1000095474 434
21 3300017792 Ga0163161_10114468 Ga0163161_101144682 434
22 3300026121 Ga0207683_10185428 Ga0207683_101854282 434
23 3300006871 Ga0075434_100007032 Ga0075434_1000070322 435
24 3300027907 Ga0207428_10033074 Ga0207428_100330743 435
25 3300050512 nmdc:mga0n895_82465_c1 nmdc:mga0n895_82465_c1_1763_3160 435
26 3300050515 nmdc:mga0a205_2982_c1 nmdc:mga0a205_2982_c1_13469_14866 435
27 3300006847 Ga0075431_100195337 Ga0075431_1001953372 437
28 3300050510 nmdc:mga06r32_177654_c1 nmdc:mga06r32_177654_c1_231_1598 437
29 3300005340 Ga0070689_100131548 Ga0070689_1001315481 439
30 3300049823 Ga0501044_0000707 Ga0501044_0000707_15253_16695 440
31 3300006871 Ga0075434_100054628 Ga0075434_1000546283 441
32 3300009094 Ga0111539_10051044 Ga0111539_100510442 441
33 3300046477 Ga0495664_0105171 Ga0495664_0105171_153_1532 441
34 3300053077 Ga0495601_0035231 Ga0495601_0035231_789_2168 441
35 3300053084 Ga0495595_0010557 Ga0495595_0010557_806_2185 441
36 3300053085 Ga0495619_0110761 Ga0495619_0110761_257_1636 441
37 3300031595 Ga0265313_10000326 Ga0265313_100003264 445
38 3300046454 Ga0495592_0149021 Ga0495592_0149021_66_1445 446
39 3300025915 Ga0207693_10161096 Ga0207693_101610961 447
40 3300006042 Ga0075368_10014120 Ga0075368_100141202 448
41 3300006178 Ga0075367_10018956 Ga0075367_100189563 448
42 3300025928 Ga0207700_10218925 Ga0207700_102189251 448
43 3300035695 Ga0373927_0054373 Ga0373927_0054373_11_1393 448
44 3300046459 Ga0495629_0016805 Ga0495629_0016805_249_1631 448
45 3300048915 Ga0496112_0195521 Ga0496112_0195521_603_1970 448
46 3300003659 JGI25404J52841_10002701 JGI25404J52841_100027012 450
47 3300005983 Ga0081540_1000007 Ga0081540_100000725 450
48 3300031344 Ga0265316_10024489 Ga0265316_100244894 450
49 3300031595 Ga0265313_10040748 Ga0265313_100407482 450
50 3300054114 Ga0501084_0126233 Ga0501084_0126233_603_2006 450
51 3300061734 Ga0530510_0045710 Ga0530510_0045710_1260_2663 450
52 3300005439 Ga0070711_100051325 Ga0070711_1000513254 452
53 3300049570 Ga0501033_0017357 Ga0501033_0017357_3466_4851 452
54 3300049571 Ga0501034_0105165 Ga0501034_0105165_258_1643 452
55 3300049591 Ga0501075_0044258 Ga0501075_0044258_329_1714 452
56 3300049593 Ga0501077_0025278 Ga0501077_0025278_168_1553 452
57 3300049741 Ga0501079_0004533 Ga0501079_0004533_1684_3069 452
58 3300049743 Ga0501081_0034408 Ga0501081_0034408_1755_3140 452
59 3300060353 Ga0501082_0040262 Ga0501082_0040262_634_2019 452
60 3300049823 Ga0501044_0293820 Ga0501044_0293820_120_1490 453
61 3300005983 Ga0081540_1004024 Ga0081540_10040248 454
62 3300006358 Ga0068871_100251808 Ga0068871_1002518081 454
63 3300006846 Ga0075430_100016809 Ga0075430_1000168093 454
64 3300006847 Ga0075431_100007719 Ga0075431_1000077199 454
65 3300013104 Ga0157370_10150497 Ga0157370_101504972 454
66 3300013308 Ga0157375_10237394 Ga0157375_102373942 454
67 3300035691 Ga0373931_0002975 Ga0373931_0002975_2034_3431 454
68 3300048908 Ga0496105_0125239 Ga0496105_0125239_141_1538 454
69 3300050507 nmdc:mga05p37_62368_c1 nmdc:mga05p37_62368_c1_93_1490 454
70 3300050510 nmdc:mga06r32_7911_c1 nmdc:mga06r32_7911_c1_539_1936 454
71 3300050513 nmdc:mga0rr50_5412_c1 nmdc:mga0rr50_5412_c1_2178_3566 454
72 3300005530 Ga0070679_100139212 Ga0070679_1001392121 455
73 3300005535 Ga0070684_100067827 Ga0070684_1000678272 455
74 3300006846 Ga0075430_100006097 Ga0075430_1000060974 455
75 3300009147 Ga0114129_10016369 Ga0114129_100163696 455
76 3300009551 Ga0105238_10054673 Ga0105238_100546734 455
77 3300013100 Ga0157373_10111698 Ga0157373_101116982 455
78 3300013307 Ga0157372_10121031 Ga0157372_101210312 455
79 3300021384 Ga0213876_10025328 Ga0213876_100253283 455
80 3300025915 Ga0207693_10027450 Ga0207693_100274502 455
81 3300025929 Ga0207664_10183287 Ga0207664_101832871 455
82 3300025939 Ga0207665_10056180 Ga0207665_100561802 455
83 3300039437 Ga0436365_0349099 Ga0436365_0349099_553_1926 455
84 3300050507 nmdc:mga05p37_143795_c1 nmdc:mga05p37_143795_c1_1058_2446 455
85 3300050509 nmdc:mga0qj67_7_c1 nmdc:mga0qj67_7_c1_118818_120218 455
86 iso_pu_bacteria 2643221547 2643757269 455
87 iso_pu_bacteria 2889914905 2889918179 455
88 3300025936 Ga0207670_10170453 Ga0207670_101704532 456
89 3300035692 Ga0373935_0057106 Ga0373935_0057106_11_1387 456
90 3300039437 Ga0436365_1169665 Ga0436365_1169665_148_1545 456
91 3300049586 Ga0501070_0003220 Ga0501070_0003220_2172_3551 456
92 3300049586 Ga0501070_0020404 Ga0501070_0020404_1832_3214 456
93 3300049587 Ga0501071_0054311 Ga0501071_0054311_862_2244 456
94 3300049590 Ga0501074_0184462 Ga0501074_0184462_54_1436 456
95 3300050494 nmdc:mga06z11_72629_c1 nmdc:mga06z11_72629_c1_10_1386 456
96 3300005347 Ga0070668_100092303 Ga0070668_1000923032 457
97 3300005355 Ga0070671_100031446 Ga0070671_1000314463 457
98 3300005356 Ga0070674_100027485 Ga0070674_1000274853 457
99 3300005618 Ga0068864_100042649 Ga0068864_1000426493 457
100 3300005981 Ga0081538_10059304 Ga0081538_100593042 457
101 3300009176 Ga0105242_10069916 Ga0105242_100699162 457
102 3300014325 Ga0163163_10093775 Ga0163163_100937752 457
103 3300025903 Ga0207680_10001283 Ga0207680_100012837 457
104 3300025903 Ga0207680_10092650 Ga0207680_100926502 457
105 3300025907 Ga0207645_10059737 Ga0207645_100597372 457
106 3300025908 Ga0207643_10031046 Ga0207643_100310462 457
107 3300025931 Ga0207644_10092872 Ga0207644_100928722 457
108 3300025932 Ga0207690_10137132 Ga0207690_101371322 457
109 3300025936 Ga0207670_10003054 Ga0207670_100030542 457
110 3300025937 Ga0207669_10031185 Ga0207669_100311852 457
111 3300025972 Ga0207668_10109409 Ga0207668_101094092 457
112 3300031241 Ga0265325_10004094 Ga0265325_1000409410 457
113 3300031249 Ga0265339_10001513 Ga0265339_100015138 457
114 3300031595 Ga0265313_10008870 Ga0265313_100088705 457
115 3300035088 Ga0373940_0012296 Ga0373940_0012296_75_1454 457
116 3300035121 Ga0373960_0003571 Ga0373960_0003571_106_1485 457
117 3300035207 Ga0373942_0009249 Ga0373942_0009249_243_1622 457
118 3300035691 Ga0373931_0007918 Ga0373931_0007918_1890_3269 457
119 3300048903 Ga0496100_0010419 Ga0496100_0010419_839_2218 457
120 3300048910 Ga0496107_0003490 Ga0496107_0003490_4096_5475 457
121 3300048911 Ga0496108_0082309 Ga0496108_0082309_51_1430 457
122 3300048912 Ga0496109_0200601 Ga0496109_0200601_171_1550 457
123 3300048913 Ga0496110_0053918 Ga0496110_0053918_1526_2905 457
124 3300048916 Ga0496113_0133408 Ga0496113_0133408_22_1401 457
125 3300049571 Ga0501034_0304648 Ga0501034_0304648_128_1519 457
126 3300049589 Ga0501073_0026466 Ga0501073_0026466_74_1465 457
127 3300049592 Ga0501076_0118405 Ga0501076_0118405_375_1757 457
128 3300049744 Ga0501083_0016539 Ga0501083_0016539_2035_3435 457
129 3300005336 Ga0070680_100019164 Ga0070680_1000191644 458
130 3300005458 Ga0070681_10001525 Ga0070681_1000152519 458
131 3300005530 Ga0070679_100012735 Ga0070679_1000127354 458
132 3300006042 Ga0075368_10005879 Ga0075368_100058792 458
133 3300006353 Ga0075370_10042438 Ga0075370_100424382 458
134 3300009147 Ga0114129_10233598 Ga0114129_102335981 458
135 3300014326 Ga0157380_10195500 Ga0157380_101955002 458
136 3300025917 Ga0207660_10092613 Ga0207660_100926132 458
137 3300025921 Ga0207652_10067950 Ga0207652_100679502 458
138 3300049569 Ga0501032_0049939 Ga0501032_0049939_349_1734 458
139 3300049570 Ga0501033_0038589 Ga0501033_0038589_1809_3194 458
140 3300049572 Ga0501036_0055564 Ga0501036_0055564_857_2242 458
141 3300049573 Ga0501037_0026077 Ga0501037_0026077_566_1951 458
142 3300049574 Ga0501038_0031263 Ga0501038_0031263_168_1547 458
143 3300049579 Ga0501043_0030487 Ga0501043_0030487_77_1456 458
144 3300049580 Ga0501046_0066278 Ga0501046_0066278_1300_2685 458
145 3300049581 Ga0501047_0110282 Ga0501047_0110282_684_2069 458
146 3300049583 Ga0501067_0006409 Ga0501067_0006409_1260_2645 458
147 3300049585 Ga0501069_0000561 Ga0501069_0000561_12584_13969 458
148 3300049586 Ga0501070_0022513 Ga0501070_0022513_3362_4747 458
149 3300049590 Ga0501074_0014496 Ga0501074_0014496_1511_2935 458
150 3300049592 Ga0501076_0167041 Ga0501076_0167041_46_1425 458
151 3300049741 Ga0501079_0047540 Ga0501079_0047540_508_1932 458
152 3300049741 Ga0501079_0096901 Ga0501079_0096901_683_2068 458
153 3300049744 Ga0501083_0022677 Ga0501083_0022677_1422_2801 458
154 3300049744 Ga0501083_0066250 Ga0501083_0066250_121_1506 458
155 3300060353 Ga0501082_0043132 Ga0501082_0043132_1016_2395 458
156 3300006847 Ga0075431_100149874 Ga0075431_1001498742 459
157 3300031235 Ga0265330_10047685 Ga0265330_100476852 459
158 3300031241 Ga0265325_10000234 Ga0265325_1000023436 459
159 3300035241 Ga0373961_0032726 Ga0373961_0032726_61_1446 459
160 3300049571 Ga0501034_0086671 Ga0501034_0086671_1445_2833 459
161 3300050510 nmdc:mga06r32_25746_c1 nmdc:mga06r32_25746_c1_972_2363 460
162 3300005328 Ga0070676_10041250 Ga0070676_100412502 461
163 3300005334 Ga0068869_100035836 Ga0068869_1000358362 461
164 3300005338 Ga0068868_100006452 Ga0068868_1000064528 461
165 3300005340 Ga0070689_100043276 Ga0070689_1000432762 461
166 3300005341 Ga0070691_10019580 Ga0070691_100195802 461
167 3300005343 Ga0070687_100006831 Ga0070687_1000068314 461
168 3300005347 Ga0070668_100051371 Ga0070668_1000513712 461
169 3300005366 Ga0070659_100039712 Ga0070659_1000397123 461
170 3300005438 Ga0070701_10022612 Ga0070701_100226122 461
171 3300005441 Ga0070700_100010471 Ga0070700_1000104712 461
172 3300005466 Ga0070685_10007517 Ga0070685_100075174 461
173 3300005530 Ga0070679_100054193 Ga0070679_1000541933 461
174 3300005535 Ga0070684_100076688 Ga0070684_1000766882 461
175 3300005544 Ga0070686_100016714 Ga0070686_1000167142 461
176 3300005578 Ga0068854_100063690 Ga0068854_1000636902 461
177 3300005615 Ga0070702_100084461 Ga0070702_1000844612 461
178 3300005616 Ga0068852_100063725 Ga0068852_1000637253 461
179 3300005617 Ga0068859_100038671 Ga0068859_1000386712 461
180 3300005618 Ga0068864_100157672 Ga0068864_1001576722 461
181 3300005718 Ga0068866_10006999 Ga0068866_100069992 461
182 3300005841 Ga0068863_100075045 Ga0068863_1000750453 461
183 3300005842 Ga0068858_100006251 Ga0068858_1000062519 461
184 3300005844 Ga0068862_100039768 Ga0068862_1000397684 461
185 3300005981 Ga0081538_10081004 Ga0081538_100810041 461
186 3300006358 Ga0068871_100065268 Ga0068871_1000652682 461
187 3300006844 Ga0075428_100000740 Ga0075428_1000007409 461
188 3300006847 Ga0075431_100000870 Ga0075431_10000087024 461
189 3300006880 Ga0075429_100004032 Ga0075429_1000040322 461
190 3300006931 Ga0097620_100038673 Ga0097620_1000386735 461
191 3300009094 Ga0111539_10005127 Ga0111539_100051276 461
192 3300009101 Ga0105247_10016894 Ga0105247_100168943 461
193 3300009147 Ga0114129_10000025 Ga0114129_100000256 461
194 3300009147 Ga0114129_10019966 Ga0114129_100199662 461
195 3300009148 Ga0105243_10031611 Ga0105243_100316114 461
196 3300009176 Ga0105242_10041795 Ga0105242_100417953 461
197 3300009177 Ga0105248_10315006 Ga0105248_103150062 461
198 3300009545 Ga0105237_10043192 Ga0105237_100431924 461
199 3300010375 Ga0105239_10038572 Ga0105239_100385725 461
200 3300011119 Ga0105246_10117462 Ga0105246_101174622 461
201 3300013296 Ga0157374_10013309 Ga0157374_100133092 461
202 3300013297 Ga0157378_10020673 Ga0157378_100206733 461
203 3300013308 Ga0157375_10053687 Ga0157375_100536874 461
204 3300014326 Ga0157380_10065721 Ga0157380_100657213 461
205 3300014968 Ga0157379_10064966 Ga0157379_100649662 461
206 3300014969 Ga0157376_10204657 Ga0157376_102046572 461
207 3300025899 Ga0207642_10039428 Ga0207642_100394282 461
208 3300025900 Ga0207710_10035227 Ga0207710_100352271 461
209 3300025901 Ga0207688_10000998 Ga0207688_1000099811 461
210 3300025904 Ga0207647_10011089 Ga0207647_100110894 461
211 3300025907 Ga0207645_10023155 Ga0207645_100231553 461
212 3300025908 Ga0207643_10004896 Ga0207643_100048963 461
213 3300025918 Ga0207662_10064039 Ga0207662_100640392 461
214 3300025927 Ga0207687_10017936 Ga0207687_100179365 461
215 3300025931 Ga0207644_10025194 Ga0207644_100251944 461
216 3300025933 Ga0207706_10007881 Ga0207706_100078814 461
217 3300025934 Ga0207686_10017951 Ga0207686_100179512 461
218 3300025935 Ga0207709_10102649 Ga0207709_101026492 461
219 3300025937 Ga0207669_10017896 Ga0207669_100178963 461
220 3300025938 Ga0207704_10174333 Ga0207704_101743331 461
221 3300025942 Ga0207689_10022711 Ga0207689_100227114 461
222 3300025960 Ga0207651_10008897 Ga0207651_100088974 461
223 3300025972 Ga0207668_10055993 Ga0207668_100559932 461
224 3300025981 Ga0207640_10043680 Ga0207640_100436802 461
225 3300025986 Ga0207658_10008052 Ga0207658_100080526 461
226 3300026067 Ga0207678_10011488 Ga0207678_100114884 461
227 3300026075 Ga0207708_10004901 Ga0207708_100049014 461
228 3300026078 Ga0207702_10068697 Ga0207702_100686972 461
229 3300026088 Ga0207641_10011257 Ga0207641_100112575 461
230 3300026089 Ga0207648_10016984 Ga0207648_100169844 461
231 3300026118 Ga0207675_100005453 Ga0207675_1000054536 461
232 3300026121 Ga0207683_10018096 Ga0207683_100180965 461
233 3300026142 Ga0207698_10024746 Ga0207698_100247462 461
234 3300027907 Ga0207428_10004572 Ga0207428_1000457211 461
235 3300028380 Ga0268265_10012344 Ga0268265_100123444 461
236 3300028381 Ga0268264_10081157 Ga0268264_100811572 461
237 3300046457 Ga0495590_0028653 Ga0495590_0028653_30_1451 461
238 3300048903 Ga0496100_0057614 Ga0496100_0057614_765_2186 461
239 3300048904 Ga0496101_0028769 Ga0496101_0028769_1568_2989 461
240 3300048905 Ga0496102_0029685 Ga0496102_0029685_2486_3907 461
241 3300048907 Ga0496104_0033638 Ga0496104_0033638_451_1872 461
242 3300048908 Ga0496105_0018426 Ga0496105_0018426_2771_4192 461
243 3300048909 Ga0496106_0019784 Ga0496106_0019784_87_1508 461
244 3300048910 Ga0496107_0029822 Ga0496107_0029822_1024_2445 461
245 3300048911 Ga0496108_0012368 Ga0496108_0012368_1440_2861 461
246 3300048913 Ga0496110_0004426 Ga0496110_0004426_5406_6827 461
247 3300048914 Ga0496111_0010441 Ga0496111_0010441_2119_3540 461
248 3300048916 Ga0496113_0003436 Ga0496113_0003436_5456_6877 461
249 3300048917 Ga0496114_0023885 Ga0496114_0023885_574_1995 461
250 3300048918 Ga0496115_0018321 Ga0496115_0018321_2092_3513 461
251 3300049569 Ga0501032_0028467 Ga0501032_0028467_23_1411 461
252 3300049571 Ga0501034_0006205 Ga0501034_0006205_4979_6370 461
253 3300049571 Ga0501034_0008624 Ga0501034_0008624_4768_6168 461
254 3300049571 Ga0501034_0157288 Ga0501034_0157288_806_2206 461
255 3300049572 Ga0501036_0000372 Ga0501036_0000372_13352_14752 461
256 3300049573 Ga0501037_0008325 Ga0501037_0008325_1431_2831 461
257 3300049573 Ga0501037_0020689 Ga0501037_0020689_2322_3710 461
258 3300049574 Ga0501038_0017530 Ga0501038_0017530_4052_5440 461
259 3300049574 Ga0501038_0026512 Ga0501038_0026512_1231_2691 461
260 3300049579 Ga0501043_0005267 Ga0501043_0005267_6877_8277 461
261 3300049579 Ga0501043_0023206 Ga0501043_0023206_1269_2657 461
262 3300049580 Ga0501046_0066195 Ga0501046_0066195_188_1612 461
263 3300049581 Ga0501047_0000164 Ga0501047_0000164_52359_53759 461
264 3300049581 Ga0501047_0025565 Ga0501047_0025565_2265_3653 461
265 3300049581 Ga0501047_0109023 Ga0501047_0109023_170_1594 461
266 3300049582 Ga0501048_0003459 Ga0501048_0003459_4613_6013 461
267 3300049586 Ga0501070_0021489 Ga0501070_0021489_2524_3984 461
268 3300049586 Ga0501070_0035382 Ga0501070_0035382_365_1765 461
269 3300049586 Ga0501070_0143033 Ga0501070_0143033_86_1474 461
270 3300049586 Ga0501070_0162714 Ga0501070_0162714_289_1677 461
271 3300049588 Ga0501072_0065822 Ga0501072_0065822_790_2178 461
272 3300049590 Ga0501074_0016572 Ga0501074_0016572_1737_3125 461
273 3300049741 Ga0501079_0047569 Ga0501079_0047569_1134_2522 461
274 3300049742 Ga0501080_0000235 Ga0501080_0000235_25427_26827 461
275 3300049742 Ga0501080_0043320 Ga0501080_0043320_1029_2417 461
276 3300049742 Ga0501080_0048885 Ga0501080_0048885_2307_3767 461
277 3300049822 Ga0501035_0046252 Ga0501035_0046252_169_1629 461
278 3300049823 Ga0501044_0004015 Ga0501044_0004015_7246_8646 461
279 3300049823 Ga0501044_0043740 Ga0501044_0043740_2632_4056 461
280 3300049823 Ga0501044_0127556 Ga0501044_0127556_762_2150 461
281 3300050507 nmdc:mga05p37_201_c1 nmdc:mga05p37_201_c1_22781_24187 461
282 3300050507 nmdc:mga05p37_44522_c1 nmdc:mga05p37_44522_c1_3644_5047 461
283 3300050508 nmdc:mga09592_30035_c1 nmdc:mga09592_30035_c1_2214_3620 461
284 3300050509 nmdc:mga0qj67_26699_c1 nmdc:mga0qj67_26699_c1_72_1478 461
285 3300050510 nmdc:mga06r32_451_c1 nmdc:mga06r32_451_c1_28831_30237 461
286 3300050511 nmdc:mga08y16_48_c1 nmdc:mga08y16_48_c1_9532_10938 461
287 2209111006 2214745202 2213754632 462
288 3300000042 ARSoilYngRDRAFT_c00086 ARSoilYngRDRAFT_000863 462
289 3300000043 ARcpr5yngRDRAFT_c000084 ARcpr5yngRDRAFT_00008418 462
290 3300000044 ARSoilOldRDRAFT_c000050 ARSoilOldRDRAFT_00005026 462
291 3300000652 ARCol0yngRDRAFT_1000023 ARCol0yngRDRAFT_100002326 462
292 3300001989 JGI24739J22299_10000209 JGI24739J22299_1000020920 462
293 3300001989 JGI24739J22299_10002430 JGI24739J22299_100024306 462
294 3300001990 JGI24737J22298_10000739 JGI24737J22298_1000073911 462
295 3300001990 JGI24737J22298_10003173 JGI24737J22298_100031736 462
296 3300002070 JGI24750J21931_1000551 JGI24750J21931_10005513 462
297 3300002074 JGI24748J21848_1000695 JGI24748J21848_10006953 462
298 3300002075 JGI24738J21930_10001189 JGI24738J21930_100011894 462
299 3300002076 JGI24749J21850_1000283 JGI24749J21850_10002838 462
300 3300002077 JGI24744J21845_10000810 JGI24744J21845_100008106 462
301 3300002126 JGI24035J26624_1000365 JGI24035J26624_10003653 462
302 3300002244 JGI24742J22300_10000279 JGI24742J22300_100002793 462
303 3300003215 JGI25153J46596_10004383 JGI25153J46596_100043836 462
304 3300005288 Ga0065714_10095322 Ga0065714_100953221 462
305 3300005289 Ga0065704_10073133 Ga0065704_100731337 462
306 3300005290 Ga0065712_10070789 Ga0065712_100707896 462
307 3300005293 Ga0065715_10000519 Ga0065715_100005194 462
308 3300005293 Ga0065715_10004456 Ga0065715_100044563 462
309 3300005328 Ga0070676_10002633 Ga0070676_100026333 462
310 3300005329 Ga0070683_100010864 Ga0070683_1000108647 462
311 3300005329 Ga0070683_100035491 Ga0070683_1000354913 462
312 3300005330 Ga0070690_100001459 Ga0070690_10000145912 462
313 3300005331 Ga0070670_100012949 Ga0070670_1000129495 462
314 3300005331 Ga0070670_100027821 Ga0070670_1000278211 462
315 3300005333 Ga0070677_10000109 Ga0070677_1000010911 462
316 3300005334 Ga0068869_100004148 Ga0068869_1000041483 462
317 3300005334 Ga0068869_100146055 Ga0068869_1001460552 462
318 3300005336 Ga0070680_100018038 Ga0070680_1000180383 462
319 3300005336 Ga0070680_100063179 Ga0070680_1000631792 462
320 3300005337 Ga0070682_100000459 Ga0070682_10000045922 462
321 3300005337 Ga0070682_100034055 Ga0070682_1000340553 462
322 3300005337 Ga0070682_100040299 Ga0070682_1000402992 462
323 3300005338 Ga0068868_100000443 Ga0068868_10000044327 462
324 3300005339 Ga0070660_100034923 Ga0070660_1000349233 462
325 3300005339 Ga0070660_100046626 Ga0070660_1000466262 462
326 3300005340 Ga0070689_100000423 Ga0070689_10000042315 462
327 3300005340 Ga0070689_100001662 Ga0070689_1000016624 462
328 3300005340 Ga0070689_100020869 Ga0070689_1000208693 462
329 3300005341 Ga0070691_10001927 Ga0070691_100019277 462
330 3300005341 Ga0070691_10011614 Ga0070691_100116143 462
331 3300005341 Ga0070691_10011885 Ga0070691_100118852 462
332 3300005343 Ga0070687_100000706 Ga0070687_1000007068 462
333 3300005343 Ga0070687_100005176 Ga0070687_1000051765 462
334 3300005343 Ga0070687_100022617 Ga0070687_1000226173 462
335 3300005344 Ga0070661_100001619 Ga0070661_1000016193 462
336 3300005345 Ga0070692_10000262 Ga0070692_1000026210 462
337 3300005345 Ga0070692_10046098 Ga0070692_100460981 462
338 3300005347 Ga0070668_100001027 Ga0070668_10000102711 462
339 3300005353 Ga0070669_100002329 Ga0070669_1000023293 462
340 3300005353 Ga0070669_100064546 Ga0070669_1000645462 462
341 3300005354 Ga0070675_100040634 Ga0070675_1000406343 462
342 3300005355 Ga0070671_100017038 Ga0070671_1000170382 462
343 3300005355 Ga0070671_100019919 Ga0070671_1000199192 462
344 3300005356 Ga0070674_100001251 Ga0070674_10000125113 462
345 3300005356 Ga0070674_100043841 Ga0070674_1000438411 462
346 3300005364 Ga0070673_100000050 Ga0070673_10000005045 462
347 3300005364 Ga0070673_100006576 Ga0070673_1000065764 462
348 3300005364 Ga0070673_100016705 Ga0070673_1000167053 462
349 3300005365 Ga0070688_100001640 Ga0070688_1000016409 462
350 3300005365 Ga0070688_100007074 Ga0070688_1000070742 462
351 3300005365 Ga0070688_100036737 Ga0070688_1000367372 462
352 3300005366 Ga0070659_100012533 Ga0070659_1000125333 462
353 3300005366 Ga0070659_100037940 Ga0070659_1000379402 462
354 3300005366 Ga0070659_100042832 Ga0070659_1000428322 462
355 3300005367 Ga0070667_100006734 Ga0070667_1000067347 462
356 3300005367 Ga0070667_100015429 Ga0070667_1000154292 462
357 3300005367 Ga0070667_100033083 Ga0070667_1000330832 462
358 3300005406 Ga0070703_10001729 Ga0070703_100017293 462
359 3300005406 Ga0070703_10002210 Ga0070703_100022102 462
360 3300005434 Ga0070709_10000525 Ga0070709_1000052512 462
361 3300005435 Ga0070714_100005095 Ga0070714_1000050953 462
362 3300005436 Ga0070713_100001754 Ga0070713_1000017545 462
363 3300005436 Ga0070713_100178398 Ga0070713_1001783981 462
364 3300005437 Ga0070710_10001598 Ga0070710_1000159810 462
365 3300005437 Ga0070710_10069031 Ga0070710_100690312 462
366 3300005438 Ga0070701_10000093 Ga0070701_100000935 462
367 3300005438 Ga0070701_10021819 Ga0070701_100218192 462
368 3300005439 Ga0070711_100016501 Ga0070711_1000165012 462
369 3300005440 Ga0070705_100003411 Ga0070705_1000034114 462
370 3300005440 Ga0070705_100009540 Ga0070705_1000095403 462
371 3300005440 Ga0070705_100101189 Ga0070705_1001011892 462
372 3300005441 Ga0070700_100009936 Ga0070700_1000099363 462
373 3300005441 Ga0070700_100014595 Ga0070700_1000145952 462
374 3300005441 Ga0070700_100016882 Ga0070700_1000168822 462
375 3300005444 Ga0070694_100009576 Ga0070694_1000095762 462
376 3300005444 Ga0070694_100019701 Ga0070694_1000197013 462
377 3300005455 Ga0070663_100030724 Ga0070663_1000307242 462
378 3300005455 Ga0070663_100090611 Ga0070663_1000906111 462
379 3300005456 Ga0070678_100001756 Ga0070678_1000017567 462
380 3300005456 Ga0070678_100015618 Ga0070678_1000156183 462
381 3300005456 Ga0070678_100133004 Ga0070678_1001330042 462
382 3300005457 Ga0070662_100003987 Ga0070662_1000039872 462
383 3300005457 Ga0070662_100009135 Ga0070662_1000091354 462
384 3300005458 Ga0070681_10001623 Ga0070681_100016237 462
385 3300005458 Ga0070681_10030838 Ga0070681_100308384 462
386 3300005458 Ga0070681_10149529 Ga0070681_101495291 462
387 3300005459 Ga0068867_100001138 Ga0068867_10000113813 462
388 3300005459 Ga0068867_100012280 Ga0068867_1000122804 462
389 3300005459 Ga0068867_100035703 Ga0068867_1000357032 462
390 3300005466 Ga0070685_10000984 Ga0070685_100009848 462
391 3300005466 Ga0070685_10017650 Ga0070685_100176503 462
392 3300005466 Ga0070685_10029019 Ga0070685_100290192 462
393 3300005518 Ga0070699_100001809 Ga0070699_1000018093 462
394 3300005530 Ga0070679_100091379 Ga0070679_1000913792 462
395 3300005535 Ga0070684_100029522 Ga0070684_1000295223 462
396 3300005535 Ga0070684_100035117 Ga0070684_1000351174 462
397 3300005535 Ga0070684_100086779 Ga0070684_1000867792 462
398 3300005535 Ga0070684_100090738 Ga0070684_1000907381 462
399 3300005539 Ga0068853_100002995 Ga0068853_1000029956 462
400 3300005539 Ga0068853_100073321 Ga0068853_1000733213 462
401 3300005543 Ga0070672_100003943 Ga0070672_1000039434 462
402 3300005544 Ga0070686_100009031 Ga0070686_1000090315 462
403 3300005544 Ga0070686_100021350 Ga0070686_1000213503 462
404 3300005545 Ga0070695_100000824 Ga0070695_1000008247 462
405 3300005545 Ga0070695_100002921 Ga0070695_1000029216 462
406 3300005545 Ga0070695_100017465 Ga0070695_1000174653 462
407 3300005546 Ga0070696_100000856 Ga0070696_10000085616 462
408 3300005547 Ga0070693_100001975 Ga0070693_1000019753 462
409 3300005548 Ga0070665_100244531 Ga0070665_1002445311 462
410 3300005549 Ga0070704_100002335 Ga0070704_1000023355 462
411 3300005549 Ga0070704_100002836 Ga0070704_1000028365 462
412 3300005549 Ga0070704_100006569 Ga0070704_1000065693 462
413 3300005549 Ga0070704_100039281 Ga0070704_1000392812 462
414 3300005563 Ga0068855_100015755 Ga0068855_1000157552 462
415 3300005564 Ga0070664_100024583 Ga0070664_1000245831 462
416 3300005564 Ga0070664_100037892 Ga0070664_1000378923 462
417 3300005564 Ga0070664_100079318 Ga0070664_1000793182 462
418 3300005577 Ga0068857_100008305 Ga0068857_1000083052 462
419 3300005577 Ga0068857_100043792 Ga0068857_1000437923 462
420 3300005578 Ga0068854_100003868 Ga0068854_1000038688 462
421 3300005578 Ga0068854_100015449 Ga0068854_1000154493 462
422 3300005578 Ga0068854_100072375 Ga0068854_1000723752 462
423 3300005614 Ga0068856_100003821 Ga0068856_10000382116 462
424 3300005614 Ga0068856_100058666 Ga0068856_1000586663 462
425 3300005615 Ga0070702_100000497 Ga0070702_1000004974 462
426 3300005615 Ga0070702_100006109 Ga0070702_1000061093 462
427 3300005616 Ga0068852_100001222 Ga0068852_1000012224 462
428 3300005617 Ga0068859_100021148 Ga0068859_1000211483 462
429 3300005617 Ga0068859_100023550 Ga0068859_1000235503 462
430 3300005617 Ga0068859_100025814 Ga0068859_1000258143 462
431 3300005617 Ga0068859_100034357 Ga0068859_1000343573 462
432 3300005618 Ga0068864_100001074 Ga0068864_10000107411 462
433 3300005618 Ga0068864_100006339 Ga0068864_1000063398 462
434 3300005618 Ga0068864_100012258 Ga0068864_1000122586 462
435 3300005618 Ga0068864_100048003 Ga0068864_1000480033 462
436 3300005718 Ga0068866_10005659 Ga0068866_100056592 462
437 3300005718 Ga0068866_10068047 Ga0068866_100680472 462
438 3300005719 Ga0068861_100001328 Ga0068861_1000013286 462
439 3300005719 Ga0068861_100016726 Ga0068861_1000167264 462
440 3300005719 Ga0068861_100017632 Ga0068861_1000176324 462
441 3300005840 Ga0068870_10000051 Ga0068870_1000005120 462
442 3300005840 Ga0068870_10015842 Ga0068870_100158423 462
443 3300005841 Ga0068863_100008364 Ga0068863_1000083648 462
444 3300005841 Ga0068863_100013387 Ga0068863_1000133874 462
445 3300005841 Ga0068863_100026590 Ga0068863_1000265903 462
446 3300005842 Ga0068858_100005147 Ga0068858_10000514712 462
447 3300005842 Ga0068858_100034414 Ga0068858_1000344144 462
448 3300005842 Ga0068858_100092885 Ga0068858_1000928852 462
449 3300005843 Ga0068860_100001825 Ga0068860_10000182517 462
450 3300005843 Ga0068860_100008760 Ga0068860_1000087607 462
451 3300005843 Ga0068860_100010661 Ga0068860_1000106616 462
452 3300005843 Ga0068860_100023546 Ga0068860_1000235463 462
453 3300005843 Ga0068860_100104445 Ga0068860_1001044451 462
454 3300005843 Ga0068860_100144787 Ga0068860_1001447872 462
455 3300005844 Ga0068862_100001949 Ga0068862_1000019493 462
456 3300005844 Ga0068862_100016670 Ga0068862_1000166703 462
457 3300005937 Ga0081455_10000081 Ga0081455_1000008122 462
458 3300005937 Ga0081455_10002198 Ga0081455_100021988 462
459 3300006038 Ga0075365_10126900 Ga0075365_101269002 462
460 3300006163 Ga0070715_10000551 Ga0070715_100005512 462
461 3300006173 Ga0070716_100001287 Ga0070716_1000012877 462
462 3300006175 Ga0070712_100004737 Ga0070712_1000047375 462
463 3300006194 Ga0075427_10000603 Ga0075427_100006032 462
464 3300006195 Ga0075366_10012326 Ga0075366_100123262 462
465 3300006237 Ga0097621_100001496 Ga0097621_1000014963 462
466 3300006358 Ga0068871_100003134 Ga0068871_1000031344 462
467 3300006358 Ga0068871_100023904 Ga0068871_1000239043 462
468 3300006358 Ga0068871_100081876 Ga0068871_1000818762 462
469 3300006844 Ga0075428_100024539 Ga0075428_1000245392 462
470 3300006846 Ga0075430_100013350 Ga0075430_1000133503 462
471 3300006847 Ga0075431_100001076 Ga0075431_1000010763 462
472 3300006847 Ga0075431_100042948 Ga0075431_1000429484 462
473 3300006852 Ga0075433_10000012 Ga0075433_100000124 462
474 3300006852 Ga0075433_10025668 Ga0075433_100256683 462
475 3300006871 Ga0075434_100003201 Ga0075434_1000032013 462
476 3300006871 Ga0075434_100008056 Ga0075434_1000080563 462
477 3300006871 Ga0075434_100012519 Ga0075434_1000125194 462
478 3300006880 Ga0075429_100000098 Ga0075429_10000009827 462
479 3300006881 Ga0068865_100003854 Ga0068865_1000038543 462
480 3300006881 Ga0068865_100016325 Ga0068865_1000163253 462
481 3300006931 Ga0097620_100021146 Ga0097620_1000211465 462
482 3300006931 Ga0097620_100023550 Ga0097620_1000235503 462
483 3300006931 Ga0097620_100025814 Ga0097620_1000258144 462
484 3300006931 Ga0097620_100034355 Ga0097620_1000343553 462
485 3300007076 Ga0075435_100028671 Ga0075435_1000286712 462
486 3300007076 Ga0075435_100069072 Ga0075435_1000690722 462
487 3300009092 Ga0105250_10040014 Ga0105250_100400142 462
488 3300009094 Ga0111539_10000757 Ga0111539_1000075729 462
489 3300009094 Ga0111539_10001671 Ga0111539_1000167127 462
490 3300009094 Ga0111539_10008480 Ga0111539_100084803 462
491 3300009094 Ga0111539_10100128 Ga0111539_101001282 462
492 3300009098 Ga0105245_10002488 Ga0105245_1000248812 462
493 3300009098 Ga0105245_10050094 Ga0105245_100500942 462
494 3300009098 Ga0105245_10182552 Ga0105245_101825522 462
495 3300009101 Ga0105247_10006103 Ga0105247_100061036 462
496 3300009101 Ga0105247_10008404 Ga0105247_100084043 462
497 3300009101 Ga0105247_10036684 Ga0105247_100366842 462
498 3300009147 Ga0114129_10008949 Ga0114129_100089492 462
499 3300009147 Ga0114129_10023567 Ga0114129_100235677 462
500 3300009147 Ga0114129_10050640 Ga0114129_100506403 462
501 3300009148 Ga0105243_10003214 Ga0105243_1000321411 462
502 3300009148 Ga0105243_10009303 Ga0105243_100093033 462
503 3300009174 Ga0105241_10004876 Ga0105241_100048766 462
504 3300009174 Ga0105241_10005826 Ga0105241_100058265 462
505 3300009174 Ga0105241_10065776 Ga0105241_100657762 462
506 3300009176 Ga0105242_10002016 Ga0105242_100020166 462
507 3300009176 Ga0105242_10003519 Ga0105242_100035194 462
508 3300009176 Ga0105242_10108685 Ga0105242_101086852 462
509 3300009177 Ga0105248_10003871 Ga0105248_100038713 462
510 3300009177 Ga0105248_10099691 Ga0105248_100996913 462
511 3300009545 Ga0105237_10006016 Ga0105237_1000601612 462
512 3300009545 Ga0105237_10078801 Ga0105237_100788013 462
513 3300009545 Ga0105237_10095030 Ga0105237_100950302 462
514 3300009551 Ga0105238_10054187 Ga0105238_100541873 462
515 3300009553 Ga0105249_10001193 Ga0105249_1000119310 462
516 3300009553 Ga0105249_10001979 Ga0105249_100019793 462
517 3300009553 Ga0105249_10108889 Ga0105249_101088892 462
518 3300010375 Ga0105239_10027649 Ga0105239_100276493 462
519 3300010375 Ga0105239_10035856 Ga0105239_100358562 462
520 3300010375 Ga0105239_10041876 Ga0105239_100418764 462
521 3300011119 Ga0105246_10000231 Ga0105246_100002313 462
522 3300011119 Ga0105246_10015760 Ga0105246_100157607 462
523 3300013100 Ga0157373_10010248 Ga0157373_100102486 462
524 3300013100 Ga0157373_10102676 Ga0157373_101026762 462
525 3300013102 Ga0157371_10025479 Ga0157371_100254792 462
526 3300013296 Ga0157374_10003239 Ga0157374_1000323911 462
527 3300013296 Ga0157374_10017421 Ga0157374_100174213 462
528 3300013296 Ga0157374_10031696 Ga0157374_100316962 462
529 3300013297 Ga0157378_10004453 Ga0157378_100044532 462
530 3300013297 Ga0157378_10010612 Ga0157378_100106125 462
531 3300013297 Ga0157378_10021915 Ga0157378_100219153 462
532 3300013306 Ga0163162_10006149 Ga0163162_100061493 462
533 3300013306 Ga0163162_10020738 Ga0163162_100207382 462
534 3300013306 Ga0163162_10026579 Ga0163162_100265793 462
535 3300013307 Ga0157372_10025465 Ga0157372_100254656 462
536 3300013308 Ga0157375_10006518 Ga0157375_100065186 462
537 3300013308 Ga0157375_10033972 Ga0157375_100339723 462
538 3300013308 Ga0157375_10100999 Ga0157375_101009992 462
539 3300013308 Ga0157375_10119222 Ga0157375_101192222 462
540 3300014325 Ga0163163_10001320 Ga0163163_1000132013 462
541 3300014325 Ga0163163_10015790 Ga0163163_100157907 462
542 3300014325 Ga0163163_10051326 Ga0163163_100513263 462
543 3300014325 Ga0163163_10168581 Ga0163163_101685811 462
544 3300014326 Ga0157380_10002744 Ga0157380_1000274410 462
545 3300014745 Ga0157377_10000164 Ga0157377_1000016429 462
546 3300014968 Ga0157379_10020078 Ga0157379_100200783 462
547 3300014968 Ga0157379_10030909 Ga0157379_100309093 462
548 3300014968 Ga0157379_10061490 Ga0157379_100614902 462
549 3300014969 Ga0157376_10002102 Ga0157376_100021023 462
550 3300014969 Ga0157376_10036456 Ga0157376_100364564 462
551 3300014969 Ga0157376_10036479 Ga0157376_100364793 462
552 3300014969 Ga0157376_10088277 Ga0157376_100882772 462
553 3300017792 Ga0163161_10002837 Ga0163161_100028373 462
554 3300017792 Ga0163161_10131060 Ga0163161_101310601 462
555 3300025271 Ga0207666_1000051 Ga0207666_100005114 462
556 3300025297 Ga0209758_1000125 Ga0209758_100012572 462
557 3300025315 Ga0207697_10000662 Ga0207697_1000066212 462
558 3300025885 Ga0207653_10000546 Ga0207653_1000054614 462
559 3300025885 Ga0207653_10001467 Ga0207653_100014673 462
560 3300025893 Ga0207682_10000072 Ga0207682_1000007219 462
561 3300025898 Ga0207692_10002147 Ga0207692_100021476 462
562 3300025899 Ga0207642_10001909 Ga0207642_100019096 462
563 3300025900 Ga0207710_10000558 Ga0207710_100005587 462
564 3300025900 Ga0207710_10004313 Ga0207710_100043134 462
565 3300025901 Ga0207688_10000229 Ga0207688_1000022919 462
566 3300025901 Ga0207688_10004677 Ga0207688_100046773 462
567 3300025904 Ga0207647_10003353 Ga0207647_100033536 462
568 3300025904 Ga0207647_10010679 Ga0207647_100106795 462
569 3300025905 Ga0207685_10001607 Ga0207685_100016072 462
570 3300025905 Ga0207685_10003975 Ga0207685_100039753 462
571 3300025906 Ga0207699_10002080 Ga0207699_100020805 462
572 3300025906 Ga0207699_10015546 Ga0207699_100155462 462
573 3300025907 Ga0207645_10000966 Ga0207645_1000096618 462
574 3300025907 Ga0207645_10007388 Ga0207645_100073885 462
575 3300025908 Ga0207643_10000004 Ga0207643_1000000444 462
576 3300025908 Ga0207643_10000794 Ga0207643_1000079420 462
577 3300025908 Ga0207643_10065728 Ga0207643_100657281 462
578 3300025911 Ga0207654_10001472 Ga0207654_1000147210 462
579 3300025911 Ga0207654_10007425 Ga0207654_100074252 462
580 3300025912 Ga0207707_10007028 Ga0207707_100070284 462
581 3300025912 Ga0207707_10065564 Ga0207707_100655643 462
582 3300025914 Ga0207671_10013159 Ga0207671_100131592 462
583 3300025914 Ga0207671_10020766 Ga0207671_100207663 462
584 3300025914 Ga0207671_10048003 Ga0207671_100480033 462
585 3300025915 Ga0207693_10006880 Ga0207693_100068808 462
586 3300025916 Ga0207663_10010875 Ga0207663_100108754 462
587 3300025916 Ga0207663_10017354 Ga0207663_100173544 462
588 3300025917 Ga0207660_10000648 Ga0207660_100006484 462
589 3300025918 Ga0207662_10000317 Ga0207662_1000031714 462
590 3300025918 Ga0207662_10000424 Ga0207662_1000042420 462
591 3300025918 Ga0207662_10013378 Ga0207662_100133784 462
592 3300025918 Ga0207662_10023881 Ga0207662_100238813 462
593 3300025918 Ga0207662_10032770 Ga0207662_100327702 462
594 3300025918 Ga0207662_10091114 Ga0207662_100911142 462
595 3300025919 Ga0207657_10002047 Ga0207657_1000204714 462
596 3300025919 Ga0207657_10028849 Ga0207657_100288493 462
597 3300025920 Ga0207649_10000262 Ga0207649_1000026219 462
598 3300025920 Ga0207649_10090257 Ga0207649_100902572 462
599 3300025921 Ga0207652_10000911 Ga0207652_100009113 462
600 3300025923 Ga0207681_10010634 Ga0207681_100106344 462
601 3300025924 Ga0207694_10024208 Ga0207694_100242083 462
602 3300025925 Ga0207650_10013694 Ga0207650_100136942 462
603 3300025925 Ga0207650_10019548 Ga0207650_100195482 462
604 3300025926 Ga0207659_10001684 Ga0207659_1000168411 462
605 3300025926 Ga0207659_10012218 Ga0207659_100122184 462
606 3300025926 Ga0207659_10024969 Ga0207659_100249694 462
607 3300025927 Ga0207687_10001501 Ga0207687_100015016 462
608 3300025927 Ga0207687_10006389 Ga0207687_100063893 462
609 3300025928 Ga0207700_10001264 Ga0207700_100012648 462
610 3300025929 Ga0207664_10002547 Ga0207664_100025473 462
611 3300025931 Ga0207644_10000467 Ga0207644_1000046726 462
612 3300025931 Ga0207644_10001961 Ga0207644_100019618 462
613 3300025931 Ga0207644_10015484 Ga0207644_100154842 462
614 3300025932 Ga0207690_10001228 Ga0207690_1000122814 462
615 3300025932 Ga0207690_10009138 Ga0207690_100091382 462
616 3300025933 Ga0207706_10001679 Ga0207706_1000167910 462
617 3300025933 Ga0207706_10018822 Ga0207706_100188226 462
618 3300025933 Ga0207706_10054074 Ga0207706_100540742 462
619 3300025934 Ga0207686_10002040 Ga0207686_100020406 462
620 3300025934 Ga0207686_10009318 Ga0207686_100093185 462
621 3300025934 Ga0207686_10099188 Ga0207686_100991882 462
622 3300025935 Ga0207709_10035318 Ga0207709_100353181 462
623 3300025936 Ga0207670_10000377 Ga0207670_100003773 462
624 3300025936 Ga0207670_10002370 Ga0207670_100023704 462
625 3300025936 Ga0207670_10037467 Ga0207670_100374673 462
626 3300025937 Ga0207669_10001912 Ga0207669_100019126 462
627 3300025937 Ga0207669_10015439 Ga0207669_100154392 462
628 3300025938 Ga0207704_10002613 Ga0207704_100026137 462
629 3300025939 Ga0207665_10001035 Ga0207665_100010358 462
630 3300025939 Ga0207665_10043619 Ga0207665_100436192 462
631 3300025939 Ga0207665_10067562 Ga0207665_100675622 462
632 3300025940 Ga0207691_10002691 Ga0207691_1000269114 462
633 3300025940 Ga0207691_10002874 Ga0207691_1000287410 462
634 3300025941 Ga0207711_10003410 Ga0207711_100034109 462
635 3300025941 Ga0207711_10006776 Ga0207711_100067762 462
636 3300025941 Ga0207711_10022868 Ga0207711_100228682 462
637 3300025941 Ga0207711_10030274 Ga0207711_100302742 462
638 3300025942 Ga0207689_10000203 Ga0207689_1000020328 462
639 3300025942 Ga0207689_10044138 Ga0207689_100441383 462
640 3300025942 Ga0207689_10045948 Ga0207689_100459484 462
641 3300025944 Ga0207661_10002165 Ga0207661_100021652 462
642 3300025944 Ga0207661_10014563 Ga0207661_100145633 462
643 3300025945 Ga0207679_10000157 Ga0207679_1000015728 462
644 3300025945 Ga0207679_10015012 Ga0207679_100150125 462
645 3300025945 Ga0207679_10158473 Ga0207679_101584731 462
646 3300025949 Ga0207667_10220437 Ga0207667_102204372 462
647 3300025961 Ga0207712_10002224 Ga0207712_100022244 462
648 3300025961 Ga0207712_10003965 Ga0207712_100039659 462
649 3300025961 Ga0207712_10039070 Ga0207712_100390703 462
650 3300025972 Ga0207668_10017144 Ga0207668_100171443 462
651 3300025986 Ga0207658_10005748 Ga0207658_100057485 462
652 3300025986 Ga0207658_10048495 Ga0207658_100484951 462
653 3300025986 Ga0207658_10167123 Ga0207658_101671232 462
654 3300026023 Ga0207677_10001675 Ga0207677_1000167510 462
655 3300026035 Ga0207703_10001346 Ga0207703_1000134611 462
656 3300026035 Ga0207703_10001852 Ga0207703_1000185215 462
657 3300026035 Ga0207703_10032158 Ga0207703_100321582 462
658 3300026041 Ga0207639_10008211 Ga0207639_100082113 462
659 3300026067 Ga0207678_10001809 Ga0207678_1000180912 462
660 3300026067 Ga0207678_10001884 Ga0207678_1000188416 462
661 3300026067 Ga0207678_10013053 Ga0207678_100130532 462
662 3300026067 Ga0207678_10034212 Ga0207678_100342123 462
663 3300026067 Ga0207678_10034731 Ga0207678_100347313 462
664 3300026067 Ga0207678_10041672 Ga0207678_100416722 462
665 3300026075 Ga0207708_10000784 Ga0207708_100007848 462
666 3300026075 Ga0207708_10001199 Ga0207708_1000119912 462
667 3300026075 Ga0207708_10003067 Ga0207708_100030674 462
668 3300026075 Ga0207708_10014093 Ga0207708_100140933 462
669 3300026078 Ga0207702_10003404 Ga0207702_1000340413 462
670 3300026088 Ga0207641_10006871 Ga0207641_100068712 462
671 3300026088 Ga0207641_10041334 Ga0207641_100413343 462
672 3300026089 Ga0207648_10002073 Ga0207648_1000207310 462
673 3300026089 Ga0207648_10002310 Ga0207648_1000231018 462
674 3300026089 Ga0207648_10027663 Ga0207648_100276632 462
675 3300026095 Ga0207676_10000990 Ga0207676_1000099019 462
676 3300026095 Ga0207676_10002295 Ga0207676_100022953 462
677 3300026095 Ga0207676_10002940 Ga0207676_100029405 462
678 3300026095 Ga0207676_10184700 Ga0207676_101847002 462
679 3300026116 Ga0207674_10000897 Ga0207674_1000089710 462
680 3300026116 Ga0207674_10011740 Ga0207674_100117407 462
681 3300026118 Ga0207675_100001726 Ga0207675_10000172614 462
682 3300026118 Ga0207675_100002371 Ga0207675_1000023717 462
683 3300026121 Ga0207683_10000824 Ga0207683_1000082418 462
684 3300026121 Ga0207683_10001176 Ga0207683_1000117613 462
685 3300026121 Ga0207683_10014019 Ga0207683_100140194 462
686 3300026121 Ga0207683_10081706 Ga0207683_100817061 462
687 3300026142 Ga0207698_10003743 Ga0207698_100037434 462
688 3300027617 Ga0210002_1003362 Ga0210002_10033622 462
689 3300027695 Ga0209966_1000247 Ga0209966_100024719 462
690 3300027717 Ga0209998_10000255 Ga0209998_100002553 462
691 3300027717 Ga0209998_10001128 Ga0209998_100011283 462
692 3300027876 Ga0209974_10001489 Ga0209974_100014894 462
693 3300027907 Ga0207428_10000137 Ga0207428_1000013732 462
694 3300027907 Ga0207428_10000792 Ga0207428_1000079226 462
695 3300027907 Ga0207428_10003106 Ga0207428_100031067 462
696 3300027907 Ga0207428_10072105 Ga0207428_100721052 462
697 3300028379 Ga0268266_10005095 Ga0268266_100050958 462
698 3300028379 Ga0268266_10023244 Ga0268266_100232443 462
699 3300028379 Ga0268266_10046625 Ga0268266_100466252 462
700 3300028380 Ga0268265_10029470 Ga0268265_100294701 462
701 3300028380 Ga0268265_10085418 Ga0268265_100854182 462
702 3300028381 Ga0268264_10002039 Ga0268264_100020399 462
703 3300028381 Ga0268264_10016623 Ga0268264_100166233 462
704 3300028381 Ga0268264_10062447 Ga0268264_100624472 462
705 3300031241 Ga0265325_10000073 Ga0265325_1000007369 462
706 3300031241 Ga0265325_10002177 Ga0265325_1000217711 462
707 3300034817 Ga0373948_0000061 Ga0373948_0000061_466_1854 462
708 3300034819 Ga0373958_0000048 Ga0373958_0000048_5763_7151 462
709 3300034819 Ga0373958_0001634 Ga0373958_0001634_858_2246 462
710 3300035083 Ga0373926_0003985 Ga0373926_0003985_450_1838 462
711 3300035084 Ga0373928_0000291 Ga0373928_0000291_5960_7348 462
712 3300035084 Ga0373928_0008797 Ga0373928_0008797_401_1789 462
713 3300035085 Ga0373929_0000564 Ga0373929_0000564_5734_7122 462
714 3300035085 Ga0373929_0005244 Ga0373929_0005244_732_2120 462
715 3300035086 Ga0373934_0020853 Ga0373934_0020853_553_1941 462
716 3300035088 Ga0373940_0000023 Ga0373940_0000023_5677_7065 462
717 3300035088 Ga0373940_0010533 Ga0373940_0010533_737_2125 462
718 3300035090 Ga0373949_0001146 Ga0373949_0001146_5221_6609 462
719 3300035091 Ga0373951_0000876 Ga0373951_0000876_5900_7288 462
720 3300035091 Ga0373951_0005478 Ga0373951_0005478_907_2295 462
721 3300035111 Ga0373923_0000851 Ga0373923_0000851_2420_3808 462
722 3300035111 Ga0373923_0003216 Ga0373923_0003216_3689_5095 462
723 3300035113 Ga0373936_0001660 Ga0373936_0001660_4614_6020 462
724 3300035114 Ga0373939_0000663 Ga0373939_0000663_5222_6610 462
725 3300035114 Ga0373939_0002651 Ga0373939_0002651_852_2243 462
726 3300035115 Ga0373941_0000309 Ga0373941_0000309_6976_8364 462
727 3300035116 Ga0373945_0000277 Ga0373945_0000277_10144_11532 462
728 3300035116 Ga0373945_0001390 Ga0373945_0001390_2858_4264 462
729 3300035117 Ga0373953_0068438 Ga0373953_0068438_55_1443 462
730 3300035118 Ga0373954_0005333 Ga0373954_0005333_2512_3900 462
731 3300035118 Ga0373954_0014688 Ga0373954_0014688_402_1796 462
732 3300035121 Ga0373960_0001082 Ga0373960_0001082_1820_3208 462
733 3300035121 Ga0373960_0003751 Ga0373960_0003751_1985_3373 462
734 3300035170 Ga0373943_0004971 Ga0373943_0004971_1828_3234 462
735 3300035170 Ga0373943_0005512 Ga0373943_0005512_3631_5019 462
736 3300035170 Ga0373943_0009916 Ga0373943_0009916_1194_2582 462
737 3300035171 Ga0373946_0001856 Ga0373946_0001856_705_2093 462
738 3300035171 Ga0373946_0002330 Ga0373946_0002330_1620_3026 462
739 3300035172 Ga0373955_0002403 Ga0373955_0002403_688_2076 462
740 3300035207 Ga0373942_0000081 Ga0373942_0000081_9176_10564 462
741 3300035207 Ga0373942_0016658 Ga0373942_0016658_44_1432 462
742 3300035241 Ga0373961_0000743 Ga0373961_0000743_6293_7681 462
743 3300035241 Ga0373961_0002954 Ga0373961_0002954_2191_3579 462
744 3300035242 Ga0373962_0000194 Ga0373962_0000194_3009_4397 462
745 3300035410 Ga0373924_0000490 Ga0373924_0000490_6614_8002 462
746 3300035410 Ga0373924_0004810 Ga0373924_0004810_1337_2743 462
747 3300035691 Ga0373931_0001008 Ga0373931_0001008_4277_5665 462
748 3300035691 Ga0373931_0001564 Ga0373931_0001564_5938_7326 462
749 3300035691 Ga0373931_0016578 Ga0373931_0016578_1814_3313 462
750 3300035692 Ga0373935_0000291 Ga0373935_0000291_7310_8716 462
751 3300035692 Ga0373935_0013547 Ga0373935_0013547_2989_4377 462
752 3300035695 Ga0373927_0005343 Ga0373927_0005343_556_1944 462
753 3300035695 Ga0373927_0009000 Ga0373927_0009000_172_1569 462
754 3300035695 Ga0373927_0034546 Ga0373927_0034546_1554_2954 462
755 3300035695 Ga0373927_0051606 Ga0373927_0051606_1089_2477 462
756 3300035695 Ga0373927_0055119 Ga0373927_0055119_1042_2448 462
757 3300035724 Ga0373933_0010185 Ga0373933_0010185_2807_4201 462
758 3300035724 Ga0373933_0012833 Ga0373933_0012833_1331_2725 462
759 3300035725 Ga0373947_0000424 Ga0373947_0000424_18873_20261 462
760 3300035725 Ga0373947_0005730 Ga0373947_0005730_5772_7178 462
761 3300035725 Ga0373947_0010154 Ga0373947_0010154_372_1772 462
762 3300035725 Ga0373947_0041253 Ga0373947_0041253_1230_2627 462
763 3300036401 Ga0373937_0000004 Ga0373937_0000004_110821_112227 462
764 3300036401 Ga0373937_0003680 Ga0373937_0003680_9175_10569 462
765 3300036401 Ga0373937_0005263 Ga0373937_0005263_3317_4705 462
766 3300036401 Ga0373937_0006030 Ga0373937_0006030_1270_2664 462
767 3300037068 Ga0373925_0000460 Ga0373925_0000460_5850_7256 462
768 3300037068 Ga0373925_0003391 Ga0373925_0003391_3057_4445 462
769 3300037068 Ga0373925_0017524 Ga0373925_0017524_3631_5019 462
770 3300042439 Ga0439464_0005396 Ga0439464_0005396_580_1968 462
771 3300045051 Ga0451576_0006650 Ga0451576_0006650_10935_12323 462
772 3300046454 Ga0495592_0000029 Ga0495592_0000029_102642_104048 462
773 3300046454 Ga0495592_0001215 Ga0495592_0001215_1028_2416 462
774 3300046454 Ga0495592_0005508 Ga0495592_0005508_652_2046 462
775 3300046454 Ga0495592_0136552 Ga0495592_0136552_27_1421 462
776 3300046459 Ga0495629_0000447 Ga0495629_0000447_15101_16489 462
777 3300046459 Ga0495629_0016571 Ga0495629_0016571_2118_3524 462
778 3300046460 Ga0495638_0028434 Ga0495638_0028434_648_2048 462
779 3300046461 Ga0495641_0001697 Ga0495641_0001697_16010_17398 462
780 3300046461 Ga0495641_0015734 Ga0495641_0015734_1633_3021 462
781 3300046461 Ga0495641_0027911 Ga0495641_0027911_959_2359 462
782 3300046462 Ga0495651_0002424 Ga0495651_0002424_4556_5944 462
783 3300046462 Ga0495651_0038986 Ga0495651_0038986_600_1994 462
784 3300046463 Ga0495653_0000012 Ga0495653_0000012_248605_250011 462
785 3300046463 Ga0495653_0003231 Ga0495653_0003231_11472_12866 462
786 3300046463 Ga0495653_0006931 Ga0495653_0006931_6181_7569 462
787 3300046463 Ga0495653_0078354 Ga0495653_0078354_856_2250 462
788 3300046472 Ga0495580_0006747 Ga0495580_0006747_2529_3917 462
789 3300046472 Ga0495580_0085877 Ga0495580_0085877_268_1668 462
790 3300046473 Ga0495582_0007072 Ga0495582_0007072_156_1544 462
791 3300046473 Ga0495582_0010997 Ga0495582_0010997_189_1577 462
792 3300046473 Ga0495582_0013202 Ga0495582_0013202_2464_3864 462
793 3300046475 Ga0495639_0006165 Ga0495639_0006165_3292_4680 462
794 3300046476 Ga0495662_0003904 Ga0495662_0003904_5099_6487 462
795 3300046476 Ga0495662_0010406 Ga0495662_0010406_2937_4343 462
796 3300046477 Ga0495664_0000004 Ga0495664_0000004_132306_133712 462
797 3300046477 Ga0495664_0009959 Ga0495664_0009959_891_2279 462
798 3300046491 Ga0495584_0002735 Ga0495584_0002735_5321_6709 462
799 3300046491 Ga0495584_0056557 Ga0495584_0056557_176_1576 462
800 3300046492 Ga0495585_0003199 Ga0495585_0003199_304_1692 462
801 3300046492 Ga0495585_0073720 Ga0495585_0073720_271_1671 462
802 3300046499 Ga0495594_0013045 Ga0495594_0013045_470_1858 462
803 3300046499 Ga0495594_0021869 Ga0495594_0021869_156_1544 462
804 3300046501 Ga0495607_0029184 Ga0495607_0029184_304_1692 462
805 3300046511 Ga0495608_0000017 Ga0495608_0000017_132293_133699 462
806 3300046514 Ga0495618_0000006 Ga0495618_0000006_91399_92805 462
807 3300046516 Ga0495628_0000001 Ga0495628_0000001_132295_133701 462
808 3300046516 Ga0495628_0009640 Ga0495628_0009640_1312_2706 462
809 3300046516 Ga0495628_0019168 Ga0495628_0019168_1851_3239 462
810 3300046516 Ga0495628_0035835 Ga0495628_0035835_1321_2715 462
811 3300046517 Ga0495630_0008370 Ga0495630_0008370_1599_3005 462
812 3300046520 Ga0495637_0042998 Ga0495637_0042998_384_1772 462
813 3300046523 Ga0495644_0002426 Ga0495644_0002426_5189_6577 462
814 3300046526 Ga0495666_0001305 Ga0495666_0001305_525_1913 462
815 3300046529 Ga0495652_0000002 Ga0495652_0000002_346829_348235 462
816 3300046529 Ga0495652_0018154 Ga0495652_0018154_4439_5827 462
817 3300046531 Ga0495665_0004009 Ga0495665_0004009_714_2102 462
818 3300046531 Ga0495665_0025407 Ga0495665_0025407_963_2363 462
819 3300046533 Ga0495640_0000001 Ga0495640_0000001_440833_442239 462
820 3300046533 Ga0495640_0017355 Ga0495640_0017355_687_2075 462
821 3300046535 Ga0495586_0007089 Ga0495586_0007089_3516_4904 462
822 3300046536 Ga0495587_0000008 Ga0495587_0000008_132513_133919 462
823 3300046536 Ga0495587_0001490 Ga0495587_0001490_1208_2602 462
824 3300046537 Ga0495598_0001556 Ga0495598_0001556_738_2138 462
825 3300046543 Ga0495645_0000002 Ga0495645_0000002_132308_133714 462
826 3300046543 Ga0495645_0000954 Ga0495645_0000954_14064_15458 462
827 3300046543 Ga0495645_0050356 Ga0495645_0050356_575_1969 462
828 3300046558 Ga0495633_0014899 Ga0495633_0014899_2521_3909 462
829 3300046559 Ga0495667_0000029 Ga0495667_0000029_132304_133710 462
830 3300046559 Ga0495667_0014263 Ga0495667_0014263_2947_4335 462
831 3300046559 Ga0495667_0043731 Ga0495667_0043731_464_1858 462
832 3300046615 Ga0495656_0000941 Ga0495656_0000941_7776_9164 462
833 3300046642 Ga0495634_0006280 Ga0495634_0006280_5808_7214 462
834 3300046642 Ga0495634_0035463 Ga0495634_0035463_1873_3261 462
835 3300046642 Ga0495634_0058157 Ga0495634_0058157_516_2015 462
836 3300046648 Ga0495611_0005829 Ga0495611_0005829_133_1521 462
837 3300046663 Ga0495635_0000002 Ga0495635_0000002_353223_354629 462
838 3300046663 Ga0495635_0013015 Ga0495635_0013015_3206_4600 462
839 3300046674 Ga0495588_0000318 Ga0495588_0000318_260_1648 462
840 3300046674 Ga0495588_0012717 Ga0495588_0012717_1601_3001 462
841 3300046674 Ga0495588_0029685 Ga0495588_0029685_827_2215 462
842 3300046675 Ga0495657_0000459 Ga0495657_0000459_16819_18225 462
843 3300046675 Ga0495657_0086718 Ga0495657_0086718_519_1907 462
844 3300046678 Ga0495599_0000104 Ga0495599_0000104_54021_55427 462
845 3300046678 Ga0495599_0001047 Ga0495599_0001047_4226_5614 462
846 3300046679 Ga0495623_0000691 Ga0495623_0000691_16223_17629 462
847 3300046679 Ga0495623_0003897 Ga0495623_0003897_584_1978 462
848 3300046680 Ga0495646_0000064 Ga0495646_0000064_27548_28954 462
849 3300046680 Ga0495646_0005442 Ga0495646_0005442_6056_7444 462
850 3300046680 Ga0495646_0006507 Ga0495646_0006507_3169_4563 462
851 3300046681 Ga0495647_0001576 Ga0495647_0001576_3631_5019 462
852 3300046683 Ga0495658_0007929 Ga0495658_0007929_1559_2956 462
853 3300046683 Ga0495658_0008212 Ga0495658_0008212_1490_2878 462
854 3300046683 Ga0495658_0008346 Ga0495658_0008346_3558_4946 462
855 3300046683 Ga0495658_0035592 Ga0495658_0035592_1329_2723 462
856 3300046689 Ga0495613_0000793 Ga0495613_0000793_198_1586 462
857 3300046689 Ga0495613_0047786 Ga0495613_0047786_1137_2525 462
858 3300046690 Ga0495624_0023831 Ga0495624_0023831_772_2160 462
859 3300046809 Ga0495600_0000010 Ga0495600_0000010_137544_138950 462
860 3300046809 Ga0495600_0032708 Ga0495600_0032708_335_1729 462
861 3300047315 Ga0495581_0002305 Ga0495581_0002305_5066_6454 462
862 3300047317 Ga0495604_0000009 Ga0495604_0000009_192591_193997 462
863 3300047317 Ga0495604_0003660 Ga0495604_0003660_7751_9139 462
864 3300047317 Ga0495604_0017295 Ga0495604_0017295_1542_2936 462
865 3300047317 Ga0495604_0017691 Ga0495604_0017691_548_1942 462
866 3300047319 Ga0495674_0000002 Ga0495674_0000002_132296_133702 462
867 3300047319 Ga0495674_0042474 Ga0495674_0042474_156_1544 462
868 3300047319 Ga0495674_0080853 Ga0495674_0080853_1070_2464 462
869 3300047321 Ga0495676_0084271 Ga0495676_0084271_474_1862 462
870 3300047321 Ga0495676_0178846 Ga0495676_0178846_23_1411 462
871 3300047322 Ga0495680_0000752 Ga0495680_0000752_18561_19967 462
872 3300047322 Ga0495680_0014315 Ga0495680_0014315_3675_5069 462
873 3300047322 Ga0495680_0014551 Ga0495680_0014551_1956_3344 462
874 3300047322 Ga0495680_0022273 Ga0495680_0022273_1437_2825 462
875 3300047322 Ga0495680_0028687 Ga0495680_0028687_627_2021 462
876 3300047444 Ga0495675_0000028 Ga0495675_0000028_104259_105665 462
877 3300047444 Ga0495675_0026696 Ga0495675_0026696_2223_3617 462
878 3300047471 Ga0495684_0000006 Ga0495684_0000006_132255_133661 462
879 3300047471 Ga0495684_0003934 Ga0495684_0003934_3295_4683 462
880 3300047673 Ga0495593_0008360 Ga0495593_0008360_232_1620 462
881 3300048088 Ga0495602_0000005 Ga0495602_0000005_211972_213378 462
882 3300048088 Ga0495602_0000776 Ga0495602_0000776_24637_26031 462
883 3300048088 Ga0495602_0002995 Ga0495602_0002995_738_2132 462
884 3300048089 Ga0495614_0004539 Ga0495614_0004539_304_1692 462
885 3300048903 Ga0496100_0002107 Ga0496100_0002107_4619_6007 462
886 3300048903 Ga0496100_0008177 Ga0496100_0008177_2460_3848 462
887 3300048903 Ga0496100_0008677 Ga0496100_0008677_30_1430 462
888 3300048904 Ga0496101_0002976 Ga0496101_0002976_9012_10406 462
889 3300048904 Ga0496101_0005170 Ga0496101_0005170_5622_7010 462
890 3300048904 Ga0496101_0005327 Ga0496101_0005327_2554_3942 462
891 3300048904 Ga0496101_0045004 Ga0496101_0045004_1243_2643 462
892 3300048904 Ga0496101_0099036 Ga0496101_0099036_610_2013 462
893 3300048905 Ga0496102_0008464 Ga0496102_0008464_2831_4219 462
894 3300048905 Ga0496102_0009880 Ga0496102_0009880_4339_5838 462
895 3300048905 Ga0496102_0017733 Ga0496102_0017733_4349_5749 462
896 3300048905 Ga0496102_0024215 Ga0496102_0024215_2595_3983 462
897 3300048905 Ga0496102_0097214 Ga0496102_0097214_771_2159 462
898 3300048906 Ga0496103_0001696 Ga0496103_0001696_9985_11373 462
899 3300048906 Ga0496103_0005658 Ga0496103_0005658_3031_4431 462
900 3300048906 Ga0496103_0005922 Ga0496103_0005922_1331_2719 462
901 3300048906 Ga0496103_0011431 Ga0496103_0011431_194_1588 462
902 3300048906 Ga0496103_0036194 Ga0496103_0036194_942_2330 462
903 3300048906 Ga0496103_0076217 Ga0496103_0076217_681_2069 462
904 3300048907 Ga0496104_0000092 Ga0496104_0000092_36652_38046 462
905 3300048907 Ga0496104_0004402 Ga0496104_0004402_4592_5986 462
906 3300048907 Ga0496104_0013405 Ga0496104_0013405_3405_4805 462
907 3300048907 Ga0496104_0069565 Ga0496104_0069565_375_1763 462
908 3300048907 Ga0496104_0112817 Ga0496104_0112817_837_2231 462
909 3300048907 Ga0496104_0269510 Ga0496104_0269510_62_1450 462
910 3300048908 Ga0496105_0001436 Ga0496105_0001436_12463_13863 462
911 3300048908 Ga0496105_0001736 Ga0496105_0001736_9276_10664 462
912 3300048908 Ga0496105_0002208 Ga0496105_0002208_1374_2873 462
913 3300048908 Ga0496105_0125052 Ga0496105_0125052_214_1614 462
914 3300048909 Ga0496106_0003134 Ga0496106_0003134_7797_9191 462
915 3300048909 Ga0496106_0006593 Ga0496106_0006593_3037_4425 462
916 3300048909 Ga0496106_0026317 Ga0496106_0026317_2554_3942 462
917 3300048909 Ga0496106_0043487 Ga0496106_0043487_918_2417 462
918 3300048909 Ga0496106_0149234 Ga0496106_0149234_347_1741 462
919 3300048910 Ga0496107_0000809 Ga0496107_0000809_6760_8148 462
920 3300048910 Ga0496107_0007194 Ga0496107_0007194_2193_3587 462
921 3300048910 Ga0496107_0012097 Ga0496107_0012097_395_1795 462
922 3300048910 Ga0496107_0013417 Ga0496107_0013417_4099_5487 462
923 3300048910 Ga0496107_0026710 Ga0496107_0026710_1273_2661 462
924 3300048911 Ga0496108_0003371 Ga0496108_0003371_11161_12660 462
925 3300048911 Ga0496108_0005285 Ga0496108_0005285_544_1932 462
926 3300048911 Ga0496108_0014164 Ga0496108_0014164_4926_6314 462
927 3300048911 Ga0496108_0090770 Ga0496108_0090770_1088_2476 462
928 3300048911 Ga0496108_0097512 Ga0496108_0097512_598_1992 462
929 3300048912 Ga0496109_0000543 Ga0496109_0000543_9180_10568 462
930 3300048912 Ga0496109_0016420 Ga0496109_0016420_4224_5624 462
931 3300048912 Ga0496109_0026427 Ga0496109_0026427_1314_2708 462
932 3300048912 Ga0496109_0031491 Ga0496109_0031491_2941_4329 462
933 3300048912 Ga0496109_0118773 Ga0496109_0118773_699_2087 462
934 3300048913 Ga0496110_0015744 Ga0496110_0015744_4301_5689 462
935 3300048913 Ga0496110_0112154 Ga0496110_0112154_1022_2422 462
936 3300048913 Ga0496110_0190509 Ga0496110_0190509_207_1595 462
937 3300048914 Ga0496111_0000388 Ga0496111_0000388_11380_12879 462
938 3300048914 Ga0496111_0002814 Ga0496111_0002814_7260_8648 462
939 3300048914 Ga0496111_0012071 Ga0496111_0012071_1165_2565 462
940 3300048914 Ga0496111_0028753 Ga0496111_0028753_2252_3640 462
941 3300048915 Ga0496112_0003072 Ga0496112_0003072_5683_7071 462
942 3300048915 Ga0496112_0009140 Ga0496112_0009140_3504_4892 462
943 3300048915 Ga0496112_0014688 Ga0496112_0014688_48_1547 462
944 3300048915 Ga0496112_0061370 Ga0496112_0061370_849_2249 462
945 3300048916 Ga0496113_0000043 Ga0496113_0000043_50337_51836 462
946 3300048916 Ga0496113_0004954 Ga0496113_0004954_5915_7303 462
947 3300048916 Ga0496113_0015314 Ga0496113_0015314_3504_4892 462
948 3300048916 Ga0496113_0047129 Ga0496113_0047129_314_1714 462
949 3300048917 Ga0496114_0003641 Ga0496114_0003641_2662_4050 462
950 3300048917 Ga0496114_0013464 Ga0496114_0013464_3756_5144 462
951 3300048917 Ga0496114_0040439 Ga0496114_0040439_685_2085 462
952 3300048917 Ga0496114_0052998 Ga0496114_0052998_1484_2887 462
953 3300048918 Ga0496115_0009341 Ga0496115_0009341_3660_5048 462
954 3300048918 Ga0496115_0046900 Ga0496115_0046900_1457_2857 462
955 3300048918 Ga0496115_0054203 Ga0496115_0054203_1301_2695 462
956 3300048918 Ga0496115_0109009 Ga0496115_0109009_368_1762 462
957 3300049568 Ga0501031_0022932 Ga0501031_0022932_1105_2499 462
958 3300049570 Ga0501033_0011567 Ga0501033_0011567_669_2063 462
959 3300049571 Ga0501034_0018337 Ga0501034_0018337_960_2360 462
960 3300049572 Ga0501036_0017605 Ga0501036_0017605_2579_3973 462
961 3300049572 Ga0501036_0025867 Ga0501036_0025867_703_2103 462
962 3300049573 Ga0501037_0020812 Ga0501037_0020812_928_2322 462
963 3300049574 Ga0501038_0062127 Ga0501038_0062127_424_1824 462
964 3300049574 Ga0501038_0096680 Ga0501038_0096680_752_2146 462
965 3300049575 Ga0501039_0015326 Ga0501039_0015326_1837_3231 462
966 3300049581 Ga0501047_0087179 Ga0501047_0087179_1140_2540 462
967 3300049586 Ga0501070_0020311 Ga0501070_0020311_580_1974 462
968 3300049586 Ga0501070_0044117 Ga0501070_0044117_896_2296 462
969 3300049822 Ga0501035_0016521 Ga0501035_0016521_4333_5727 462
970 3300049823 Ga0501044_0033812 Ga0501044_0033812_3255_4655 462
971 3300049823 Ga0501044_0144177 Ga0501044_0144177_528_1922 462
972 3300050492 nmdc:mga0yw44_46679_c1 nmdc:mga0yw44_46679_c1_876_2375 462
973 3300050493 nmdc:mga0k408_5532_c1 nmdc:mga0k408_5532_c1_4678_6093 462
974 3300050507 nmdc:mga05p37_309031_c1 nmdc:mga05p37_309031_c1_444_1844 462
975 3300050507 nmdc:mga05p37_6242_c1 nmdc:mga05p37_6242_c1_1847_3346 462
976 3300050507 nmdc:mga05p37_66_c1 nmdc:mga05p37_66_c1_25819_27207 462
977 3300050507 nmdc:mga05p37_92206_c1 nmdc:mga05p37_92206_c1_1688_3076 462
978 3300050508 nmdc:mga09592_7876_c1 nmdc:mga09592_7876_c1_2075_3463 462
979 3300050509 nmdc:mga0qj67_24563_c1 nmdc:mga0qj67_24563_c1_2679_4076 462
980 3300050509 nmdc:mga0qj67_512_c1 nmdc:mga0qj67_512_c1_17809_19197 462
981 3300050510 nmdc:mga06r32_7326_c1 nmdc:mga06r32_7326_c1_7219_8607 462
982 3300050511 nmdc:mga08y16_1809_c1 nmdc:mga08y16_1809_c1_20055_21443 462
983 3300050511 nmdc:mga08y16_31568_c1 nmdc:mga08y16_31568_c1_1541_2929 462
984 3300050511 nmdc:mga08y16_4145_c1 nmdc:mga08y16_4145_c1_6349_7737 462
985 3300050511 nmdc:mga08y16_56670_c1 nmdc:mga08y16_56670_c1_885_2384 462
986 3300050512 nmdc:mga0n895_43_c1 nmdc:mga0n895_43_c1_47180_48568 462
987 3300050512 nmdc:mga0n895_74467_c1 nmdc:mga0n895_74467_c1_1844_3232 462
988 3300050512 nmdc:mga0n895_78577_c1 nmdc:mga0n895_78577_c1_1864_3252 462
989 3300050513 nmdc:mga0rr50_21285_c1 nmdc:mga0rr50_21285_c1_1461_2849 462
990 3300050513 nmdc:mga0rr50_43928_c1 nmdc:mga0rr50_43928_c1_983_2371 462
991 3300050515 nmdc:mga0a205_13273_c1 nmdc:mga0a205_13273_c1_5299_6687 462
992 3300050515 nmdc:mga0a205_3268_c1 nmdc:mga0a205_3268_c1_11295_12683 462
993 3300053077 Ga0495601_0000002 Ga0495601_0000002_177760_179166 462
994 3300053077 Ga0495601_0000107 Ga0495601_0000107_30477_31871 462
995 3300053077 Ga0495601_0005039 Ga0495601_0005039_3819_5213 462
996 3300053077 Ga0495601_0027688 Ga0495601_0027688_1962_3350 462
997 3300053077 Ga0495601_0122728 Ga0495601_0122728_107_1510 462
998 3300053078 Ga0495612_0000010 Ga0495612_0000010_113648_115054 462
999 3300053078 Ga0495612_0001623 Ga0495612_0001623_6862_8250 462
1000 3300053078 Ga0495612_0002221 Ga0495612_0002221_3080_4474 462
1001 3300053078 Ga0495612_0005028 Ga0495612_0005028_1271_2665 462
1002 3300053084 Ga0495595_0000777 Ga0495595_0000777_4804_6210 462
1003 3300053084 Ga0495595_0004037 Ga0495595_0004037_2089_3477 462
1004 3300053084 Ga0495595_0019908 Ga0495595_0019908_1176_2570 462
1005 3300053085 Ga0495619_0000019 Ga0495619_0000019_137096_138502 462
1006 3300053085 Ga0495619_0000045 Ga0495619_0000045_67662_69056 462
1007 3300053085 Ga0495619_0002374 Ga0495619_0002374_9744_11132 462
1008 3300053085 Ga0495619_0002899 Ga0495619_0002899_1232_2620 462
1009 3300053085 Ga0495619_0004604 Ga0495619_0004604_1981_3375 462
1010 3300053085 Ga0495619_0044260 Ga0495619_0044260_190_1593 462
1011 3300053119 Ga0500595_000002 Ga0500595_000002_937986_939377 462
1012 3300053153 Ga0500616_0007357 Ga0500616_0007357_2535_3932 462
1013 3300060353 Ga0501082_0000074 Ga0501082_0000074_59429_60829 462

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01654

Cyt_bd_oxida_I

Cytochrome bd terminal oxidase subunit I

8

426

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ose-assembly1.cif.gz_D cytochrome bd-ii type oxidase with bound aurachin d 0.9557 4 434
7nkz-assembly1.cif.gz_A cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.9351 1 434
5ir6-assembly1.cif.gz_A the structure of bd oxidase from geobacillus thermodenitrificans 0.9205 1 434
5ir6-assembly1.cif.gz_A the structure of bd oxidase from geobacillus thermodenitrificans 0.9184 1 434
7nkz-assembly1.cif.gz_A cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.8916 1 434
ID Description Score Start End Superfamily
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.5457 13 377 1.20.1630.10
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.5334 13 377 1.20.1630.10
af_Q54YB8_113_357_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4232 9 225 1.20.1250.20
2cmrA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.423 12 240 1.20.58.1860
af_A4I2W7_8_252_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4145 122 382 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A0K6IUC4-F1-model_v4 Bacterial Cytochrome Ubiquinol Oxidase 0.9911 143 256 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A366GMK4-F1-model_v4 Cytochrome bd-I ubiquinol oxidase subunit 1 apoprotein 0.9893 1 398 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A5N7YB97-F1-model_v4 deleted 0.9872 1 429
AF-A0A329P241-F1-model_v4 deleted 0.9869 64 413
AF-A0A7C4N6J7-F1-model_v4 Cytochrome ubiquinol oxidase subunit I 0.9866 4 434 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069

Feature Viewer

pLDDT pTM Quality
89.86 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map