F488189
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1013 | 377 | 1011 | 463 |
Family's Representative Sequence
| Representative Sequence | 3300005439|Ga0070711_100051325|Ga0070711_1000513254 |
| Length | 452 |
| Sequence | MDFDPVLLARLQFAFTIIFHIIFPSFTIGLSAYIATLGALWLRSGEERHQLLMRFWVKIFAVSFAMGVVSGIVLSYQFGTNWSRFSVATGNVLGPLLGYEVLAAFFLEATFLGILLFGFNKVPPWLYVLSAIVVAIGTMTSAFWILAANSWMQTPAGHEFRDGVAYPLDWLHIVFNPSFPYRFAHMLNAAYLTTAFVVIAVGARYLIRTMLRMGIGLAAILAPLQLIIGDQHGLNTLAHQPLKVAAMEAHWDGSKPGDFHIFAWPDEKAGVNHFELSIPKGASLILTHKMNGLFPGLLSVPEADRPPVKVVFFGFRIMLGVGLFMIASALFGAFLWWRGTLFETRWYLRIMAQSWWVGFVAVIAGWVVTESGRQPWIVYGVMRTADATSPVPGATIAGTLALFVLAYGVVFSFGIYYMNRLIANGPDQGTETGGEFSGNPLSTTQDAGRGPL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 3 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 14 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 15 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 16 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 19 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 93 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 94 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 95 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 99 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 100 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 101 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 103 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 104 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 105 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 106 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 107 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 108 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 109 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 110 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 113 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 142 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 217 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 218 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 222 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 224 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 225 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 226 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 229 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 232 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 233 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 244 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 245 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 247 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 248 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 249 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 250 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 253 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 254 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 255 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 314 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 315 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 316 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 317 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 318 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 319 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 322 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 323 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 324 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 325 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 326 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 327 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 356 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 357 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 358 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 372 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 373 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 374 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 375 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.8 |
| Metatranscriptomes | 0 |
| Isolates | 0.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.68 |
| Nodule | 0 |
| Rhizoplane | 9.38 |
| Rhizosphere | 88.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214745202 | 2209111006 | Bacteria | 16175 |
| 2 | ARSoilYngRDRAFT_c00086 | 3300000042 | Bacteria | 15520 |
| 3 | ARcpr5yngRDRAFT_c000084 | 3300000043 | Bacteria | 15520 |
| 4 | ARSoilOldRDRAFT_c000050 | 3300000044 | Bacteria | 25074 |
| 5 | ARCol0yngRDRAFT_1000023 | 3300000652 | Bacteria | 28722 |
| 6 | JGI24739J22299_10000209 | 3300001989 | Bacteria | 19461 |
| 7 | JGI24739J22299_10002430 | 3300001989 | Bacteria | 7191 |
| 8 | JGI24737J22298_10000739 | 3300001990 | Bacteria | 11509 |
| 9 | JGI24737J22298_10003173 | 3300001990 | Bacteria | 5839 |
| 10 | JGI24750J21931_1000551 | 3300002070 | Bacteria | 5744 |
| 11 | JGI24748J21848_1000695 | 3300002074 | Bacteria | 3616 |
| 12 | JGI24738J21930_10001189 | 3300002075 | Bacteria | 7282 |
| 13 | JGI24749J21850_1000283 | 3300002076 | Bacteria | 7793 |
| 14 | JGI24744J21845_10000810 | 3300002077 | Bacteria | 5872 |
| 15 | JGI24035J26624_1000365 | 3300002126 | Bacteria | 4267 |
| 16 | JGI24742J22300_10000279 | 3300002244 | Bacteria | 7687 |
| 17 | JGI25153J46596_10004383 | 3300003215 | Bacteria | 7615 |
| 18 | JGI25404J52841_10002701 | 3300003659 | Bacteria | 3395 |
| 19 | Ga0065714_10095322 | 3300005288 | Bacteria | 1790 |
| 20 | Ga0065704_10073133 | 3300005289 | Bacteria | 7551 |
| 21 | Ga0065712_10070789 | 3300005290 | Bacteria | 5705 |
| 22 | Ga0065715_10000519 | 3300005293 | Bacteria | 20489 |
| 23 | Ga0065715_10004456 | 3300005293 | Bacteria | 3808 |
| 24 | Ga0070676_10002633 | 3300005328 | Bacteria | 9237 |
| 25 | Ga0070676_10041250 | 3300005328 | Bacteria | 2675 |
| 26 | Ga0070683_100010864 | 3300005329 | Bacteria | 7839 |
| 27 | Ga0070683_100035491 | 3300005329 | Bacteria | 4558 |
| 28 | Ga0070690_100001459 | 3300005330 | Bacteria | 12359 |
| 29 | Ga0070670_100012949 | 3300005331 | Bacteria | 7141 |
| 30 | Ga0070670_100027821 | 3300005331 | Bacteria | 4864 |
| 31 | Ga0070677_10000109 | 3300005333 | Bacteria | 26990 |
| 32 | Ga0068869_100004148 | 3300005334 | Bacteria | 8986 |
| 33 | Ga0068869_100035836 | 3300005334 | Bacteria | 3520 |
| 34 | Ga0068869_100146055 | 3300005334 | Bacteria | 1830 |
| 35 | Ga0070680_100018038 | 3300005336 | Bacteria | 5574 |
| 36 | Ga0070680_100019164 | 3300005336 | Bacteria | 5420 |
| 37 | Ga0070680_100063179 | 3300005336 | Bacteria | 3032 |
| 38 | Ga0070682_100000459 | 3300005337 | Bacteria | 25698 |
| 39 | Ga0070682_100034055 | 3300005337 | Bacteria | 3099 |
| 40 | Ga0070682_100040299 | 3300005337 | Bacteria | 2874 |
| 41 | Ga0068868_100000443 | 3300005338 | Bacteria | 27815 |
| 42 | Ga0068868_100006452 | 3300005338 | Bacteria | 8300 |
| 43 | Ga0070660_100034923 | 3300005339 | Bacteria | 3802 |
| 44 | Ga0070660_100046626 | 3300005339 | Bacteria | 3322 |
| 45 | Ga0070689_100000423 | 3300005340 | Bacteria | 24943 |
| 46 | Ga0070689_100001662 | 3300005340 | Bacteria | 14205 |
| 47 | Ga0070689_100020869 | 3300005340 | Bacteria | 4868 |
| 48 | Ga0070689_100043276 | 3300005340 | Bacteria | 3460 |
| 49 | Ga0070689_100131548 | 3300005340 | Bacteria | 2007 |
| 50 | Ga0070691_10001927 | 3300005341 | Bacteria | 9119 |
| 51 | Ga0070691_10011614 | 3300005341 | Bacteria | 4023 |
| 52 | Ga0070691_10011885 | 3300005341 | Bacteria | 3984 |
| 53 | Ga0070691_10019580 | 3300005341 | Bacteria | 3125 |
| 54 | Ga0070687_100000706 | 3300005343 | Bacteria | 11178 |
| 55 | Ga0070687_100005176 | 3300005343 | Bacteria | 5266 |
| 56 | Ga0070687_100006831 | 3300005343 | Bacteria | 4706 |
| 57 | Ga0070687_100022617 | 3300005343 | Bacteria | 2976 |
| 58 | Ga0070661_100001619 | 3300005344 | Bacteria | 15572 |
| 59 | Ga0070692_10000262 | 3300005345 | Bacteria | 14685 |
| 60 | Ga0070692_10046098 | 3300005345 | Bacteria | 2251 |
| 61 | Ga0070668_100001027 | 3300005347 | Bacteria | 19571 |
| 62 | Ga0070668_100051371 | 3300005347 | Bacteria | 3176 |
| 63 | Ga0070668_100092303 | 3300005347 | Bacteria | 2388 |
| 64 | Ga0070669_100002329 | 3300005353 | Bacteria | 13729 |
| 65 | Ga0070669_100064546 | 3300005353 | Bacteria | 2697 |
| 66 | Ga0070675_100040634 | 3300005354 | Bacteria | 3798 |
| 67 | Ga0070671_100017038 | 3300005355 | Bacteria | 5877 |
| 68 | Ga0070671_100019919 | 3300005355 | Bacteria | 5465 |
| 69 | Ga0070671_100031446 | 3300005355 | Bacteria | 4384 |
| 70 | Ga0070674_100001251 | 3300005356 | Bacteria | 13361 |
| 71 | Ga0070674_100009547 | 3300005356 | Bacteria | 5810 |
| 72 | Ga0070674_100027485 | 3300005356 | Bacteria | 3729 |
| 73 | Ga0070674_100043841 | 3300005356 | Bacteria | 3045 |
| 74 | Ga0070673_100000050 | 3300005364 | Bacteria | 49499 |
| 75 | Ga0070673_100006576 | 3300005364 | Bacteria | 7565 |
| 76 | Ga0070673_100016705 | 3300005364 | Bacteria | 5200 |
| 77 | Ga0070688_100001640 | 3300005365 | Bacteria | 11206 |
| 78 | Ga0070688_100007074 | 3300005365 | Bacteria | 6036 |
| 79 | Ga0070688_100036737 | 3300005365 | Bacteria | 2981 |
| 80 | Ga0070659_100012533 | 3300005366 | Bacteria | 6285 |
| 81 | Ga0070659_100037940 | 3300005366 | Bacteria | 3756 |
| 82 | Ga0070659_100039712 | 3300005366 | Bacteria | 3675 |
| 83 | Ga0070659_100042832 | 3300005366 | Bacteria | 3540 |
| 84 | Ga0070667_100006734 | 3300005367 | Bacteria | 9546 |
| 85 | Ga0070667_100015429 | 3300005367 | Bacteria | 6316 |
| 86 | Ga0070667_100033083 | 3300005367 | Bacteria | 4317 |
| 87 | Ga0070703_10001729 | 3300005406 | Bacteria | 6477 |
| 88 | Ga0070703_10002210 | 3300005406 | Bacteria | 5657 |
| 89 | Ga0070709_10000525 | 3300005434 | Bacteria | 22547 |
| 90 | Ga0070714_100005095 | 3300005435 | Bacteria | 9993 |
| 91 | Ga0070713_100001754 | 3300005436 | Bacteria | 13984 |
| 92 | Ga0070713_100178398 | 3300005436 | Bacteria | 1907 |
| 93 | Ga0070710_10001598 | 3300005437 | Bacteria | 10686 |
| 94 | Ga0070710_10069031 | 3300005437 | Bacteria | 2032 |
| 95 | Ga0070701_10000093 | 3300005438 | Bacteria | 25004 |
| 96 | Ga0070701_10021819 | 3300005438 | Bacteria | 3063 |
| 97 | Ga0070701_10022612 | 3300005438 | Bacteria | 3015 |
| 98 | Ga0070711_100016501 | 3300005439 | Bacteria | 4692 |
| 99 | Ga0070711_100051325 | 3300005439 | Bacteria | 2832 |
| 100 | Ga0070705_100003411 | 3300005440 | Bacteria | 7790 |
| 101 | Ga0070705_100009540 | 3300005440 | Bacteria | 4829 |
| 102 | Ga0070705_100101189 | 3300005440 | Bacteria | 1820 |
| 103 | Ga0070700_100009936 | 3300005441 | Bacteria | 5236 |
| 104 | Ga0070700_100010471 | 3300005441 | Bacteria | 5122 |
| 105 | Ga0070700_100014595 | 3300005441 | Bacteria | 4437 |
| 106 | Ga0070700_100016882 | 3300005441 | Bacteria | 4165 |
| 107 | Ga0070694_100009576 | 3300005444 | Bacteria | 5943 |
| 108 | Ga0070694_100019701 | 3300005444 | Bacteria | 4293 |
| 109 | Ga0070663_100030724 | 3300005455 | Bacteria | 3685 |
| 110 | Ga0070663_100090611 | 3300005455 | Bacteria | 2265 |
| 111 | Ga0070678_100001756 | 3300005456 | Bacteria | 11671 |
| 112 | Ga0070678_100015618 | 3300005456 | Bacteria | 4832 |
| 113 | Ga0070678_100133004 | 3300005456 | Bacteria | 1979 |
| 114 | Ga0070662_100003987 | 3300005457 | Bacteria | 9250 |
| 115 | Ga0070662_100009135 | 3300005457 | Bacteria | 6472 |
| 116 | Ga0070681_10001525 | 3300005458 | Bacteria | 20520 |
| 117 | Ga0070681_10001623 | 3300005458 | Bacteria | 20035 |
| 118 | Ga0070681_10030838 | 3300005458 | Bacteria | 5381 |
| 119 | Ga0070681_10149529 | 3300005458 | Bacteria | 2263 |
| 120 | Ga0068867_100001138 | 3300005459 | Bacteria | 18176 |
| 121 | Ga0068867_100012280 | 3300005459 | Bacteria | 6056 |
| 122 | Ga0068867_100035703 | 3300005459 | Bacteria | 3606 |
| 123 | Ga0070685_10000984 | 3300005466 | Bacteria | 15313 |
| 124 | Ga0070685_10007517 | 3300005466 | Bacteria | 5578 |
| 125 | Ga0070685_10017650 | 3300005466 | Bacteria | 3823 |
| 126 | Ga0070685_10029019 | 3300005466 | Bacteria | 3071 |
| 127 | Ga0070699_100001809 | 3300005518 | Bacteria | 19434 |
| 128 | Ga0070679_100012735 | 3300005530 | Bacteria | 8043 |
| 129 | Ga0070679_100054193 | 3300005530 | Bacteria | 3992 |
| 130 | Ga0070679_100091379 | 3300005530 | Bacteria | 3032 |
| 131 | Ga0070679_100139212 | 3300005530 | Bacteria | 2407 |
| 132 | Ga0070684_100029522 | 3300005535 | Bacteria | 4648 |
| 133 | Ga0070684_100035117 | 3300005535 | Bacteria | 4289 |
| 134 | Ga0070684_100067827 | 3300005535 | Bacteria | 3134 |
| 135 | Ga0070684_100076688 | 3300005535 | Bacteria | 2951 |
| 136 | Ga0070684_100086779 | 3300005535 | Bacteria | 2778 |
| 137 | Ga0070684_100090738 | 3300005535 | Bacteria | 2718 |
| 138 | Ga0068853_100002995 | 3300005539 | Bacteria | 12889 |
| 139 | Ga0068853_100073321 | 3300005539 | Bacteria | 2984 |
| 140 | Ga0070672_100003943 | 3300005543 | Bacteria | 9675 |
| 141 | Ga0070686_100009031 | 3300005544 | Bacteria | 5590 |
| 142 | Ga0070686_100016714 | 3300005544 | Bacteria | 4272 |
| 143 | Ga0070686_100021350 | 3300005544 | Bacteria | 3847 |
| 144 | Ga0070695_100000824 | 3300005545 | Bacteria | 16725 |
| 145 | Ga0070695_100002921 | 3300005545 | Bacteria | 9944 |
| 146 | Ga0070695_100017465 | 3300005545 | Bacteria | 4351 |
| 147 | Ga0070696_100000856 | 3300005546 | Bacteria | 19655 |
| 148 | Ga0070693_100001975 | 3300005547 | Bacteria | 9380 |
| 149 | Ga0070665_100244531 | 3300005548 | Bacteria | 1795 |
| 150 | Ga0070704_100002335 | 3300005549 | Bacteria | 10635 |
| 151 | Ga0070704_100002836 | 3300005549 | Bacteria | 9819 |
| 152 | Ga0070704_100006569 | 3300005549 | Bacteria | 6858 |
| 153 | Ga0070704_100039281 | 3300005549 | Bacteria | 3248 |
| 154 | Ga0068855_100015755 | 3300005563 | Bacteria | 9093 |
| 155 | Ga0070664_100024583 | 3300005564 | Bacteria | 4985 |
| 156 | Ga0070664_100037892 | 3300005564 | Bacteria | 4055 |
| 157 | Ga0070664_100079318 | 3300005564 | Bacteria | 2826 |
| 158 | Ga0068857_100008305 | 3300005577 | Bacteria | 8971 |
| 159 | Ga0068857_100043792 | 3300005577 | Bacteria | 3970 |
| 160 | Ga0068854_100003868 | 3300005578 | Bacteria | 9383 |
| 161 | Ga0068854_100015449 | 3300005578 | Bacteria | 5057 |
| 162 | Ga0068854_100063690 | 3300005578 | Bacteria | 2677 |
| 163 | Ga0068854_100072375 | 3300005578 | Bacteria | 2524 |
| 164 | Ga0068856_100003821 | 3300005614 | Bacteria | 15095 |
| 165 | Ga0068856_100058666 | 3300005614 | Bacteria | 3801 |
| 166 | Ga0070702_100000497 | 3300005615 | Bacteria | 14109 |
| 167 | Ga0070702_100006109 | 3300005615 | Bacteria | 5676 |
| 168 | Ga0070702_100084461 | 3300005615 | Bacteria | 1909 |
| 169 | Ga0068852_100001222 | 3300005616 | Bacteria | 17091 |
| 170 | Ga0068852_100063725 | 3300005616 | Bacteria | 3210 |
| 171 | Ga0068859_100021148 | 3300005617 | Bacteria | 6529 |
| 172 | Ga0068859_100023550 | 3300005617 | Bacteria | 6179 |
| 173 | Ga0068859_100025814 | 3300005617 | Bacteria | 5895 |
| 174 | Ga0068859_100034357 | 3300005617 | Bacteria | 5089 |
| 175 | Ga0068859_100038671 | 3300005617 | Bacteria | 4786 |
| 176 | Ga0068864_100001074 | 3300005618 | Bacteria | 22938 |
| 177 | Ga0068864_100006339 | 3300005618 | Bacteria | 9703 |
| 178 | Ga0068864_100012258 | 3300005618 | Bacteria | 7084 |
| 179 | Ga0068864_100042649 | 3300005618 | Bacteria | 3883 |
| 180 | Ga0068864_100048003 | 3300005618 | Bacteria | 3670 |
| 181 | Ga0068864_100157672 | 3300005618 | Bacteria | 2061 |
| 182 | Ga0068866_10005659 | 3300005718 | Bacteria | 5176 |
| 183 | Ga0068866_10006999 | 3300005718 | Bacteria | 4713 |
| 184 | Ga0068866_10068047 | 3300005718 | Bacteria | 1871 |
| 185 | Ga0068861_100001328 | 3300005719 | Bacteria | 15509 |
| 186 | Ga0068861_100016726 | 3300005719 | Bacteria | 5195 |
| 187 | Ga0068861_100017632 | 3300005719 | Bacteria | 5074 |
| 188 | Ga0068870_10000051 | 3300005840 | Bacteria | 36782 |
| 189 | Ga0068870_10015842 | 3300005840 | Bacteria | 3587 |
| 190 | Ga0068863_100008364 | 3300005841 | Bacteria | 10106 |
| 191 | Ga0068863_100013387 | 3300005841 | Bacteria | 7909 |
| 192 | Ga0068863_100026590 | 3300005841 | Bacteria | 5518 |
| 193 | Ga0068863_100075045 | 3300005841 | Bacteria | 3199 |
| 194 | Ga0068858_100005147 | 3300005842 | Bacteria | 12813 |
| 195 | Ga0068858_100006251 | 3300005842 | Bacteria | 11604 |
| 196 | Ga0068858_100034414 | 3300005842 | Bacteria | 4699 |
| 197 | Ga0068858_100092885 | 3300005842 | Bacteria | 2809 |
| 198 | Ga0068860_100001825 | 3300005843 | Bacteria | 22684 |
| 199 | Ga0068860_100008760 | 3300005843 | Bacteria | 10078 |
| 200 | Ga0068860_100010661 | 3300005843 | Bacteria | 9077 |
| 201 | Ga0068860_100023546 | 3300005843 | Bacteria | 5951 |
| 202 | Ga0068860_100104445 | 3300005843 | Bacteria | 2705 |
| 203 | Ga0068860_100144787 | 3300005843 | Bacteria | 2286 |
| 204 | Ga0068862_100001949 | 3300005844 | Bacteria | 18707 |
| 205 | Ga0068862_100016670 | 3300005844 | Bacteria | 6117 |
| 206 | Ga0068862_100039768 | 3300005844 | Bacteria | 3996 |
| 207 | Ga0081455_10000081 | 3300005937 | Bacteria | 103752 |
| 208 | Ga0081455_10002198 | 3300005937 | Bacteria | 23233 |
| 209 | Ga0081538_10059304 | 3300005981 | Bacteria | 2211 |
| 210 | Ga0081538_10081004 | 3300005981 | Bacteria | 1729 |
| 211 | Ga0081540_1000007 | 3300005983 | Bacteria | 205328 |
| 212 | Ga0081540_1004024 | 3300005983 | Bacteria | 11383 |
| 213 | Ga0075365_10126900 | 3300006038 | Bacteria | 1763 |
| 214 | Ga0075368_10005879 | 3300006042 | Bacteria | 4248 |
| 215 | Ga0075368_10014120 | 3300006042 | Bacteria | 2945 |
| 216 | Ga0070715_10000551 | 3300006163 | Bacteria | 9852 |
| 217 | Ga0070716_100001287 | 3300006173 | Bacteria | 11081 |
| 218 | Ga0070712_100004737 | 3300006175 | Bacteria | 8411 |
| 219 | Ga0075367_10018956 | 3300006178 | Bacteria | 3806 |
| 220 | Ga0075427_10000603 | 3300006194 | Bacteria | 4197 |
| 221 | Ga0075366_10012326 | 3300006195 | Bacteria | 4847 |
| 222 | Ga0097621_100001496 | 3300006237 | Bacteria | 16030 |
| 223 | Ga0075370_10042438 | 3300006353 | Bacteria | 2570 |
| 224 | Ga0068871_100003134 | 3300006358 | Bacteria | 11345 |
| 225 | Ga0068871_100023904 | 3300006358 | Bacteria | 4735 |
| 226 | Ga0068871_100065268 | 3300006358 | Bacteria | 2981 |
| 227 | Ga0068871_100081876 | 3300006358 | Bacteria | 2675 |
| 228 | Ga0068871_100251808 | 3300006358 | Bacteria | 1539 |
| 229 | Ga0075428_100000740 | 3300006844 | Bacteria | 33927 |
| 230 | Ga0075428_100024539 | 3300006844 | Bacteria | 6672 |
| 231 | Ga0075430_100006097 | 3300006846 | Bacteria | 10161 |
| 232 | Ga0075430_100013350 | 3300006846 | Bacteria | 7000 |
| 233 | Ga0075430_100016809 | 3300006846 | Bacteria | 6231 |
| 234 | Ga0075431_100000870 | 3300006847 | Bacteria | 26533 |
| 235 | Ga0075431_100001076 | 3300006847 | Bacteria | 24422 |
| 236 | Ga0075431_100007719 | 3300006847 | Bacteria | 10714 |
| 237 | Ga0075431_100042948 | 3300006847 | Bacteria | 4664 |
| 238 | Ga0075431_100149874 | 3300006847 | Bacteria | 2402 |
| 239 | Ga0075431_100195337 | 3300006847 | Bacteria | 2072 |
| 240 | Ga0075433_10000012 | 3300006852 | Bacteria | 71065 |
| 241 | Ga0075433_10025668 | 3300006852 | Bacteria | 4983 |
| 242 | Ga0075434_100003201 | 3300006871 | Bacteria | 14596 |
| 243 | Ga0075434_100007032 | 3300006871 | Bacteria | 10380 |
| 244 | Ga0075434_100008056 | 3300006871 | Bacteria | 9773 |
| 245 | Ga0075434_100012519 | 3300006871 | Bacteria | 8046 |
| 246 | Ga0075434_100054628 | 3300006871 | Bacteria | 3967 |
| 247 | Ga0075429_100000098 | 3300006880 | Bacteria | 47888 |
| 248 | Ga0075429_100004032 | 3300006880 | Bacteria | 12577 |
| 249 | Ga0068865_100003854 | 3300006881 | Bacteria | 8992 |
| 250 | Ga0068865_100016325 | 3300006881 | Bacteria | 4750 |
| 251 | Ga0097620_100021146 | 3300006931 | Bacteria | 6529 |
| 252 | Ga0097620_100023550 | 3300006931 | Bacteria | 6179 |
| 253 | Ga0097620_100025814 | 3300006931 | Bacteria | 5895 |
| 254 | Ga0097620_100034355 | 3300006931 | Bacteria | 5089 |
| 255 | Ga0097620_100038673 | 3300006931 | Bacteria | 4786 |
| 256 | Ga0075435_100028671 | 3300007076 | Bacteria | 4367 |
| 257 | Ga0075435_100069072 | 3300007076 | Bacteria | 2880 |
| 258 | Ga0105250_10040014 | 3300009092 | Bacteria | 1880 |
| 259 | Ga0111539_10000757 | 3300009094 | Bacteria | 42016 |
| 260 | Ga0111539_10001671 | 3300009094 | Bacteria | 29561 |
| 261 | Ga0111539_10005127 | 3300009094 | Bacteria | 16990 |
| 262 | Ga0111539_10008480 | 3300009094 | Bacteria | 13063 |
| 263 | Ga0111539_10051044 | 3300009094 | Bacteria | 4927 |
| 264 | Ga0111539_10100128 | 3300009094 | Bacteria | 3403 |
| 265 | Ga0111539_10150020 | 3300009094 | Bacteria | 2729 |
| 266 | Ga0105245_10002488 | 3300009098 | Bacteria | 16638 |
| 267 | Ga0105245_10050094 | 3300009098 | Bacteria | 3741 |
| 268 | Ga0105245_10182552 | 3300009098 | Bacteria | 2005 |
| 269 | Ga0105247_10006103 | 3300009101 | Bacteria | 7490 |
| 270 | Ga0105247_10008404 | 3300009101 | Bacteria | 6293 |
| 271 | Ga0105247_10016894 | 3300009101 | Bacteria | 4375 |
| 272 | Ga0105247_10036684 | 3300009101 | Bacteria | 2988 |
| 273 | Ga0114129_10000025 | 3300009147 | Bacteria | 116480 |
| 274 | Ga0114129_10008949 | 3300009147 | Bacteria | 14268 |
| 275 | Ga0114129_10016369 | 3300009147 | Bacteria | 10556 |
| 276 | Ga0114129_10019966 | 3300009147 | Bacteria | 9538 |
| 277 | Ga0114129_10023567 | 3300009147 | Bacteria | 8725 |
| 278 | Ga0114129_10050640 | 3300009147 | Bacteria | 5833 |
| 279 | Ga0114129_10233598 | 3300009147 | Bacteria | 2476 |
| 280 | Ga0105243_10003214 | 3300009148 | Bacteria | 13370 |
| 281 | Ga0105243_10009303 | 3300009148 | Bacteria | 7494 |
| 282 | Ga0105243_10031611 | 3300009148 | Bacteria | 4081 |
| 283 | Ga0105241_10004876 | 3300009174 | Bacteria | 9894 |
| 284 | Ga0105241_10005826 | 3300009174 | Bacteria | 9097 |
| 285 | Ga0105241_10065776 | 3300009174 | Bacteria | 2802 |
| 286 | Ga0105242_10002016 | 3300009176 | Bacteria | 15990 |
| 287 | Ga0105242_10003519 | 3300009176 | Bacteria | 12173 |
| 288 | Ga0105242_10041795 | 3300009176 | Bacteria | 3699 |
| 289 | Ga0105242_10069916 | 3300009176 | Bacteria | 2909 |
| 290 | Ga0105242_10108685 | 3300009176 | Bacteria | 2361 |
| 291 | Ga0105248_10003871 | 3300009177 | Bacteria | 16548 |
| 292 | Ga0105248_10099691 | 3300009177 | Bacteria | 3273 |
| 293 | Ga0105248_10315006 | 3300009177 | Bacteria | 1762 |
| 294 | Ga0105237_10006016 | 3300009545 | Bacteria | 13574 |
| 295 | Ga0105237_10043192 | 3300009545 | Bacteria | 4542 |
| 296 | Ga0105237_10078801 | 3300009545 | Bacteria | 3284 |
| 297 | Ga0105237_10095030 | 3300009545 | Bacteria | 2970 |
| 298 | Ga0105238_10054187 | 3300009551 | Bacteria | 4029 |
| 299 | Ga0105238_10054673 | 3300009551 | Bacteria | 4008 |
| 300 | Ga0105249_10001193 | 3300009553 | Bacteria | 22912 |
| 301 | Ga0105249_10001979 | 3300009553 | Bacteria | 17784 |
| 302 | Ga0105249_10108889 | 3300009553 | Bacteria | 2616 |
| 303 | Ga0105239_10027649 | 3300010375 | Bacteria | 6241 |
| 304 | Ga0105239_10035856 | 3300010375 | Bacteria | 5446 |
| 305 | Ga0105239_10038572 | 3300010375 | Bacteria | 5236 |
| 306 | Ga0105239_10041876 | 3300010375 | Bacteria | 5019 |
| 307 | Ga0105246_10000231 | 3300011119 | Bacteria | 28580 |
| 308 | Ga0105246_10015760 | 3300011119 | Bacteria | 4778 |
| 309 | Ga0105246_10117462 | 3300011119 | Bacteria | 1965 |
| 310 | Ga0157373_10010248 | 3300013100 | Bacteria | 6904 |
| 311 | Ga0157373_10102676 | 3300013100 | Bacteria | 2012 |
| 312 | Ga0157373_10111698 | 3300013100 | Bacteria | 1921 |
| 313 | Ga0157371_10025479 | 3300013102 | Bacteria | 4310 |
| 314 | Ga0157370_10150497 | 3300013104 | Bacteria | 2166 |
| 315 | Ga0157374_10003239 | 3300013296 | Bacteria | 13672 |
| 316 | Ga0157374_10013309 | 3300013296 | Bacteria | 7178 |
| 317 | Ga0157374_10017421 | 3300013296 | Bacteria | 6324 |
| 318 | Ga0157374_10031696 | 3300013296 | Bacteria | 4807 |
| 319 | Ga0157378_10004453 | 3300013297 | Bacteria | 12317 |
| 320 | Ga0157378_10010612 | 3300013297 | Bacteria | 8051 |
| 321 | Ga0157378_10020673 | 3300013297 | Bacteria | 5790 |
| 322 | Ga0157378_10021915 | 3300013297 | Bacteria | 5619 |
| 323 | Ga0163162_10006149 | 3300013306 | Bacteria | 11621 |
| 324 | Ga0163162_10020738 | 3300013306 | Bacteria | 6461 |
| 325 | Ga0163162_10026579 | 3300013306 | Bacteria | 5722 |
| 326 | Ga0157372_10025465 | 3300013307 | Bacteria | 6433 |
| 327 | Ga0157372_10121031 | 3300013307 | Bacteria | 3006 |
| 328 | Ga0157375_10006518 | 3300013308 | Bacteria | 10160 |
| 329 | Ga0157375_10033972 | 3300013308 | Bacteria | 4853 |
| 330 | Ga0157375_10053687 | 3300013308 | Bacteria | 3967 |
| 331 | Ga0157375_10100999 | 3300013308 | Bacteria | 2966 |
| 332 | Ga0157375_10119222 | 3300013308 | Bacteria | 2746 |
| 333 | Ga0157375_10237394 | 3300013308 | Bacteria | 1982 |
| 334 | Ga0163163_10001320 | 3300014325 | Bacteria | 20935 |
| 335 | Ga0163163_10015790 | 3300014325 | Bacteria | 6993 |
| 336 | Ga0163163_10051326 | 3300014325 | Bacteria | 4067 |
| 337 | Ga0163163_10093775 | 3300014325 | Bacteria | 3019 |
| 338 | Ga0163163_10168581 | 3300014325 | Bacteria | 2236 |
| 339 | Ga0157380_10002744 | 3300014326 | Bacteria | 11948 |
| 340 | Ga0157380_10065721 | 3300014326 | Bacteria | 2916 |
| 341 | Ga0157380_10195500 | 3300014326 | Bacteria | 1790 |
| 342 | Ga0157377_10000164 | 3300014745 | Bacteria | 39592 |
| 343 | Ga0157379_10020078 | 3300014968 | Bacteria | 5905 |
| 344 | Ga0157379_10030909 | 3300014968 | Bacteria | 4770 |
| 345 | Ga0157379_10061490 | 3300014968 | Bacteria | 3358 |
| 346 | Ga0157379_10064966 | 3300014968 | Bacteria | 3261 |
| 347 | Ga0157376_10002102 | 3300014969 | Bacteria | 13394 |
| 348 | Ga0157376_10036456 | 3300014969 | Bacteria | 3984 |
| 349 | Ga0157376_10036479 | 3300014969 | Bacteria | 3983 |
| 350 | Ga0157376_10088277 | 3300014969 | Bacteria | 2678 |
| 351 | Ga0157376_10204657 | 3300014969 | Bacteria | 1819 |
| 352 | Ga0163161_10002837 | 3300017792 | Bacteria | 12295 |
| 353 | Ga0163161_10114468 | 3300017792 | Bacteria | 2020 |
| 354 | Ga0163161_10131060 | 3300017792 | Bacteria | 1891 |
| 355 | Ga0213876_10025328 | 3300021384 | Bacteria | 3130 |
| 356 | Ga0207666_1000051 | 3300025271 | Bacteria | 21813 |
| 357 | Ga0209758_1000125 | 3300025297 | Bacteria | 189869 |
| 358 | Ga0207697_10000662 | 3300025315 | Bacteria | 19563 |
| 359 | Ga0207653_10000546 | 3300025885 | Bacteria | 13918 |
| 360 | Ga0207653_10001467 | 3300025885 | Bacteria | 7655 |
| 361 | Ga0207682_10000072 | 3300025893 | Bacteria | 44659 |
| 362 | Ga0207692_10002147 | 3300025898 | Bacteria | 7536 |
| 363 | Ga0207642_10001909 | 3300025899 | Bacteria | 6431 |
| 364 | Ga0207642_10039428 | 3300025899 | Bacteria | 2052 |
| 365 | Ga0207710_10000558 | 3300025900 | Bacteria | 22251 |
| 366 | Ga0207710_10004313 | 3300025900 | Bacteria | 6228 |
| 367 | Ga0207710_10035227 | 3300025900 | Bacteria | 2202 |
| 368 | Ga0207688_10000229 | 3300025901 | Bacteria | 25389 |
| 369 | Ga0207688_10000998 | 3300025901 | Bacteria | 14427 |
| 370 | Ga0207688_10004677 | 3300025901 | Bacteria | 7461 |
| 371 | Ga0207680_10001283 | 3300025903 | Bacteria | 11893 |
| 372 | Ga0207680_10092650 | 3300025903 | Bacteria | 1925 |
| 373 | Ga0207647_10003353 | 3300025904 | Bacteria | 12014 |
| 374 | Ga0207647_10010679 | 3300025904 | Bacteria | 6473 |
| 375 | Ga0207647_10011089 | 3300025904 | Bacteria | 6334 |
| 376 | Ga0207685_10001607 | 3300025905 | Bacteria | 4832 |
| 377 | Ga0207685_10003975 | 3300025905 | Bacteria | 3682 |
| 378 | Ga0207699_10002080 | 3300025906 | Bacteria | 9455 |
| 379 | Ga0207699_10015546 | 3300025906 | Bacteria | 3956 |
| 380 | Ga0207645_10000966 | 3300025907 | Bacteria | 23780 |
| 381 | Ga0207645_10007388 | 3300025907 | Bacteria | 7770 |
| 382 | Ga0207645_10023155 | 3300025907 | Bacteria | 4037 |
| 383 | Ga0207645_10059737 | 3300025907 | Bacteria | 2435 |
| 384 | Ga0207643_10000004 | 3300025908 | Bacteria | 187006 |
| 385 | Ga0207643_10000794 | 3300025908 | Bacteria | 19261 |
| 386 | Ga0207643_10004896 | 3300025908 | Bacteria | 7167 |
| 387 | Ga0207643_10031046 | 3300025908 | Bacteria | 2977 |
| 388 | Ga0207643_10065728 | 3300025908 | Bacteria | 2078 |
| 389 | Ga0207654_10001472 | 3300025911 | Bacteria | 12448 |
| 390 | Ga0207654_10007425 | 3300025911 | Bacteria | 5521 |
| 391 | Ga0207707_10007028 | 3300025912 | Bacteria | 9814 |
| 392 | Ga0207707_10065564 | 3300025912 | Bacteria | 3163 |
| 393 | Ga0207671_10013159 | 3300025914 | Bacteria | 6607 |
| 394 | Ga0207671_10020766 | 3300025914 | Bacteria | 4995 |
| 395 | Ga0207671_10048003 | 3300025914 | Bacteria | 3159 |
| 396 | Ga0207693_10006880 | 3300025915 | Bacteria | 9393 |
| 397 | Ga0207693_10027450 | 3300025915 | Bacteria | 4501 |
| 398 | Ga0207693_10161096 | 3300025915 | Bacteria | 1765 |
| 399 | Ga0207663_10010875 | 3300025916 | Bacteria | 4861 |
| 400 | Ga0207663_10017354 | 3300025916 | Bacteria | 4009 |
| 401 | Ga0207660_10000648 | 3300025917 | Bacteria | 23454 |
| 402 | Ga0207660_10092613 | 3300025917 | Bacteria | 2243 |
| 403 | Ga0207662_10000317 | 3300025918 | Bacteria | 21877 |
| 404 | Ga0207662_10000424 | 3300025918 | Bacteria | 18665 |
| 405 | Ga0207662_10013378 | 3300025918 | Bacteria | 4589 |
| 406 | Ga0207662_10023881 | 3300025918 | Bacteria | 3515 |
| 407 | Ga0207662_10032770 | 3300025918 | Bacteria | 3026 |
| 408 | Ga0207662_10064039 | 3300025918 | Bacteria | 2211 |
| 409 | Ga0207662_10091114 | 3300025918 | Bacteria | 1875 |
| 410 | Ga0207657_10002047 | 3300025919 | Bacteria | 21819 |
| 411 | Ga0207657_10028849 | 3300025919 | Bacteria | 5056 |
| 412 | Ga0207649_10000262 | 3300025920 | Bacteria | 41689 |
| 413 | Ga0207649_10090257 | 3300025920 | Bacteria | 2005 |
| 414 | Ga0207652_10000911 | 3300025921 | Bacteria | 27891 |
| 415 | Ga0207652_10067950 | 3300025921 | Bacteria | 3091 |
| 416 | Ga0207681_10010634 | 3300025923 | Bacteria | 5643 |
| 417 | Ga0207694_10024208 | 3300025924 | Bacteria | 4609 |
| 418 | Ga0207650_10013694 | 3300025925 | Bacteria | 5623 |
| 419 | Ga0207650_10019548 | 3300025925 | Bacteria | 4762 |
| 420 | Ga0207659_10001684 | 3300025926 | Bacteria | 13118 |
| 421 | Ga0207659_10012218 | 3300025926 | Bacteria | 5451 |
| 422 | Ga0207659_10024969 | 3300025926 | Bacteria | 4011 |
| 423 | Ga0207687_10001501 | 3300025927 | Bacteria | 15981 |
| 424 | Ga0207687_10006389 | 3300025927 | Bacteria | 7789 |
| 425 | Ga0207687_10017936 | 3300025927 | Bacteria | 4670 |
| 426 | Ga0207700_10001264 | 3300025928 | Bacteria | 14408 |
| 427 | Ga0207700_10218925 | 3300025928 | Bacteria | 1613 |
| 428 | Ga0207664_10002547 | 3300025929 | Bacteria | 12049 |
| 429 | Ga0207664_10183287 | 3300025929 | Bacteria | 1798 |
| 430 | Ga0207644_10000467 | 3300025931 | Bacteria | 26087 |
| 431 | Ga0207644_10001961 | 3300025931 | Bacteria | 13297 |
| 432 | Ga0207644_10015484 | 3300025931 | Bacteria | 5120 |
| 433 | Ga0207644_10025194 | 3300025931 | Bacteria | 4089 |
| 434 | Ga0207644_10092872 | 3300025931 | Bacteria | 2252 |
| 435 | Ga0207690_10001228 | 3300025932 | Bacteria | 16182 |
| 436 | Ga0207690_10009138 | 3300025932 | Bacteria | 5883 |
| 437 | Ga0207690_10137132 | 3300025932 | Bacteria | 1798 |
| 438 | Ga0207706_10001679 | 3300025933 | Bacteria | 21866 |
| 439 | Ga0207706_10007881 | 3300025933 | Bacteria | 9829 |
| 440 | Ga0207706_10018822 | 3300025933 | Bacteria | 6211 |
| 441 | Ga0207706_10054074 | 3300025933 | Bacteria | 3543 |
| 442 | Ga0207706_10203437 | 3300025933 | Bacteria | 1736 |
| 443 | Ga0207686_10002040 | 3300025934 | Bacteria | 11131 |
| 444 | Ga0207686_10009318 | 3300025934 | Bacteria | 5323 |
| 445 | Ga0207686_10017951 | 3300025934 | Bacteria | 3998 |
| 446 | Ga0207686_10099188 | 3300025934 | Bacteria | 1941 |
| 447 | Ga0207709_10035318 | 3300025935 | Bacteria | 2954 |
| 448 | Ga0207709_10102649 | 3300025935 | Bacteria | 1894 |
| 449 | Ga0207670_10000377 | 3300025936 | Bacteria | 25697 |
| 450 | Ga0207670_10002370 | 3300025936 | Bacteria | 9867 |
| 451 | Ga0207670_10003054 | 3300025936 | Bacteria | 8831 |
| 452 | Ga0207670_10037467 | 3300025936 | Bacteria | 3160 |
| 453 | Ga0207670_10170453 | 3300025936 | Bacteria | 1632 |
| 454 | Ga0207669_10001912 | 3300025937 | Bacteria | 8835 |
| 455 | Ga0207669_10015439 | 3300025937 | Bacteria | 3851 |
| 456 | Ga0207669_10017896 | 3300025937 | Bacteria | 3648 |
| 457 | Ga0207669_10031185 | 3300025937 | Bacteria | 2975 |
| 458 | Ga0207704_10002613 | 3300025938 | Bacteria | 8128 |
| 459 | Ga0207704_10174333 | 3300025938 | Bacteria | 1546 |
| 460 | Ga0207665_10001035 | 3300025939 | Bacteria | 18728 |
| 461 | Ga0207665_10043619 | 3300025939 | Bacteria | 2999 |
| 462 | Ga0207665_10056180 | 3300025939 | Bacteria | 2657 |
| 463 | Ga0207665_10067562 | 3300025939 | Bacteria | 2434 |
| 464 | Ga0207691_10002691 | 3300025940 | Bacteria | 17379 |
| 465 | Ga0207691_10002874 | 3300025940 | Bacteria | 16780 |
| 466 | Ga0207711_10003410 | 3300025941 | Bacteria | 13758 |
| 467 | Ga0207711_10006776 | 3300025941 | Bacteria | 9628 |
| 468 | Ga0207711_10022868 | 3300025941 | Bacteria | 5232 |
| 469 | Ga0207711_10030274 | 3300025941 | Bacteria | 4565 |
| 470 | Ga0207689_10000203 | 3300025942 | Bacteria | 52425 |
| 471 | Ga0207689_10022711 | 3300025942 | Bacteria | 5270 |
| 472 | Ga0207689_10044138 | 3300025942 | Bacteria | 3685 |
| 473 | Ga0207689_10045948 | 3300025942 | Bacteria | 3610 |
| 474 | Ga0207661_10002165 | 3300025944 | Bacteria | 13530 |
| 475 | Ga0207661_10014563 | 3300025944 | Bacteria | 5769 |
| 476 | Ga0207679_10000157 | 3300025945 | Bacteria | 56166 |
| 477 | Ga0207679_10015012 | 3300025945 | Bacteria | 5106 |
| 478 | Ga0207679_10158473 | 3300025945 | Bacteria | 1851 |
| 479 | Ga0207667_10220437 | 3300025949 | Bacteria | 1943 |
| 480 | Ga0207651_10008897 | 3300025960 | Bacteria | 5454 |
| 481 | Ga0207712_10002224 | 3300025961 | Bacteria | 12622 |
| 482 | Ga0207712_10003965 | 3300025961 | Bacteria | 9349 |
| 483 | Ga0207712_10039070 | 3300025961 | Bacteria | 3250 |
| 484 | Ga0207668_10017144 | 3300025972 | Bacteria | 4532 |
| 485 | Ga0207668_10055993 | 3300025972 | Bacteria | 2744 |
| 486 | Ga0207668_10109409 | 3300025972 | Bacteria | 2070 |
| 487 | Ga0207640_10043680 | 3300025981 | Bacteria | 2866 |
| 488 | Ga0207658_10005748 | 3300025986 | Bacteria | 8483 |
| 489 | Ga0207658_10008052 | 3300025986 | Bacteria | 7181 |
| 490 | Ga0207658_10048495 | 3300025986 | Bacteria | 3114 |
| 491 | Ga0207658_10167123 | 3300025986 | Bacteria | 1808 |
| 492 | Ga0207677_10001675 | 3300026023 | Bacteria | 11738 |
| 493 | Ga0207677_10006260 | 3300026023 | Bacteria | 6510 |
| 494 | Ga0207703_10001346 | 3300026035 | Bacteria | 22503 |
| 495 | Ga0207703_10001852 | 3300026035 | Bacteria | 18819 |
| 496 | Ga0207703_10032158 | 3300026035 | Bacteria | 4151 |
| 497 | Ga0207639_10008211 | 3300026041 | Bacteria | 7147 |
| 498 | Ga0207678_10001809 | 3300026067 | Bacteria | 19589 |
| 499 | Ga0207678_10001884 | 3300026067 | Bacteria | 19130 |
| 500 | Ga0207678_10011488 | 3300026067 | Bacteria | 7777 |
| 501 | Ga0207678_10013053 | 3300026067 | Bacteria | 7289 |
| 502 | Ga0207678_10034212 | 3300026067 | Bacteria | 4426 |
| 503 | Ga0207678_10034731 | 3300026067 | Bacteria | 4391 |
| 504 | Ga0207678_10041672 | 3300026067 | Bacteria | 3981 |
| 505 | Ga0207708_10000784 | 3300026075 | Bacteria | 23952 |
| 506 | Ga0207708_10001199 | 3300026075 | Bacteria | 19559 |
| 507 | Ga0207708_10003067 | 3300026075 | Bacteria | 12308 |
| 508 | Ga0207708_10004901 | 3300026075 | Bacteria | 9865 |
| 509 | Ga0207708_10014093 | 3300026075 | Bacteria | 5974 |
| 510 | Ga0207702_10003404 | 3300026078 | Bacteria | 14557 |
| 511 | Ga0207702_10068697 | 3300026078 | Bacteria | 3045 |
| 512 | Ga0207641_10006871 | 3300026088 | Bacteria | 9524 |
| 513 | Ga0207641_10011257 | 3300026088 | Bacteria | 7337 |
| 514 | Ga0207641_10041334 | 3300026088 | Bacteria | 3863 |
| 515 | Ga0207648_10002073 | 3300026089 | Bacteria | 21861 |
| 516 | Ga0207648_10002310 | 3300026089 | Bacteria | 20581 |
| 517 | Ga0207648_10016984 | 3300026089 | Bacteria | 6632 |
| 518 | Ga0207648_10027663 | 3300026089 | Bacteria | 5032 |
| 519 | Ga0207676_10000990 | 3300026095 | Bacteria | 21882 |
| 520 | Ga0207676_10002295 | 3300026095 | Bacteria | 13719 |
| 521 | Ga0207676_10002940 | 3300026095 | Bacteria | 12143 |
| 522 | Ga0207676_10048845 | 3300026095 | Bacteria | 3287 |
| 523 | Ga0207676_10184700 | 3300026095 | Bacteria | 1829 |
| 524 | Ga0207674_10000897 | 3300026116 | Bacteria | 38907 |
| 525 | Ga0207674_10011740 | 3300026116 | Bacteria | 9828 |
| 526 | Ga0207675_100001726 | 3300026118 | Bacteria | 21899 |
| 527 | Ga0207675_100002371 | 3300026118 | Bacteria | 18651 |
| 528 | Ga0207675_100005453 | 3300026118 | Bacteria | 12188 |
| 529 | Ga0207683_10000824 | 3300026121 | Bacteria | 28453 |
| 530 | Ga0207683_10001176 | 3300026121 | Bacteria | 23694 |
| 531 | Ga0207683_10014019 | 3300026121 | Bacteria | 6834 |
| 532 | Ga0207683_10018096 | 3300026121 | Bacteria | 6008 |
| 533 | Ga0207683_10081706 | 3300026121 | Bacteria | 2869 |
| 534 | Ga0207683_10185428 | 3300026121 | Bacteria | 1888 |
| 535 | Ga0207698_10003743 | 3300026142 | Bacteria | 9193 |
| 536 | Ga0207698_10024746 | 3300026142 | Bacteria | 4219 |
| 537 | Ga0210002_1003362 | 3300027617 | Bacteria | 2352 |
| 538 | Ga0209966_1000247 | 3300027695 | Bacteria | 19895 |
| 539 | Ga0209998_10000255 | 3300027717 | Bacteria | 17497 |
| 540 | Ga0209998_10001128 | 3300027717 | Bacteria | 6625 |
| 541 | Ga0209974_10001489 | 3300027876 | Bacteria | 8511 |
| 542 | Ga0207428_10000137 | 3300027907 | Bacteria | 98535 |
| 543 | Ga0207428_10000792 | 3300027907 | Bacteria | 35769 |
| 544 | Ga0207428_10003106 | 3300027907 | Bacteria | 16320 |
| 545 | Ga0207428_10004572 | 3300027907 | Bacteria | 13115 |
| 546 | Ga0207428_10033074 | 3300027907 | Bacteria | 4249 |
| 547 | Ga0207428_10072105 | 3300027907 | Bacteria | 2712 |
| 548 | Ga0268266_10005095 | 3300028379 | Bacteria | 12383 |
| 549 | Ga0268266_10023244 | 3300028379 | Bacteria | 5278 |
| 550 | Ga0268266_10046625 | 3300028379 | Bacteria | 3710 |
| 551 | Ga0268265_10012344 | 3300028380 | Bacteria | 5788 |
| 552 | Ga0268265_10029470 | 3300028380 | Bacteria | 3939 |
| 553 | Ga0268265_10085418 | 3300028380 | Bacteria | 2504 |
| 554 | Ga0268264_10002039 | 3300028381 | Bacteria | 18053 |
| 555 | Ga0268264_10016623 | 3300028381 | Bacteria | 6024 |
| 556 | Ga0268264_10062447 | 3300028381 | Bacteria | 3128 |
| 557 | Ga0268264_10081157 | 3300028381 | Bacteria | 2771 |
| 558 | Ga0265330_10047685 | 3300031235 | Bacteria | 1885 |
| 559 | Ga0265325_10000073 | 3300031241 | Bacteria | 70109 |
| 560 | Ga0265325_10000234 | 3300031241 | Bacteria | 39472 |
| 561 | Ga0265325_10002177 | 3300031241 | Bacteria | 13332 |
| 562 | Ga0265325_10004094 | 3300031241 | Bacteria | 9289 |
| 563 | Ga0265340_10021850 | 3300031247 | Bacteria | 3277 |
| 564 | Ga0265339_10001513 | 3300031249 | Bacteria | 17175 |
| 565 | Ga0265316_10024489 | 3300031344 | Bacteria | 5056 |
| 566 | Ga0265313_10000326 | 3300031595 | Bacteria | 51836 |
| 567 | Ga0265313_10008870 | 3300031595 | Bacteria | 6619 |
| 568 | Ga0265313_10040748 | 3300031595 | Bacteria | 2293 |
| 569 | Ga0373948_0000061 | 3300034817 | Bacteria | 11538 |
| 570 | Ga0373958_0000048 | 3300034819 | Bacteria | 11955 |
| 571 | Ga0373958_0001634 | 3300034819 | Bacteria | 3043 |
| 572 | Ga0373926_0003985 | 3300035083 | Bacteria | 4827 |
| 573 | Ga0373928_0000291 | 3300035084 | Bacteria | 9922 |
| 574 | Ga0373928_0008797 | 3300035084 | Bacteria | 1965 |
| 575 | Ga0373929_0000564 | 3300035085 | Bacteria | 7143 |
| 576 | Ga0373929_0005244 | 3300035085 | Bacteria | 2331 |
| 577 | Ga0373934_0020853 | 3300035086 | Bacteria | 2522 |
| 578 | Ga0373940_0000023 | 3300035088 | Bacteria | 16767 |
| 579 | Ga0373940_0010533 | 3300035088 | Bacteria | 2176 |
| 580 | Ga0373940_0012296 | 3300035088 | Bacteria | 2049 |
| 581 | Ga0373949_0001146 | 3300035090 | Bacteria | 7970 |
| 582 | Ga0373951_0000876 | 3300035091 | Bacteria | 8125 |
| 583 | Ga0373951_0005478 | 3300035091 | Bacteria | 2948 |
| 584 | Ga0373923_0000851 | 3300035111 | Bacteria | 8076 |
| 585 | Ga0373923_0003216 | 3300035111 | Bacteria | 5195 |
| 586 | Ga0373936_0001660 | 3300035113 | Bacteria | 8158 |
| 587 | Ga0373939_0000663 | 3300035114 | Bacteria | 8540 |
| 588 | Ga0373939_0002651 | 3300035114 | Bacteria | 4201 |
| 589 | Ga0373941_0000309 | 3300035115 | Bacteria | 9451 |
| 590 | Ga0373945_0000277 | 3300035116 | Bacteria | 14473 |
| 591 | Ga0373945_0001390 | 3300035116 | Bacteria | 7348 |
| 592 | Ga0373953_0068438 | 3300035117 | Bacteria | 1461 |
| 593 | Ga0373954_0005333 | 3300035118 | Bacteria | 5557 |
| 594 | Ga0373954_0014688 | 3300035118 | Bacteria | 3493 |
| 595 | Ga0373960_0001082 | 3300035121 | Bacteria | 5885 |
| 596 | Ga0373960_0003571 | 3300035121 | Bacteria | 3527 |
| 597 | Ga0373960_0003751 | 3300035121 | Bacteria | 3453 |
| 598 | Ga0373943_0004971 | 3300035170 | Bacteria | 6002 |
| 599 | Ga0373943_0005512 | 3300035170 | Bacteria | 5690 |
| 600 | Ga0373943_0009916 | 3300035170 | Bacteria | 4268 |
| 601 | Ga0373946_0001856 | 3300035171 | Bacteria | 7374 |
| 602 | Ga0373946_0002330 | 3300035171 | Bacteria | 6718 |
| 603 | Ga0373955_0002403 | 3300035172 | Bacteria | 8160 |
| 604 | Ga0373942_0000081 | 3300035207 | Bacteria | 20661 |
| 605 | Ga0373942_0003417 | 3300035207 | Bacteria | 3733 |
| 606 | Ga0373942_0009249 | 3300035207 | Bacteria | 2304 |
| 607 | Ga0373942_0016658 | 3300035207 | Bacteria | 1805 |
| 608 | Ga0373961_0000743 | 3300035241 | Bacteria | 11267 |
| 609 | Ga0373961_0002954 | 3300035241 | Bacteria | 4297 |
| 610 | Ga0373961_0032726 | 3300035241 | Bacteria | 1460 |
| 611 | Ga0373962_0000194 | 3300035242 | Bacteria | 12882 |
| 612 | Ga0373924_0000490 | 3300035410 | Bacteria | 12118 |
| 613 | Ga0373924_0004810 | 3300035410 | Bacteria | 4747 |
| 614 | Ga0373931_0001008 | 3300035691 | Bacteria | 11924 |
| 615 | Ga0373931_0001564 | 3300035691 | Bacteria | 9881 |
| 616 | Ga0373931_0002975 | 3300035691 | Bacteria | 7569 |
| 617 | Ga0373931_0007918 | 3300035691 | Bacteria | 5027 |
| 618 | Ga0373931_0016578 | 3300035691 | Bacteria | 3629 |
| 619 | Ga0373935_0000291 | 3300035692 | Bacteria | 24802 |
| 620 | Ga0373935_0013547 | 3300035692 | Bacteria | 4922 |
| 621 | Ga0373935_0057106 | 3300035692 | Bacteria | 2490 |
| 622 | Ga0373927_0005343 | 3300035695 | Bacteria | 8880 |
| 623 | Ga0373927_0009000 | 3300035695 | Bacteria | 6703 |
| 624 | Ga0373927_0034546 | 3300035695 | Bacteria | 3289 |
| 625 | Ga0373927_0051606 | 3300035695 | Bacteria | 2659 |
| 626 | Ga0373927_0054373 | 3300035695 | Bacteria | 2590 |
| 627 | Ga0373927_0055119 | 3300035695 | Bacteria | 2571 |
| 628 | Ga0373933_0010185 | 3300035724 | Bacteria | 5149 |
| 629 | Ga0373933_0012833 | 3300035724 | Bacteria | 4633 |
| 630 | Ga0373947_0000424 | 3300035725 | Bacteria | 23999 |
| 631 | Ga0373947_0005730 | 3300035725 | Bacteria | 7243 |
| 632 | Ga0373947_0010154 | 3300035725 | Bacteria | 5407 |
| 633 | Ga0373947_0041253 | 3300035725 | Bacteria | 2751 |
| 634 | Ga0373947_0048954 | 3300035725 | Bacteria | 2537 |
| 635 | Ga0373937_0000004 | 3300036401 | Bacteria | 212269 |
| 636 | Ga0373937_0003680 | 3300036401 | Bacteria | 12949 |
| 637 | Ga0373937_0005263 | 3300036401 | Bacteria | 11048 |
| 638 | Ga0373937_0006030 | 3300036401 | Bacteria | 10436 |
| 639 | Ga0373925_0000460 | 3300037068 | Bacteria | 41057 |
| 640 | Ga0373925_0003391 | 3300037068 | Bacteria | 12354 |
| 641 | Ga0373925_0017524 | 3300037068 | Bacteria | 5192 |
| 642 | Ga0373925_0127647 | 3300037068 | Bacteria | 1980 |
| 643 | Ga0436365_0349099 | 3300039437 | Bacteria | 3604 |
| 644 | Ga0436365_1169665 | 3300039437 | Bacteria | 1720 |
| 645 | Ga0439464_0005396 | 3300042439 | Bacteria | 3304 |
| 646 | Ga0451576_0006650 | 3300045051 | Bacteria | 14107 |
| 647 | Ga0495592_0000029 | 3300046454 | Bacteria | 131879 |
| 648 | Ga0495592_0001215 | 3300046454 | Bacteria | 17883 |
| 649 | Ga0495592_0005508 | 3300046454 | Bacteria | 9360 |
| 650 | Ga0495592_0136552 | 3300046454 | Bacteria | 1710 |
| 651 | Ga0495592_0149021 | 3300046454 | Bacteria | 1620 |
| 652 | Ga0495590_0028653 | 3300046457 | Bacteria | 1953 |
| 653 | Ga0495629_0000447 | 3300046459 | Bacteria | 34326 |
| 654 | Ga0495629_0016571 | 3300046459 | Bacteria | 5290 |
| 655 | Ga0495629_0016805 | 3300046459 | Bacteria | 5251 |
| 656 | Ga0495638_0028434 | 3300046460 | Bacteria | 3611 |
| 657 | Ga0495641_0001697 | 3300046461 | Bacteria | 18404 |
| 658 | Ga0495641_0015734 | 3300046461 | Bacteria | 4019 |
| 659 | Ga0495641_0027911 | 3300046461 | Bacteria | 2737 |
| 660 | Ga0495651_0002424 | 3300046462 | Bacteria | 14396 |
| 661 | Ga0495651_0038986 | 3300046462 | Bacteria | 3699 |
| 662 | Ga0495653_0000012 | 3300046463 | Bacteria | 266880 |
| 663 | Ga0495653_0003231 | 3300046463 | Bacteria | 13066 |
| 664 | Ga0495653_0006931 | 3300046463 | Bacteria | 9309 |
| 665 | Ga0495653_0078354 | 3300046463 | Bacteria | 2451 |
| 666 | Ga0495580_0006747 | 3300046472 | Bacteria | 9313 |
| 667 | Ga0495580_0085877 | 3300046472 | Bacteria | 2191 |
| 668 | Ga0495582_0007072 | 3300046473 | Bacteria | 6234 |
| 669 | Ga0495582_0010997 | 3300046473 | Bacteria | 4982 |
| 670 | Ga0495582_0013202 | 3300046473 | Bacteria | 4545 |
| 671 | Ga0495639_0006165 | 3300046475 | Bacteria | 5148 |
| 672 | Ga0495662_0003904 | 3300046476 | Bacteria | 7520 |
| 673 | Ga0495662_0010406 | 3300046476 | Bacteria | 4557 |
| 674 | Ga0495664_0000004 | 3300046477 | Bacteria | 489411 |
| 675 | Ga0495664_0009959 | 3300046477 | Bacteria | 5332 |
| 676 | Ga0495664_0105171 | 3300046477 | Bacteria | 1702 |
| 677 | Ga0495584_0002735 | 3300046491 | Bacteria | 9877 |
| 678 | Ga0495584_0056557 | 3300046491 | Bacteria | 1974 |
| 679 | Ga0495585_0003199 | 3300046492 | Bacteria | 11181 |
| 680 | Ga0495585_0073720 | 3300046492 | Bacteria | 1858 |
| 681 | Ga0495594_0013045 | 3300046499 | Bacteria | 4333 |
| 682 | Ga0495594_0021869 | 3300046499 | Bacteria | 3416 |
| 683 | Ga0495607_0029184 | 3300046501 | Bacteria | 3397 |
| 684 | Ga0495608_0000017 | 3300046511 | Bacteria | 192929 |
| 685 | Ga0495618_0000006 | 3300046514 | Bacteria | 229906 |
| 686 | Ga0495628_0000001 | 3300046516 | Bacteria | 917742 |
| 687 | Ga0495628_0009640 | 3300046516 | Bacteria | 8239 |
| 688 | Ga0495628_0019168 | 3300046516 | Bacteria | 5658 |
| 689 | Ga0495628_0035835 | 3300046516 | Bacteria | 3985 |
| 690 | Ga0495630_0008370 | 3300046517 | Bacteria | 7424 |
| 691 | Ga0495637_0042998 | 3300046520 | Bacteria | 1931 |
| 692 | Ga0495644_0002426 | 3300046523 | Bacteria | 7434 |
| 693 | Ga0495666_0001305 | 3300046526 | Bacteria | 12056 |
| 694 | Ga0495652_0000002 | 3300046529 | Bacteria | 946606 |
| 695 | Ga0495652_0018154 | 3300046529 | Bacteria | 6278 |
| 696 | Ga0495665_0004009 | 3300046531 | Bacteria | 7939 |
| 697 | Ga0495665_0025407 | 3300046531 | Bacteria | 3182 |
| 698 | Ga0495640_0000001 | 3300046533 | Bacteria | 853827 |
| 699 | Ga0495640_0017355 | 3300046533 | Bacteria | 5366 |
| 700 | Ga0495586_0007089 | 3300046535 | Bacteria | 5973 |
| 701 | Ga0495587_0000008 | 3300046536 | Bacteria | 271097 |
| 702 | Ga0495587_0001490 | 3300046536 | Bacteria | 15605 |
| 703 | Ga0495598_0001556 | 3300046537 | Bacteria | 4597 |
| 704 | Ga0495645_0000002 | 3300046543 | Bacteria | 651644 |
| 705 | Ga0495645_0000954 | 3300046543 | Bacteria | 19779 |
| 706 | Ga0495645_0050356 | 3300046543 | Bacteria | 3032 |
| 707 | Ga0495633_0014899 | 3300046558 | Bacteria | 4044 |
| 708 | Ga0495667_0000029 | 3300046559 | Bacteria | 151568 |
| 709 | Ga0495667_0014263 | 3300046559 | Bacteria | 5367 |
| 710 | Ga0495667_0043731 | 3300046559 | Bacteria | 2967 |
| 711 | Ga0495656_0000941 | 3300046615 | Bacteria | 9423 |
| 712 | Ga0495634_0006280 | 3300046642 | Bacteria | 9051 |
| 713 | Ga0495634_0035463 | 3300046642 | Bacteria | 3416 |
| 714 | Ga0495634_0058157 | 3300046642 | Bacteria | 2578 |
| 715 | Ga0495611_0005829 | 3300046648 | Bacteria | 5256 |
| 716 | Ga0495635_0000002 | 3300046663 | Bacteria | 490490 |
| 717 | Ga0495635_0013015 | 3300046663 | Bacteria | 5824 |
| 718 | Ga0495588_0000318 | 3300046674 | Bacteria | 32296 |
| 719 | Ga0495588_0012717 | 3300046674 | Bacteria | 3987 |
| 720 | Ga0495588_0029685 | 3300046674 | Bacteria | 2745 |
| 721 | Ga0495657_0000459 | 3300046675 | Bacteria | 38116 |
| 722 | Ga0495657_0086718 | 3300046675 | Bacteria | 2016 |
| 723 | Ga0495599_0000104 | 3300046678 | Bacteria | 59442 |
| 724 | Ga0495599_0001047 | 3300046678 | Bacteria | 15552 |
| 725 | Ga0495599_0034637 | 3300046678 | Bacteria | 3171 |
| 726 | Ga0495623_0000691 | 3300046679 | Bacteria | 22400 |
| 727 | Ga0495623_0003897 | 3300046679 | Bacteria | 9840 |
| 728 | Ga0495646_0000064 | 3300046680 | Bacteria | 50992 |
| 729 | Ga0495646_0005442 | 3300046680 | Bacteria | 8047 |
| 730 | Ga0495646_0006507 | 3300046680 | Bacteria | 7412 |
| 731 | Ga0495647_0001576 | 3300046681 | Bacteria | 7039 |
| 732 | Ga0495658_0007929 | 3300046683 | Bacteria | 5258 |
| 733 | Ga0495658_0008212 | 3300046683 | Bacteria | 5170 |
| 734 | Ga0495658_0008346 | 3300046683 | Bacteria | 5130 |
| 735 | Ga0495658_0035592 | 3300046683 | Bacteria | 2741 |
| 736 | Ga0495613_0000793 | 3300046689 | Bacteria | 24573 |
| 737 | Ga0495613_0047786 | 3300046689 | Bacteria | 3161 |
| 738 | Ga0495624_0023831 | 3300046690 | Bacteria | 4032 |
| 739 | Ga0495600_0000010 | 3300046809 | Bacteria | 143675 |
| 740 | Ga0495600_0032708 | 3300046809 | Bacteria | 3375 |
| 741 | Ga0495581_0002305 | 3300047315 | Bacteria | 10746 |
| 742 | Ga0495604_0000009 | 3300047317 | Bacteria | 326341 |
| 743 | Ga0495604_0003660 | 3300047317 | Bacteria | 12247 |
| 744 | Ga0495604_0017295 | 3300047317 | Bacteria | 5770 |
| 745 | Ga0495604_0017691 | 3300047317 | Bacteria | 5705 |
| 746 | Ga0495674_0000002 | 3300047319 | Bacteria | 642785 |
| 747 | Ga0495674_0042474 | 3300047319 | Bacteria | 4055 |
| 748 | Ga0495674_0080853 | 3300047319 | Bacteria | 2788 |
| 749 | Ga0495676_0084271 | 3300047321 | Bacteria | 2398 |
| 750 | Ga0495676_0178846 | 3300047321 | Bacteria | 1488 |
| 751 | Ga0495680_0000752 | 3300047322 | Bacteria | 36296 |
| 752 | Ga0495680_0014315 | 3300047322 | Bacteria | 6877 |
| 753 | Ga0495680_0014551 | 3300047322 | Bacteria | 6811 |
| 754 | Ga0495680_0022273 | 3300047322 | Bacteria | 5284 |
| 755 | Ga0495680_0028687 | 3300047322 | Bacteria | 4562 |
| 756 | Ga0495675_0000028 | 3300047444 | Bacteria | 105848 |
| 757 | Ga0495675_0026696 | 3300047444 | Bacteria | 3682 |
| 758 | Ga0495684_0000006 | 3300047471 | Bacteria | 247568 |
| 759 | Ga0495684_0003934 | 3300047471 | Bacteria | 11578 |
| 760 | Ga0495593_0008360 | 3300047673 | Bacteria | 6022 |
| 761 | Ga0495602_0000005 | 3300048088 | Bacteria | 325957 |
| 762 | Ga0495602_0000776 | 3300048088 | Bacteria | 30394 |
| 763 | Ga0495602_0002995 | 3300048088 | Bacteria | 17317 |
| 764 | Ga0495614_0004539 | 3300048089 | Bacteria | 6257 |
| 765 | Ga0496100_0002107 | 3300048903 | Bacteria | 10021 |
| 766 | Ga0496100_0008177 | 3300048903 | Bacteria | 5824 |
| 767 | Ga0496100_0008677 | 3300048903 | Bacteria | 5676 |
| 768 | Ga0496100_0010419 | 3300048903 | Bacteria | 5260 |
| 769 | Ga0496100_0057614 | 3300048903 | Bacteria | 2545 |
| 770 | Ga0496101_0002976 | 3300048904 | Bacteria | 10437 |
| 771 | Ga0496101_0005170 | 3300048904 | Bacteria | 8300 |
| 772 | Ga0496101_0005327 | 3300048904 | Bacteria | 8192 |
| 773 | Ga0496101_0028769 | 3300048904 | Bacteria | 3882 |
| 774 | Ga0496101_0045004 | 3300048904 | Bacteria | 3159 |
| 775 | Ga0496101_0099036 | 3300048904 | Bacteria | 2179 |
| 776 | Ga0496102_0008464 | 3300048905 | Bacteria | 8820 |
| 777 | Ga0496102_0009880 | 3300048905 | Bacteria | 8205 |
| 778 | Ga0496102_0017733 | 3300048905 | Bacteria | 6241 |
| 779 | Ga0496102_0024215 | 3300048905 | Bacteria | 5395 |
| 780 | Ga0496102_0029685 | 3300048905 | Bacteria | 4893 |
| 781 | Ga0496102_0097214 | 3300048905 | Bacteria | 2731 |
| 782 | Ga0496103_0001696 | 3300048906 | Bacteria | 14405 |
| 783 | Ga0496103_0005658 | 3300048906 | Bacteria | 7469 |
| 784 | Ga0496103_0005922 | 3300048906 | Bacteria | 7307 |
| 785 | Ga0496103_0011431 | 3300048906 | Bacteria | 5262 |
| 786 | Ga0496103_0036194 | 3300048906 | Bacteria | 3022 |
| 787 | Ga0496103_0076217 | 3300048906 | Bacteria | 2104 |
| 788 | Ga0496104_0000092 | 3300048907 | Bacteria | 87232 |
| 789 | Ga0496104_0004402 | 3300048907 | Bacteria | 12265 |
| 790 | Ga0496104_0013405 | 3300048907 | Bacteria | 7385 |
| 791 | Ga0496104_0033638 | 3300048907 | Bacteria | 4777 |
| 792 | Ga0496104_0069565 | 3300048907 | Bacteria | 3345 |
| 793 | Ga0496104_0112817 | 3300048907 | Bacteria | 2607 |
| 794 | Ga0496104_0269510 | 3300048907 | Bacteria | 1615 |
| 795 | Ga0496105_0001436 | 3300048908 | Bacteria | 16761 |
| 796 | Ga0496105_0001736 | 3300048908 | Bacteria | 15574 |
| 797 | Ga0496105_0002164 | 3300048908 | Bacteria | 14224 |
| 798 | Ga0496105_0002208 | 3300048908 | Bacteria | 14097 |
| 799 | Ga0496105_0018426 | 3300048908 | Bacteria | 5611 |
| 800 | Ga0496105_0125052 | 3300048908 | Bacteria | 2120 |
| 801 | Ga0496105_0125239 | 3300048908 | Bacteria | 2118 |
| 802 | Ga0496106_0003134 | 3300048909 | Bacteria | 12340 |
| 803 | Ga0496106_0006593 | 3300048909 | Bacteria | 8594 |
| 804 | Ga0496106_0019784 | 3300048909 | Bacteria | 4992 |
| 805 | Ga0496106_0026317 | 3300048909 | Bacteria | 4330 |
| 806 | Ga0496106_0043487 | 3300048909 | Bacteria | 3370 |
| 807 | Ga0496106_0149234 | 3300048909 | Bacteria | 1843 |
| 808 | Ga0496107_0000809 | 3300048910 | Bacteria | 18171 |
| 809 | Ga0496107_0003490 | 3300048910 | Bacteria | 10516 |
| 810 | Ga0496107_0007194 | 3300048910 | Bacteria | 7667 |
| 811 | Ga0496107_0012097 | 3300048910 | Bacteria | 6018 |
| 812 | Ga0496107_0013417 | 3300048910 | Bacteria | 5726 |
| 813 | Ga0496107_0026710 | 3300048910 | Bacteria | 4095 |
| 814 | Ga0496107_0029822 | 3300048910 | Bacteria | 3884 |
| 815 | Ga0496108_0003371 | 3300048911 | Bacteria | 12827 |
| 816 | Ga0496108_0005285 | 3300048911 | Bacteria | 10421 |
| 817 | Ga0496108_0012368 | 3300048911 | Bacteria | 6944 |
| 818 | Ga0496108_0014164 | 3300048911 | Bacteria | 6506 |
| 819 | Ga0496108_0082309 | 3300048911 | Bacteria | 2729 |
| 820 | Ga0496108_0090770 | 3300048911 | Bacteria | 2597 |
| 821 | Ga0496108_0097512 | 3300048911 | Bacteria | 2505 |
| 822 | Ga0496109_0000543 | 3300048912 | Bacteria | 31945 |
| 823 | Ga0496109_0016420 | 3300048912 | Bacteria | 6472 |
| 824 | Ga0496109_0026427 | 3300048912 | Bacteria | 5177 |
| 825 | Ga0496109_0031491 | 3300048912 | Bacteria | 4759 |
| 826 | Ga0496109_0118773 | 3300048912 | Bacteria | 2461 |
| 827 | Ga0496109_0200601 | 3300048912 | Bacteria | 1875 |
| 828 | Ga0496110_0004426 | 3300048913 | Bacteria | 10885 |
| 829 | Ga0496110_0015744 | 3300048913 | Bacteria | 6301 |
| 830 | Ga0496110_0053918 | 3300048913 | Bacteria | 3536 |
| 831 | Ga0496110_0112154 | 3300048913 | Bacteria | 2451 |
| 832 | Ga0496110_0190509 | 3300048913 | Bacteria | 1862 |
| 833 | Ga0496111_0000388 | 3300048914 | Bacteria | 21996 |
| 834 | Ga0496111_0002814 | 3300048914 | Bacteria | 10601 |
| 835 | Ga0496111_0010441 | 3300048914 | Bacteria | 6231 |
| 836 | Ga0496111_0012071 | 3300048914 | Bacteria | 5841 |
| 837 | Ga0496111_0028753 | 3300048914 | Bacteria | 3940 |
| 838 | Ga0496112_0003072 | 3300048915 | Bacteria | 13667 |
| 839 | Ga0496112_0009140 | 3300048915 | Bacteria | 8904 |
| 840 | Ga0496112_0014688 | 3300048915 | Bacteria | 7278 |
| 841 | Ga0496112_0061370 | 3300048915 | Bacteria | 3705 |
| 842 | Ga0496112_0195521 | 3300048915 | Bacteria | 1983 |
| 843 | Ga0496113_0000043 | 3300048916 | Bacteria | 52544 |
| 844 | Ga0496113_0003436 | 3300048916 | Bacteria | 9480 |
| 845 | Ga0496113_0004954 | 3300048916 | Bacteria | 8248 |
| 846 | Ga0496113_0015314 | 3300048916 | Bacteria | 5266 |
| 847 | Ga0496113_0047129 | 3300048916 | Bacteria | 3202 |
| 848 | Ga0496113_0133408 | 3300048916 | Bacteria | 1950 |
| 849 | Ga0496113_0189022 | 3300048916 | Bacteria | 1634 |
| 850 | Ga0496114_0003641 | 3300048917 | Bacteria | 11847 |
| 851 | Ga0496114_0013464 | 3300048917 | Bacteria | 6558 |
| 852 | Ga0496114_0023885 | 3300048917 | Bacteria | 4988 |
| 853 | Ga0496114_0040439 | 3300048917 | Bacteria | 3860 |
| 854 | Ga0496114_0052998 | 3300048917 | Bacteria | 3381 |
| 855 | Ga0496115_0009341 | 3300048918 | Bacteria | 7286 |
| 856 | Ga0496115_0018321 | 3300048918 | Bacteria | 5373 |
| 857 | Ga0496115_0046900 | 3300048918 | Bacteria | 3455 |
| 858 | Ga0496115_0054203 | 3300048918 | Bacteria | 3220 |
| 859 | Ga0496115_0109009 | 3300048918 | Bacteria | 2273 |
| 860 | Ga0501031_0022932 | 3300049568 | Bacteria | 4071 |
| 861 | Ga0501032_0028467 | 3300049569 | Bacteria | 3839 |
| 862 | Ga0501032_0049939 | 3300049569 | Bacteria | 2821 |
| 863 | Ga0501033_0011567 | 3300049570 | Bacteria | 6751 |
| 864 | Ga0501033_0017357 | 3300049570 | Bacteria | 5439 |
| 865 | Ga0501033_0038589 | 3300049570 | Bacteria | 3569 |
| 866 | Ga0501034_0006205 | 3300049571 | Bacteria | 12870 |
| 867 | Ga0501034_0008624 | 3300049571 | Bacteria | 10756 |
| 868 | Ga0501034_0018337 | 3300049571 | Bacteria | 7180 |
| 869 | Ga0501034_0086671 | 3300049571 | Bacteria | 3132 |
| 870 | Ga0501034_0105165 | 3300049571 | Bacteria | 2816 |
| 871 | Ga0501034_0157288 | 3300049571 | Bacteria | 2246 |
| 872 | Ga0501034_0304648 | 3300049571 | Bacteria | 1529 |
| 873 | Ga0501036_0000372 | 3300049572 | Bacteria | 31588 |
| 874 | Ga0501036_0017605 | 3300049572 | Bacteria | 5977 |
| 875 | Ga0501036_0025867 | 3300049572 | Bacteria | 4952 |
| 876 | Ga0501036_0055564 | 3300049572 | Bacteria | 3354 |
| 877 | Ga0501037_0008325 | 3300049573 | Bacteria | 7601 |
| 878 | Ga0501037_0020689 | 3300049573 | Bacteria | 4858 |
| 879 | Ga0501037_0020812 | 3300049573 | Bacteria | 4843 |
| 880 | Ga0501037_0026077 | 3300049573 | Bacteria | 4319 |
| 881 | Ga0501038_0017530 | 3300049574 | Bacteria | 6472 |
| 882 | Ga0501038_0026512 | 3300049574 | Bacteria | 5161 |
| 883 | Ga0501038_0031263 | 3300049574 | Bacteria | 4705 |
| 884 | Ga0501038_0062127 | 3300049574 | Bacteria | 3192 |
| 885 | Ga0501038_0096680 | 3300049574 | Bacteria | 2464 |
| 886 | Ga0501039_0015326 | 3300049575 | Bacteria | 5867 |
| 887 | Ga0501043_0005267 | 3300049579 | Bacteria | 10454 |
| 888 | Ga0501043_0023206 | 3300049579 | Bacteria | 4866 |
| 889 | Ga0501043_0030487 | 3300049579 | Bacteria | 4239 |
| 890 | Ga0501046_0066195 | 3300049580 | Bacteria | 2817 |
| 891 | Ga0501046_0066278 | 3300049580 | Bacteria | 2814 |
| 892 | Ga0501047_0000164 | 3300049581 | Bacteria | 81200 |
| 893 | Ga0501047_0025565 | 3300049581 | Bacteria | 5676 |
| 894 | Ga0501047_0079486 | 3300049581 | Bacteria | 3153 |
| 895 | Ga0501047_0087179 | 3300049581 | Bacteria | 2999 |
| 896 | Ga0501047_0109023 | 3300049581 | Bacteria | 2651 |
| 897 | Ga0501047_0110282 | 3300049581 | Bacteria | 2634 |
| 898 | Ga0501048_0003459 | 3300049582 | Bacteria | 12003 |
| 899 | Ga0501067_0006409 | 3300049583 | Bacteria | 6519 |
| 900 | Ga0501069_0000561 | 3300049585 | Bacteria | 17113 |
| 901 | Ga0501070_0003220 | 3300049586 | Bacteria | 14202 |
| 902 | Ga0501070_0020311 | 3300049586 | Bacteria | 5572 |
| 903 | Ga0501070_0020404 | 3300049586 | Bacteria | 5560 |
| 904 | Ga0501070_0021489 | 3300049586 | Bacteria | 5414 |
| 905 | Ga0501070_0022513 | 3300049586 | Bacteria | 5278 |
| 906 | Ga0501070_0035382 | 3300049586 | Bacteria | 4173 |
| 907 | Ga0501070_0044117 | 3300049586 | Bacteria | 3711 |
| 908 | Ga0501070_0143033 | 3300049586 | Bacteria | 1975 |
| 909 | Ga0501070_0162714 | 3300049586 | Bacteria | 1839 |
| 910 | Ga0501071_0054311 | 3300049587 | Bacteria | 2891 |
| 911 | Ga0501072_0065822 | 3300049588 | Bacteria | 2858 |
| 912 | Ga0501072_0147428 | 3300049588 | Bacteria | 1876 |
| 913 | Ga0501073_0026466 | 3300049589 | Bacteria | 4156 |
| 914 | Ga0501074_0014496 | 3300049590 | Bacteria | 5735 |
| 915 | Ga0501074_0016572 | 3300049590 | Bacteria | 5349 |
| 916 | Ga0501074_0184462 | 3300049590 | Bacteria | 1488 |
| 917 | Ga0501075_0044258 | 3300049591 | Bacteria | 3340 |
| 918 | Ga0501076_0118405 | 3300049592 | Bacteria | 2144 |
| 919 | Ga0501076_0167041 | 3300049592 | Bacteria | 1794 |
| 920 | Ga0501077_0025278 | 3300049593 | Bacteria | 3772 |
| 921 | Ga0501079_0004533 | 3300049741 | Bacteria | 10304 |
| 922 | Ga0501079_0047540 | 3300049741 | Bacteria | 3310 |
| 923 | Ga0501079_0047569 | 3300049741 | Bacteria | 3309 |
| 924 | Ga0501079_0096901 | 3300049741 | Bacteria | 2287 |
| 925 | Ga0501080_0000235 | 3300049742 | Bacteria | 41534 |
| 926 | Ga0501080_0043320 | 3300049742 | Bacteria | 4191 |
| 927 | Ga0501080_0048885 | 3300049742 | Bacteria | 3935 |
| 928 | Ga0501081_0034408 | 3300049743 | Bacteria | 3447 |
| 929 | Ga0501083_0016539 | 3300049744 | Bacteria | 5159 |
| 930 | Ga0501083_0022677 | 3300049744 | Bacteria | 4356 |
| 931 | Ga0501083_0066250 | 3300049744 | Bacteria | 2405 |
| 932 | Ga0501035_0016521 | 3300049822 | Bacteria | 6805 |
| 933 | Ga0501035_0046252 | 3300049822 | Bacteria | 3914 |
| 934 | Ga0501044_0000707 | 3300049823 | Bacteria | 40284 |
| 935 | Ga0501044_0004015 | 3300049823 | Bacteria | 16492 |
| 936 | Ga0501044_0033812 | 3300049823 | Bacteria | 5368 |
| 937 | Ga0501044_0043740 | 3300049823 | Bacteria | 4651 |
| 938 | Ga0501044_0127556 | 3300049823 | Bacteria | 2540 |
| 939 | Ga0501044_0144177 | 3300049823 | Bacteria | 2368 |
| 940 | Ga0501044_0293820 | 3300049823 | Bacteria | 1556 |
| 941 | Ga0501044_0310905 | 3300049823 | Bacteria | 1502 |
| 942 | nmdc:mga0yw44_46679_c1 | 3300050492 | Bacteria | 2602 |
| 943 | nmdc:mga0k408_5532_c1 | 3300050493 | Bacteria | 6726 |
| 944 | nmdc:mga06z11_72629_c1 | 3300050494 | Bacteria | 1824 |
| 945 | nmdc:mga05p37_143795_c1 | 3300050507 | Bacteria | 2921 |
| 946 | nmdc:mga05p37_201_c1 | 3300050507 | Bacteria | 59705 |
| 947 | nmdc:mga05p37_309031_c1 | 3300050507 | Bacteria | 1875 |
| 948 | nmdc:mga05p37_44522_c1 | 3300050507 | Bacteria | 5460 |
| 949 | nmdc:mga05p37_62368_c1 | 3300050507 | Bacteria | 4587 |
| 950 | nmdc:mga05p37_6242_c1 | 3300050507 | Bacteria | 14032 |
| 951 | nmdc:mga05p37_66_c1 | 3300050507 | Bacteria | 91764 |
| 952 | nmdc:mga05p37_92206_c1 | 3300050507 | Bacteria | 3733 |
| 953 | nmdc:mga09592_30035_c1 | 3300050508 | Bacteria | 4523 |
| 954 | nmdc:mga09592_7876_c1 | 3300050508 | Bacteria | 8660 |
| 955 | nmdc:mga0qj67_24563_c1 | 3300050509 | Bacteria | 4647 |
| 956 | nmdc:mga0qj67_26699_c1 | 3300050509 | Bacteria | 4471 |
| 957 | nmdc:mga0qj67_512_c1 | 3300050509 | Bacteria | 26543 |
| 958 | nmdc:mga0qj67_7_c1 | 3300050509 | Bacteria | 146944 |
| 959 | nmdc:mga06r32_177654_c1 | 3300050510 | Bacteria | 2114 |
| 960 | nmdc:mga06r32_25746_c1 | 3300050510 | Bacteria | 3867 |
| 961 | nmdc:mga06r32_451_c1 | 3300050510 | Bacteria | 34946 |
| 962 | nmdc:mga06r32_7326_c1 | 3300050510 | Bacteria | 9931 |
| 963 | nmdc:mga06r32_7911_c1 | 3300050510 | Bacteria | 9557 |
| 964 | nmdc:mga08y16_1809_c1 | 3300050511 | Bacteria | 21689 |
| 965 | nmdc:mga08y16_253276_c1 | 3300050511 | Bacteria | 1819 |
| 966 | nmdc:mga08y16_31568_c1 | 3300050511 | Bacteria | 5571 |
| 967 | nmdc:mga08y16_4145_c1 | 3300050511 | Bacteria | 15133 |
| 968 | nmdc:mga08y16_48_c1 | 3300050511 | Bacteria | 111306 |
| 969 | nmdc:mga08y16_56670_c1 | 3300050511 | Bacteria | 4095 |
| 970 | nmdc:mga0n895_43_c1 | 3300050512 | Bacteria | 74924 |
| 971 | nmdc:mga0n895_74467_c1 | 3300050512 | Bacteria | 3373 |
| 972 | nmdc:mga0n895_78577_c1 | 3300050512 | Bacteria | 3284 |
| 973 | nmdc:mga0n895_82465_c1 | 3300050512 | Bacteria | 3206 |
| 974 | nmdc:mga0rr50_21285_c1 | 3300050513 | Bacteria | 4423 |
| 975 | nmdc:mga0rr50_43928_c1 | 3300050513 | Bacteria | 3274 |
| 976 | nmdc:mga0rr50_5412_c1 | 3300050513 | Bacteria | 7612 |
| 977 | nmdc:mga0a205_13273_c1 | 3300050515 | Bacteria | 7662 |
| 978 | nmdc:mga0a205_2982_c1 | 3300050515 | Bacteria | 15012 |
| 979 | nmdc:mga0a205_3268_c1 | 3300050515 | Bacteria | 14416 |
| 980 | Ga0495601_0000002 | 3300053077 | Bacteria | 528704 |
| 981 | Ga0495601_0000107 | 3300053077 | Bacteria | 45730 |
| 982 | Ga0495601_0005039 | 3300053077 | Bacteria | 7668 |
| 983 | Ga0495601_0027688 | 3300053077 | Bacteria | 3505 |
| 984 | Ga0495601_0035231 | 3300053077 | Bacteria | 3123 |
| 985 | Ga0495601_0122728 | 3300053077 | Bacteria | 1688 |
| 986 | Ga0495612_0000010 | 3300053078 | Bacteria | 227618 |
| 987 | Ga0495612_0001623 | 3300053078 | Bacteria | 9246 |
| 988 | Ga0495612_0002221 | 3300053078 | Bacteria | 7987 |
| 989 | Ga0495612_0005028 | 3300053078 | Bacteria | 5475 |
| 990 | Ga0495595_0000777 | 3300053084 | Bacteria | 12093 |
| 991 | Ga0495595_0004037 | 3300053084 | Bacteria | 5874 |
| 992 | Ga0495595_0010557 | 3300053084 | Bacteria | 3840 |
| 993 | Ga0495595_0019908 | 3300053084 | Bacteria | 2915 |
| 994 | Ga0495619_0000019 | 3300053085 | Bacteria | 209518 |
| 995 | Ga0495619_0000045 | 3300053085 | Bacteria | 108543 |
| 996 | Ga0495619_0002374 | 3300053085 | Bacteria | 12380 |
| 997 | Ga0495619_0002899 | 3300053085 | Bacteria | 11139 |
| 998 | Ga0495619_0004604 | 3300053085 | Bacteria | 8803 |
| 999 | Ga0495619_0044260 | 3300053085 | Bacteria | 2922 |
| 1000 | Ga0495619_0110761 | 3300053085 | Bacteria | 1876 |
| 1001 | Ga0500644_0001293 | 3300053088 | Bacteria | 6806 |
| 1002 | Ga0500651_0006213 | 3300053093 | Bacteria | 6869 |
| 1003 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 1004 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1005 | Ga0500616_0007357 | 3300053153 | Bacteria | 7014 |
| 1006 | Ga0500645_000099 | 3300053730 | Bacteria | 68426 |
| 1007 | Ga0501084_0126233 | 3300054114 | Bacteria | 2153 |
| 1008 | Ga0501082_0000074 | 3300060353 | Bacteria | 73246 |
| 1009 | Ga0501082_0040262 | 3300060353 | Bacteria | 4031 |
| 1010 | Ga0501082_0043132 | 3300060353 | Bacteria | 3888 |
| 1011 | Ga0530510_0045710 | 3300061734 | Bacteria | 3163 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025933 | Ga0207706_10203437 | Ga0207706_102034372 | 401 |
| 2 | 3300049588 | Ga0501072_0147428 | Ga0501072_0147428_640_1863 | 406 |
| 3 | 3300049823 | Ga0501044_0310905 | Ga0501044_0310905_249_1487 | 409 |
| 4 | 3300035725 | Ga0373947_0048954 | Ga0373947_0048954_708_2126 | 410 |
| 5 | 3300037068 | Ga0373925_0127647 | Ga0373925_0127647_473_1891 | 410 |
| 6 | 3300046678 | Ga0495599_0034637 | Ga0495599_0034637_10_1248 | 410 |
| 7 | 3300048908 | Ga0496105_0002164 | Ga0496105_0002164_8296_9534 | 410 |
| 8 | 3300048916 | Ga0496113_0189022 | Ga0496113_0189022_28_1260 | 410 |
| 9 | 3300050511 | nmdc:mga08y16_253276_c1 | nmdc:mga08y16_253276_c1_10_1242 | 410 |
| 10 | 3300026095 | Ga0207676_10048845 | Ga0207676_100488453 | 412 |
| 11 | 3300009094 | Ga0111539_10150020 | Ga0111539_101500202 | 422 |
| 12 | 3300026023 | Ga0207677_10006260 | Ga0207677_100062606 | 422 |
| 13 | 3300035207 | Ga0373942_0003417 | Ga0373942_0003417_19_1290 | 423 |
| 14 | 3300049581 | Ga0501047_0079486 | Ga0501047_0079486_735_2120 | 425 |
| 15 | 3300031247 | Ga0265340_10021850 | Ga0265340_100218501 | 427 |
| 16 | 3300053088 | Ga0500644_0001293 | Ga0500644_0001293_1942_3339 | 427 |
| 17 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_1042204_1043601 | 427 |
| 18 | 3300053730 | Ga0500645_000099 | Ga0500645_000099_14264_15661 | 431 |
| 19 | 3300053093 | Ga0500651_0006213 | Ga0500651_0006213_4071_5471 | 433 |
| 20 | 3300005356 | Ga0070674_100009547 | Ga0070674_1000095474 | 434 |
| 21 | 3300017792 | Ga0163161_10114468 | Ga0163161_101144682 | 434 |
| 22 | 3300026121 | Ga0207683_10185428 | Ga0207683_101854282 | 434 |
| 23 | 3300006871 | Ga0075434_100007032 | Ga0075434_1000070322 | 435 |
| 24 | 3300027907 | Ga0207428_10033074 | Ga0207428_100330743 | 435 |
| 25 | 3300050512 | nmdc:mga0n895_82465_c1 | nmdc:mga0n895_82465_c1_1763_3160 | 435 |
| 26 | 3300050515 | nmdc:mga0a205_2982_c1 | nmdc:mga0a205_2982_c1_13469_14866 | 435 |
| 27 | 3300006847 | Ga0075431_100195337 | Ga0075431_1001953372 | 437 |
| 28 | 3300050510 | nmdc:mga06r32_177654_c1 | nmdc:mga06r32_177654_c1_231_1598 | 437 |
| 29 | 3300005340 | Ga0070689_100131548 | Ga0070689_1001315481 | 439 |
| 30 | 3300049823 | Ga0501044_0000707 | Ga0501044_0000707_15253_16695 | 440 |
| 31 | 3300006871 | Ga0075434_100054628 | Ga0075434_1000546283 | 441 |
| 32 | 3300009094 | Ga0111539_10051044 | Ga0111539_100510442 | 441 |
| 33 | 3300046477 | Ga0495664_0105171 | Ga0495664_0105171_153_1532 | 441 |
| 34 | 3300053077 | Ga0495601_0035231 | Ga0495601_0035231_789_2168 | 441 |
| 35 | 3300053084 | Ga0495595_0010557 | Ga0495595_0010557_806_2185 | 441 |
| 36 | 3300053085 | Ga0495619_0110761 | Ga0495619_0110761_257_1636 | 441 |
| 37 | 3300031595 | Ga0265313_10000326 | Ga0265313_100003264 | 445 |
| 38 | 3300046454 | Ga0495592_0149021 | Ga0495592_0149021_66_1445 | 446 |
| 39 | 3300025915 | Ga0207693_10161096 | Ga0207693_101610961 | 447 |
| 40 | 3300006042 | Ga0075368_10014120 | Ga0075368_100141202 | 448 |
| 41 | 3300006178 | Ga0075367_10018956 | Ga0075367_100189563 | 448 |
| 42 | 3300025928 | Ga0207700_10218925 | Ga0207700_102189251 | 448 |
| 43 | 3300035695 | Ga0373927_0054373 | Ga0373927_0054373_11_1393 | 448 |
| 44 | 3300046459 | Ga0495629_0016805 | Ga0495629_0016805_249_1631 | 448 |
| 45 | 3300048915 | Ga0496112_0195521 | Ga0496112_0195521_603_1970 | 448 |
| 46 | 3300003659 | JGI25404J52841_10002701 | JGI25404J52841_100027012 | 450 |
| 47 | 3300005983 | Ga0081540_1000007 | Ga0081540_100000725 | 450 |
| 48 | 3300031344 | Ga0265316_10024489 | Ga0265316_100244894 | 450 |
| 49 | 3300031595 | Ga0265313_10040748 | Ga0265313_100407482 | 450 |
| 50 | 3300054114 | Ga0501084_0126233 | Ga0501084_0126233_603_2006 | 450 |
| 51 | 3300061734 | Ga0530510_0045710 | Ga0530510_0045710_1260_2663 | 450 |
| 52 | 3300005439 | Ga0070711_100051325 | Ga0070711_1000513254 | 452 |
| 53 | 3300049570 | Ga0501033_0017357 | Ga0501033_0017357_3466_4851 | 452 |
| 54 | 3300049571 | Ga0501034_0105165 | Ga0501034_0105165_258_1643 | 452 |
| 55 | 3300049591 | Ga0501075_0044258 | Ga0501075_0044258_329_1714 | 452 |
| 56 | 3300049593 | Ga0501077_0025278 | Ga0501077_0025278_168_1553 | 452 |
| 57 | 3300049741 | Ga0501079_0004533 | Ga0501079_0004533_1684_3069 | 452 |
| 58 | 3300049743 | Ga0501081_0034408 | Ga0501081_0034408_1755_3140 | 452 |
| 59 | 3300060353 | Ga0501082_0040262 | Ga0501082_0040262_634_2019 | 452 |
| 60 | 3300049823 | Ga0501044_0293820 | Ga0501044_0293820_120_1490 | 453 |
| 61 | 3300005983 | Ga0081540_1004024 | Ga0081540_10040248 | 454 |
| 62 | 3300006358 | Ga0068871_100251808 | Ga0068871_1002518081 | 454 |
| 63 | 3300006846 | Ga0075430_100016809 | Ga0075430_1000168093 | 454 |
| 64 | 3300006847 | Ga0075431_100007719 | Ga0075431_1000077199 | 454 |
| 65 | 3300013104 | Ga0157370_10150497 | Ga0157370_101504972 | 454 |
| 66 | 3300013308 | Ga0157375_10237394 | Ga0157375_102373942 | 454 |
| 67 | 3300035691 | Ga0373931_0002975 | Ga0373931_0002975_2034_3431 | 454 |
| 68 | 3300048908 | Ga0496105_0125239 | Ga0496105_0125239_141_1538 | 454 |
| 69 | 3300050507 | nmdc:mga05p37_62368_c1 | nmdc:mga05p37_62368_c1_93_1490 | 454 |
| 70 | 3300050510 | nmdc:mga06r32_7911_c1 | nmdc:mga06r32_7911_c1_539_1936 | 454 |
| 71 | 3300050513 | nmdc:mga0rr50_5412_c1 | nmdc:mga0rr50_5412_c1_2178_3566 | 454 |
| 72 | 3300005530 | Ga0070679_100139212 | Ga0070679_1001392121 | 455 |
| 73 | 3300005535 | Ga0070684_100067827 | Ga0070684_1000678272 | 455 |
| 74 | 3300006846 | Ga0075430_100006097 | Ga0075430_1000060974 | 455 |
| 75 | 3300009147 | Ga0114129_10016369 | Ga0114129_100163696 | 455 |
| 76 | 3300009551 | Ga0105238_10054673 | Ga0105238_100546734 | 455 |
| 77 | 3300013100 | Ga0157373_10111698 | Ga0157373_101116982 | 455 |
| 78 | 3300013307 | Ga0157372_10121031 | Ga0157372_101210312 | 455 |
| 79 | 3300021384 | Ga0213876_10025328 | Ga0213876_100253283 | 455 |
| 80 | 3300025915 | Ga0207693_10027450 | Ga0207693_100274502 | 455 |
| 81 | 3300025929 | Ga0207664_10183287 | Ga0207664_101832871 | 455 |
| 82 | 3300025939 | Ga0207665_10056180 | Ga0207665_100561802 | 455 |
| 83 | 3300039437 | Ga0436365_0349099 | Ga0436365_0349099_553_1926 | 455 |
| 84 | 3300050507 | nmdc:mga05p37_143795_c1 | nmdc:mga05p37_143795_c1_1058_2446 | 455 |
| 85 | 3300050509 | nmdc:mga0qj67_7_c1 | nmdc:mga0qj67_7_c1_118818_120218 | 455 |
| 86 | iso_pu_bacteria | 2643221547 | 2643757269 | 455 |
| 87 | iso_pu_bacteria | 2889914905 | 2889918179 | 455 |
| 88 | 3300025936 | Ga0207670_10170453 | Ga0207670_101704532 | 456 |
| 89 | 3300035692 | Ga0373935_0057106 | Ga0373935_0057106_11_1387 | 456 |
| 90 | 3300039437 | Ga0436365_1169665 | Ga0436365_1169665_148_1545 | 456 |
| 91 | 3300049586 | Ga0501070_0003220 | Ga0501070_0003220_2172_3551 | 456 |
| 92 | 3300049586 | Ga0501070_0020404 | Ga0501070_0020404_1832_3214 | 456 |
| 93 | 3300049587 | Ga0501071_0054311 | Ga0501071_0054311_862_2244 | 456 |
| 94 | 3300049590 | Ga0501074_0184462 | Ga0501074_0184462_54_1436 | 456 |
| 95 | 3300050494 | nmdc:mga06z11_72629_c1 | nmdc:mga06z11_72629_c1_10_1386 | 456 |
| 96 | 3300005347 | Ga0070668_100092303 | Ga0070668_1000923032 | 457 |
| 97 | 3300005355 | Ga0070671_100031446 | Ga0070671_1000314463 | 457 |
| 98 | 3300005356 | Ga0070674_100027485 | Ga0070674_1000274853 | 457 |
| 99 | 3300005618 | Ga0068864_100042649 | Ga0068864_1000426493 | 457 |
| 100 | 3300005981 | Ga0081538_10059304 | Ga0081538_100593042 | 457 |
| 101 | 3300009176 | Ga0105242_10069916 | Ga0105242_100699162 | 457 |
| 102 | 3300014325 | Ga0163163_10093775 | Ga0163163_100937752 | 457 |
| 103 | 3300025903 | Ga0207680_10001283 | Ga0207680_100012837 | 457 |
| 104 | 3300025903 | Ga0207680_10092650 | Ga0207680_100926502 | 457 |
| 105 | 3300025907 | Ga0207645_10059737 | Ga0207645_100597372 | 457 |
| 106 | 3300025908 | Ga0207643_10031046 | Ga0207643_100310462 | 457 |
| 107 | 3300025931 | Ga0207644_10092872 | Ga0207644_100928722 | 457 |
| 108 | 3300025932 | Ga0207690_10137132 | Ga0207690_101371322 | 457 |
| 109 | 3300025936 | Ga0207670_10003054 | Ga0207670_100030542 | 457 |
| 110 | 3300025937 | Ga0207669_10031185 | Ga0207669_100311852 | 457 |
| 111 | 3300025972 | Ga0207668_10109409 | Ga0207668_101094092 | 457 |
| 112 | 3300031241 | Ga0265325_10004094 | Ga0265325_1000409410 | 457 |
| 113 | 3300031249 | Ga0265339_10001513 | Ga0265339_100015138 | 457 |
| 114 | 3300031595 | Ga0265313_10008870 | Ga0265313_100088705 | 457 |
| 115 | 3300035088 | Ga0373940_0012296 | Ga0373940_0012296_75_1454 | 457 |
| 116 | 3300035121 | Ga0373960_0003571 | Ga0373960_0003571_106_1485 | 457 |
| 117 | 3300035207 | Ga0373942_0009249 | Ga0373942_0009249_243_1622 | 457 |
| 118 | 3300035691 | Ga0373931_0007918 | Ga0373931_0007918_1890_3269 | 457 |
| 119 | 3300048903 | Ga0496100_0010419 | Ga0496100_0010419_839_2218 | 457 |
| 120 | 3300048910 | Ga0496107_0003490 | Ga0496107_0003490_4096_5475 | 457 |
| 121 | 3300048911 | Ga0496108_0082309 | Ga0496108_0082309_51_1430 | 457 |
| 122 | 3300048912 | Ga0496109_0200601 | Ga0496109_0200601_171_1550 | 457 |
| 123 | 3300048913 | Ga0496110_0053918 | Ga0496110_0053918_1526_2905 | 457 |
| 124 | 3300048916 | Ga0496113_0133408 | Ga0496113_0133408_22_1401 | 457 |
| 125 | 3300049571 | Ga0501034_0304648 | Ga0501034_0304648_128_1519 | 457 |
| 126 | 3300049589 | Ga0501073_0026466 | Ga0501073_0026466_74_1465 | 457 |
| 127 | 3300049592 | Ga0501076_0118405 | Ga0501076_0118405_375_1757 | 457 |
| 128 | 3300049744 | Ga0501083_0016539 | Ga0501083_0016539_2035_3435 | 457 |
| 129 | 3300005336 | Ga0070680_100019164 | Ga0070680_1000191644 | 458 |
| 130 | 3300005458 | Ga0070681_10001525 | Ga0070681_1000152519 | 458 |
| 131 | 3300005530 | Ga0070679_100012735 | Ga0070679_1000127354 | 458 |
| 132 | 3300006042 | Ga0075368_10005879 | Ga0075368_100058792 | 458 |
| 133 | 3300006353 | Ga0075370_10042438 | Ga0075370_100424382 | 458 |
| 134 | 3300009147 | Ga0114129_10233598 | Ga0114129_102335981 | 458 |
| 135 | 3300014326 | Ga0157380_10195500 | Ga0157380_101955002 | 458 |
| 136 | 3300025917 | Ga0207660_10092613 | Ga0207660_100926132 | 458 |
| 137 | 3300025921 | Ga0207652_10067950 | Ga0207652_100679502 | 458 |
| 138 | 3300049569 | Ga0501032_0049939 | Ga0501032_0049939_349_1734 | 458 |
| 139 | 3300049570 | Ga0501033_0038589 | Ga0501033_0038589_1809_3194 | 458 |
| 140 | 3300049572 | Ga0501036_0055564 | Ga0501036_0055564_857_2242 | 458 |
| 141 | 3300049573 | Ga0501037_0026077 | Ga0501037_0026077_566_1951 | 458 |
| 142 | 3300049574 | Ga0501038_0031263 | Ga0501038_0031263_168_1547 | 458 |
| 143 | 3300049579 | Ga0501043_0030487 | Ga0501043_0030487_77_1456 | 458 |
| 144 | 3300049580 | Ga0501046_0066278 | Ga0501046_0066278_1300_2685 | 458 |
| 145 | 3300049581 | Ga0501047_0110282 | Ga0501047_0110282_684_2069 | 458 |
| 146 | 3300049583 | Ga0501067_0006409 | Ga0501067_0006409_1260_2645 | 458 |
| 147 | 3300049585 | Ga0501069_0000561 | Ga0501069_0000561_12584_13969 | 458 |
| 148 | 3300049586 | Ga0501070_0022513 | Ga0501070_0022513_3362_4747 | 458 |
| 149 | 3300049590 | Ga0501074_0014496 | Ga0501074_0014496_1511_2935 | 458 |
| 150 | 3300049592 | Ga0501076_0167041 | Ga0501076_0167041_46_1425 | 458 |
| 151 | 3300049741 | Ga0501079_0047540 | Ga0501079_0047540_508_1932 | 458 |
| 152 | 3300049741 | Ga0501079_0096901 | Ga0501079_0096901_683_2068 | 458 |
| 153 | 3300049744 | Ga0501083_0022677 | Ga0501083_0022677_1422_2801 | 458 |
| 154 | 3300049744 | Ga0501083_0066250 | Ga0501083_0066250_121_1506 | 458 |
| 155 | 3300060353 | Ga0501082_0043132 | Ga0501082_0043132_1016_2395 | 458 |
| 156 | 3300006847 | Ga0075431_100149874 | Ga0075431_1001498742 | 459 |
| 157 | 3300031235 | Ga0265330_10047685 | Ga0265330_100476852 | 459 |
| 158 | 3300031241 | Ga0265325_10000234 | Ga0265325_1000023436 | 459 |
| 159 | 3300035241 | Ga0373961_0032726 | Ga0373961_0032726_61_1446 | 459 |
| 160 | 3300049571 | Ga0501034_0086671 | Ga0501034_0086671_1445_2833 | 459 |
| 161 | 3300050510 | nmdc:mga06r32_25746_c1 | nmdc:mga06r32_25746_c1_972_2363 | 460 |
| 162 | 3300005328 | Ga0070676_10041250 | Ga0070676_100412502 | 461 |
| 163 | 3300005334 | Ga0068869_100035836 | Ga0068869_1000358362 | 461 |
| 164 | 3300005338 | Ga0068868_100006452 | Ga0068868_1000064528 | 461 |
| 165 | 3300005340 | Ga0070689_100043276 | Ga0070689_1000432762 | 461 |
| 166 | 3300005341 | Ga0070691_10019580 | Ga0070691_100195802 | 461 |
| 167 | 3300005343 | Ga0070687_100006831 | Ga0070687_1000068314 | 461 |
| 168 | 3300005347 | Ga0070668_100051371 | Ga0070668_1000513712 | 461 |
| 169 | 3300005366 | Ga0070659_100039712 | Ga0070659_1000397123 | 461 |
| 170 | 3300005438 | Ga0070701_10022612 | Ga0070701_100226122 | 461 |
| 171 | 3300005441 | Ga0070700_100010471 | Ga0070700_1000104712 | 461 |
| 172 | 3300005466 | Ga0070685_10007517 | Ga0070685_100075174 | 461 |
| 173 | 3300005530 | Ga0070679_100054193 | Ga0070679_1000541933 | 461 |
| 174 | 3300005535 | Ga0070684_100076688 | Ga0070684_1000766882 | 461 |
| 175 | 3300005544 | Ga0070686_100016714 | Ga0070686_1000167142 | 461 |
| 176 | 3300005578 | Ga0068854_100063690 | Ga0068854_1000636902 | 461 |
| 177 | 3300005615 | Ga0070702_100084461 | Ga0070702_1000844612 | 461 |
| 178 | 3300005616 | Ga0068852_100063725 | Ga0068852_1000637253 | 461 |
| 179 | 3300005617 | Ga0068859_100038671 | Ga0068859_1000386712 | 461 |
| 180 | 3300005618 | Ga0068864_100157672 | Ga0068864_1001576722 | 461 |
| 181 | 3300005718 | Ga0068866_10006999 | Ga0068866_100069992 | 461 |
| 182 | 3300005841 | Ga0068863_100075045 | Ga0068863_1000750453 | 461 |
| 183 | 3300005842 | Ga0068858_100006251 | Ga0068858_1000062519 | 461 |
| 184 | 3300005844 | Ga0068862_100039768 | Ga0068862_1000397684 | 461 |
| 185 | 3300005981 | Ga0081538_10081004 | Ga0081538_100810041 | 461 |
| 186 | 3300006358 | Ga0068871_100065268 | Ga0068871_1000652682 | 461 |
| 187 | 3300006844 | Ga0075428_100000740 | Ga0075428_1000007409 | 461 |
| 188 | 3300006847 | Ga0075431_100000870 | Ga0075431_10000087024 | 461 |
| 189 | 3300006880 | Ga0075429_100004032 | Ga0075429_1000040322 | 461 |
| 190 | 3300006931 | Ga0097620_100038673 | Ga0097620_1000386735 | 461 |
| 191 | 3300009094 | Ga0111539_10005127 | Ga0111539_100051276 | 461 |
| 192 | 3300009101 | Ga0105247_10016894 | Ga0105247_100168943 | 461 |
| 193 | 3300009147 | Ga0114129_10000025 | Ga0114129_100000256 | 461 |
| 194 | 3300009147 | Ga0114129_10019966 | Ga0114129_100199662 | 461 |
| 195 | 3300009148 | Ga0105243_10031611 | Ga0105243_100316114 | 461 |
| 196 | 3300009176 | Ga0105242_10041795 | Ga0105242_100417953 | 461 |
| 197 | 3300009177 | Ga0105248_10315006 | Ga0105248_103150062 | 461 |
| 198 | 3300009545 | Ga0105237_10043192 | Ga0105237_100431924 | 461 |
| 199 | 3300010375 | Ga0105239_10038572 | Ga0105239_100385725 | 461 |
| 200 | 3300011119 | Ga0105246_10117462 | Ga0105246_101174622 | 461 |
| 201 | 3300013296 | Ga0157374_10013309 | Ga0157374_100133092 | 461 |
| 202 | 3300013297 | Ga0157378_10020673 | Ga0157378_100206733 | 461 |
| 203 | 3300013308 | Ga0157375_10053687 | Ga0157375_100536874 | 461 |
| 204 | 3300014326 | Ga0157380_10065721 | Ga0157380_100657213 | 461 |
| 205 | 3300014968 | Ga0157379_10064966 | Ga0157379_100649662 | 461 |
| 206 | 3300014969 | Ga0157376_10204657 | Ga0157376_102046572 | 461 |
| 207 | 3300025899 | Ga0207642_10039428 | Ga0207642_100394282 | 461 |
| 208 | 3300025900 | Ga0207710_10035227 | Ga0207710_100352271 | 461 |
| 209 | 3300025901 | Ga0207688_10000998 | Ga0207688_1000099811 | 461 |
| 210 | 3300025904 | Ga0207647_10011089 | Ga0207647_100110894 | 461 |
| 211 | 3300025907 | Ga0207645_10023155 | Ga0207645_100231553 | 461 |
| 212 | 3300025908 | Ga0207643_10004896 | Ga0207643_100048963 | 461 |
| 213 | 3300025918 | Ga0207662_10064039 | Ga0207662_100640392 | 461 |
| 214 | 3300025927 | Ga0207687_10017936 | Ga0207687_100179365 | 461 |
| 215 | 3300025931 | Ga0207644_10025194 | Ga0207644_100251944 | 461 |
| 216 | 3300025933 | Ga0207706_10007881 | Ga0207706_100078814 | 461 |
| 217 | 3300025934 | Ga0207686_10017951 | Ga0207686_100179512 | 461 |
| 218 | 3300025935 | Ga0207709_10102649 | Ga0207709_101026492 | 461 |
| 219 | 3300025937 | Ga0207669_10017896 | Ga0207669_100178963 | 461 |
| 220 | 3300025938 | Ga0207704_10174333 | Ga0207704_101743331 | 461 |
| 221 | 3300025942 | Ga0207689_10022711 | Ga0207689_100227114 | 461 |
| 222 | 3300025960 | Ga0207651_10008897 | Ga0207651_100088974 | 461 |
| 223 | 3300025972 | Ga0207668_10055993 | Ga0207668_100559932 | 461 |
| 224 | 3300025981 | Ga0207640_10043680 | Ga0207640_100436802 | 461 |
| 225 | 3300025986 | Ga0207658_10008052 | Ga0207658_100080526 | 461 |
| 226 | 3300026067 | Ga0207678_10011488 | Ga0207678_100114884 | 461 |
| 227 | 3300026075 | Ga0207708_10004901 | Ga0207708_100049014 | 461 |
| 228 | 3300026078 | Ga0207702_10068697 | Ga0207702_100686972 | 461 |
| 229 | 3300026088 | Ga0207641_10011257 | Ga0207641_100112575 | 461 |
| 230 | 3300026089 | Ga0207648_10016984 | Ga0207648_100169844 | 461 |
| 231 | 3300026118 | Ga0207675_100005453 | Ga0207675_1000054536 | 461 |
| 232 | 3300026121 | Ga0207683_10018096 | Ga0207683_100180965 | 461 |
| 233 | 3300026142 | Ga0207698_10024746 | Ga0207698_100247462 | 461 |
| 234 | 3300027907 | Ga0207428_10004572 | Ga0207428_1000457211 | 461 |
| 235 | 3300028380 | Ga0268265_10012344 | Ga0268265_100123444 | 461 |
| 236 | 3300028381 | Ga0268264_10081157 | Ga0268264_100811572 | 461 |
| 237 | 3300046457 | Ga0495590_0028653 | Ga0495590_0028653_30_1451 | 461 |
| 238 | 3300048903 | Ga0496100_0057614 | Ga0496100_0057614_765_2186 | 461 |
| 239 | 3300048904 | Ga0496101_0028769 | Ga0496101_0028769_1568_2989 | 461 |
| 240 | 3300048905 | Ga0496102_0029685 | Ga0496102_0029685_2486_3907 | 461 |
| 241 | 3300048907 | Ga0496104_0033638 | Ga0496104_0033638_451_1872 | 461 |
| 242 | 3300048908 | Ga0496105_0018426 | Ga0496105_0018426_2771_4192 | 461 |
| 243 | 3300048909 | Ga0496106_0019784 | Ga0496106_0019784_87_1508 | 461 |
| 244 | 3300048910 | Ga0496107_0029822 | Ga0496107_0029822_1024_2445 | 461 |
| 245 | 3300048911 | Ga0496108_0012368 | Ga0496108_0012368_1440_2861 | 461 |
| 246 | 3300048913 | Ga0496110_0004426 | Ga0496110_0004426_5406_6827 | 461 |
| 247 | 3300048914 | Ga0496111_0010441 | Ga0496111_0010441_2119_3540 | 461 |
| 248 | 3300048916 | Ga0496113_0003436 | Ga0496113_0003436_5456_6877 | 461 |
| 249 | 3300048917 | Ga0496114_0023885 | Ga0496114_0023885_574_1995 | 461 |
| 250 | 3300048918 | Ga0496115_0018321 | Ga0496115_0018321_2092_3513 | 461 |
| 251 | 3300049569 | Ga0501032_0028467 | Ga0501032_0028467_23_1411 | 461 |
| 252 | 3300049571 | Ga0501034_0006205 | Ga0501034_0006205_4979_6370 | 461 |
| 253 | 3300049571 | Ga0501034_0008624 | Ga0501034_0008624_4768_6168 | 461 |
| 254 | 3300049571 | Ga0501034_0157288 | Ga0501034_0157288_806_2206 | 461 |
| 255 | 3300049572 | Ga0501036_0000372 | Ga0501036_0000372_13352_14752 | 461 |
| 256 | 3300049573 | Ga0501037_0008325 | Ga0501037_0008325_1431_2831 | 461 |
| 257 | 3300049573 | Ga0501037_0020689 | Ga0501037_0020689_2322_3710 | 461 |
| 258 | 3300049574 | Ga0501038_0017530 | Ga0501038_0017530_4052_5440 | 461 |
| 259 | 3300049574 | Ga0501038_0026512 | Ga0501038_0026512_1231_2691 | 461 |
| 260 | 3300049579 | Ga0501043_0005267 | Ga0501043_0005267_6877_8277 | 461 |
| 261 | 3300049579 | Ga0501043_0023206 | Ga0501043_0023206_1269_2657 | 461 |
| 262 | 3300049580 | Ga0501046_0066195 | Ga0501046_0066195_188_1612 | 461 |
| 263 | 3300049581 | Ga0501047_0000164 | Ga0501047_0000164_52359_53759 | 461 |
| 264 | 3300049581 | Ga0501047_0025565 | Ga0501047_0025565_2265_3653 | 461 |
| 265 | 3300049581 | Ga0501047_0109023 | Ga0501047_0109023_170_1594 | 461 |
| 266 | 3300049582 | Ga0501048_0003459 | Ga0501048_0003459_4613_6013 | 461 |
| 267 | 3300049586 | Ga0501070_0021489 | Ga0501070_0021489_2524_3984 | 461 |
| 268 | 3300049586 | Ga0501070_0035382 | Ga0501070_0035382_365_1765 | 461 |
| 269 | 3300049586 | Ga0501070_0143033 | Ga0501070_0143033_86_1474 | 461 |
| 270 | 3300049586 | Ga0501070_0162714 | Ga0501070_0162714_289_1677 | 461 |
| 271 | 3300049588 | Ga0501072_0065822 | Ga0501072_0065822_790_2178 | 461 |
| 272 | 3300049590 | Ga0501074_0016572 | Ga0501074_0016572_1737_3125 | 461 |
| 273 | 3300049741 | Ga0501079_0047569 | Ga0501079_0047569_1134_2522 | 461 |
| 274 | 3300049742 | Ga0501080_0000235 | Ga0501080_0000235_25427_26827 | 461 |
| 275 | 3300049742 | Ga0501080_0043320 | Ga0501080_0043320_1029_2417 | 461 |
| 276 | 3300049742 | Ga0501080_0048885 | Ga0501080_0048885_2307_3767 | 461 |
| 277 | 3300049822 | Ga0501035_0046252 | Ga0501035_0046252_169_1629 | 461 |
| 278 | 3300049823 | Ga0501044_0004015 | Ga0501044_0004015_7246_8646 | 461 |
| 279 | 3300049823 | Ga0501044_0043740 | Ga0501044_0043740_2632_4056 | 461 |
| 280 | 3300049823 | Ga0501044_0127556 | Ga0501044_0127556_762_2150 | 461 |
| 281 | 3300050507 | nmdc:mga05p37_201_c1 | nmdc:mga05p37_201_c1_22781_24187 | 461 |
| 282 | 3300050507 | nmdc:mga05p37_44522_c1 | nmdc:mga05p37_44522_c1_3644_5047 | 461 |
| 283 | 3300050508 | nmdc:mga09592_30035_c1 | nmdc:mga09592_30035_c1_2214_3620 | 461 |
| 284 | 3300050509 | nmdc:mga0qj67_26699_c1 | nmdc:mga0qj67_26699_c1_72_1478 | 461 |
| 285 | 3300050510 | nmdc:mga06r32_451_c1 | nmdc:mga06r32_451_c1_28831_30237 | 461 |
| 286 | 3300050511 | nmdc:mga08y16_48_c1 | nmdc:mga08y16_48_c1_9532_10938 | 461 |
| 287 | 2209111006 | 2214745202 | 2213754632 | 462 |
| 288 | 3300000042 | ARSoilYngRDRAFT_c00086 | ARSoilYngRDRAFT_000863 | 462 |
| 289 | 3300000043 | ARcpr5yngRDRAFT_c000084 | ARcpr5yngRDRAFT_00008418 | 462 |
| 290 | 3300000044 | ARSoilOldRDRAFT_c000050 | ARSoilOldRDRAFT_00005026 | 462 |
| 291 | 3300000652 | ARCol0yngRDRAFT_1000023 | ARCol0yngRDRAFT_100002326 | 462 |
| 292 | 3300001989 | JGI24739J22299_10000209 | JGI24739J22299_1000020920 | 462 |
| 293 | 3300001989 | JGI24739J22299_10002430 | JGI24739J22299_100024306 | 462 |
| 294 | 3300001990 | JGI24737J22298_10000739 | JGI24737J22298_1000073911 | 462 |
| 295 | 3300001990 | JGI24737J22298_10003173 | JGI24737J22298_100031736 | 462 |
| 296 | 3300002070 | JGI24750J21931_1000551 | JGI24750J21931_10005513 | 462 |
| 297 | 3300002074 | JGI24748J21848_1000695 | JGI24748J21848_10006953 | 462 |
| 298 | 3300002075 | JGI24738J21930_10001189 | JGI24738J21930_100011894 | 462 |
| 299 | 3300002076 | JGI24749J21850_1000283 | JGI24749J21850_10002838 | 462 |
| 300 | 3300002077 | JGI24744J21845_10000810 | JGI24744J21845_100008106 | 462 |
| 301 | 3300002126 | JGI24035J26624_1000365 | JGI24035J26624_10003653 | 462 |
| 302 | 3300002244 | JGI24742J22300_10000279 | JGI24742J22300_100002793 | 462 |
| 303 | 3300003215 | JGI25153J46596_10004383 | JGI25153J46596_100043836 | 462 |
| 304 | 3300005288 | Ga0065714_10095322 | Ga0065714_100953221 | 462 |
| 305 | 3300005289 | Ga0065704_10073133 | Ga0065704_100731337 | 462 |
| 306 | 3300005290 | Ga0065712_10070789 | Ga0065712_100707896 | 462 |
| 307 | 3300005293 | Ga0065715_10000519 | Ga0065715_100005194 | 462 |
| 308 | 3300005293 | Ga0065715_10004456 | Ga0065715_100044563 | 462 |
| 309 | 3300005328 | Ga0070676_10002633 | Ga0070676_100026333 | 462 |
| 310 | 3300005329 | Ga0070683_100010864 | Ga0070683_1000108647 | 462 |
| 311 | 3300005329 | Ga0070683_100035491 | Ga0070683_1000354913 | 462 |
| 312 | 3300005330 | Ga0070690_100001459 | Ga0070690_10000145912 | 462 |
| 313 | 3300005331 | Ga0070670_100012949 | Ga0070670_1000129495 | 462 |
| 314 | 3300005331 | Ga0070670_100027821 | Ga0070670_1000278211 | 462 |
| 315 | 3300005333 | Ga0070677_10000109 | Ga0070677_1000010911 | 462 |
| 316 | 3300005334 | Ga0068869_100004148 | Ga0068869_1000041483 | 462 |
| 317 | 3300005334 | Ga0068869_100146055 | Ga0068869_1001460552 | 462 |
| 318 | 3300005336 | Ga0070680_100018038 | Ga0070680_1000180383 | 462 |
| 319 | 3300005336 | Ga0070680_100063179 | Ga0070680_1000631792 | 462 |
| 320 | 3300005337 | Ga0070682_100000459 | Ga0070682_10000045922 | 462 |
| 321 | 3300005337 | Ga0070682_100034055 | Ga0070682_1000340553 | 462 |
| 322 | 3300005337 | Ga0070682_100040299 | Ga0070682_1000402992 | 462 |
| 323 | 3300005338 | Ga0068868_100000443 | Ga0068868_10000044327 | 462 |
| 324 | 3300005339 | Ga0070660_100034923 | Ga0070660_1000349233 | 462 |
| 325 | 3300005339 | Ga0070660_100046626 | Ga0070660_1000466262 | 462 |
| 326 | 3300005340 | Ga0070689_100000423 | Ga0070689_10000042315 | 462 |
| 327 | 3300005340 | Ga0070689_100001662 | Ga0070689_1000016624 | 462 |
| 328 | 3300005340 | Ga0070689_100020869 | Ga0070689_1000208693 | 462 |
| 329 | 3300005341 | Ga0070691_10001927 | Ga0070691_100019277 | 462 |
| 330 | 3300005341 | Ga0070691_10011614 | Ga0070691_100116143 | 462 |
| 331 | 3300005341 | Ga0070691_10011885 | Ga0070691_100118852 | 462 |
| 332 | 3300005343 | Ga0070687_100000706 | Ga0070687_1000007068 | 462 |
| 333 | 3300005343 | Ga0070687_100005176 | Ga0070687_1000051765 | 462 |
| 334 | 3300005343 | Ga0070687_100022617 | Ga0070687_1000226173 | 462 |
| 335 | 3300005344 | Ga0070661_100001619 | Ga0070661_1000016193 | 462 |
| 336 | 3300005345 | Ga0070692_10000262 | Ga0070692_1000026210 | 462 |
| 337 | 3300005345 | Ga0070692_10046098 | Ga0070692_100460981 | 462 |
| 338 | 3300005347 | Ga0070668_100001027 | Ga0070668_10000102711 | 462 |
| 339 | 3300005353 | Ga0070669_100002329 | Ga0070669_1000023293 | 462 |
| 340 | 3300005353 | Ga0070669_100064546 | Ga0070669_1000645462 | 462 |
| 341 | 3300005354 | Ga0070675_100040634 | Ga0070675_1000406343 | 462 |
| 342 | 3300005355 | Ga0070671_100017038 | Ga0070671_1000170382 | 462 |
| 343 | 3300005355 | Ga0070671_100019919 | Ga0070671_1000199192 | 462 |
| 344 | 3300005356 | Ga0070674_100001251 | Ga0070674_10000125113 | 462 |
| 345 | 3300005356 | Ga0070674_100043841 | Ga0070674_1000438411 | 462 |
| 346 | 3300005364 | Ga0070673_100000050 | Ga0070673_10000005045 | 462 |
| 347 | 3300005364 | Ga0070673_100006576 | Ga0070673_1000065764 | 462 |
| 348 | 3300005364 | Ga0070673_100016705 | Ga0070673_1000167053 | 462 |
| 349 | 3300005365 | Ga0070688_100001640 | Ga0070688_1000016409 | 462 |
| 350 | 3300005365 | Ga0070688_100007074 | Ga0070688_1000070742 | 462 |
| 351 | 3300005365 | Ga0070688_100036737 | Ga0070688_1000367372 | 462 |
| 352 | 3300005366 | Ga0070659_100012533 | Ga0070659_1000125333 | 462 |
| 353 | 3300005366 | Ga0070659_100037940 | Ga0070659_1000379402 | 462 |
| 354 | 3300005366 | Ga0070659_100042832 | Ga0070659_1000428322 | 462 |
| 355 | 3300005367 | Ga0070667_100006734 | Ga0070667_1000067347 | 462 |
| 356 | 3300005367 | Ga0070667_100015429 | Ga0070667_1000154292 | 462 |
| 357 | 3300005367 | Ga0070667_100033083 | Ga0070667_1000330832 | 462 |
| 358 | 3300005406 | Ga0070703_10001729 | Ga0070703_100017293 | 462 |
| 359 | 3300005406 | Ga0070703_10002210 | Ga0070703_100022102 | 462 |
| 360 | 3300005434 | Ga0070709_10000525 | Ga0070709_1000052512 | 462 |
| 361 | 3300005435 | Ga0070714_100005095 | Ga0070714_1000050953 | 462 |
| 362 | 3300005436 | Ga0070713_100001754 | Ga0070713_1000017545 | 462 |
| 363 | 3300005436 | Ga0070713_100178398 | Ga0070713_1001783981 | 462 |
| 364 | 3300005437 | Ga0070710_10001598 | Ga0070710_1000159810 | 462 |
| 365 | 3300005437 | Ga0070710_10069031 | Ga0070710_100690312 | 462 |
| 366 | 3300005438 | Ga0070701_10000093 | Ga0070701_100000935 | 462 |
| 367 | 3300005438 | Ga0070701_10021819 | Ga0070701_100218192 | 462 |
| 368 | 3300005439 | Ga0070711_100016501 | Ga0070711_1000165012 | 462 |
| 369 | 3300005440 | Ga0070705_100003411 | Ga0070705_1000034114 | 462 |
| 370 | 3300005440 | Ga0070705_100009540 | Ga0070705_1000095403 | 462 |
| 371 | 3300005440 | Ga0070705_100101189 | Ga0070705_1001011892 | 462 |
| 372 | 3300005441 | Ga0070700_100009936 | Ga0070700_1000099363 | 462 |
| 373 | 3300005441 | Ga0070700_100014595 | Ga0070700_1000145952 | 462 |
| 374 | 3300005441 | Ga0070700_100016882 | Ga0070700_1000168822 | 462 |
| 375 | 3300005444 | Ga0070694_100009576 | Ga0070694_1000095762 | 462 |
| 376 | 3300005444 | Ga0070694_100019701 | Ga0070694_1000197013 | 462 |
| 377 | 3300005455 | Ga0070663_100030724 | Ga0070663_1000307242 | 462 |
| 378 | 3300005455 | Ga0070663_100090611 | Ga0070663_1000906111 | 462 |
| 379 | 3300005456 | Ga0070678_100001756 | Ga0070678_1000017567 | 462 |
| 380 | 3300005456 | Ga0070678_100015618 | Ga0070678_1000156183 | 462 |
| 381 | 3300005456 | Ga0070678_100133004 | Ga0070678_1001330042 | 462 |
| 382 | 3300005457 | Ga0070662_100003987 | Ga0070662_1000039872 | 462 |
| 383 | 3300005457 | Ga0070662_100009135 | Ga0070662_1000091354 | 462 |
| 384 | 3300005458 | Ga0070681_10001623 | Ga0070681_100016237 | 462 |
| 385 | 3300005458 | Ga0070681_10030838 | Ga0070681_100308384 | 462 |
| 386 | 3300005458 | Ga0070681_10149529 | Ga0070681_101495291 | 462 |
| 387 | 3300005459 | Ga0068867_100001138 | Ga0068867_10000113813 | 462 |
| 388 | 3300005459 | Ga0068867_100012280 | Ga0068867_1000122804 | 462 |
| 389 | 3300005459 | Ga0068867_100035703 | Ga0068867_1000357032 | 462 |
| 390 | 3300005466 | Ga0070685_10000984 | Ga0070685_100009848 | 462 |
| 391 | 3300005466 | Ga0070685_10017650 | Ga0070685_100176503 | 462 |
| 392 | 3300005466 | Ga0070685_10029019 | Ga0070685_100290192 | 462 |
| 393 | 3300005518 | Ga0070699_100001809 | Ga0070699_1000018093 | 462 |
| 394 | 3300005530 | Ga0070679_100091379 | Ga0070679_1000913792 | 462 |
| 395 | 3300005535 | Ga0070684_100029522 | Ga0070684_1000295223 | 462 |
| 396 | 3300005535 | Ga0070684_100035117 | Ga0070684_1000351174 | 462 |
| 397 | 3300005535 | Ga0070684_100086779 | Ga0070684_1000867792 | 462 |
| 398 | 3300005535 | Ga0070684_100090738 | Ga0070684_1000907381 | 462 |
| 399 | 3300005539 | Ga0068853_100002995 | Ga0068853_1000029956 | 462 |
| 400 | 3300005539 | Ga0068853_100073321 | Ga0068853_1000733213 | 462 |
| 401 | 3300005543 | Ga0070672_100003943 | Ga0070672_1000039434 | 462 |
| 402 | 3300005544 | Ga0070686_100009031 | Ga0070686_1000090315 | 462 |
| 403 | 3300005544 | Ga0070686_100021350 | Ga0070686_1000213503 | 462 |
| 404 | 3300005545 | Ga0070695_100000824 | Ga0070695_1000008247 | 462 |
| 405 | 3300005545 | Ga0070695_100002921 | Ga0070695_1000029216 | 462 |
| 406 | 3300005545 | Ga0070695_100017465 | Ga0070695_1000174653 | 462 |
| 407 | 3300005546 | Ga0070696_100000856 | Ga0070696_10000085616 | 462 |
| 408 | 3300005547 | Ga0070693_100001975 | Ga0070693_1000019753 | 462 |
| 409 | 3300005548 | Ga0070665_100244531 | Ga0070665_1002445311 | 462 |
| 410 | 3300005549 | Ga0070704_100002335 | Ga0070704_1000023355 | 462 |
| 411 | 3300005549 | Ga0070704_100002836 | Ga0070704_1000028365 | 462 |
| 412 | 3300005549 | Ga0070704_100006569 | Ga0070704_1000065693 | 462 |
| 413 | 3300005549 | Ga0070704_100039281 | Ga0070704_1000392812 | 462 |
| 414 | 3300005563 | Ga0068855_100015755 | Ga0068855_1000157552 | 462 |
| 415 | 3300005564 | Ga0070664_100024583 | Ga0070664_1000245831 | 462 |
| 416 | 3300005564 | Ga0070664_100037892 | Ga0070664_1000378923 | 462 |
| 417 | 3300005564 | Ga0070664_100079318 | Ga0070664_1000793182 | 462 |
| 418 | 3300005577 | Ga0068857_100008305 | Ga0068857_1000083052 | 462 |
| 419 | 3300005577 | Ga0068857_100043792 | Ga0068857_1000437923 | 462 |
| 420 | 3300005578 | Ga0068854_100003868 | Ga0068854_1000038688 | 462 |
| 421 | 3300005578 | Ga0068854_100015449 | Ga0068854_1000154493 | 462 |
| 422 | 3300005578 | Ga0068854_100072375 | Ga0068854_1000723752 | 462 |
| 423 | 3300005614 | Ga0068856_100003821 | Ga0068856_10000382116 | 462 |
| 424 | 3300005614 | Ga0068856_100058666 | Ga0068856_1000586663 | 462 |
| 425 | 3300005615 | Ga0070702_100000497 | Ga0070702_1000004974 | 462 |
| 426 | 3300005615 | Ga0070702_100006109 | Ga0070702_1000061093 | 462 |
| 427 | 3300005616 | Ga0068852_100001222 | Ga0068852_1000012224 | 462 |
| 428 | 3300005617 | Ga0068859_100021148 | Ga0068859_1000211483 | 462 |
| 429 | 3300005617 | Ga0068859_100023550 | Ga0068859_1000235503 | 462 |
| 430 | 3300005617 | Ga0068859_100025814 | Ga0068859_1000258143 | 462 |
| 431 | 3300005617 | Ga0068859_100034357 | Ga0068859_1000343573 | 462 |
| 432 | 3300005618 | Ga0068864_100001074 | Ga0068864_10000107411 | 462 |
| 433 | 3300005618 | Ga0068864_100006339 | Ga0068864_1000063398 | 462 |
| 434 | 3300005618 | Ga0068864_100012258 | Ga0068864_1000122586 | 462 |
| 435 | 3300005618 | Ga0068864_100048003 | Ga0068864_1000480033 | 462 |
| 436 | 3300005718 | Ga0068866_10005659 | Ga0068866_100056592 | 462 |
| 437 | 3300005718 | Ga0068866_10068047 | Ga0068866_100680472 | 462 |
| 438 | 3300005719 | Ga0068861_100001328 | Ga0068861_1000013286 | 462 |
| 439 | 3300005719 | Ga0068861_100016726 | Ga0068861_1000167264 | 462 |
| 440 | 3300005719 | Ga0068861_100017632 | Ga0068861_1000176324 | 462 |
| 441 | 3300005840 | Ga0068870_10000051 | Ga0068870_1000005120 | 462 |
| 442 | 3300005840 | Ga0068870_10015842 | Ga0068870_100158423 | 462 |
| 443 | 3300005841 | Ga0068863_100008364 | Ga0068863_1000083648 | 462 |
| 444 | 3300005841 | Ga0068863_100013387 | Ga0068863_1000133874 | 462 |
| 445 | 3300005841 | Ga0068863_100026590 | Ga0068863_1000265903 | 462 |
| 446 | 3300005842 | Ga0068858_100005147 | Ga0068858_10000514712 | 462 |
| 447 | 3300005842 | Ga0068858_100034414 | Ga0068858_1000344144 | 462 |
| 448 | 3300005842 | Ga0068858_100092885 | Ga0068858_1000928852 | 462 |
| 449 | 3300005843 | Ga0068860_100001825 | Ga0068860_10000182517 | 462 |
| 450 | 3300005843 | Ga0068860_100008760 | Ga0068860_1000087607 | 462 |
| 451 | 3300005843 | Ga0068860_100010661 | Ga0068860_1000106616 | 462 |
| 452 | 3300005843 | Ga0068860_100023546 | Ga0068860_1000235463 | 462 |
| 453 | 3300005843 | Ga0068860_100104445 | Ga0068860_1001044451 | 462 |
| 454 | 3300005843 | Ga0068860_100144787 | Ga0068860_1001447872 | 462 |
| 455 | 3300005844 | Ga0068862_100001949 | Ga0068862_1000019493 | 462 |
| 456 | 3300005844 | Ga0068862_100016670 | Ga0068862_1000166703 | 462 |
| 457 | 3300005937 | Ga0081455_10000081 | Ga0081455_1000008122 | 462 |
| 458 | 3300005937 | Ga0081455_10002198 | Ga0081455_100021988 | 462 |
| 459 | 3300006038 | Ga0075365_10126900 | Ga0075365_101269002 | 462 |
| 460 | 3300006163 | Ga0070715_10000551 | Ga0070715_100005512 | 462 |
| 461 | 3300006173 | Ga0070716_100001287 | Ga0070716_1000012877 | 462 |
| 462 | 3300006175 | Ga0070712_100004737 | Ga0070712_1000047375 | 462 |
| 463 | 3300006194 | Ga0075427_10000603 | Ga0075427_100006032 | 462 |
| 464 | 3300006195 | Ga0075366_10012326 | Ga0075366_100123262 | 462 |
| 465 | 3300006237 | Ga0097621_100001496 | Ga0097621_1000014963 | 462 |
| 466 | 3300006358 | Ga0068871_100003134 | Ga0068871_1000031344 | 462 |
| 467 | 3300006358 | Ga0068871_100023904 | Ga0068871_1000239043 | 462 |
| 468 | 3300006358 | Ga0068871_100081876 | Ga0068871_1000818762 | 462 |
| 469 | 3300006844 | Ga0075428_100024539 | Ga0075428_1000245392 | 462 |
| 470 | 3300006846 | Ga0075430_100013350 | Ga0075430_1000133503 | 462 |
| 471 | 3300006847 | Ga0075431_100001076 | Ga0075431_1000010763 | 462 |
| 472 | 3300006847 | Ga0075431_100042948 | Ga0075431_1000429484 | 462 |
| 473 | 3300006852 | Ga0075433_10000012 | Ga0075433_100000124 | 462 |
| 474 | 3300006852 | Ga0075433_10025668 | Ga0075433_100256683 | 462 |
| 475 | 3300006871 | Ga0075434_100003201 | Ga0075434_1000032013 | 462 |
| 476 | 3300006871 | Ga0075434_100008056 | Ga0075434_1000080563 | 462 |
| 477 | 3300006871 | Ga0075434_100012519 | Ga0075434_1000125194 | 462 |
| 478 | 3300006880 | Ga0075429_100000098 | Ga0075429_10000009827 | 462 |
| 479 | 3300006881 | Ga0068865_100003854 | Ga0068865_1000038543 | 462 |
| 480 | 3300006881 | Ga0068865_100016325 | Ga0068865_1000163253 | 462 |
| 481 | 3300006931 | Ga0097620_100021146 | Ga0097620_1000211465 | 462 |
| 482 | 3300006931 | Ga0097620_100023550 | Ga0097620_1000235503 | 462 |
| 483 | 3300006931 | Ga0097620_100025814 | Ga0097620_1000258144 | 462 |
| 484 | 3300006931 | Ga0097620_100034355 | Ga0097620_1000343553 | 462 |
| 485 | 3300007076 | Ga0075435_100028671 | Ga0075435_1000286712 | 462 |
| 486 | 3300007076 | Ga0075435_100069072 | Ga0075435_1000690722 | 462 |
| 487 | 3300009092 | Ga0105250_10040014 | Ga0105250_100400142 | 462 |
| 488 | 3300009094 | Ga0111539_10000757 | Ga0111539_1000075729 | 462 |
| 489 | 3300009094 | Ga0111539_10001671 | Ga0111539_1000167127 | 462 |
| 490 | 3300009094 | Ga0111539_10008480 | Ga0111539_100084803 | 462 |
| 491 | 3300009094 | Ga0111539_10100128 | Ga0111539_101001282 | 462 |
| 492 | 3300009098 | Ga0105245_10002488 | Ga0105245_1000248812 | 462 |
| 493 | 3300009098 | Ga0105245_10050094 | Ga0105245_100500942 | 462 |
| 494 | 3300009098 | Ga0105245_10182552 | Ga0105245_101825522 | 462 |
| 495 | 3300009101 | Ga0105247_10006103 | Ga0105247_100061036 | 462 |
| 496 | 3300009101 | Ga0105247_10008404 | Ga0105247_100084043 | 462 |
| 497 | 3300009101 | Ga0105247_10036684 | Ga0105247_100366842 | 462 |
| 498 | 3300009147 | Ga0114129_10008949 | Ga0114129_100089492 | 462 |
| 499 | 3300009147 | Ga0114129_10023567 | Ga0114129_100235677 | 462 |
| 500 | 3300009147 | Ga0114129_10050640 | Ga0114129_100506403 | 462 |
| 501 | 3300009148 | Ga0105243_10003214 | Ga0105243_1000321411 | 462 |
| 502 | 3300009148 | Ga0105243_10009303 | Ga0105243_100093033 | 462 |
| 503 | 3300009174 | Ga0105241_10004876 | Ga0105241_100048766 | 462 |
| 504 | 3300009174 | Ga0105241_10005826 | Ga0105241_100058265 | 462 |
| 505 | 3300009174 | Ga0105241_10065776 | Ga0105241_100657762 | 462 |
| 506 | 3300009176 | Ga0105242_10002016 | Ga0105242_100020166 | 462 |
| 507 | 3300009176 | Ga0105242_10003519 | Ga0105242_100035194 | 462 |
| 508 | 3300009176 | Ga0105242_10108685 | Ga0105242_101086852 | 462 |
| 509 | 3300009177 | Ga0105248_10003871 | Ga0105248_100038713 | 462 |
| 510 | 3300009177 | Ga0105248_10099691 | Ga0105248_100996913 | 462 |
| 511 | 3300009545 | Ga0105237_10006016 | Ga0105237_1000601612 | 462 |
| 512 | 3300009545 | Ga0105237_10078801 | Ga0105237_100788013 | 462 |
| 513 | 3300009545 | Ga0105237_10095030 | Ga0105237_100950302 | 462 |
| 514 | 3300009551 | Ga0105238_10054187 | Ga0105238_100541873 | 462 |
| 515 | 3300009553 | Ga0105249_10001193 | Ga0105249_1000119310 | 462 |
| 516 | 3300009553 | Ga0105249_10001979 | Ga0105249_100019793 | 462 |
| 517 | 3300009553 | Ga0105249_10108889 | Ga0105249_101088892 | 462 |
| 518 | 3300010375 | Ga0105239_10027649 | Ga0105239_100276493 | 462 |
| 519 | 3300010375 | Ga0105239_10035856 | Ga0105239_100358562 | 462 |
| 520 | 3300010375 | Ga0105239_10041876 | Ga0105239_100418764 | 462 |
| 521 | 3300011119 | Ga0105246_10000231 | Ga0105246_100002313 | 462 |
| 522 | 3300011119 | Ga0105246_10015760 | Ga0105246_100157607 | 462 |
| 523 | 3300013100 | Ga0157373_10010248 | Ga0157373_100102486 | 462 |
| 524 | 3300013100 | Ga0157373_10102676 | Ga0157373_101026762 | 462 |
| 525 | 3300013102 | Ga0157371_10025479 | Ga0157371_100254792 | 462 |
| 526 | 3300013296 | Ga0157374_10003239 | Ga0157374_1000323911 | 462 |
| 527 | 3300013296 | Ga0157374_10017421 | Ga0157374_100174213 | 462 |
| 528 | 3300013296 | Ga0157374_10031696 | Ga0157374_100316962 | 462 |
| 529 | 3300013297 | Ga0157378_10004453 | Ga0157378_100044532 | 462 |
| 530 | 3300013297 | Ga0157378_10010612 | Ga0157378_100106125 | 462 |
| 531 | 3300013297 | Ga0157378_10021915 | Ga0157378_100219153 | 462 |
| 532 | 3300013306 | Ga0163162_10006149 | Ga0163162_100061493 | 462 |
| 533 | 3300013306 | Ga0163162_10020738 | Ga0163162_100207382 | 462 |
| 534 | 3300013306 | Ga0163162_10026579 | Ga0163162_100265793 | 462 |
| 535 | 3300013307 | Ga0157372_10025465 | Ga0157372_100254656 | 462 |
| 536 | 3300013308 | Ga0157375_10006518 | Ga0157375_100065186 | 462 |
| 537 | 3300013308 | Ga0157375_10033972 | Ga0157375_100339723 | 462 |
| 538 | 3300013308 | Ga0157375_10100999 | Ga0157375_101009992 | 462 |
| 539 | 3300013308 | Ga0157375_10119222 | Ga0157375_101192222 | 462 |
| 540 | 3300014325 | Ga0163163_10001320 | Ga0163163_1000132013 | 462 |
| 541 | 3300014325 | Ga0163163_10015790 | Ga0163163_100157907 | 462 |
| 542 | 3300014325 | Ga0163163_10051326 | Ga0163163_100513263 | 462 |
| 543 | 3300014325 | Ga0163163_10168581 | Ga0163163_101685811 | 462 |
| 544 | 3300014326 | Ga0157380_10002744 | Ga0157380_1000274410 | 462 |
| 545 | 3300014745 | Ga0157377_10000164 | Ga0157377_1000016429 | 462 |
| 546 | 3300014968 | Ga0157379_10020078 | Ga0157379_100200783 | 462 |
| 547 | 3300014968 | Ga0157379_10030909 | Ga0157379_100309093 | 462 |
| 548 | 3300014968 | Ga0157379_10061490 | Ga0157379_100614902 | 462 |
| 549 | 3300014969 | Ga0157376_10002102 | Ga0157376_100021023 | 462 |
| 550 | 3300014969 | Ga0157376_10036456 | Ga0157376_100364564 | 462 |
| 551 | 3300014969 | Ga0157376_10036479 | Ga0157376_100364793 | 462 |
| 552 | 3300014969 | Ga0157376_10088277 | Ga0157376_100882772 | 462 |
| 553 | 3300017792 | Ga0163161_10002837 | Ga0163161_100028373 | 462 |
| 554 | 3300017792 | Ga0163161_10131060 | Ga0163161_101310601 | 462 |
| 555 | 3300025271 | Ga0207666_1000051 | Ga0207666_100005114 | 462 |
| 556 | 3300025297 | Ga0209758_1000125 | Ga0209758_100012572 | 462 |
| 557 | 3300025315 | Ga0207697_10000662 | Ga0207697_1000066212 | 462 |
| 558 | 3300025885 | Ga0207653_10000546 | Ga0207653_1000054614 | 462 |
| 559 | 3300025885 | Ga0207653_10001467 | Ga0207653_100014673 | 462 |
| 560 | 3300025893 | Ga0207682_10000072 | Ga0207682_1000007219 | 462 |
| 561 | 3300025898 | Ga0207692_10002147 | Ga0207692_100021476 | 462 |
| 562 | 3300025899 | Ga0207642_10001909 | Ga0207642_100019096 | 462 |
| 563 | 3300025900 | Ga0207710_10000558 | Ga0207710_100005587 | 462 |
| 564 | 3300025900 | Ga0207710_10004313 | Ga0207710_100043134 | 462 |
| 565 | 3300025901 | Ga0207688_10000229 | Ga0207688_1000022919 | 462 |
| 566 | 3300025901 | Ga0207688_10004677 | Ga0207688_100046773 | 462 |
| 567 | 3300025904 | Ga0207647_10003353 | Ga0207647_100033536 | 462 |
| 568 | 3300025904 | Ga0207647_10010679 | Ga0207647_100106795 | 462 |
| 569 | 3300025905 | Ga0207685_10001607 | Ga0207685_100016072 | 462 |
| 570 | 3300025905 | Ga0207685_10003975 | Ga0207685_100039753 | 462 |
| 571 | 3300025906 | Ga0207699_10002080 | Ga0207699_100020805 | 462 |
| 572 | 3300025906 | Ga0207699_10015546 | Ga0207699_100155462 | 462 |
| 573 | 3300025907 | Ga0207645_10000966 | Ga0207645_1000096618 | 462 |
| 574 | 3300025907 | Ga0207645_10007388 | Ga0207645_100073885 | 462 |
| 575 | 3300025908 | Ga0207643_10000004 | Ga0207643_1000000444 | 462 |
| 576 | 3300025908 | Ga0207643_10000794 | Ga0207643_1000079420 | 462 |
| 577 | 3300025908 | Ga0207643_10065728 | Ga0207643_100657281 | 462 |
| 578 | 3300025911 | Ga0207654_10001472 | Ga0207654_1000147210 | 462 |
| 579 | 3300025911 | Ga0207654_10007425 | Ga0207654_100074252 | 462 |
| 580 | 3300025912 | Ga0207707_10007028 | Ga0207707_100070284 | 462 |
| 581 | 3300025912 | Ga0207707_10065564 | Ga0207707_100655643 | 462 |
| 582 | 3300025914 | Ga0207671_10013159 | Ga0207671_100131592 | 462 |
| 583 | 3300025914 | Ga0207671_10020766 | Ga0207671_100207663 | 462 |
| 584 | 3300025914 | Ga0207671_10048003 | Ga0207671_100480033 | 462 |
| 585 | 3300025915 | Ga0207693_10006880 | Ga0207693_100068808 | 462 |
| 586 | 3300025916 | Ga0207663_10010875 | Ga0207663_100108754 | 462 |
| 587 | 3300025916 | Ga0207663_10017354 | Ga0207663_100173544 | 462 |
| 588 | 3300025917 | Ga0207660_10000648 | Ga0207660_100006484 | 462 |
| 589 | 3300025918 | Ga0207662_10000317 | Ga0207662_1000031714 | 462 |
| 590 | 3300025918 | Ga0207662_10000424 | Ga0207662_1000042420 | 462 |
| 591 | 3300025918 | Ga0207662_10013378 | Ga0207662_100133784 | 462 |
| 592 | 3300025918 | Ga0207662_10023881 | Ga0207662_100238813 | 462 |
| 593 | 3300025918 | Ga0207662_10032770 | Ga0207662_100327702 | 462 |
| 594 | 3300025918 | Ga0207662_10091114 | Ga0207662_100911142 | 462 |
| 595 | 3300025919 | Ga0207657_10002047 | Ga0207657_1000204714 | 462 |
| 596 | 3300025919 | Ga0207657_10028849 | Ga0207657_100288493 | 462 |
| 597 | 3300025920 | Ga0207649_10000262 | Ga0207649_1000026219 | 462 |
| 598 | 3300025920 | Ga0207649_10090257 | Ga0207649_100902572 | 462 |
| 599 | 3300025921 | Ga0207652_10000911 | Ga0207652_100009113 | 462 |
| 600 | 3300025923 | Ga0207681_10010634 | Ga0207681_100106344 | 462 |
| 601 | 3300025924 | Ga0207694_10024208 | Ga0207694_100242083 | 462 |
| 602 | 3300025925 | Ga0207650_10013694 | Ga0207650_100136942 | 462 |
| 603 | 3300025925 | Ga0207650_10019548 | Ga0207650_100195482 | 462 |
| 604 | 3300025926 | Ga0207659_10001684 | Ga0207659_1000168411 | 462 |
| 605 | 3300025926 | Ga0207659_10012218 | Ga0207659_100122184 | 462 |
| 606 | 3300025926 | Ga0207659_10024969 | Ga0207659_100249694 | 462 |
| 607 | 3300025927 | Ga0207687_10001501 | Ga0207687_100015016 | 462 |
| 608 | 3300025927 | Ga0207687_10006389 | Ga0207687_100063893 | 462 |
| 609 | 3300025928 | Ga0207700_10001264 | Ga0207700_100012648 | 462 |
| 610 | 3300025929 | Ga0207664_10002547 | Ga0207664_100025473 | 462 |
| 611 | 3300025931 | Ga0207644_10000467 | Ga0207644_1000046726 | 462 |
| 612 | 3300025931 | Ga0207644_10001961 | Ga0207644_100019618 | 462 |
| 613 | 3300025931 | Ga0207644_10015484 | Ga0207644_100154842 | 462 |
| 614 | 3300025932 | Ga0207690_10001228 | Ga0207690_1000122814 | 462 |
| 615 | 3300025932 | Ga0207690_10009138 | Ga0207690_100091382 | 462 |
| 616 | 3300025933 | Ga0207706_10001679 | Ga0207706_1000167910 | 462 |
| 617 | 3300025933 | Ga0207706_10018822 | Ga0207706_100188226 | 462 |
| 618 | 3300025933 | Ga0207706_10054074 | Ga0207706_100540742 | 462 |
| 619 | 3300025934 | Ga0207686_10002040 | Ga0207686_100020406 | 462 |
| 620 | 3300025934 | Ga0207686_10009318 | Ga0207686_100093185 | 462 |
| 621 | 3300025934 | Ga0207686_10099188 | Ga0207686_100991882 | 462 |
| 622 | 3300025935 | Ga0207709_10035318 | Ga0207709_100353181 | 462 |
| 623 | 3300025936 | Ga0207670_10000377 | Ga0207670_100003773 | 462 |
| 624 | 3300025936 | Ga0207670_10002370 | Ga0207670_100023704 | 462 |
| 625 | 3300025936 | Ga0207670_10037467 | Ga0207670_100374673 | 462 |
| 626 | 3300025937 | Ga0207669_10001912 | Ga0207669_100019126 | 462 |
| 627 | 3300025937 | Ga0207669_10015439 | Ga0207669_100154392 | 462 |
| 628 | 3300025938 | Ga0207704_10002613 | Ga0207704_100026137 | 462 |
| 629 | 3300025939 | Ga0207665_10001035 | Ga0207665_100010358 | 462 |
| 630 | 3300025939 | Ga0207665_10043619 | Ga0207665_100436192 | 462 |
| 631 | 3300025939 | Ga0207665_10067562 | Ga0207665_100675622 | 462 |
| 632 | 3300025940 | Ga0207691_10002691 | Ga0207691_1000269114 | 462 |
| 633 | 3300025940 | Ga0207691_10002874 | Ga0207691_1000287410 | 462 |
| 634 | 3300025941 | Ga0207711_10003410 | Ga0207711_100034109 | 462 |
| 635 | 3300025941 | Ga0207711_10006776 | Ga0207711_100067762 | 462 |
| 636 | 3300025941 | Ga0207711_10022868 | Ga0207711_100228682 | 462 |
| 637 | 3300025941 | Ga0207711_10030274 | Ga0207711_100302742 | 462 |
| 638 | 3300025942 | Ga0207689_10000203 | Ga0207689_1000020328 | 462 |
| 639 | 3300025942 | Ga0207689_10044138 | Ga0207689_100441383 | 462 |
| 640 | 3300025942 | Ga0207689_10045948 | Ga0207689_100459484 | 462 |
| 641 | 3300025944 | Ga0207661_10002165 | Ga0207661_100021652 | 462 |
| 642 | 3300025944 | Ga0207661_10014563 | Ga0207661_100145633 | 462 |
| 643 | 3300025945 | Ga0207679_10000157 | Ga0207679_1000015728 | 462 |
| 644 | 3300025945 | Ga0207679_10015012 | Ga0207679_100150125 | 462 |
| 645 | 3300025945 | Ga0207679_10158473 | Ga0207679_101584731 | 462 |
| 646 | 3300025949 | Ga0207667_10220437 | Ga0207667_102204372 | 462 |
| 647 | 3300025961 | Ga0207712_10002224 | Ga0207712_100022244 | 462 |
| 648 | 3300025961 | Ga0207712_10003965 | Ga0207712_100039659 | 462 |
| 649 | 3300025961 | Ga0207712_10039070 | Ga0207712_100390703 | 462 |
| 650 | 3300025972 | Ga0207668_10017144 | Ga0207668_100171443 | 462 |
| 651 | 3300025986 | Ga0207658_10005748 | Ga0207658_100057485 | 462 |
| 652 | 3300025986 | Ga0207658_10048495 | Ga0207658_100484951 | 462 |
| 653 | 3300025986 | Ga0207658_10167123 | Ga0207658_101671232 | 462 |
| 654 | 3300026023 | Ga0207677_10001675 | Ga0207677_1000167510 | 462 |
| 655 | 3300026035 | Ga0207703_10001346 | Ga0207703_1000134611 | 462 |
| 656 | 3300026035 | Ga0207703_10001852 | Ga0207703_1000185215 | 462 |
| 657 | 3300026035 | Ga0207703_10032158 | Ga0207703_100321582 | 462 |
| 658 | 3300026041 | Ga0207639_10008211 | Ga0207639_100082113 | 462 |
| 659 | 3300026067 | Ga0207678_10001809 | Ga0207678_1000180912 | 462 |
| 660 | 3300026067 | Ga0207678_10001884 | Ga0207678_1000188416 | 462 |
| 661 | 3300026067 | Ga0207678_10013053 | Ga0207678_100130532 | 462 |
| 662 | 3300026067 | Ga0207678_10034212 | Ga0207678_100342123 | 462 |
| 663 | 3300026067 | Ga0207678_10034731 | Ga0207678_100347313 | 462 |
| 664 | 3300026067 | Ga0207678_10041672 | Ga0207678_100416722 | 462 |
| 665 | 3300026075 | Ga0207708_10000784 | Ga0207708_100007848 | 462 |
| 666 | 3300026075 | Ga0207708_10001199 | Ga0207708_1000119912 | 462 |
| 667 | 3300026075 | Ga0207708_10003067 | Ga0207708_100030674 | 462 |
| 668 | 3300026075 | Ga0207708_10014093 | Ga0207708_100140933 | 462 |
| 669 | 3300026078 | Ga0207702_10003404 | Ga0207702_1000340413 | 462 |
| 670 | 3300026088 | Ga0207641_10006871 | Ga0207641_100068712 | 462 |
| 671 | 3300026088 | Ga0207641_10041334 | Ga0207641_100413343 | 462 |
| 672 | 3300026089 | Ga0207648_10002073 | Ga0207648_1000207310 | 462 |
| 673 | 3300026089 | Ga0207648_10002310 | Ga0207648_1000231018 | 462 |
| 674 | 3300026089 | Ga0207648_10027663 | Ga0207648_100276632 | 462 |
| 675 | 3300026095 | Ga0207676_10000990 | Ga0207676_1000099019 | 462 |
| 676 | 3300026095 | Ga0207676_10002295 | Ga0207676_100022953 | 462 |
| 677 | 3300026095 | Ga0207676_10002940 | Ga0207676_100029405 | 462 |
| 678 | 3300026095 | Ga0207676_10184700 | Ga0207676_101847002 | 462 |
| 679 | 3300026116 | Ga0207674_10000897 | Ga0207674_1000089710 | 462 |
| 680 | 3300026116 | Ga0207674_10011740 | Ga0207674_100117407 | 462 |
| 681 | 3300026118 | Ga0207675_100001726 | Ga0207675_10000172614 | 462 |
| 682 | 3300026118 | Ga0207675_100002371 | Ga0207675_1000023717 | 462 |
| 683 | 3300026121 | Ga0207683_10000824 | Ga0207683_1000082418 | 462 |
| 684 | 3300026121 | Ga0207683_10001176 | Ga0207683_1000117613 | 462 |
| 685 | 3300026121 | Ga0207683_10014019 | Ga0207683_100140194 | 462 |
| 686 | 3300026121 | Ga0207683_10081706 | Ga0207683_100817061 | 462 |
| 687 | 3300026142 | Ga0207698_10003743 | Ga0207698_100037434 | 462 |
| 688 | 3300027617 | Ga0210002_1003362 | Ga0210002_10033622 | 462 |
| 689 | 3300027695 | Ga0209966_1000247 | Ga0209966_100024719 | 462 |
| 690 | 3300027717 | Ga0209998_10000255 | Ga0209998_100002553 | 462 |
| 691 | 3300027717 | Ga0209998_10001128 | Ga0209998_100011283 | 462 |
| 692 | 3300027876 | Ga0209974_10001489 | Ga0209974_100014894 | 462 |
| 693 | 3300027907 | Ga0207428_10000137 | Ga0207428_1000013732 | 462 |
| 694 | 3300027907 | Ga0207428_10000792 | Ga0207428_1000079226 | 462 |
| 695 | 3300027907 | Ga0207428_10003106 | Ga0207428_100031067 | 462 |
| 696 | 3300027907 | Ga0207428_10072105 | Ga0207428_100721052 | 462 |
| 697 | 3300028379 | Ga0268266_10005095 | Ga0268266_100050958 | 462 |
| 698 | 3300028379 | Ga0268266_10023244 | Ga0268266_100232443 | 462 |
| 699 | 3300028379 | Ga0268266_10046625 | Ga0268266_100466252 | 462 |
| 700 | 3300028380 | Ga0268265_10029470 | Ga0268265_100294701 | 462 |
| 701 | 3300028380 | Ga0268265_10085418 | Ga0268265_100854182 | 462 |
| 702 | 3300028381 | Ga0268264_10002039 | Ga0268264_100020399 | 462 |
| 703 | 3300028381 | Ga0268264_10016623 | Ga0268264_100166233 | 462 |
| 704 | 3300028381 | Ga0268264_10062447 | Ga0268264_100624472 | 462 |
| 705 | 3300031241 | Ga0265325_10000073 | Ga0265325_1000007369 | 462 |
| 706 | 3300031241 | Ga0265325_10002177 | Ga0265325_1000217711 | 462 |
| 707 | 3300034817 | Ga0373948_0000061 | Ga0373948_0000061_466_1854 | 462 |
| 708 | 3300034819 | Ga0373958_0000048 | Ga0373958_0000048_5763_7151 | 462 |
| 709 | 3300034819 | Ga0373958_0001634 | Ga0373958_0001634_858_2246 | 462 |
| 710 | 3300035083 | Ga0373926_0003985 | Ga0373926_0003985_450_1838 | 462 |
| 711 | 3300035084 | Ga0373928_0000291 | Ga0373928_0000291_5960_7348 | 462 |
| 712 | 3300035084 | Ga0373928_0008797 | Ga0373928_0008797_401_1789 | 462 |
| 713 | 3300035085 | Ga0373929_0000564 | Ga0373929_0000564_5734_7122 | 462 |
| 714 | 3300035085 | Ga0373929_0005244 | Ga0373929_0005244_732_2120 | 462 |
| 715 | 3300035086 | Ga0373934_0020853 | Ga0373934_0020853_553_1941 | 462 |
| 716 | 3300035088 | Ga0373940_0000023 | Ga0373940_0000023_5677_7065 | 462 |
| 717 | 3300035088 | Ga0373940_0010533 | Ga0373940_0010533_737_2125 | 462 |
| 718 | 3300035090 | Ga0373949_0001146 | Ga0373949_0001146_5221_6609 | 462 |
| 719 | 3300035091 | Ga0373951_0000876 | Ga0373951_0000876_5900_7288 | 462 |
| 720 | 3300035091 | Ga0373951_0005478 | Ga0373951_0005478_907_2295 | 462 |
| 721 | 3300035111 | Ga0373923_0000851 | Ga0373923_0000851_2420_3808 | 462 |
| 722 | 3300035111 | Ga0373923_0003216 | Ga0373923_0003216_3689_5095 | 462 |
| 723 | 3300035113 | Ga0373936_0001660 | Ga0373936_0001660_4614_6020 | 462 |
| 724 | 3300035114 | Ga0373939_0000663 | Ga0373939_0000663_5222_6610 | 462 |
| 725 | 3300035114 | Ga0373939_0002651 | Ga0373939_0002651_852_2243 | 462 |
| 726 | 3300035115 | Ga0373941_0000309 | Ga0373941_0000309_6976_8364 | 462 |
| 727 | 3300035116 | Ga0373945_0000277 | Ga0373945_0000277_10144_11532 | 462 |
| 728 | 3300035116 | Ga0373945_0001390 | Ga0373945_0001390_2858_4264 | 462 |
| 729 | 3300035117 | Ga0373953_0068438 | Ga0373953_0068438_55_1443 | 462 |
| 730 | 3300035118 | Ga0373954_0005333 | Ga0373954_0005333_2512_3900 | 462 |
| 731 | 3300035118 | Ga0373954_0014688 | Ga0373954_0014688_402_1796 | 462 |
| 732 | 3300035121 | Ga0373960_0001082 | Ga0373960_0001082_1820_3208 | 462 |
| 733 | 3300035121 | Ga0373960_0003751 | Ga0373960_0003751_1985_3373 | 462 |
| 734 | 3300035170 | Ga0373943_0004971 | Ga0373943_0004971_1828_3234 | 462 |
| 735 | 3300035170 | Ga0373943_0005512 | Ga0373943_0005512_3631_5019 | 462 |
| 736 | 3300035170 | Ga0373943_0009916 | Ga0373943_0009916_1194_2582 | 462 |
| 737 | 3300035171 | Ga0373946_0001856 | Ga0373946_0001856_705_2093 | 462 |
| 738 | 3300035171 | Ga0373946_0002330 | Ga0373946_0002330_1620_3026 | 462 |
| 739 | 3300035172 | Ga0373955_0002403 | Ga0373955_0002403_688_2076 | 462 |
| 740 | 3300035207 | Ga0373942_0000081 | Ga0373942_0000081_9176_10564 | 462 |
| 741 | 3300035207 | Ga0373942_0016658 | Ga0373942_0016658_44_1432 | 462 |
| 742 | 3300035241 | Ga0373961_0000743 | Ga0373961_0000743_6293_7681 | 462 |
| 743 | 3300035241 | Ga0373961_0002954 | Ga0373961_0002954_2191_3579 | 462 |
| 744 | 3300035242 | Ga0373962_0000194 | Ga0373962_0000194_3009_4397 | 462 |
| 745 | 3300035410 | Ga0373924_0000490 | Ga0373924_0000490_6614_8002 | 462 |
| 746 | 3300035410 | Ga0373924_0004810 | Ga0373924_0004810_1337_2743 | 462 |
| 747 | 3300035691 | Ga0373931_0001008 | Ga0373931_0001008_4277_5665 | 462 |
| 748 | 3300035691 | Ga0373931_0001564 | Ga0373931_0001564_5938_7326 | 462 |
| 749 | 3300035691 | Ga0373931_0016578 | Ga0373931_0016578_1814_3313 | 462 |
| 750 | 3300035692 | Ga0373935_0000291 | Ga0373935_0000291_7310_8716 | 462 |
| 751 | 3300035692 | Ga0373935_0013547 | Ga0373935_0013547_2989_4377 | 462 |
| 752 | 3300035695 | Ga0373927_0005343 | Ga0373927_0005343_556_1944 | 462 |
| 753 | 3300035695 | Ga0373927_0009000 | Ga0373927_0009000_172_1569 | 462 |
| 754 | 3300035695 | Ga0373927_0034546 | Ga0373927_0034546_1554_2954 | 462 |
| 755 | 3300035695 | Ga0373927_0051606 | Ga0373927_0051606_1089_2477 | 462 |
| 756 | 3300035695 | Ga0373927_0055119 | Ga0373927_0055119_1042_2448 | 462 |
| 757 | 3300035724 | Ga0373933_0010185 | Ga0373933_0010185_2807_4201 | 462 |
| 758 | 3300035724 | Ga0373933_0012833 | Ga0373933_0012833_1331_2725 | 462 |
| 759 | 3300035725 | Ga0373947_0000424 | Ga0373947_0000424_18873_20261 | 462 |
| 760 | 3300035725 | Ga0373947_0005730 | Ga0373947_0005730_5772_7178 | 462 |
| 761 | 3300035725 | Ga0373947_0010154 | Ga0373947_0010154_372_1772 | 462 |
| 762 | 3300035725 | Ga0373947_0041253 | Ga0373947_0041253_1230_2627 | 462 |
| 763 | 3300036401 | Ga0373937_0000004 | Ga0373937_0000004_110821_112227 | 462 |
| 764 | 3300036401 | Ga0373937_0003680 | Ga0373937_0003680_9175_10569 | 462 |
| 765 | 3300036401 | Ga0373937_0005263 | Ga0373937_0005263_3317_4705 | 462 |
| 766 | 3300036401 | Ga0373937_0006030 | Ga0373937_0006030_1270_2664 | 462 |
| 767 | 3300037068 | Ga0373925_0000460 | Ga0373925_0000460_5850_7256 | 462 |
| 768 | 3300037068 | Ga0373925_0003391 | Ga0373925_0003391_3057_4445 | 462 |
| 769 | 3300037068 | Ga0373925_0017524 | Ga0373925_0017524_3631_5019 | 462 |
| 770 | 3300042439 | Ga0439464_0005396 | Ga0439464_0005396_580_1968 | 462 |
| 771 | 3300045051 | Ga0451576_0006650 | Ga0451576_0006650_10935_12323 | 462 |
| 772 | 3300046454 | Ga0495592_0000029 | Ga0495592_0000029_102642_104048 | 462 |
| 773 | 3300046454 | Ga0495592_0001215 | Ga0495592_0001215_1028_2416 | 462 |
| 774 | 3300046454 | Ga0495592_0005508 | Ga0495592_0005508_652_2046 | 462 |
| 775 | 3300046454 | Ga0495592_0136552 | Ga0495592_0136552_27_1421 | 462 |
| 776 | 3300046459 | Ga0495629_0000447 | Ga0495629_0000447_15101_16489 | 462 |
| 777 | 3300046459 | Ga0495629_0016571 | Ga0495629_0016571_2118_3524 | 462 |
| 778 | 3300046460 | Ga0495638_0028434 | Ga0495638_0028434_648_2048 | 462 |
| 779 | 3300046461 | Ga0495641_0001697 | Ga0495641_0001697_16010_17398 | 462 |
| 780 | 3300046461 | Ga0495641_0015734 | Ga0495641_0015734_1633_3021 | 462 |
| 781 | 3300046461 | Ga0495641_0027911 | Ga0495641_0027911_959_2359 | 462 |
| 782 | 3300046462 | Ga0495651_0002424 | Ga0495651_0002424_4556_5944 | 462 |
| 783 | 3300046462 | Ga0495651_0038986 | Ga0495651_0038986_600_1994 | 462 |
| 784 | 3300046463 | Ga0495653_0000012 | Ga0495653_0000012_248605_250011 | 462 |
| 785 | 3300046463 | Ga0495653_0003231 | Ga0495653_0003231_11472_12866 | 462 |
| 786 | 3300046463 | Ga0495653_0006931 | Ga0495653_0006931_6181_7569 | 462 |
| 787 | 3300046463 | Ga0495653_0078354 | Ga0495653_0078354_856_2250 | 462 |
| 788 | 3300046472 | Ga0495580_0006747 | Ga0495580_0006747_2529_3917 | 462 |
| 789 | 3300046472 | Ga0495580_0085877 | Ga0495580_0085877_268_1668 | 462 |
| 790 | 3300046473 | Ga0495582_0007072 | Ga0495582_0007072_156_1544 | 462 |
| 791 | 3300046473 | Ga0495582_0010997 | Ga0495582_0010997_189_1577 | 462 |
| 792 | 3300046473 | Ga0495582_0013202 | Ga0495582_0013202_2464_3864 | 462 |
| 793 | 3300046475 | Ga0495639_0006165 | Ga0495639_0006165_3292_4680 | 462 |
| 794 | 3300046476 | Ga0495662_0003904 | Ga0495662_0003904_5099_6487 | 462 |
| 795 | 3300046476 | Ga0495662_0010406 | Ga0495662_0010406_2937_4343 | 462 |
| 796 | 3300046477 | Ga0495664_0000004 | Ga0495664_0000004_132306_133712 | 462 |
| 797 | 3300046477 | Ga0495664_0009959 | Ga0495664_0009959_891_2279 | 462 |
| 798 | 3300046491 | Ga0495584_0002735 | Ga0495584_0002735_5321_6709 | 462 |
| 799 | 3300046491 | Ga0495584_0056557 | Ga0495584_0056557_176_1576 | 462 |
| 800 | 3300046492 | Ga0495585_0003199 | Ga0495585_0003199_304_1692 | 462 |
| 801 | 3300046492 | Ga0495585_0073720 | Ga0495585_0073720_271_1671 | 462 |
| 802 | 3300046499 | Ga0495594_0013045 | Ga0495594_0013045_470_1858 | 462 |
| 803 | 3300046499 | Ga0495594_0021869 | Ga0495594_0021869_156_1544 | 462 |
| 804 | 3300046501 | Ga0495607_0029184 | Ga0495607_0029184_304_1692 | 462 |
| 805 | 3300046511 | Ga0495608_0000017 | Ga0495608_0000017_132293_133699 | 462 |
| 806 | 3300046514 | Ga0495618_0000006 | Ga0495618_0000006_91399_92805 | 462 |
| 807 | 3300046516 | Ga0495628_0000001 | Ga0495628_0000001_132295_133701 | 462 |
| 808 | 3300046516 | Ga0495628_0009640 | Ga0495628_0009640_1312_2706 | 462 |
| 809 | 3300046516 | Ga0495628_0019168 | Ga0495628_0019168_1851_3239 | 462 |
| 810 | 3300046516 | Ga0495628_0035835 | Ga0495628_0035835_1321_2715 | 462 |
| 811 | 3300046517 | Ga0495630_0008370 | Ga0495630_0008370_1599_3005 | 462 |
| 812 | 3300046520 | Ga0495637_0042998 | Ga0495637_0042998_384_1772 | 462 |
| 813 | 3300046523 | Ga0495644_0002426 | Ga0495644_0002426_5189_6577 | 462 |
| 814 | 3300046526 | Ga0495666_0001305 | Ga0495666_0001305_525_1913 | 462 |
| 815 | 3300046529 | Ga0495652_0000002 | Ga0495652_0000002_346829_348235 | 462 |
| 816 | 3300046529 | Ga0495652_0018154 | Ga0495652_0018154_4439_5827 | 462 |
| 817 | 3300046531 | Ga0495665_0004009 | Ga0495665_0004009_714_2102 | 462 |
| 818 | 3300046531 | Ga0495665_0025407 | Ga0495665_0025407_963_2363 | 462 |
| 819 | 3300046533 | Ga0495640_0000001 | Ga0495640_0000001_440833_442239 | 462 |
| 820 | 3300046533 | Ga0495640_0017355 | Ga0495640_0017355_687_2075 | 462 |
| 821 | 3300046535 | Ga0495586_0007089 | Ga0495586_0007089_3516_4904 | 462 |
| 822 | 3300046536 | Ga0495587_0000008 | Ga0495587_0000008_132513_133919 | 462 |
| 823 | 3300046536 | Ga0495587_0001490 | Ga0495587_0001490_1208_2602 | 462 |
| 824 | 3300046537 | Ga0495598_0001556 | Ga0495598_0001556_738_2138 | 462 |
| 825 | 3300046543 | Ga0495645_0000002 | Ga0495645_0000002_132308_133714 | 462 |
| 826 | 3300046543 | Ga0495645_0000954 | Ga0495645_0000954_14064_15458 | 462 |
| 827 | 3300046543 | Ga0495645_0050356 | Ga0495645_0050356_575_1969 | 462 |
| 828 | 3300046558 | Ga0495633_0014899 | Ga0495633_0014899_2521_3909 | 462 |
| 829 | 3300046559 | Ga0495667_0000029 | Ga0495667_0000029_132304_133710 | 462 |
| 830 | 3300046559 | Ga0495667_0014263 | Ga0495667_0014263_2947_4335 | 462 |
| 831 | 3300046559 | Ga0495667_0043731 | Ga0495667_0043731_464_1858 | 462 |
| 832 | 3300046615 | Ga0495656_0000941 | Ga0495656_0000941_7776_9164 | 462 |
| 833 | 3300046642 | Ga0495634_0006280 | Ga0495634_0006280_5808_7214 | 462 |
| 834 | 3300046642 | Ga0495634_0035463 | Ga0495634_0035463_1873_3261 | 462 |
| 835 | 3300046642 | Ga0495634_0058157 | Ga0495634_0058157_516_2015 | 462 |
| 836 | 3300046648 | Ga0495611_0005829 | Ga0495611_0005829_133_1521 | 462 |
| 837 | 3300046663 | Ga0495635_0000002 | Ga0495635_0000002_353223_354629 | 462 |
| 838 | 3300046663 | Ga0495635_0013015 | Ga0495635_0013015_3206_4600 | 462 |
| 839 | 3300046674 | Ga0495588_0000318 | Ga0495588_0000318_260_1648 | 462 |
| 840 | 3300046674 | Ga0495588_0012717 | Ga0495588_0012717_1601_3001 | 462 |
| 841 | 3300046674 | Ga0495588_0029685 | Ga0495588_0029685_827_2215 | 462 |
| 842 | 3300046675 | Ga0495657_0000459 | Ga0495657_0000459_16819_18225 | 462 |
| 843 | 3300046675 | Ga0495657_0086718 | Ga0495657_0086718_519_1907 | 462 |
| 844 | 3300046678 | Ga0495599_0000104 | Ga0495599_0000104_54021_55427 | 462 |
| 845 | 3300046678 | Ga0495599_0001047 | Ga0495599_0001047_4226_5614 | 462 |
| 846 | 3300046679 | Ga0495623_0000691 | Ga0495623_0000691_16223_17629 | 462 |
| 847 | 3300046679 | Ga0495623_0003897 | Ga0495623_0003897_584_1978 | 462 |
| 848 | 3300046680 | Ga0495646_0000064 | Ga0495646_0000064_27548_28954 | 462 |
| 849 | 3300046680 | Ga0495646_0005442 | Ga0495646_0005442_6056_7444 | 462 |
| 850 | 3300046680 | Ga0495646_0006507 | Ga0495646_0006507_3169_4563 | 462 |
| 851 | 3300046681 | Ga0495647_0001576 | Ga0495647_0001576_3631_5019 | 462 |
| 852 | 3300046683 | Ga0495658_0007929 | Ga0495658_0007929_1559_2956 | 462 |
| 853 | 3300046683 | Ga0495658_0008212 | Ga0495658_0008212_1490_2878 | 462 |
| 854 | 3300046683 | Ga0495658_0008346 | Ga0495658_0008346_3558_4946 | 462 |
| 855 | 3300046683 | Ga0495658_0035592 | Ga0495658_0035592_1329_2723 | 462 |
| 856 | 3300046689 | Ga0495613_0000793 | Ga0495613_0000793_198_1586 | 462 |
| 857 | 3300046689 | Ga0495613_0047786 | Ga0495613_0047786_1137_2525 | 462 |
| 858 | 3300046690 | Ga0495624_0023831 | Ga0495624_0023831_772_2160 | 462 |
| 859 | 3300046809 | Ga0495600_0000010 | Ga0495600_0000010_137544_138950 | 462 |
| 860 | 3300046809 | Ga0495600_0032708 | Ga0495600_0032708_335_1729 | 462 |
| 861 | 3300047315 | Ga0495581_0002305 | Ga0495581_0002305_5066_6454 | 462 |
| 862 | 3300047317 | Ga0495604_0000009 | Ga0495604_0000009_192591_193997 | 462 |
| 863 | 3300047317 | Ga0495604_0003660 | Ga0495604_0003660_7751_9139 | 462 |
| 864 | 3300047317 | Ga0495604_0017295 | Ga0495604_0017295_1542_2936 | 462 |
| 865 | 3300047317 | Ga0495604_0017691 | Ga0495604_0017691_548_1942 | 462 |
| 866 | 3300047319 | Ga0495674_0000002 | Ga0495674_0000002_132296_133702 | 462 |
| 867 | 3300047319 | Ga0495674_0042474 | Ga0495674_0042474_156_1544 | 462 |
| 868 | 3300047319 | Ga0495674_0080853 | Ga0495674_0080853_1070_2464 | 462 |
| 869 | 3300047321 | Ga0495676_0084271 | Ga0495676_0084271_474_1862 | 462 |
| 870 | 3300047321 | Ga0495676_0178846 | Ga0495676_0178846_23_1411 | 462 |
| 871 | 3300047322 | Ga0495680_0000752 | Ga0495680_0000752_18561_19967 | 462 |
| 872 | 3300047322 | Ga0495680_0014315 | Ga0495680_0014315_3675_5069 | 462 |
| 873 | 3300047322 | Ga0495680_0014551 | Ga0495680_0014551_1956_3344 | 462 |
| 874 | 3300047322 | Ga0495680_0022273 | Ga0495680_0022273_1437_2825 | 462 |
| 875 | 3300047322 | Ga0495680_0028687 | Ga0495680_0028687_627_2021 | 462 |
| 876 | 3300047444 | Ga0495675_0000028 | Ga0495675_0000028_104259_105665 | 462 |
| 877 | 3300047444 | Ga0495675_0026696 | Ga0495675_0026696_2223_3617 | 462 |
| 878 | 3300047471 | Ga0495684_0000006 | Ga0495684_0000006_132255_133661 | 462 |
| 879 | 3300047471 | Ga0495684_0003934 | Ga0495684_0003934_3295_4683 | 462 |
| 880 | 3300047673 | Ga0495593_0008360 | Ga0495593_0008360_232_1620 | 462 |
| 881 | 3300048088 | Ga0495602_0000005 | Ga0495602_0000005_211972_213378 | 462 |
| 882 | 3300048088 | Ga0495602_0000776 | Ga0495602_0000776_24637_26031 | 462 |
| 883 | 3300048088 | Ga0495602_0002995 | Ga0495602_0002995_738_2132 | 462 |
| 884 | 3300048089 | Ga0495614_0004539 | Ga0495614_0004539_304_1692 | 462 |
| 885 | 3300048903 | Ga0496100_0002107 | Ga0496100_0002107_4619_6007 | 462 |
| 886 | 3300048903 | Ga0496100_0008177 | Ga0496100_0008177_2460_3848 | 462 |
| 887 | 3300048903 | Ga0496100_0008677 | Ga0496100_0008677_30_1430 | 462 |
| 888 | 3300048904 | Ga0496101_0002976 | Ga0496101_0002976_9012_10406 | 462 |
| 889 | 3300048904 | Ga0496101_0005170 | Ga0496101_0005170_5622_7010 | 462 |
| 890 | 3300048904 | Ga0496101_0005327 | Ga0496101_0005327_2554_3942 | 462 |
| 891 | 3300048904 | Ga0496101_0045004 | Ga0496101_0045004_1243_2643 | 462 |
| 892 | 3300048904 | Ga0496101_0099036 | Ga0496101_0099036_610_2013 | 462 |
| 893 | 3300048905 | Ga0496102_0008464 | Ga0496102_0008464_2831_4219 | 462 |
| 894 | 3300048905 | Ga0496102_0009880 | Ga0496102_0009880_4339_5838 | 462 |
| 895 | 3300048905 | Ga0496102_0017733 | Ga0496102_0017733_4349_5749 | 462 |
| 896 | 3300048905 | Ga0496102_0024215 | Ga0496102_0024215_2595_3983 | 462 |
| 897 | 3300048905 | Ga0496102_0097214 | Ga0496102_0097214_771_2159 | 462 |
| 898 | 3300048906 | Ga0496103_0001696 | Ga0496103_0001696_9985_11373 | 462 |
| 899 | 3300048906 | Ga0496103_0005658 | Ga0496103_0005658_3031_4431 | 462 |
| 900 | 3300048906 | Ga0496103_0005922 | Ga0496103_0005922_1331_2719 | 462 |
| 901 | 3300048906 | Ga0496103_0011431 | Ga0496103_0011431_194_1588 | 462 |
| 902 | 3300048906 | Ga0496103_0036194 | Ga0496103_0036194_942_2330 | 462 |
| 903 | 3300048906 | Ga0496103_0076217 | Ga0496103_0076217_681_2069 | 462 |
| 904 | 3300048907 | Ga0496104_0000092 | Ga0496104_0000092_36652_38046 | 462 |
| 905 | 3300048907 | Ga0496104_0004402 | Ga0496104_0004402_4592_5986 | 462 |
| 906 | 3300048907 | Ga0496104_0013405 | Ga0496104_0013405_3405_4805 | 462 |
| 907 | 3300048907 | Ga0496104_0069565 | Ga0496104_0069565_375_1763 | 462 |
| 908 | 3300048907 | Ga0496104_0112817 | Ga0496104_0112817_837_2231 | 462 |
| 909 | 3300048907 | Ga0496104_0269510 | Ga0496104_0269510_62_1450 | 462 |
| 910 | 3300048908 | Ga0496105_0001436 | Ga0496105_0001436_12463_13863 | 462 |
| 911 | 3300048908 | Ga0496105_0001736 | Ga0496105_0001736_9276_10664 | 462 |
| 912 | 3300048908 | Ga0496105_0002208 | Ga0496105_0002208_1374_2873 | 462 |
| 913 | 3300048908 | Ga0496105_0125052 | Ga0496105_0125052_214_1614 | 462 |
| 914 | 3300048909 | Ga0496106_0003134 | Ga0496106_0003134_7797_9191 | 462 |
| 915 | 3300048909 | Ga0496106_0006593 | Ga0496106_0006593_3037_4425 | 462 |
| 916 | 3300048909 | Ga0496106_0026317 | Ga0496106_0026317_2554_3942 | 462 |
| 917 | 3300048909 | Ga0496106_0043487 | Ga0496106_0043487_918_2417 | 462 |
| 918 | 3300048909 | Ga0496106_0149234 | Ga0496106_0149234_347_1741 | 462 |
| 919 | 3300048910 | Ga0496107_0000809 | Ga0496107_0000809_6760_8148 | 462 |
| 920 | 3300048910 | Ga0496107_0007194 | Ga0496107_0007194_2193_3587 | 462 |
| 921 | 3300048910 | Ga0496107_0012097 | Ga0496107_0012097_395_1795 | 462 |
| 922 | 3300048910 | Ga0496107_0013417 | Ga0496107_0013417_4099_5487 | 462 |
| 923 | 3300048910 | Ga0496107_0026710 | Ga0496107_0026710_1273_2661 | 462 |
| 924 | 3300048911 | Ga0496108_0003371 | Ga0496108_0003371_11161_12660 | 462 |
| 925 | 3300048911 | Ga0496108_0005285 | Ga0496108_0005285_544_1932 | 462 |
| 926 | 3300048911 | Ga0496108_0014164 | Ga0496108_0014164_4926_6314 | 462 |
| 927 | 3300048911 | Ga0496108_0090770 | Ga0496108_0090770_1088_2476 | 462 |
| 928 | 3300048911 | Ga0496108_0097512 | Ga0496108_0097512_598_1992 | 462 |
| 929 | 3300048912 | Ga0496109_0000543 | Ga0496109_0000543_9180_10568 | 462 |
| 930 | 3300048912 | Ga0496109_0016420 | Ga0496109_0016420_4224_5624 | 462 |
| 931 | 3300048912 | Ga0496109_0026427 | Ga0496109_0026427_1314_2708 | 462 |
| 932 | 3300048912 | Ga0496109_0031491 | Ga0496109_0031491_2941_4329 | 462 |
| 933 | 3300048912 | Ga0496109_0118773 | Ga0496109_0118773_699_2087 | 462 |
| 934 | 3300048913 | Ga0496110_0015744 | Ga0496110_0015744_4301_5689 | 462 |
| 935 | 3300048913 | Ga0496110_0112154 | Ga0496110_0112154_1022_2422 | 462 |
| 936 | 3300048913 | Ga0496110_0190509 | Ga0496110_0190509_207_1595 | 462 |
| 937 | 3300048914 | Ga0496111_0000388 | Ga0496111_0000388_11380_12879 | 462 |
| 938 | 3300048914 | Ga0496111_0002814 | Ga0496111_0002814_7260_8648 | 462 |
| 939 | 3300048914 | Ga0496111_0012071 | Ga0496111_0012071_1165_2565 | 462 |
| 940 | 3300048914 | Ga0496111_0028753 | Ga0496111_0028753_2252_3640 | 462 |
| 941 | 3300048915 | Ga0496112_0003072 | Ga0496112_0003072_5683_7071 | 462 |
| 942 | 3300048915 | Ga0496112_0009140 | Ga0496112_0009140_3504_4892 | 462 |
| 943 | 3300048915 | Ga0496112_0014688 | Ga0496112_0014688_48_1547 | 462 |
| 944 | 3300048915 | Ga0496112_0061370 | Ga0496112_0061370_849_2249 | 462 |
| 945 | 3300048916 | Ga0496113_0000043 | Ga0496113_0000043_50337_51836 | 462 |
| 946 | 3300048916 | Ga0496113_0004954 | Ga0496113_0004954_5915_7303 | 462 |
| 947 | 3300048916 | Ga0496113_0015314 | Ga0496113_0015314_3504_4892 | 462 |
| 948 | 3300048916 | Ga0496113_0047129 | Ga0496113_0047129_314_1714 | 462 |
| 949 | 3300048917 | Ga0496114_0003641 | Ga0496114_0003641_2662_4050 | 462 |
| 950 | 3300048917 | Ga0496114_0013464 | Ga0496114_0013464_3756_5144 | 462 |
| 951 | 3300048917 | Ga0496114_0040439 | Ga0496114_0040439_685_2085 | 462 |
| 952 | 3300048917 | Ga0496114_0052998 | Ga0496114_0052998_1484_2887 | 462 |
| 953 | 3300048918 | Ga0496115_0009341 | Ga0496115_0009341_3660_5048 | 462 |
| 954 | 3300048918 | Ga0496115_0046900 | Ga0496115_0046900_1457_2857 | 462 |
| 955 | 3300048918 | Ga0496115_0054203 | Ga0496115_0054203_1301_2695 | 462 |
| 956 | 3300048918 | Ga0496115_0109009 | Ga0496115_0109009_368_1762 | 462 |
| 957 | 3300049568 | Ga0501031_0022932 | Ga0501031_0022932_1105_2499 | 462 |
| 958 | 3300049570 | Ga0501033_0011567 | Ga0501033_0011567_669_2063 | 462 |
| 959 | 3300049571 | Ga0501034_0018337 | Ga0501034_0018337_960_2360 | 462 |
| 960 | 3300049572 | Ga0501036_0017605 | Ga0501036_0017605_2579_3973 | 462 |
| 961 | 3300049572 | Ga0501036_0025867 | Ga0501036_0025867_703_2103 | 462 |
| 962 | 3300049573 | Ga0501037_0020812 | Ga0501037_0020812_928_2322 | 462 |
| 963 | 3300049574 | Ga0501038_0062127 | Ga0501038_0062127_424_1824 | 462 |
| 964 | 3300049574 | Ga0501038_0096680 | Ga0501038_0096680_752_2146 | 462 |
| 965 | 3300049575 | Ga0501039_0015326 | Ga0501039_0015326_1837_3231 | 462 |
| 966 | 3300049581 | Ga0501047_0087179 | Ga0501047_0087179_1140_2540 | 462 |
| 967 | 3300049586 | Ga0501070_0020311 | Ga0501070_0020311_580_1974 | 462 |
| 968 | 3300049586 | Ga0501070_0044117 | Ga0501070_0044117_896_2296 | 462 |
| 969 | 3300049822 | Ga0501035_0016521 | Ga0501035_0016521_4333_5727 | 462 |
| 970 | 3300049823 | Ga0501044_0033812 | Ga0501044_0033812_3255_4655 | 462 |
| 971 | 3300049823 | Ga0501044_0144177 | Ga0501044_0144177_528_1922 | 462 |
| 972 | 3300050492 | nmdc:mga0yw44_46679_c1 | nmdc:mga0yw44_46679_c1_876_2375 | 462 |
| 973 | 3300050493 | nmdc:mga0k408_5532_c1 | nmdc:mga0k408_5532_c1_4678_6093 | 462 |
| 974 | 3300050507 | nmdc:mga05p37_309031_c1 | nmdc:mga05p37_309031_c1_444_1844 | 462 |
| 975 | 3300050507 | nmdc:mga05p37_6242_c1 | nmdc:mga05p37_6242_c1_1847_3346 | 462 |
| 976 | 3300050507 | nmdc:mga05p37_66_c1 | nmdc:mga05p37_66_c1_25819_27207 | 462 |
| 977 | 3300050507 | nmdc:mga05p37_92206_c1 | nmdc:mga05p37_92206_c1_1688_3076 | 462 |
| 978 | 3300050508 | nmdc:mga09592_7876_c1 | nmdc:mga09592_7876_c1_2075_3463 | 462 |
| 979 | 3300050509 | nmdc:mga0qj67_24563_c1 | nmdc:mga0qj67_24563_c1_2679_4076 | 462 |
| 980 | 3300050509 | nmdc:mga0qj67_512_c1 | nmdc:mga0qj67_512_c1_17809_19197 | 462 |
| 981 | 3300050510 | nmdc:mga06r32_7326_c1 | nmdc:mga06r32_7326_c1_7219_8607 | 462 |
| 982 | 3300050511 | nmdc:mga08y16_1809_c1 | nmdc:mga08y16_1809_c1_20055_21443 | 462 |
| 983 | 3300050511 | nmdc:mga08y16_31568_c1 | nmdc:mga08y16_31568_c1_1541_2929 | 462 |
| 984 | 3300050511 | nmdc:mga08y16_4145_c1 | nmdc:mga08y16_4145_c1_6349_7737 | 462 |
| 985 | 3300050511 | nmdc:mga08y16_56670_c1 | nmdc:mga08y16_56670_c1_885_2384 | 462 |
| 986 | 3300050512 | nmdc:mga0n895_43_c1 | nmdc:mga0n895_43_c1_47180_48568 | 462 |
| 987 | 3300050512 | nmdc:mga0n895_74467_c1 | nmdc:mga0n895_74467_c1_1844_3232 | 462 |
| 988 | 3300050512 | nmdc:mga0n895_78577_c1 | nmdc:mga0n895_78577_c1_1864_3252 | 462 |
| 989 | 3300050513 | nmdc:mga0rr50_21285_c1 | nmdc:mga0rr50_21285_c1_1461_2849 | 462 |
| 990 | 3300050513 | nmdc:mga0rr50_43928_c1 | nmdc:mga0rr50_43928_c1_983_2371 | 462 |
| 991 | 3300050515 | nmdc:mga0a205_13273_c1 | nmdc:mga0a205_13273_c1_5299_6687 | 462 |
| 992 | 3300050515 | nmdc:mga0a205_3268_c1 | nmdc:mga0a205_3268_c1_11295_12683 | 462 |
| 993 | 3300053077 | Ga0495601_0000002 | Ga0495601_0000002_177760_179166 | 462 |
| 994 | 3300053077 | Ga0495601_0000107 | Ga0495601_0000107_30477_31871 | 462 |
| 995 | 3300053077 | Ga0495601_0005039 | Ga0495601_0005039_3819_5213 | 462 |
| 996 | 3300053077 | Ga0495601_0027688 | Ga0495601_0027688_1962_3350 | 462 |
| 997 | 3300053077 | Ga0495601_0122728 | Ga0495601_0122728_107_1510 | 462 |
| 998 | 3300053078 | Ga0495612_0000010 | Ga0495612_0000010_113648_115054 | 462 |
| 999 | 3300053078 | Ga0495612_0001623 | Ga0495612_0001623_6862_8250 | 462 |
| 1000 | 3300053078 | Ga0495612_0002221 | Ga0495612_0002221_3080_4474 | 462 |
| 1001 | 3300053078 | Ga0495612_0005028 | Ga0495612_0005028_1271_2665 | 462 |
| 1002 | 3300053084 | Ga0495595_0000777 | Ga0495595_0000777_4804_6210 | 462 |
| 1003 | 3300053084 | Ga0495595_0004037 | Ga0495595_0004037_2089_3477 | 462 |
| 1004 | 3300053084 | Ga0495595_0019908 | Ga0495595_0019908_1176_2570 | 462 |
| 1005 | 3300053085 | Ga0495619_0000019 | Ga0495619_0000019_137096_138502 | 462 |
| 1006 | 3300053085 | Ga0495619_0000045 | Ga0495619_0000045_67662_69056 | 462 |
| 1007 | 3300053085 | Ga0495619_0002374 | Ga0495619_0002374_9744_11132 | 462 |
| 1008 | 3300053085 | Ga0495619_0002899 | Ga0495619_0002899_1232_2620 | 462 |
| 1009 | 3300053085 | Ga0495619_0004604 | Ga0495619_0004604_1981_3375 | 462 |
| 1010 | 3300053085 | Ga0495619_0044260 | Ga0495619_0044260_190_1593 | 462 |
| 1011 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_937986_939377 | 462 |
| 1012 | 3300053153 | Ga0500616_0007357 | Ga0500616_0007357_2535_3932 | 462 |
| 1013 | 3300060353 | Ga0501082_0000074 | Ga0501082_0000074_59429_60829 | 462 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ose-assembly1.cif.gz_D | cytochrome bd-ii type oxidase with bound aurachin d | 0.9557 | 4 | 434 |
| 7nkz-assembly1.cif.gz_A | cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution | 0.9351 | 1 | 434 |
| 5ir6-assembly1.cif.gz_A | the structure of bd oxidase from geobacillus thermodenitrificans | 0.9205 | 1 | 434 |
| 5ir6-assembly1.cif.gz_A | the structure of bd oxidase from geobacillus thermodenitrificans | 0.9184 | 1 | 434 |
| 7nkz-assembly1.cif.gz_A | cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution | 0.8916 | 1 | 434 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76173_1_274_1.20.1630.10 | Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain | 0.5457 | 13 | 377 | 1.20.1630.10 |
| af_P76173_1_274_1.20.1630.10 | Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain | 0.5334 | 13 | 377 | 1.20.1630.10 |
| af_Q54YB8_113_357_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4232 | 9 | 225 | 1.20.1250.20 |
| 2cmrA00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.423 | 12 | 240 | 1.20.58.1860 |
| af_A4I2W7_8_252_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.4145 | 122 | 382 | 1.20.1070.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0K6IUC4-F1-model_v4 | Bacterial Cytochrome Ubiquinol Oxidase | 0.9911 | 143 | 256 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0020037 GO:0046872 GO:0070069 |
| AF-A0A366GMK4-F1-model_v4 | Cytochrome bd-I ubiquinol oxidase subunit 1 apoprotein | 0.9893 | 1 | 398 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0020037 GO:0046872 GO:0070069 |
| AF-A0A5N7YB97-F1-model_v4 | deleted | 0.9872 | 1 | 429 |
|
| AF-A0A329P241-F1-model_v4 | deleted | 0.9869 | 64 | 413 |
|
| AF-A0A7C4N6J7-F1-model_v4 | Cytochrome ubiquinol oxidase subunit I | 0.9866 | 4 | 434 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0020037 GO:0046872 GO:0070069 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar