F488157

General Info

Members Datasets Scaffolds Average Seq Length
1012 820 461 232

Family's Representative Sequence

Representative Sequence 3300001989|JGI24739J22299_10012934|JGI24739J22299_100129344
Length 267
Sequence MNDTIRLDESWRAPLLGEFTSPYMQELKRFLQEEKAQGKRVFPRGTEYFRALDLTPLDKVKVVVLGQDPYHGEGQAHGLCFSVRPGVRTPPSLVNIYKELQSDLGLSPPRHGFLEHWARQGVLLLNSVLTVEMGKAASHQKRGWERFTDAIIRLVNQQAEPVVFLLWGAYAQRKAEFVDRSRHLVLKAAHPSPLSAHNGFLGCRHFSQANAFLEQKGRGAIDWACPRRWHEFRRSVAPLFRSARCGGADARXXXGGDRAYARRFRAG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
3 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
4 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
5 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
6 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
7 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
8 2511231004 Pseudomonas sp. GM102 Isolate Nodule
9 2511231006 Pseudomonas sp. GM17 Isolate Nodule
10 2511231007 Pseudomonas sp. GM18 Isolate Nodule
11 2511231008 Pseudomonas sp. GM21 Isolate Nodule
12 2511231010 Pseudomonas sp. GM25 Isolate Nodule
13 2511231011 Pseudomonas sp. GM30 Isolate Nodule
14 2511231012 Pseudomonas sp. GM33 Isolate Nodule
15 2511231015 Pseudomonas sp. GM49 Isolate Nodule
16 2511231016 Pseudomonas sp. GM50 Isolate Nodule
17 2511231017 Pseudomonas sp. GM55 Isolate Nodule
18 2511231018 Pseudomonas sp. GM60 Isolate Nodule
19 2511231019 Pseudomonas sp. GM67 Isolate Nodule
20 2511231020 Pseudomonas sp. GM74 Isolate Nodule
21 2511231021 Pseudomonas sp. GM78 Isolate Nodule
22 2511231022 Pseudomonas sp. GM79 Isolate Nodule
23 2511231023 Pseudomonas sp. GM80 Isolate Nodule
24 2511231031 Pseudomonas sp. GM16 Isolate Nodule
25 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
26 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
27 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
28 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
29 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
30 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
31 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
32 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
33 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
34 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
35 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
36 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
37 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
38 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
39 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
40 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
41 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
42 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
43 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
44 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
45 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
46 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
47 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
48 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
49 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
50 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
51 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
52 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
53 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
54 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
55 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
56 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
57 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
58 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
59 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
60 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
61 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
62 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
63 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
64 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
65 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
66 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
67 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
68 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
69 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
70 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
71 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
72 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
73 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
74 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
75 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
76 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
77 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
78 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
79 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
80 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
81 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
82 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
83 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
84 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
85 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
86 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
87 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
88 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
89 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
90 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
91 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
92 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
93 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
94 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
95 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
96 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
97 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
98 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
99 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
100 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
101 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
102 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
103 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
104 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
105 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
106 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
107 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
108 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
109 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
110 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
111 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
112 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
113 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
114 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
115 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
116 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
117 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
118 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
119 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
120 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
121 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
122 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
123 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
124 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
125 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
126 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
127 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
128 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
129 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
130 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
131 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
132 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
133 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
134 2643221618 Ensifer sp. Root231 Isolate Unclassified
135 2643221626 Ensifer sp. Root31 Isolate Unclassified
136 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
137 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
138 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
139 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
140 2643221655 Ensifer sp. Root1252 Isolate Unclassified
141 2643221659 Ensifer sp. Root127 Isolate Unclassified
142 2643221693 Rhizobium sp. Root491 Isolate Unclassified
143 2643221698 Ensifer sp. Root142 Isolate Unclassified
144 2643221712 Ensifer sp. Root258 Isolate Unclassified
145 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
146 2643221718 Rhizobium sp. Root268 Isolate Unclassified
147 2643221723 Ensifer sp. Root278 Isolate Unclassified
148 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
149 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
150 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
151 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
152 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
153 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
154 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
155 2718217927 Rhizobium sp. N324 Isolate Nodule
156 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
157 2718218423 Rhizobium sp. N941 Isolate Nodule
158 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
159 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
160 2721755809 Rhizobium sp. N541 Isolate Nodule
161 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
162 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
163 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
164 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
165 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
166 2738541293 Rhizobium sp. GV031 Isolate Unclassified
167 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
168 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
169 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
170 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
171 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
172 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
173 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
174 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
175 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
176 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
177 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
178 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
179 2773857670 Pseudomonas sp. 478 Isolate Unclassified
180 2773857673 Pseudomonas sp. 443 Isolate Unclassified
181 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
182 2784132063 Pseudomonas sp. 424 Isolate Unclassified
183 2784132072 Pseudomonas sp. 460 Isolate Unclassified
184 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
185 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
186 2791355256 Rhizobium sp. M10 Isolate Nodule
187 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
188 2791355261 Rhizobium sp. J15 Isolate Nodule
189 2791355262 Rhizobium sp. M1 Isolate Nodule
190 2791355265 Rhizobium sp. H4 Isolate Nodule
191 2791355266 Rhizobium sp. L43 Isolate Nodule
192 2791355267 Rhizobium sp. L18 Isolate Nodule
193 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
194 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
195 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
196 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
197 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
198 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
199 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
200 2802429633 Rhizobium anhuiense J3 Isolate Nodule
201 2802429634 Rhizobium anhuiense S10 Isolate Nodule
202 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
203 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
204 2802429637 Rhizobium anhuiense C15 Isolate Nodule
205 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
206 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
207 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
208 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
209 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
210 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
211 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
212 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
213 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
214 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
215 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
216 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
217 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
218 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
219 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
220 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
221 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
222 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
223 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
224 2838048938 Rhizobium pisi 27/80 Isolate Nodule
225 2838061910 Rhizobium phaseoli L15 Isolate Nodule
226 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
227 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
228 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
229 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
230 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
231 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
232 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
233 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
234 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
235 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
236 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
237 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
238 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
239 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
240 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
241 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
242 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
243 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
244 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
245 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
246 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
247 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
248 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
249 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
250 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
251 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
252 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
253 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
254 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
255 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
256 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
257 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
258 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
259 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
260 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
261 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
262 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
263 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
264 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
265 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
266 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
267 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
268 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
269 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
270 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
271 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
272 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
273 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
274 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
275 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
276 2844163670 Ensifer sp. 1H6 Isolate Unclassified
277 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
278 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
279 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
280 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
281 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
282 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
283 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
284 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
285 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
286 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
287 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
288 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
289 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
290 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
291 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
292 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
293 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
294 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
295 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
296 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
297 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
298 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
299 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
300 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
301 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
302 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
303 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
304 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
305 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
306 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
307 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
308 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
309 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
310 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
311 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
312 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
313 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
314 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
315 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
316 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
317 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
318 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
319 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
320 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
321 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
322 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
323 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
324 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
325 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
326 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
327 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
328 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
329 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
330 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
331 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
332 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
333 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
334 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
335 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
336 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
337 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
338 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
339 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
340 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
341 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
342 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
343 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
344 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
345 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
346 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
347 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
348 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
349 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
350 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
351 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
352 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
353 2933599457 Rhizobium phaseoli M3 Isolate Nodule
354 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
355 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
356 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
357 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
358 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
359 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
360 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
361 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
362 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
363 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
364 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
365 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
366 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
367 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
368 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
369 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
370 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
371 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
372 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
373 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
374 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
375 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
376 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
377 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
378 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
379 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
380 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
381 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
382 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
383 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
384 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
385 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
386 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
387 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
388 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
389 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
390 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
391 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
392 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
393 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
394 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
395 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
396 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
397 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
398 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
399 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
400 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
401 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
402 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
403 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
404 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
405 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
406 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
407 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
408 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
409 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
410 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
411 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
412 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
413 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
414 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
415 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
416 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
417 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
418 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
419 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
420 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
421 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
422 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
423 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
424 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
425 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
426 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
427 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
428 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
429 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
430 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
431 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
432 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
433 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
434 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
435 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
436 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
437 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
438 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
439 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
440 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
441 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
442 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
443 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
444 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
445 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
446 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
447 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
448 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
449 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
450 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
451 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
452 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
453 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
454 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
455 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
456 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
457 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
458 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
459 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
460 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
461 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
462 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
463 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
464 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
465 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
466 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
467 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
468 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
469 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
470 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
471 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
472 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
473 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
474 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
475 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
476 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
477 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
478 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
479 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
480 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
481 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
482 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
483 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
484 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
485 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
486 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
487 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
488 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
489 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
490 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
491 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
492 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
493 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
494 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
495 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
496 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
497 2996887358 Rhizobium sp. R711 Isolate Nodule
498 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
499 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
500 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
501 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
502 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
503 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
504 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
505 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
506 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
507 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
508 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
509 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
510 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
511 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
512 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
513 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
514 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
515 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
516 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
517 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
518 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
519 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
520 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
521 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
522 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
523 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
524 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
525 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
526 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
527 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
528 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
529 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
530 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
531 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
532 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
533 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
534 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
535 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
536 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
537 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
538 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
539 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
540 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
541 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
542 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
543 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
544 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
545 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
546 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
547 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
548 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
549 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
550 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
551 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
552 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
553 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
554 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
555 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
556 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
557 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
558 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
559 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
560 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
561 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
562 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
563 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
564 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
565 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
566 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
567 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
568 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
569 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
570 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
571 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
572 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
573 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
574 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
575 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
576 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
577 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
578 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
579 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
580 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
581 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
582 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
583 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
584 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
585 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
586 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
587 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
588 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
589 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
590 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
591 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
592 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
593 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
594 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
595 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
596 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
597 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
598 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
599 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
600 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
601 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
602 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
603 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
604 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
605 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
606 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
607 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
608 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
609 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
610 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
611 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
612 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
613 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
614 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
615 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
616 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
617 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
618 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
619 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
620 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
621 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
622 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
623 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
624 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
625 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
626 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
627 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
628 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
629 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
630 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
631 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
632 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
633 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
634 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
635 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
636 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
637 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
638 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
639 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
640 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
641 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
642 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
643 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
644 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
645 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
646 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
647 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
648 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
649 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
650 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
651 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
652 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
653 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
654 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
655 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
656 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
657 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
658 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
659 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
660 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
661 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
662 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
663 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
664 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
665 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
666 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
667 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
668 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
669 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
670 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
671 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
672 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
673 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
674 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
675 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
676 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
677 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
678 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
679 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
680 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
681 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
682 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
683 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
684 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
685 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
686 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
687 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
688 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
689 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
690 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
691 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
692 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
693 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
694 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
695 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
696 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
697 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
698 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
699 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
700 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
701 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
702 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
703 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
704 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
705 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
706 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
707 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
708 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
709 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
710 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
711 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
712 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
713 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
714 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
715 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
716 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
717 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
718 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
719 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
720 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
721 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
722 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
723 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
724 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
725 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
726 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
727 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
728 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
729 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
730 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
731 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
732 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
733 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
734 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
735 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
736 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
737 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
738 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
739 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
740 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
741 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
742 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
743 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
744 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
745 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
746 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
747 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
748 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
749 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
750 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
751 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
752 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
753 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
754 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
755 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
756 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
757 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
758 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
759 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
760 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
761 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
762 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
763 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
764 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
765 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
766 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
767 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
768 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
769 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
770 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
771 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
772 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
773 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
774 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
775 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
776 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
777 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
778 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
779 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
780 8005258706 Rhizobium sp. R693 Isolate Nodule
781 8005275841 Rhizobium sp. N4311 Isolate Nodule
782 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
783 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
784 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
785 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
786 8005321885 Rhizobium sp. R72 Isolate Nodule
787 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
788 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
789 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
790 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
791 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
792 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
793 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
794 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
795 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
796 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
797 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
798 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
799 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
800 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
801 8018176218 Rhizobium sp. N122 Isolate Nodule
802 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
803 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
804 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
805 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
806 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
807 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
808 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
809 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
810 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
811 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
812 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
813 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
814 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
815 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
816 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
817 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
818 8056382006 Rhizobium croatiense 13T Isolate Nodule
819 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
820 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 45.55
Metatranscriptomes 0
Isolates 54.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.45
Nodule 34.88
Rhizoplane 6.82
Rhizosphere 31.92
Stem 0
Stem Tuber 0
Unclassified 13.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_241682 2162886007 Bacteria 2969
2 JGI24736J21556_1001222 3300001904 Bacteria 4723
3 JGI24741J21665_1000167 3300001915 Bacteria 18846
4 JGI24739J22299_10012934 3300001989 Bacteria 3054
5 JGI24737J22298_10001381 3300001990 Bacteria 8616
6 JGI24735J21928_10012571 3300002067 Bacteria 2673
7 JGI24738J21930_10005392 3300002075 Bacteria 3068
8 JGI24738J21930_10022840 3300002075 Bacteria 1292
9 JGI25152J39213_1005349 3300002773 Bacteria 3771
10 JGI25152J39213_1007474 3300002773 Bacteria 2825
11 JGI25150J39212_1000024 3300002774 Bacteria 129646
12 JGI25150J39212_1008934 3300002774 Bacteria 1935
13 JGI25159J45721_1000092 3300002987 Bacteria 42762
14 JGI25159J45721_1000403 3300002987 Bacteria 20187
15 JGI25151J46595_10000027 3300003187 Bacteria 208739
16 JGI25151J46595_10000634 3300003187 Bacteria 30281
17 JGI25153J46596_10003652 3300003215 Bacteria 8519
18 JGI25153J46596_10045296 3300003215 Bacteria 1314
19 rootH2_10145754 3300003320 Bacteria 1250
20 rootH1_10113875 3300003323 Bacteria 3943
21 JGI25160J50197_1000134 3300003354 Bacteria 66627
22 JGI25160J50197_1003062 3300003354 Bacteria 7621
23 JGI25161J50226_1000116 3300003374 Bacteria 62089
24 JGI25161J50226_1002066 3300003374 Bacteria 5447
25 Ga0055526_1002223 3300003771 Bacteria 13288
26 Ga0055526_1006923 3300003771 Bacteria 6032
27 Ga0055526_1008732 3300003771 Bacteria 4998
28 Ga0055524_1004804 3300003775 Bacteria 6158
29 Ga0055524_1007061 3300003775 Bacteria 4817
30 Ga0055524_1014106 3300003775 Bacteria 2979
31 Ga0055536_1012400 3300003781 Bacteria 3165
32 Ga0055528_1000247 3300003790 Bacteria 45698
33 Ga0055528_1005275 3300003790 Bacteria 6055
34 Ga0055528_1019047 3300003790 Bacteria 2297
35 Ga0055528_1021132 3300003790 Bacteria 2078
36 Ga0055528_1021545 3300003790 Bacteria 2041
37 Ga0055530_10024224 3300003791 Bacteria 1727
38 Ga0055540_1000830 3300003792 Bacteria 20773
39 Ga0055540_1015811 3300003792 Bacteria 2177
40 Ga0055540_1018012 3300003792 Bacteria 1950
41 Ga0055531_10027290 3300003794 Bacteria 2007
42 Ga0055543_1001164 3300004625 Bacteria 11203
43 Ga0055543_1002380 3300004625 Bacteria 6265
44 Ga0065165_1000196 3300005262 Bacteria 104569
45 Ga0065165_1016239 3300005262 Bacteria 2796
46 Ga0065704_10084786 3300005289 Bacteria 3296
47 Ga0065704_10086396 3300005289 Bacteria 3124
48 Ga0070658_10000042 3300005327 Bacteria 132351
49 Ga0070658_10074878 3300005327 Bacteria 2776
50 Ga0070683_100369615 3300005329 Bacteria 1366
51 Ga0070670_100006818 3300005331 Bacteria 9674
52 Ga0070670_100033711 3300005331 Bacteria 4410
53 Ga0070677_10000549 3300005333 Bacteria 12833
54 Ga0070661_100009868 3300005344 Bacteria 6624
55 Ga0070668_100062322 3300005347 Bacteria 2889
56 Ga0070668_100421347 3300005347 Bacteria 1143
57 Ga0070669_100077379 3300005353 Bacteria 2471
58 Ga0070675_100281628 3300005354 Bacteria 1461
59 Ga0070671_100036784 3300005355 Bacteria 4059
60 Ga0070659_100014711 3300005366 Bacteria 5851
61 Ga0070659_100019829 3300005366 Bacteria 5104
62 Ga0070659_100211978 3300005366 Bacteria 1596
63 Ga0070667_100101850 3300005367 Bacteria 2481
64 Ga0070663_100035253 3300005455 Bacteria 3471
65 Ga0070663_100046192 3300005455 Bacteria 3080
66 Ga0070662_100000662 3300005457 Bacteria 20926
67 Ga0070662_100123460 3300005457 Bacteria 1987
68 Ga0070681_10171694 3300005458 Bacteria 2090
69 Ga0070679_100196813 3300005530 Bacteria 1983
70 Ga0068853_100266400 3300005539 Bacteria 1576
71 Ga0070665_100029050 3300005548 Bacteria 5566
72 Ga0068855_100005402 3300005563 Bacteria 15590
73 Ga0068855_100140990 3300005563 Bacteria 2748
74 Ga0070664_100006129 3300005564 Bacteria 9726
75 Ga0068857_100043573 3300005577 Bacteria 3980
76 Ga0068857_100621831 3300005577 Bacteria 1022
77 Ga0068854_100000219 3300005578 Bacteria 38639
78 Ga0068854_100078231 3300005578 Bacteria 2436
79 Ga0068854_100279464 3300005578 Bacteria 1344
80 Ga0068856_100007045 3300005614 Bacteria 10981
81 Ga0068856_100380194 3300005614 Bacteria 1431
82 Ga0068852_100000061 3300005616 Bacteria 73079
83 Ga0068852_100003939 3300005616 Bacteria 10436
84 Ga0068859_100043467 3300005617 Bacteria 4515
85 Ga0068864_100210803 3300005618 Bacteria 1789
86 Ga0068860_100046822 3300005843 Bacteria 4123
87 Ga0075365_10000894 3300006038 Bacteria 12488
88 Ga0075365_10017583 3300006038 Bacteria 4378
89 Ga0075368_10001025 3300006042 Bacteria 8733
90 Ga0075368_10096523 3300006042 Bacteria 1212
91 Ga0075363_100093450 3300006048 Bacteria 1658
92 Ga0075362_10000179 3300006177 Bacteria 17463
93 Ga0075362_10001873 3300006177 Bacteria 6892
94 Ga0075362_10072251 3300006177 Bacteria 1578
95 Ga0075362_10121585 3300006177 Bacteria 1236
96 Ga0075367_10024658 3300006178 Bacteria 3393
97 Ga0075367_10479250 3300006178 Bacteria 789
98 Ga0075369_10005696 3300006186 Bacteria 4673
99 Ga0075369_10011194 3300006186 Bacteria 3523
100 Ga0075366_10029897 3300006195 Bacteria 3201
101 Ga0075366_10176830 3300006195 Bacteria 1296
102 Ga0075366_10359574 3300006195 Bacteria 894
103 Ga0097621_100228956 3300006237 Bacteria 1622
104 Ga0075370_10057011 3300006353 Bacteria 2220
105 Ga0097620_100043468 3300006931 Bacteria 4515
106 Ga0079104_1001826 3300006946 Bacteria 13092
107 Ga0105251_10022498 3300009011 Bacteria 3271
108 Ga0105251_10025900 3300009011 Bacteria 2992
109 Ga0105244_10120405 3300009036 Bacteria 1271
110 Ga0105240_10020551 3300009093 Bacteria 8802
111 Ga0105240_10371767 3300009093 Bacteria 1616
112 Ga0105243_10010255 3300009148 Bacteria 7118
113 Ga0105241_10001920 3300009174 Bacteria 15738
114 Ga0105248_10549722 3300009177 Bacteria 1302
115 Ga0105238_10962504 3300009551 Bacteria 874
116 Ga0105249_10015257 3300009553 Bacteria 6800
117 Ga0123341_1001576 3300009765 Bacteria 17486
118 Ga0123342_1011000 3300009766 Bacteria 10111
119 Ga0105148_100372 3300009978 Bacteria 4802
120 Ga0105239_10357701 3300010375 Bacteria 1648
121 Ga0105246_10000345 3300011119 Bacteria 24772
122 Ga0105246_10091865 3300011119 Bacteria 2189
123 Ga0105246_10150925 3300011119 Bacteria 1759
124 Ga0157322_1000493 3300012490 Bacteria 1494
125 Ga0157326_1000035 3300012513 Bacteria 11769
126 Ga0157373_10013541 3300013100 Bacteria 5983
127 Ga0157373_10090502 3300013100 Bacteria 2155
128 Ga0157373_10307874 3300013100 Bacteria 1125
129 Ga0157371_10000165 3300013102 Bacteria 96321
130 Ga0157371_10004669 3300013102 Bacteria 11854
131 Ga0157370_10000338 3300013104 Bacteria 59035
132 Ga0157370_10010162 3300013104 Bacteria 9938
133 Ga0157370_10073377 3300013104 Bacteria 3229
134 Ga0157369_10016418 3300013105 Bacteria 8326
135 Ga0171463_1014 3300013249 Bacteria 83917
136 Ga0157378_10159209 3300013297 Bacteria 2110
137 Ga0163162_10526805 3300013306 Bacteria 1311
138 Ga0157372_10492359 3300013307 Bacteria 1430
139 Ga0157372_10748645 3300013307 Bacteria 1136
140 Ga0157380_10164602 3300014326 Bacteria 1931
141 Ga0183363_1028 3300015690 Bacteria 50706
142 Ga0163161_10004616 3300017792 Bacteria 9586
143 Ga0214543_1000008 3300021327 Bacteria 385680
144 Ga0228711_1000003 3300022739 Bacteria 258118
145 Ga0228710_1000003 3300022740 Bacteria 262981
146 Ga0209436_101037 3300025208 Bacteria 10611
147 Ga0207425_1000043 3300025245 Bacteria 208791
148 Ga0207425_1009366 3300025245 Bacteria 2439
149 Ga0209129_1000072 3300025258 Bacteria 208805
150 Ga0209129_1000456 3300025258 Bacteria 30258
151 Ga0209129_1009702 3300025258 Bacteria 2496
152 Ga0209673_1000025 3300025273 Bacteria 404572
153 Ga0209673_1000112 3300025273 Bacteria 179676
154 Ga0209673_1001826 3300025273 Bacteria 17422
155 Ga0209673_1003534 3300025273 Bacteria 9142
156 Ga0209673_1013139 3300025273 Bacteria 3289
157 Ga0209673_1044411 3300025273 Bacteria 1230
158 Ga0209130_1000198 3300025284 Bacteria 82557
159 Ga0209676_1004562 3300025292 Bacteria 7665
160 Ga0209025_1000120 3300025294 Bacteria 208791
161 Ga0209025_1000339 3300025294 Bacteria 103239
162 Ga0209025_1000386 3300025294 Bacteria 91377
163 Ga0209025_1011767 3300025294 Bacteria 5708
164 Ga0209025_1030765 3300025294 Bacteria 2560
165 Ga0209564_1000353 3300025295 Bacteria 85747
166 Ga0209564_1000874 3300025295 Bacteria 40052
167 Ga0209564_1002270 3300025295 Bacteria 15739
168 Ga0209564_1003966 3300025295 Bacteria 9413
169 Ga0209758_1000111 3300025297 Bacteria 208790
170 Ga0209758_1000254 3300025297 Bacteria 107330
171 Ga0209758_1015500 3300025297 Bacteria 3939
172 Ga0209050_1010702 3300025298 Bacteria 4476
173 Ga0209256_1000368 3300025299 Bacteria 72598
174 Ga0209256_1000451 3300025299 Bacteria 62479
175 Ga0209256_1000884 3300025299 Bacteria 37000
176 Ga0209256_1001144 3300025299 Bacteria 30100
177 Ga0209256_1007416 3300025299 Bacteria 5413
178 Ga0209256_1017286 3300025299 Bacteria 2405
179 Ga0207426_1000048 3300025302 Bacteria 409127
180 Ga0207426_1000208 3300025302 Bacteria 140385
181 Ga0207426_1005241 3300025302 Bacteria 6000
182 Ga0209051_1000176 3300025303 Bacteria 115875
183 Ga0209051_1000756 3300025303 Bacteria 34622
184 Ga0209051_1006644 3300025303 Bacteria 6477
185 Ga0209051_1013500 3300025303 Bacteria 3885
186 Ga0209051_1023589 3300025303 Bacteria 2553
187 Ga0209257_1011520 3300025304 Bacteria 4244
188 Ga0207656_10037759 3300025321 Bacteria 2034
189 Ga0207682_10006559 3300025893 Bacteria 4684
190 Ga0207647_10013414 3300025904 Bacteria 5680
191 Ga0207647_10143071 3300025904 Bacteria 1401
192 Ga0207647_10227424 3300025904 Bacteria 1074
193 Ga0207647_10332224 3300025904 Bacteria 862
194 Ga0207705_10000007 3300025909 Bacteria 597387
195 Ga0207705_10000692 3300025909 Bacteria 27908
196 Ga0207705_10163837 3300025909 Bacteria 1671
197 Ga0207654_10064158 3300025911 Bacteria 2158
198 Ga0207707_10141066 3300025912 Bacteria 2107
199 Ga0207695_10014948 3300025913 Bacteria 9160
200 Ga0207695_10045888 3300025913 Bacteria 4635
201 Ga0207657_10001140 3300025919 Bacteria 28213
202 Ga0207657_10123715 3300025919 Bacteria 2126
203 Ga0207657_10496335 3300025919 Bacteria 956
204 Ga0207649_10049464 3300025920 Bacteria 2597
205 Ga0207681_10067880 3300025923 Bacteria 2474
206 Ga0207681_10152723 3300025923 Bacteria 1732
207 Ga0207694_10010447 3300025924 Bacteria 7001
208 Ga0207650_10036708 3300025925 Bacteria 3566
209 Ga0207644_10076669 3300025931 Bacteria 2460
210 Ga0207690_10034961 3300025932 Bacteria 3241
211 Ga0207690_10060297 3300025932 Bacteria 2574
212 Ga0207706_10000980 3300025933 Bacteria 29041
213 Ga0207706_10014449 3300025933 Bacteria 7156
214 Ga0207706_10014839 3300025933 Bacteria 7053
215 Ga0207667_10008267 3300025949 Bacteria 12384
216 Ga0207667_10018847 3300025949 Bacteria 7725
217 Ga0207667_10024905 3300025949 Bacteria 6560
218 Ga0207667_10118741 3300025949 Bacteria 2725
219 Ga0207712_10022659 3300025961 Bacteria 4138
220 Ga0207668_10257831 3300025972 Bacteria 1419
221 Ga0207640_10016756 3300025981 Bacteria 4270
222 Ga0207640_10034263 3300025981 Bacteria 3167
223 Ga0207640_10056760 3300025981 Bacteria 2572
224 Ga0207640_10131020 3300025981 Bacteria 1813
225 Ga0207639_10001981 3300026041 Bacteria 13776
226 Ga0207678_10001506 3300026067 Bacteria 21341
227 Ga0207678_10015475 3300026067 Bacteria 6705
228 Ga0207678_10084061 3300026067 Bacteria 2722
229 Ga0207702_10004475 3300026078 Bacteria 12412
230 Ga0207702_10212462 3300026078 Bacteria 1799
231 Ga0207702_10336123 3300026078 Bacteria 1442
232 Ga0207674_10016238 3300026116 Bacteria 8155
233 Ga0207674_10084278 3300026116 Bacteria 3177
234 Ga0207674_10681417 3300026116 Bacteria 992
235 Ga0207698_10000337 3300026142 Bacteria 27840
236 Ga0207698_10017734 3300026142 Bacteria 4838
237 Ga0207698_10115719 3300026142 Bacteria 2258
238 Ga0209281_1000081 3300027111 Bacteria 258084
239 Ga0209281_1000141 3300027111 Bacteria 175634
240 Ga0209282_1000036 3300027666 Bacteria 130242
241 Ga0209813_10073095 3300027866 Bacteria 1119
242 Ga0268266_10869374 3300028379 Bacteria 871
243 Ga0268264_10096786 3300028381 Bacteria 2557
244 Ga0307515_10000691 3300028794 Bacteria 77788
245 Ga0307515_10101588 3300028794 Bacteria 3469
246 Ga0307512_10248325 3300030522 Bacteria 890
247 Ga0307513_10003481 3300031456 Bacteria 21301
248 Ga0307513_10008757 3300031456 Bacteria 12889
249 Ga0307513_10011619 3300031456 Bacteria 10933
250 Ga0307408_100115798 3300031548 Bacteria 2067
251 Ga0316579_10011735 3300031691 Bacteria 3732
252 Ga0307405_10001049 3300031731 Bacteria 11189
253 Ga0307405_10150079 3300031731 Bacteria 1637
254 Ga0307405_10186857 3300031731 Bacteria 1493
255 Ga0307410_10496527 3300031852 Bacteria 1003
256 Ga0307412_10000246 3300031911 Bacteria 35145
257 Ga0307412_10002548 3300031911 Bacteria 10119
258 Ga0307412_10048614 3300031911 Bacteria 2790
259 Ga0307412_10177475 3300031911 Bacteria 1598
260 Ga0315914_1000002 3300031967 Bacteria 365357
261 Ga0307416_100157299 3300032002 Bacteria 2094
262 Ga0307411_10175707 3300032005 Bacteria 1620
263 Ga0307411_10267088 3300032005 Bacteria 1354
264 Ga0316583_10003611 3300032133 Bacteria 5462
265 Ga0315913_1000009 3300033430 Bacteria 149770
266 Ga0315915_1000005 3300033464 Bacteria 397591
267 Ga0316582_0006914 3300036647 Bacteria 6001
268 Ga0316584_0029608 3300036712 Bacteria 4042
269 Ga0316584_0183247 3300036712 Bacteria 1549
270 Ga0395899_0000025 3300037312 Bacteria 350927
271 Ga0395899_0005230 3300037312 Bacteria 10092
272 Ga0395900_0001684 3300037418 Bacteria 25724
273 Ga0395900_0024780 3300037418 Bacteria 6142
274 Ga0395900_0112112 3300037418 Bacteria 2801
275 Ga0395905_0000054 3300037471 Bacteria 210118
276 Ga0395905_0000521 3300037471 Bacteria 52722
277 Ga0395905_0019240 3300037471 Bacteria 6474
278 Ga0395905_0068285 3300037471 Bacteria 3330
279 Ga0316581_0009120 3300037588 Bacteria 2719
280 Ga0395901_0000047 3300038443 Bacteria 175221
281 Ga0237819_01643 3300038705 Bacteria 5505
282 Ga0439465_0002237 3300041413 Bacteria 6352
283 Ga0439465_0012736 3300041413 Bacteria 2629
284 Ga0451795_0811535 3300041456 Bacteria 2734
285 Ga0451795_1587801 3300041456 Bacteria 1310
286 Ga0451845_0821845 3300041501 Bacteria 5945
287 Ga0451847_0466867 3300041503 Bacteria 1528
288 Ga0451851_0182692 3300041507 Bacteria 5852
289 Ga0451855_0583055 3300041511 Bacteria 4929
290 Ga0451853_0501375 3300041512 Bacteria 4419
291 Ga0439432_003862 3300042006 Bacteria 5525
292 Ga0439449_0005690 3300042007 Bacteria 4765
293 Ga0439449_0023717 3300042007 Bacteria 2294
294 Ga0439462_0010789 3300042015 Bacteria 2317
295 Ga0466965_0028532 3300044683 Bacteria 2712
296 Ga0451576_0000017 3300045051 Bacteria 558261
297 Ga0495638_0022829 3300046460 Bacteria 4102
298 Ga0495638_0053543 3300046460 Bacteria 2511
299 Ga0495605_0045314 3300046474 Bacteria 2168
300 Ga0495585_0001982 3300046492 Bacteria 15218
301 Ga0495585_0012019 3300046492 Bacteria 5109
302 Ga0495596_0194173 3300046500 Bacteria 789
303 Ga0495607_0030981 3300046501 Bacteria 3277
304 Ga0495583_0009288 3300046506 Bacteria 5890
305 Ga0495606_0047962 3300046507 Bacteria 2813
306 Ga0495610_0018932 3300046512 Bacteria 3869
307 Ga0495616_0035167 3300046513 Bacteria 2595
308 Ga0495620_0021271 3300046515 Bacteria 3152
309 Ga0495620_0025613 3300046515 Bacteria 2787
310 Ga0495620_0045305 3300046515 Bacteria 1906
311 Ga0495631_0027399 3300046518 Bacteria 2608
312 Ga0495632_0022048 3300046519 Bacteria 3421
313 Ga0495643_0061860 3300046522 Bacteria 1984
314 Ga0495643_0072378 3300046522 Bacteria 1807
315 Ga0495648_0068667 3300046524 Bacteria 2066
316 Ga0495663_0016229 3300046525 Bacteria 2105
317 Ga0495642_0072760 3300046528 Bacteria 1439
318 Ga0495654_0097510 3300046530 Bacteria 1357
319 Ga0495598_0021693 3300046537 Bacteria 1711
320 Ga0495609_0054787 3300046538 Bacteria 1770
321 Ga0495609_0103295 3300046538 Bacteria 1234
322 Ga0495621_0262212 3300046539 Unclassified 708
323 Ga0495597_0055298 3300046542 Bacteria 1741
324 Ga0495633_0004895 3300046558 Bacteria 8362
325 Ga0495633_0020894 3300046558 Bacteria 3284
326 Ga0495656_0075848 3300046615 Bacteria 1505
327 Ga0495668_0153859 3300046616 Bacteria 1259
328 Ga0495611_0263382 3300046648 Bacteria 798
329 Ga0495625_0015697 3300046660 Bacteria 5984
330 Ga0495625_0018986 3300046660 Bacteria 5350
331 Ga0495625_0031047 3300046660 Bacteria 3977
332 Ga0495625_0107606 3300046660 Bacteria 1908
333 Ga0495661_0036716 3300046665 Bacteria 3065
334 Ga0495588_0002321 3300046674 Bacteria 8149
335 Ga0495588_0014657 3300046674 Bacteria 3758
336 Ga0495670_0005457 3300046691 Bacteria 6241
337 Ga0495670_0054408 3300046691 Bacteria 2005
338 Ga0495660_0006753 3300046810 Bacteria 6769
339 Ga0495683_0055292 3300047323 Bacteria 1976
340 Ga0495687_010720 3300047443 Bacteria 5001
341 Ga0495677_0001002 3300047445 Bacteria 11369
342 Ga0495677_0078569 3300047445 Bacteria 1235
343 Ga0495681_0008166 3300047470 Bacteria 6589
344 Ga0495686_0005354 3300047472 Bacteria 10152
345 Ga0495686_0122466 3300047472 Bacteria 1548
346 Ga0495626_0034066 3300048091 Bacteria 2438
347 Ga0496102_0573176 3300048905 Bacteria 1051
348 Ga0496103_0032151 3300048906 Bacteria 3201
349 Ga0496104_0056916 3300048907 Bacteria 3700
350 Ga0496104_0494010 3300048907 Bacteria 1135
351 Ga0496105_0044437 3300048908 Bacteria 3664
352 Ga0496106_0226385 3300048909 Bacteria 1492
353 Ga0496108_0001008 3300048911 Bacteria 22003
354 Ga0496108_0223073 3300048911 Bacteria 1638
355 Ga0496108_0232544 3300048911 Bacteria 1603
356 Ga0496109_0519933 3300048912 Bacteria 1123
357 Ga0496109_0672836 3300048912 Bacteria 972
358 Ga0496110_0037288 3300048913 Bacteria 4225
359 Ga0496111_0195050 3300048914 Bacteria 1505
360 Ga0496111_0280728 3300048914 Bacteria 1235
361 Ga0496113_0054141 3300048916 Bacteria 3002
362 Ga0496114_0187500 3300048917 Bacteria 1808
363 Ga0496116_0003197 3300048919 Bacteria 16381
364 Ga0496116_0003578 3300048919 Bacteria 15278
365 Ga0496116_0026733 3300048919 Bacteria 4210
366 Ga0496116_0178163 3300048919 Bacteria 1142
367 Ga0496117_0000002 3300048920 Bacteria 2483758
368 Ga0496117_0004238 3300048920 Bacteria 16006
369 Ga0496117_0077700 3300048920 Bacteria 2195
370 Ga0496118_0001712 3300048921 Bacteria 31995
371 Ga0496118_0001964 3300048921 Bacteria 29165
372 Ga0496118_0107433 3300048921 Bacteria 1863
373 Ga0496119_0014395 3300048922 Bacteria 6195
374 Ga0496120_0000093 3300048923 Bacteria 146905
375 Ga0496121_0000065 3300048924 Bacteria 269310
376 Ga0496121_0002534 3300048924 Bacteria 27692
377 Ga0496121_0027017 3300048924 Bacteria 5384
378 Ga0496121_0198900 3300048924 Bacteria 1430
379 Ga0496122_0000004 3300048925 Bacteria 645283
380 Ga0496122_0002878 3300048925 Bacteria 23563
381 Ga0496122_0008704 3300048925 Bacteria 10866
382 Ga0496122_0012168 3300048925 Bacteria 8605
383 Ga0496122_0012991 3300048925 Bacteria 8212
384 Ga0496122_0057805 3300048925 Bacteria 2876
385 Ga0496122_0232757 3300048925 Bacteria 1046
386 Ga0496123_0000007 3300048926 Bacteria 645283
387 Ga0496123_0006417 3300048926 Bacteria 11402
388 Ga0496123_0035386 3300048926 Bacteria 3559
389 Ga0496123_0038163 3300048926 Bacteria 3380
390 Ga0496124_0001193 3300048927 Bacteria 40502
391 Ga0496124_0001771 3300048927 Bacteria 30049
392 Ga0496124_0003788 3300048927 Bacteria 18163
393 Ga0496124_0089421 3300048927 Bacteria 2514
394 Ga0496124_0177667 3300048927 Bacteria 1641
395 Ga0496125_0000425 3300048928 Bacteria 78294
396 Ga0496125_0002655 3300048928 Bacteria 22861
397 Ga0496125_0042107 3300048928 Bacteria 3895
398 Ga0496125_0077718 3300048928 Bacteria 2556
399 Ga0496125_0106789 3300048928 Bacteria 2042
400 Ga0496126_0011280 3300048929 Bacteria 9273
401 Ga0496126_0079811 3300048929 Bacteria 2896
402 Ga0496126_0145320 3300048929 Bacteria 2037
403 Ga0496126_0268818 3300048929 Bacteria 1415
404 Ga0495678_023893 3300049459 Bacteria 2648
405 Ga0501033_0224335 3300049570 Bacteria 1337
406 Ga0501034_0160607 3300049571 Bacteria 2218
407 Ga0501034_0197078 3300049571 Bacteria 1973
408 Ga0501036_0270392 3300049572 Bacteria 1423
409 Ga0501037_0100104 3300049573 Bacteria 2093
410 Ga0501038_0030755 3300049574 Bacteria 4747
411 Ga0501039_0032247 3300049575 Bacteria 4039
412 Ga0501043_0005362 3300049579 Bacteria 10358
413 Ga0501046_0258943 3300049580 Bacteria 1278
414 Ga0501047_0007006 3300049581 Bacteria 10585
415 Ga0501223_000030 3300049663 Bacteria 51216
416 Ga0501223_000062 3300049663 Bacteria 35069
417 Ga0501224_000018 3300049664 Bacteria 80972
418 Ga0501233_000149 3300049668 Bacteria 10087
419 Ga0501235_002383 3300049669 Bacteria 4051
420 Ga0501249_000229 3300049679 Bacteria 16831
421 Ga0501225_0000050 3300049705 Bacteria 40536
422 Ga0501225_0001835 3300049705 Bacteria 6653
423 Ga0501234_001523 3300049707 Bacteria 3637
424 Ga0501083_0023886 3300049744 Bacteria 4239
425 Ga0501282_001771 3300049778 Bacteria 2378
426 Ga0501035_0374756 3300049822 Bacteria 1188
427 Ga0501044_0044666 3300049823 Bacteria 4597
428 Ga0501044_0286980 3300049823 Bacteria 1578
429 Ga0501204_007800 3300049850 Bacteria 1209
430 Ga0501226_000030 3300049853 Bacteria 80922
431 nmdc:mga03683_30323_c1 3300050489 Bacteria 2164
432 nmdc:mga03683_86714_c1 3300050489 Bacteria 1360
433 nmdc:mga00v17_7_c1 3300050491 Bacteria 167228
434 nmdc:mga0yw44_13633_c1 3300050492 Bacteria 4286
435 nmdc:mga0yw44_456530_c1 3300050492 Bacteria 866
436 nmdc:mga0k408_134463_c1 3300050493 Bacteria 1469
437 nmdc:mga0k408_195079_c1 3300050493 Bacteria 1209
438 nmdc:mga0k408_397485_c1 3300050493 Bacteria 820
439 nmdc:mga0k408_54499_c1 3300050493 Bacteria 2318
440 nmdc:mga06z11_35099_c1 3300050494 Bacteria 2466
441 nmdc:mga06z11_39161_c1 3300050494 Bacteria 2358
442 nmdc:mga04h51_1148_c1 3300050495 Bacteria 6123
443 nmdc:mga07m45_127685_c1 3300050496 Bacteria 1471
444 nmdc:mga07m45_159489_c1 3300050496 Bacteria 1309
445 nmdc:mga0sz30_26_c1 3300050516 Bacteria 59011
446 Ga0500578_0268480 3300053086 Bacteria 1021
447 Ga0500643_000385 3300053087 Bacteria 34308
448 Ga0500643_005394 3300053087 Bacteria 5523
449 Ga0500643_009309 3300053087 Bacteria 3760
450 Ga0500643_013251 3300053087 Bacteria 2918
451 Ga0500643_033750 3300053087 Bacteria 1545
452 Ga0500569_011645 3300053109 Bacteria 2107
453 Ga0500592_005960 3300053116 Bacteria 1938
454 Ga0500658_0000390 3300053134 Bacteria 19207
455 Ga0500561_0000103 3300053137 Bacteria 16431
456 Ga0500561_0049655 3300053137 Bacteria 1140
457 Ga0500573_0000039 3300053140 Bacteria 105413
458 Ga0500622_0022475 3300053156 Bacteria 3344
459 Ga0500624_000237 3300053157 Bacteria 19741
460 Ga0500634_0020849 3300053161 Bacteria 3549
461 Ga0500661_000716 3300055283 Bacteria 6200

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046539 Ga0495621_0262212 Ga0495621_0262212_11_604 187
2 3300046528 Ga0495642_0072760 Ga0495642_0072760_245_949 202
3 3300049572 Ga0501036_0270392 Ga0501036_0270392_507_1199 204
4 3300049580 Ga0501046_0258943 Ga0501046_0258943_211_903 204
5 iso_pu_bacteria 2510065057 2510303776 212
6 iso_pu_bacteria 2511231052 2511503073 212
7 iso_pu_bacteria 2512875026 2512973843 212
8 iso_pu_bacteria 2513237086 2513585954 212
9 iso_pu_bacteria 2513237089 2513602440 212
10 iso_pu_bacteria 2513237091 2513617242 212
11 iso_pu_bacteria 2513237140 2513882983 212
12 iso_pu_bacteria 2513237143 2513903013 212
13 iso_pu_bacteria 2513237156 2513985688 212
14 iso_pu_bacteria 2513237160 2514004083 212
15 iso_pu_bacteria 2515154107 2515610243 212
16 iso_pu_bacteria 2516653046 2516894477 212
17 iso_pu_bacteria 2517487022 2517571095 212
18 iso_pu_bacteria 2524023207 2524451960 212
19 iso_pu_bacteria 2551306084 2551679888 212
20 iso_pu_bacteria 2551306085 2551689758 212
21 iso_pu_bacteria 2551306086 2551692511 212
22 iso_pu_bacteria 2551306087 2551702535 212
23 iso_pu_bacteria 2551306089 2551715222 212
24 iso_pu_bacteria 2551306090 2551716373 212
25 iso_pu_bacteria 2551306091 2551729544 212
26 iso_pu_bacteria 2551306092 2551737782 212
27 iso_pu_bacteria 2551306093 2551745618 212
28 iso_pu_bacteria 2599185156 2599334667 212
29 iso_pu_bacteria 2599185352 2600194181 212
30 iso_pu_bacteria 2643221618 2644106652 212
31 iso_pu_bacteria 2643221626 2644149625 212
32 iso_pu_bacteria 2643221655 2644309726 212
33 iso_pu_bacteria 2643221659 2644333397 212
34 iso_pu_bacteria 2643221698 2644543581 212
35 iso_pu_bacteria 2643221712 2644618173 212
36 iso_pu_bacteria 2643221723 2644676652 212
37 iso_pu_bacteria 2657244999 2657684495 212
38 iso_pu_bacteria 2690316117 2692314415 212
39 iso_pu_bacteria 2751185821 2753461000 212
40 iso_pu_bacteria 2775507255 2778126167 212
41 iso_pu_bacteria 2791355091 2792624363 212
42 iso_pu_bacteria 2791355092 2792625635 212
43 iso_pu_bacteria 2802428858 2802717815 212
44 iso_pu_bacteria 2802428859 2802725334 212
45 iso_pu_bacteria 2802428860 2802730542 212
46 iso_pu_bacteria 2802428861 2802737889 212
47 iso_pu_bacteria 2802428862 2802744242 212
48 iso_pu_bacteria 2802428863 2802753074 212
49 iso_pu_bacteria 2802429268 2804753396 212
50 iso_pu_bacteria 2842922631 2842925791 212
51 iso_pu_bacteria 2847417321 2847420533 212
52 iso_pu_bacteria 2848992105 2848995405 212
53 iso_pu_bacteria 2855825444 2855827113 212
54 iso_pu_bacteria 2855839649 2855842510 212
55 iso_pu_bacteria 2855872281 2855878340 212
56 iso_pu_bacteria 2858800743 2858803326 212
57 iso_pu_bacteria 2915980308 2915980646 212
58 iso_pu_bacteria 2915986958 2915991057 212
59 iso_pu_bacteria 2915993759 2915997713 212
60 iso_pu_bacteria 2916000859 2916006932 212
61 iso_pu_bacteria 2916007675 2916009466 212
62 iso_pu_bacteria 2916014648 2916016480 212
63 iso_pu_bacteria 2916021584 2916027698 212
64 iso_pu_bacteria 2916028427 2916030289 212
65 iso_pu_bacteria 2916035215 2916036846 212
66 iso_pu_bacteria 2916041962 2916044703 212
67 iso_pu_bacteria 2916048683 2916053904 212
68 iso_pu_bacteria 2916055098 2916058415 212
69 iso_pu_bacteria 2916061851 2916065606 212
70 iso_pu_bacteria 2916068649 2916073778 212
71 iso_pu_bacteria 2916076590 2916077934 212
72 iso_pu_bacteria 2920760137 2920760669 212
73 iso_pu_bacteria 2920822456 2920828395 212
74 iso_pu_bacteria 2921201388 2921201433 212
75 iso_pu_bacteria 2921208531 2921209590 212
76 iso_pu_bacteria 2921237296 2921237516 212
77 iso_pu_bacteria 2921244191 2921244301 212
78 iso_pu_bacteria 2921250672 2921252585 212
79 iso_pu_bacteria 2921257292 2921260659 212
80 iso_pu_bacteria 2921263974 2921265918 212
81 iso_pu_bacteria 2921282425 2921286311 212
82 iso_pu_bacteria 2921289301 2921293346 212
83 iso_pu_bacteria 2921296804 2921300186 212
84 iso_pu_bacteria 2924144063 2924148736 212
85 iso_pu_bacteria 2924150972 2924154941 212
86 iso_pu_bacteria 2924158325 2924164157 212
87 iso_pu_bacteria 2924165586 2924166586 212
88 iso_pu_bacteria 2924172951 2924174375 212
89 iso_pu_bacteria 2924179722 2924182304 212
90 iso_pu_bacteria 2924186466 2924188512 212
91 iso_pu_bacteria 2924193448 2924193857 212
92 iso_pu_bacteria 2924200457 2924206616 212
93 iso_pu_bacteria 2924207177 2924213048 212
94 iso_pu_bacteria 2924214083 2924221283 212
95 iso_pu_bacteria 2924221636 2924226805 212
96 iso_pu_bacteria 2924228884 2924231998 212
97 iso_pu_bacteria 2936996657 2937000145 212
98 iso_pu_bacteria 2937002841 2937006906 212
99 iso_pu_bacteria 2937009748 2937015376 212
100 iso_pu_bacteria 2937016420 2937018095 212
101 iso_pu_bacteria 2937023124 2937024299 212
102 iso_pu_bacteria 2937029754 2937032911 212
103 iso_pu_bacteria 2937036028 2937042306 212
104 iso_pu_bacteria 2937042894 2937046646 212
105 iso_pu_bacteria 2937049772 2937052262 212
106 iso_pu_bacteria 2937056579 2937063071 212
107 iso_pu_bacteria 2937063883 2937067505 212
108 iso_pu_bacteria 2937071275 2937071320 212
109 iso_pu_bacteria 2937078374 2937078712 212
110 iso_pu_bacteria 2937084907 2937086673 212
111 iso_pu_bacteria 2937091812 2937092973 212
112 iso_pu_bacteria 2937098957 2937104795 212
113 iso_pu_bacteria 2937106411 2937110559 212
114 iso_pu_bacteria 2937113482 2937114493 212
115 iso_pu_bacteria 2937119839 2937123779 212
116 iso_pu_bacteria 2937126314 2937129243 212
117 iso_pu_bacteria 2957375807 2957376850 212
118 iso_pu_bacteria 2957382221 2957386004 212
119 iso_pu_bacteria 2957388812 2957390088 212
120 iso_pu_bacteria 2957395598 2957396848 212
121 iso_pu_bacteria 2957402308 2957406185 212
122 iso_pu_bacteria 2957408893 2957408938 212
123 iso_pu_bacteria 2957415311 2957421979 212
124 iso_pu_bacteria 2957422303 2957427001 212
125 iso_pu_bacteria 2957430029 2957430612 212
126 iso_pu_bacteria 2957437181 2957441384 212
127 iso_pu_bacteria 2957443900 2957444426 212
128 iso_pu_bacteria 2957450854 2957454464 212
129 iso_pu_bacteria 2957457609 2957459435 212
130 iso_pu_bacteria 2957464669 2957468276 212
131 iso_pu_bacteria 2957471148 2957472014 212
132 iso_pu_bacteria 2957478035 2957480939 212
133 iso_pu_bacteria 2957484790 2957485578 212
134 iso_pu_bacteria 2957491536 2957495192 212
135 iso_pu_bacteria 2957498199 2957500307 212
136 iso_pu_bacteria 2957505466 2957506975 212
137 iso_pu_bacteria 2960584000 2960587537 212
138 iso_pu_bacteria 2960591022 2960591360 212
139 iso_pu_bacteria 2960597568 2960598697 212
140 iso_pu_bacteria 2960610863 2960617330 212
141 iso_pu_bacteria 2960617483 2960618678 212
142 iso_pu_bacteria 2960624210 2960629605 212
143 iso_pu_bacteria 2960631154 2960632613 212
144 iso_pu_bacteria 2960637947 2960638782 212
145 iso_pu_bacteria 2960645483 2960646667 212
146 iso_pu_bacteria 2960652885 2960659715 212
147 iso_pu_bacteria 2960660292 2960662875 212
148 iso_pu_bacteria 2960667422 2960671417 212
149 iso_pu_bacteria 2960674078 2960675405 212
150 iso_pu_bacteria 2960680706 2960681443 212
151 iso_pu_bacteria 2960687367 2960687853 212
152 iso_pu_bacteria 2960693952 2960694483 212
153 iso_pu_bacteria 2964607997 2964612364 212
154 iso_pu_bacteria 2964615318 2964618540 212
155 iso_pu_bacteria 2964621998 2964624858 212
156 iso_pu_bacteria 2964628898 2964631405 212
157 iso_pu_bacteria 2964636051 2964640519 212
158 iso_pu_bacteria 2964643177 2964647162 212
159 iso_pu_bacteria 2964649959 2964650941 212
160 iso_pu_bacteria 2964656573 2964659053 212
161 iso_pu_bacteria 2964663802 2964668778 212
162 iso_pu_bacteria 2964670856 2964673262 212
163 iso_pu_bacteria 2964678106 2964681712 212
164 iso_pu_bacteria 2964685014 2964688651 212
165 iso_pu_bacteria 2964691889 2964692664 212
166 iso_pu_bacteria 2964698721 2964705113 212
167 iso_pu_bacteria 2964705432 2964706273 212
168 iso_pu_bacteria 2964712639 2964719036 212
169 iso_pu_bacteria 2964719344 2964724301 212
170 iso_pu_bacteria 2967664464 2967666408 212
171 iso_pu_bacteria 2967671571 2967673163 212
172 iso_pu_bacteria 2967678726 2967682962 212
173 iso_pu_bacteria 2967686174 2967686591 212
174 iso_pu_bacteria 2967693043 2967696080 212
175 iso_pu_bacteria 2967699805 2967699942 212
176 iso_pu_bacteria 2967706974 2967708263 212
177 iso_pu_bacteria 2967714385 2967715860 212
178 iso_pu_bacteria 2967721400 2967722049 212
179 iso_pu_bacteria 2967728569 2967732404 212
180 iso_pu_bacteria 2967735183 2967735467 212
181 iso_pu_bacteria 2967742019 2967743440 212
182 iso_pu_bacteria 2967748971 2967750173 212
183 iso_pu_bacteria 2967755722 2967760029 212
184 iso_pu_bacteria 2967762386 2967769103 212
185 iso_pu_bacteria 2967769361 2967774508 212
186 iso_pu_bacteria 2967775926 2967777493 212
187 iso_pu_bacteria 2970019648 2970025014 212
188 iso_pu_bacteria 2970026789 2970029394 212
189 iso_pu_bacteria 2970033650 2970040696 212
190 iso_pu_bacteria 2970040964 2970041805 212
191 iso_pu_bacteria 2970047711 2970049503 212
192 iso_pu_bacteria 2970054988 2970061013 212
193 iso_pu_bacteria 2970061556 2970068104 212
194 iso_pu_bacteria 2970068827 2970069402 212
195 iso_pu_bacteria 2970076120 2970082612 212
196 iso_pu_bacteria 2970082768 2970084210 212
197 iso_pu_bacteria 2970088815 2970095458 212
198 iso_pu_bacteria 2970095765 2970099040 212
199 iso_pu_bacteria 2970102677 2970108786 212
200 iso_pu_bacteria 2970109326 2970115213 212
201 iso_pu_bacteria 2970116247 2970119275 212
202 iso_pu_bacteria 2970122695 2970126382 212
203 iso_pu_bacteria 2970129317 2970134255 212
204 iso_pu_bacteria 2970136068 2970137432 212
205 iso_pu_bacteria 2970143518 2970144625 212
206 iso_pu_bacteria 2970149975 2970155690 212
207 iso_pu_bacteria 2970156795 2970158292 212
208 iso_pu_bacteria 2970164137 2970165935 212
209 iso_pu_bacteria 2970170962 2970173303 212
210 iso_pu_bacteria 2970177841 2970179796 212
211 iso_pu_bacteria 2970184632 2970186482 212
212 iso_pu_bacteria 2970191845 2970194466 212
213 iso_pu_bacteria 2977516862 2977520740 212
214 iso_pu_bacteria 2977523885 2977530128 212
215 iso_pu_bacteria 2977530762 2977532394 212
216 iso_pu_bacteria 2977537788 2977540925 212
217 iso_pu_bacteria 2977544691 2977551167 212
218 iso_pu_bacteria 2977551784 2977556805 212
219 iso_pu_bacteria 2977558990 2977565554 212
220 iso_pu_bacteria 2977565890 2977569067 212
221 iso_pu_bacteria 2977572785 2977578054 212
222 iso_pu_bacteria 2977579622 2977579668 212
223 iso_pu_bacteria 648276728 648735765 212
224 iso_pu_bacteria 8003992118 8003995051 212
225 iso_pu_bacteria 8003999396 8004002813 212
226 3300009978 Ga0105148_100372 Ga0105148_1003721 213
227 3300014326 Ga0157380_10164602 Ga0157380_101646022 213
228 3300028379 Ga0268266_10869374 Ga0268266_108693741 213
229 3300037418 Ga0395900_0024780 Ga0395900_0024780_850_1524 213
230 3300037471 Ga0395905_0000054 Ga0395905_0000054_33720_34394 213
231 iso_pu_bacteria 2509276021 2509390204 213
232 iso_pu_bacteria 2509276033 2509447505 213
233 iso_pu_bacteria 2510065019 2510134330 213
234 iso_pu_bacteria 2510461076 2510895763 213
235 iso_pu_bacteria 2510917028 2511186503 213
236 iso_pu_bacteria 2511231004 2511254415 213
237 iso_pu_bacteria 2511231006 2511267420 213
238 iso_pu_bacteria 2511231007 2511274272 213
239 iso_pu_bacteria 2511231008 2511276431 213
240 iso_pu_bacteria 2511231010 2511291877 213
241 iso_pu_bacteria 2511231011 2511294974 213
242 iso_pu_bacteria 2511231012 2511304410 213
243 iso_pu_bacteria 2511231015 2511319173 213
244 iso_pu_bacteria 2511231016 2511329297 213
245 iso_pu_bacteria 2511231017 2511333090 213
246 iso_pu_bacteria 2511231018 2511336701 213
247 iso_pu_bacteria 2511231019 2511341933 213
248 iso_pu_bacteria 2511231020 2511350886 213
249 iso_pu_bacteria 2511231021 2511356637 213
250 iso_pu_bacteria 2511231022 2511364942 213
251 iso_pu_bacteria 2511231023 2511370113 213
252 iso_pu_bacteria 2511231031 2511412257 213
253 iso_pu_bacteria 2511231156 2511823388 213
254 iso_pu_bacteria 2512047018 2512326472 213
255 iso_pu_bacteria 2513237084 2513567549 213
256 iso_pu_bacteria 2513237085 2513577887 213
257 iso_pu_bacteria 2513237088 2513598334 213
258 iso_pu_bacteria 2513237093 2513631968 213
259 iso_pu_bacteria 2513237103 2513708003 213
260 iso_pu_bacteria 2513237144 2513910566 213
261 iso_pu_bacteria 2513237146 2513928008 213
262 iso_pu_bacteria 2513237162 2514017926 213
263 iso_pu_bacteria 2515075009 2515113501 213
264 iso_pu_bacteria 2515154113 2515635213 213
265 iso_pu_bacteria 2515154114 2515643877 213
266 iso_pu_bacteria 2515154116 2515654967 213
267 iso_pu_bacteria 2515154134 2515739853 213
268 iso_pu_bacteria 2516653077 2517037107 213
269 iso_pu_bacteria 2516653085 2517077452 213
270 iso_pu_bacteria 2517093000 2517096218 213
271 iso_pu_bacteria 2517287029 2517408078 213
272 iso_pu_bacteria 2534681796 2535517309 213
273 iso_pu_bacteria 2554235003 2554248594 213
274 iso_pu_bacteria 2554235231 2555244578 213
275 iso_pu_bacteria 2558860242 2559295682 213
276 iso_pu_bacteria 2582580891 2583790641 213
277 iso_pu_bacteria 2585427526 2585524879 213
278 iso_pu_bacteria 2585427528 2585538566 213
279 iso_pu_bacteria 2585427593 2585836517 213
280 iso_pu_bacteria 2585427594 2585847785 213
281 iso_pu_bacteria 2597489887 2597856596 213
282 iso_pu_bacteria 2597489888 2597862697 213
283 iso_pu_bacteria 2597489889 2597868534 213
284 iso_pu_bacteria 2599185160 2599355413 213
285 iso_pu_bacteria 2599185161 2599360768 213
286 iso_pu_bacteria 2599185162 2599367090 213
287 iso_pu_bacteria 2599185163 2599373880 213
288 iso_pu_bacteria 2599185164 2599380519 213
289 iso_pu_bacteria 2599185165 2599386966 213
290 iso_pu_bacteria 2599185166 2599392738 213
291 iso_pu_bacteria 2599185167 2599396704 213
292 iso_pu_bacteria 2599185168 2599404505 213
293 iso_pu_bacteria 2599185170 2599421019 213
294 iso_pu_bacteria 2599185179 2599448690 213
295 iso_pu_bacteria 2599185181 2599462247 213
296 iso_pu_bacteria 2599185182 2599466711 213
297 iso_pu_bacteria 2599185185 2599483154 213
298 iso_pu_bacteria 2599185186 2599490661 213
299 iso_pu_bacteria 2599185189 2599507681 213
300 iso_pu_bacteria 2599185190 2599511550 213
301 iso_pu_bacteria 2599185191 2599517501 213
302 iso_pu_bacteria 2599185212 2599615480 213
303 iso_pu_bacteria 2599185257 2599805055 213
304 iso_pu_bacteria 2599185288 2599880014 213
305 iso_pu_bacteria 2599185290 2599890925 213
306 iso_pu_bacteria 2599185302 2599945494 213
307 iso_pu_bacteria 2599185303 2599948515 213
308 iso_pu_bacteria 2599185304 2599956612 213
309 iso_pu_bacteria 2599185306 2599968362 213
310 iso_pu_bacteria 2599185307 2599974087 213
311 iso_pu_bacteria 2599185308 2599979549 213
312 iso_pu_bacteria 2599185309 2599985466 213
313 iso_pu_bacteria 2599185310 2599991783 213
314 iso_pu_bacteria 2599185312 2600002420 213
315 iso_pu_bacteria 2599185314 2600013361 213
316 iso_pu_bacteria 2599185316 2600026095 213
317 iso_pu_bacteria 2599185317 2600031739 213
318 iso_pu_bacteria 2599185318 2600036381 213
319 iso_pu_bacteria 2599185320 2600049953 213
320 iso_pu_bacteria 2599185322 2600061896 213
321 iso_pu_bacteria 2599185325 2600080073 213
322 iso_pu_bacteria 2599185356 2600214869 213
323 iso_pu_bacteria 2600254930 2600361490 213
324 iso_pu_bacteria 2600254931 2600363768 213
325 iso_pu_bacteria 2600255296 2601691268 213
326 iso_pu_bacteria 2600255313 2601774426 213
327 iso_pu_bacteria 2600255318 2601799899 213
328 iso_pu_bacteria 2603880185 2606074302 213
329 iso_pu_bacteria 2603880199 2606127165 213
330 iso_pu_bacteria 2619619299 2621301173 213
331 iso_pu_bacteria 2623620443 2624479182 213
332 iso_pu_bacteria 2623620446 2624493818 213
333 iso_pu_bacteria 2643221565 2643845215 213
334 iso_pu_bacteria 2643221571 2643873084 213
335 iso_pu_bacteria 2643221589 2643951980 213
336 iso_pu_bacteria 2643221602 2644024261 213
337 iso_pu_bacteria 2643221633 2644187544 213
338 iso_pu_bacteria 2643221643 2644237973 213
339 iso_pu_bacteria 2643221650 2644283561 213
340 iso_pu_bacteria 2643221693 2644523351 213
341 iso_pu_bacteria 2643221713 2644624360 213
342 iso_pu_bacteria 2667528171 2671098015 213
343 iso_pu_bacteria 2667528176 2671127774 213
344 iso_pu_bacteria 2671180172 2671768211 213
345 iso_pu_bacteria 2675903515 2678262314 213
346 iso_pu_bacteria 2713897149 2715759729 213
347 iso_pu_bacteria 2718217927 2719386804 213
348 iso_pu_bacteria 2718218199 2720492962 213
349 iso_pu_bacteria 2718218423 2721400527 213
350 iso_pu_bacteria 2721755556 2723027857 213
351 iso_pu_bacteria 2721755607 2723247568 213
352 iso_pu_bacteria 2721755809 2724039340 213
353 iso_pu_bacteria 2721755823 2724111200 213
354 iso_pu_bacteria 2724679232 2725950270 213
355 iso_pu_bacteria 2728369352 2730108793 213
356 iso_pu_bacteria 2738541265 2738674058 213
357 iso_pu_bacteria 2738541282 2738752451 213
358 iso_pu_bacteria 2738541293 2738803292 213
359 iso_pu_bacteria 2738541294 2738809480 213
360 iso_pu_bacteria 2738541303 2738861492 213
361 iso_pu_bacteria 2738541309 2738896840 213
362 iso_pu_bacteria 2738541333 2739033205 213
363 iso_pu_bacteria 2738543004 2739198698 213
364 iso_pu_bacteria 2738543015 2739256538 213
365 iso_pu_bacteria 2738543025 2739314354 213
366 iso_pu_bacteria 2740892503 2743736020 213
367 iso_pu_bacteria 2744054620 2745008661 213
368 iso_pu_bacteria 2765235942 2766066248 213
369 iso_pu_bacteria 2773857670 2774121412 213
370 iso_pu_bacteria 2773857673 2774136046 213
371 iso_pu_bacteria 2784132063 2784260115 213
372 iso_pu_bacteria 2784132072 2784315700 213
373 iso_pu_bacteria 2791355256 2793294050 213
374 iso_pu_bacteria 2791355259 2793314276 213
375 iso_pu_bacteria 2791355261 2793328832 213
376 iso_pu_bacteria 2791355262 2793334810 213
377 iso_pu_bacteria 2791355265 2793351412 213
378 iso_pu_bacteria 2791355266 2793362388 213
379 iso_pu_bacteria 2791355267 2793367510 213
380 iso_pu_bacteria 2802429633 2806045348 213
381 iso_pu_bacteria 2802429634 2806049859 213
382 iso_pu_bacteria 2802429635 2806056697 213
383 iso_pu_bacteria 2802429636 2806064078 213
384 iso_pu_bacteria 2802429637 2806071347 213
385 iso_pu_bacteria 2808606361 2808856796 213
386 iso_pu_bacteria 2808606376 2808924077 213
387 iso_pu_bacteria 2808606377 2808929291 213
388 iso_pu_bacteria 2808606378 2808936755 213
389 iso_pu_bacteria 2808606380 2808946018 213
390 iso_pu_bacteria 2808606381 2808951601 213
391 iso_pu_bacteria 2808606382 2808957403 213
392 iso_pu_bacteria 2808606383 2808965183 213
393 iso_pu_bacteria 2808606385 2808975630 213
394 iso_pu_bacteria 2808606387 2808987585 213
395 iso_pu_bacteria 2808606388 2808990731 213
396 iso_pu_bacteria 2808606389 2809000075 213
397 iso_pu_bacteria 2808606445 2809216134 213
398 iso_pu_bacteria 2816332298 2817489473 213
399 iso_pu_bacteria 2818991456 2819654604 213
400 iso_pu_bacteria 2818991464 2819703100 213
401 iso_pu_bacteria 2838016132 2838019968 213
402 iso_pu_bacteria 2838035591 2838041379 213
403 iso_pu_bacteria 2838042994 2838045579 213
404 iso_pu_bacteria 2838048938 2838052778 213
405 iso_pu_bacteria 2838061910 2838065034 213
406 iso_pu_bacteria 2838068647 2838069758 213
407 iso_pu_bacteria 2838661181 2838665772 213
408 iso_pu_bacteria 2838680041 2838683059 213
409 iso_pu_bacteria 2838686498 2838686671 213
410 iso_pu_bacteria 2838694306 2838697997 213
411 iso_pu_bacteria 2838707686 2838711112 213
412 iso_pu_bacteria 2838729681 2838734913 213
413 iso_pu_bacteria 2838742623 2838747528 213
414 iso_pu_bacteria 2841851746 2841854500 213
415 iso_pu_bacteria 2841864319 2841867357 213
416 iso_pu_bacteria 2842077413 2842079287 213
417 iso_pu_bacteria 2842110456 2842115608 213
418 iso_pu_bacteria 2842118031 2842118202 213
419 iso_pu_bacteria 2842156927 2842158481 213
420 iso_pu_bacteria 2842163707 2842169075 213
421 iso_pu_bacteria 2842180545 2842182095 213
422 iso_pu_bacteria 2842205361 2842209429 213
423 iso_pu_bacteria 2842217011 2842218332 213
424 iso_pu_bacteria 2842229732 2842229905 213
425 iso_pu_bacteria 2842237096 2842240116 213
426 iso_pu_bacteria 2842243621 2842243794 213
427 iso_pu_bacteria 2842257432 2842258121 213
428 iso_pu_bacteria 2842264693 2842267687 213
429 iso_pu_bacteria 2842271015 2842271791 213
430 iso_pu_bacteria 2842278818 2842282883 213
431 iso_pu_bacteria 2842285085 2842285222 213
432 iso_pu_bacteria 2842291075 2842292949 213
433 iso_pu_bacteria 2842304105 2842305402 213
434 iso_pu_bacteria 2842311132 2842314125 213
435 iso_pu_bacteria 2842341865 2842347673 213
436 iso_pu_bacteria 2842363717 2842368675 213
437 iso_pu_bacteria 2842370503 2842373689 213
438 iso_pu_bacteria 2842377471 2842379346 213
439 iso_pu_bacteria 2842384541 2842384713 213
440 iso_pu_bacteria 2842395702 2842400618 213
441 iso_pu_bacteria 2842402390 2842402580 213
442 iso_pu_bacteria 2842409023 2842410049 213
443 iso_pu_bacteria 2842415677 2842416697 213
444 iso_pu_bacteria 2842422224 2842423372 213
445 iso_pu_bacteria 2842428310 2842430331 213
446 iso_pu_bacteria 2842434925 2842436857 213
447 iso_pu_bacteria 2842441272 2842443301 213
448 iso_pu_bacteria 2842447887 2842449166 213
449 iso_pu_bacteria 2842462802 2842467203 213
450 iso_pu_bacteria 2842469257 2842471273 213
451 iso_pu_bacteria 2842826826 2842830217 213
452 iso_pu_bacteria 2842832357 2842832997 213
453 iso_pu_bacteria 2842837860 2842839969 213
454 iso_pu_bacteria 2842854478 2842858923 213
455 iso_pu_bacteria 2844454524 2844457969 213
456 iso_pu_bacteria 2852612431 2852615128 213
457 iso_pu_bacteria 2852657418 2852658654 213
458 iso_pu_bacteria 2852667396 2852670096 213
459 iso_pu_bacteria 2854896431 2854900427 213
460 iso_pu_bacteria 2854916844 2854917518 213
461 iso_pu_bacteria 2857516855 2857517045 213
462 iso_pu_bacteria 2860339153 2860340311 213
463 iso_pu_bacteria 2860867994 2860869402 213
464 iso_pu_bacteria 2878029506 2878031142 213
465 iso_pu_bacteria 2880230671 2880232039 213
466 iso_pu_bacteria 2899845264 2899847315 213
467 iso_pu_bacteria 2904518522 2904522426 213
468 iso_pu_bacteria 2904550169 2904551569 213
469 iso_pu_bacteria 2908446538 2908448304 213
470 iso_pu_bacteria 2917070673 2917072181 213
471 iso_pu_bacteria 2919063839 2919064343 213
472 iso_pu_bacteria 2919385768 2919386168 213
473 iso_pu_bacteria 2919456309 2919462061 213
474 iso_pu_bacteria 2919487758 2919491750 213
475 iso_pu_bacteria 2919697872 2919700276 213
476 iso_pu_bacteria 2923153595 2923155030 213
477 iso_pu_bacteria 2926760298 2926762469 213
478 iso_pu_bacteria 2929144301 2929145731 213
479 iso_pu_bacteria 2929189879 2929191378 213
480 iso_pu_bacteria 2931390751 2931392391 213
481 iso_pu_bacteria 2931396565 2931399783 213
482 iso_pu_bacteria 2933570622 2933571209 213
483 iso_pu_bacteria 2933586486 2933592023 213
484 iso_pu_bacteria 2933599457 2933600565 213
485 iso_pu_bacteria 2935353572 2935354352 213
486 iso_pu_bacteria 2935894831 2935896619 213
487 iso_pu_bacteria 2935901341 2935901517 213
488 iso_pu_bacteria 2936367885 2936371659 213
489 iso_pu_bacteria 2936375103 2936378834 213
490 iso_pu_bacteria 2939636861 2939637749 213
491 iso_pu_bacteria 2945928738 2945929193 213
492 iso_pu_bacteria 2945961074 2945961665 213
493 iso_pu_bacteria 2946006987 2946011432 213
494 iso_pu_bacteria 2947233263 2947236206 213
495 iso_pu_bacteria 2969304461 2969305968 213
496 iso_pu_bacteria 2974289157 2974292445 213
497 iso_pu_bacteria 2979089926 2979092262 213
498 iso_pu_bacteria 2979095461 2979100349 213
499 iso_pu_bacteria 2984286254 2984291010 213
500 iso_pu_bacteria 2988728565 2988733270 213
501 iso_pu_bacteria 2996887358 2996892608 213
502 iso_pu_bacteria 2998139840 2998141376 213
503 iso_pu_bacteria 3007395558 3007400560 213
504 iso_pu_bacteria 3007511990 3007512755 213
505 iso_pu_bacteria 3007614139 3007616219 213
506 iso_pu_bacteria 3007619802 3007620469 213
507 iso_pu_bacteria 3007718800 3007723028 213
508 iso_pu_bacteria 3007855910 3007855970 213
509 iso_pu_bacteria 3007861166 3007863392 213
510 iso_pu_bacteria 637000220 637318775 213
511 iso_pu_bacteria 639633055 639649548 213
512 iso_pu_bacteria 650716007 650740894 213
513 iso_pu_bacteria 8005258706 8005264765 213
514 iso_pu_bacteria 8005275841 8005281614 213
515 iso_pu_bacteria 8005282627 8005284422 213
516 iso_pu_bacteria 8005289223 8005289681 213
517 iso_pu_bacteria 8005301065 8005303525 213
518 iso_pu_bacteria 8005307578 8005314037 213
519 iso_pu_bacteria 8005321885 8005327135 213
520 iso_pu_bacteria 8005376324 8005381308 213
521 iso_pu_bacteria 8005430974 8005433429 213
522 iso_pu_bacteria 8005460587 8005464185 213
523 iso_pu_bacteria 8005497431 8005501289 213
524 iso_pu_bacteria 8005542996 8005546133 213
525 iso_pu_bacteria 8005556819 8005561598 213
526 iso_pu_bacteria 8005563573 8005568373 213
527 iso_pu_bacteria 8005570704 8005573086 213
528 iso_pu_bacteria 8005619151 8005622649 213
529 iso_pu_bacteria 8005668836 8005672708 213
530 iso_pu_bacteria 8005688590 8005691698 213
531 iso_pu_bacteria 8005695170 8005696830 213
532 iso_pu_bacteria 8015687852 8015689252 213
533 iso_pu_bacteria 8018163183 8018164187 213
534 iso_pu_bacteria 8018176218 8018179589 213
535 iso_pu_bacteria 8019775933 8019776931 213
536 iso_pu_bacteria 8023680758 8023682792 213
537 iso_pu_bacteria 8024479707 8024486147 213
538 iso_pu_bacteria 8029995093 8029999374 213
539 iso_pu_bacteria 8054285046 8054288760 213
540 iso_pu_bacteria 8054347763 8054351827 213
541 iso_pu_bacteria 8054503363 8054504942 213
542 iso_pu_bacteria 8055770955 8055772368 213
543 iso_pu_bacteria 8055817908 8055819415 213
544 iso_pu_bacteria 8056125926 8056127416 213
545 iso_pu_bacteria 8056143049 8056147545 213
546 iso_pu_bacteria 8056148874 8056149562 213
547 iso_pu_bacteria 8056155041 8056159393 213
548 iso_pu_bacteria 8056166840 8056169684 213
549 iso_pu_bacteria 8056172158 8056175794 213
550 iso_pu_bacteria 8056375014 8056376982 213
551 iso_pu_bacteria 8056382006 8056387302 213
552 iso_pu_bacteria 8056569372 8056570037 213
553 iso_pu_bacteria 8057874678 8057881964 213
554 3300013297 Ga0157378_10159209 Ga0157378_101592091 214
555 3300037312 Ga0395899_0000025 Ga0395899_0000025_166599_167276 214
556 3300037418 Ga0395900_0112112 Ga0395900_0112112_181_858 214
557 3300046525 Ga0495663_0016229 Ga0495663_0016229_151_843 214
558 iso_pu_bacteria 2995392953 2995395619 214
559 3300037471 Ga0395905_0068285 Ga0395905_0068285_1829_2533 215
560 3300001904 JGI24736J21556_1001222 JGI24736J21556_10012225 216
561 3300001915 JGI24741J21665_1000167 JGI24741J21665_100016710 216
562 3300001989 JGI24739J22299_10012934 JGI24739J22299_100129344 216
563 3300001990 JGI24737J22298_10001381 JGI24737J22298_100013819 216
564 3300002067 JGI24735J21928_10012571 JGI24735J21928_100125712 216
565 3300002075 JGI24738J21930_10005392 JGI24738J21930_100053923 216
566 3300002075 JGI24738J21930_10022840 JGI24738J21930_100228402 216
567 3300002773 JGI25152J39213_1005349 JGI25152J39213_10053492 216
568 3300002773 JGI25152J39213_1007474 JGI25152J39213_10074742 216
569 3300002774 JGI25150J39212_1000024 JGI25150J39212_100002442 216
570 3300002774 JGI25150J39212_1008934 JGI25150J39212_10089342 216
571 3300002987 JGI25159J45721_1000092 JGI25159J45721_10000926 216
572 3300002987 JGI25159J45721_1000403 JGI25159J45721_100040316 216
573 3300003187 JGI25151J46595_10000027 JGI25151J46595_10000027107 216
574 3300003187 JGI25151J46595_10000634 JGI25151J46595_1000063420 216
575 3300003215 JGI25153J46596_10003652 JGI25153J46596_100036524 216
576 3300003215 JGI25153J46596_10045296 JGI25153J46596_100452962 216
577 3300003320 rootH2_10145754 rootH2_101457542 216
578 3300003323 rootH1_10113875 rootH1_101138754 216
579 3300003354 JGI25160J50197_1000134 JGI25160J50197_100013422 216
580 3300003354 JGI25160J50197_1003062 JGI25160J50197_10030625 216
581 3300003374 JGI25161J50226_1000116 JGI25161J50226_100011636 216
582 3300003374 JGI25161J50226_1002066 JGI25161J50226_10020661 216
583 3300003771 Ga0055526_1002223 Ga0055526_100222312 216
584 3300003771 Ga0055526_1006923 Ga0055526_10069237 216
585 3300003771 Ga0055526_1008732 Ga0055526_10087322 216
586 3300003775 Ga0055524_1004804 Ga0055524_10048042 216
587 3300003775 Ga0055524_1007061 Ga0055524_10070613 216
588 3300003775 Ga0055524_1014106 Ga0055524_10141062 216
589 3300003781 Ga0055536_1012400 Ga0055536_10124003 216
590 3300003790 Ga0055528_1000247 Ga0055528_100024746 216
591 3300003790 Ga0055528_1005275 Ga0055528_10052751 216
592 3300003790 Ga0055528_1019047 Ga0055528_10190471 216
593 3300003790 Ga0055528_1021132 Ga0055528_10211322 216
594 3300003790 Ga0055528_1021545 Ga0055528_10215452 216
595 3300003791 Ga0055530_10024224 Ga0055530_100242242 216
596 3300003792 Ga0055540_1000830 Ga0055540_10008307 216
597 3300003792 Ga0055540_1015811 Ga0055540_10158112 216
598 3300003792 Ga0055540_1018012 Ga0055540_10180121 216
599 3300003794 Ga0055531_10027290 Ga0055531_100272902 216
600 3300004625 Ga0055543_1001164 Ga0055543_10011646 216
601 3300004625 Ga0055543_1002380 Ga0055543_10023808 216
602 3300005262 Ga0065165_1000196 Ga0065165_100019656 216
603 3300005262 Ga0065165_1016239 Ga0065165_10162392 216
604 3300005289 Ga0065704_10086396 Ga0065704_100863961 216
605 3300005327 Ga0070658_10074878 Ga0070658_100748782 216
606 3300005329 Ga0070683_100369615 Ga0070683_1003696152 216
607 3300005331 Ga0070670_100033711 Ga0070670_1000337112 216
608 3300005347 Ga0070668_100062322 Ga0070668_1000623222 216
609 3300005353 Ga0070669_100077379 Ga0070669_1000773792 216
610 3300005354 Ga0070675_100281628 Ga0070675_1002816282 216
611 3300005355 Ga0070671_100036784 Ga0070671_1000367842 216
612 3300005366 Ga0070659_100014711 Ga0070659_1000147114 216
613 3300005366 Ga0070659_100019829 Ga0070659_1000198296 216
614 3300005367 Ga0070667_100101850 Ga0070667_1001018503 216
615 3300005455 Ga0070663_100046192 Ga0070663_1000461923 216
616 3300005457 Ga0070662_100000662 Ga0070662_1000006625 216
617 3300005457 Ga0070662_100123460 Ga0070662_1001234604 216
618 3300005548 Ga0070665_100029050 Ga0070665_1000290506 216
619 3300005564 Ga0070664_100006129 Ga0070664_1000061293 216
620 3300005578 Ga0068854_100279464 Ga0068854_1002794642 216
621 3300005614 Ga0068856_100380194 Ga0068856_1003801942 216
622 3300005618 Ga0068864_100210803 Ga0068864_1002108032 216
623 3300006038 Ga0075365_10000894 Ga0075365_1000089411 216
624 3300006038 Ga0075365_10017583 Ga0075365_100175833 216
625 3300006042 Ga0075368_10001025 Ga0075368_1000102510 216
626 3300006042 Ga0075368_10096523 Ga0075368_100965231 216
627 3300006048 Ga0075363_100093450 Ga0075363_1000934501 216
628 3300006177 Ga0075362_10000179 Ga0075362_100001792 216
629 3300006177 Ga0075362_10001873 Ga0075362_100018732 216
630 3300006177 Ga0075362_10072251 Ga0075362_100722511 216
631 3300006177 Ga0075362_10121585 Ga0075362_101215852 216
632 3300006178 Ga0075367_10024658 Ga0075367_100246582 216
633 3300006178 Ga0075367_10479250 Ga0075367_104792501 216
634 3300006186 Ga0075369_10005696 Ga0075369_100056964 216
635 3300006186 Ga0075369_10011194 Ga0075369_100111943 216
636 3300006195 Ga0075366_10029897 Ga0075366_100298973 216
637 3300006195 Ga0075366_10359574 Ga0075366_103595742 216
638 3300006237 Ga0097621_100228956 Ga0097621_1002289563 216
639 3300006353 Ga0075370_10057011 Ga0075370_100570112 216
640 3300006946 Ga0079104_1001826 Ga0079104_100182611 216
641 3300009011 Ga0105251_10022498 Ga0105251_100224982 216
642 3300009011 Ga0105251_10025900 Ga0105251_100259003 216
643 3300009036 Ga0105244_10120405 Ga0105244_101204052 216
644 3300009093 Ga0105240_10371767 Ga0105240_103717671 216
645 3300009148 Ga0105243_10010255 Ga0105243_100102558 216
646 3300009174 Ga0105241_10001920 Ga0105241_100019207 216
647 3300009177 Ga0105248_10549722 Ga0105248_105497222 216
648 3300009553 Ga0105249_10015257 Ga0105249_100152574 216
649 3300009765 Ga0123341_1001576 Ga0123341_10015762 216
650 3300009766 Ga0123342_1011000 Ga0123342_10110002 216
651 3300010375 Ga0105239_10357701 Ga0105239_103577013 216
652 3300011119 Ga0105246_10000345 Ga0105246_100003453 216
653 3300011119 Ga0105246_10091865 Ga0105246_100918652 216
654 3300011119 Ga0105246_10150925 Ga0105246_101509253 216
655 3300012490 Ga0157322_1000493 Ga0157322_10004932 216
656 3300013100 Ga0157373_10013541 Ga0157373_100135415 216
657 3300013100 Ga0157373_10090502 Ga0157373_100905023 216
658 3300013100 Ga0157373_10307874 Ga0157373_103078742 216
659 3300013102 Ga0157371_10000165 Ga0157371_100001659 216
660 3300013104 Ga0157370_10000338 Ga0157370_1000033838 216
661 3300013104 Ga0157370_10010162 Ga0157370_100101626 216
662 3300013249 Ga0171463_1014 Ga0171463_101437 216
663 3300013307 Ga0157372_10748645 Ga0157372_107486451 216
664 3300015690 Ga0183363_1028 Ga0183363_102824 216
665 3300017792 Ga0163161_10004616 Ga0163161_100046164 216
666 3300022739 Ga0228711_1000003 Ga0228711_1000003226 216
667 3300022740 Ga0228710_1000003 Ga0228710_1000003232 216
668 3300025208 Ga0209436_101037 Ga0209436_1010374 216
669 3300025245 Ga0207425_1000043 Ga0207425_1000043105 216
670 3300025245 Ga0207425_1009366 Ga0207425_10093662 216
671 3300025258 Ga0209129_1000072 Ga0209129_100007289 216
672 3300025258 Ga0209129_1000456 Ga0209129_100045611 216
673 3300025258 Ga0209129_1009702 Ga0209129_10097021 216
674 3300025273 Ga0209673_1000025 Ga0209673_100002546 216
675 3300025273 Ga0209673_1000112 Ga0209673_1000112164 216
676 3300025273 Ga0209673_1001826 Ga0209673_10018268 216
677 3300025273 Ga0209673_1003534 Ga0209673_10035347 216
678 3300025273 Ga0209673_1013139 Ga0209673_10131393 216
679 3300025273 Ga0209673_1044411 Ga0209673_10444111 216
680 3300025284 Ga0209130_1000198 Ga0209130_100019837 216
681 3300025292 Ga0209676_1004562 Ga0209676_10045623 216
682 3300025294 Ga0209025_1000120 Ga0209025_100012089 216
683 3300025294 Ga0209025_1000339 Ga0209025_100033954 216
684 3300025294 Ga0209025_1000386 Ga0209025_100038618 216
685 3300025294 Ga0209025_1011767 Ga0209025_10117676 216
686 3300025294 Ga0209025_1030765 Ga0209025_10307651 216
687 3300025295 Ga0209564_1000353 Ga0209564_100035336 216
688 3300025295 Ga0209564_1000874 Ga0209564_10008741 216
689 3300025295 Ga0209564_1002270 Ga0209564_100227014 216
690 3300025295 Ga0209564_1003966 Ga0209564_10039664 216
691 3300025297 Ga0209758_1000111 Ga0209758_100011189 216
692 3300025297 Ga0209758_1000254 Ga0209758_100025460 216
693 3300025297 Ga0209758_1015500 Ga0209758_10155001 216
694 3300025298 Ga0209050_1010702 Ga0209050_10107024 216
695 3300025299 Ga0209256_1000368 Ga0209256_100036865 216
696 3300025299 Ga0209256_1000451 Ga0209256_10004512 216
697 3300025299 Ga0209256_1000884 Ga0209256_10008849 216
698 3300025299 Ga0209256_1001144 Ga0209256_10011446 216
699 3300025299 Ga0209256_1007416 Ga0209256_10074163 216
700 3300025299 Ga0209256_1017286 Ga0209256_10172862 216
701 3300025302 Ga0207426_1000048 Ga0207426_1000048342 216
702 3300025302 Ga0207426_1000208 Ga0207426_100020880 216
703 3300025302 Ga0207426_1005241 Ga0207426_10052418 216
704 3300025303 Ga0209051_1000176 Ga0209051_100017691 216
705 3300025303 Ga0209051_1000756 Ga0209051_100075620 216
706 3300025303 Ga0209051_1006644 Ga0209051_10066444 216
707 3300025303 Ga0209051_1013500 Ga0209051_10135006 216
708 3300025303 Ga0209051_1023589 Ga0209051_10235893 216
709 3300025304 Ga0209257_1011520 Ga0209257_10115202 216
710 3300025321 Ga0207656_10037759 Ga0207656_100377593 216
711 3300025904 Ga0207647_10013414 Ga0207647_100134144 216
712 3300025904 Ga0207647_10332224 Ga0207647_103322241 216
713 3300025909 Ga0207705_10163837 Ga0207705_101638372 216
714 3300025911 Ga0207654_10064158 Ga0207654_100641582 216
715 3300025913 Ga0207695_10045888 Ga0207695_100458885 216
716 3300025919 Ga0207657_10123715 Ga0207657_101237152 216
717 3300025923 Ga0207681_10067880 Ga0207681_100678802 216
718 3300025923 Ga0207681_10152723 Ga0207681_101527232 216
719 3300025924 Ga0207694_10010447 Ga0207694_100104472 216
720 3300025931 Ga0207644_10076669 Ga0207644_100766692 216
721 3300025932 Ga0207690_10034961 Ga0207690_100349612 216
722 3300025932 Ga0207690_10060297 Ga0207690_100602974 216
723 3300025933 Ga0207706_10000980 Ga0207706_1000098024 216
724 3300025933 Ga0207706_10014449 Ga0207706_100144497 216
725 3300025933 Ga0207706_10014839 Ga0207706_100148396 216
726 3300025949 Ga0207667_10118741 Ga0207667_101187414 216
727 3300025961 Ga0207712_10022659 Ga0207712_100226591 216
728 3300025972 Ga0207668_10257831 Ga0207668_102578313 216
729 3300025981 Ga0207640_10016756 Ga0207640_100167564 216
730 3300026041 Ga0207639_10001981 Ga0207639_1000198111 216
731 3300026067 Ga0207678_10001506 Ga0207678_1000150611 216
732 3300026067 Ga0207678_10084061 Ga0207678_100840613 216
733 3300026078 Ga0207702_10336123 Ga0207702_103361232 216
734 3300026116 Ga0207674_10016238 Ga0207674_100162388 216
735 3300026142 Ga0207698_10115719 Ga0207698_101157192 216
736 3300027111 Ga0209281_1000081 Ga0209281_1000081226 216
737 3300027111 Ga0209281_1000141 Ga0209281_1000141115 216
738 3300027666 Ga0209282_1000036 Ga0209282_100003612 216
739 3300027866 Ga0209813_10073095 Ga0209813_100730951 216
740 3300028794 Ga0307515_10000691 Ga0307515_100006917 216
741 3300028794 Ga0307515_10101588 Ga0307515_101015882 216
742 3300031456 Ga0307513_10003481 Ga0307513_100034814 216
743 3300031456 Ga0307513_10011619 Ga0307513_100116199 216
744 3300031548 Ga0307408_100115798 Ga0307408_1001157982 216
745 3300031691 Ga0316579_10011735 Ga0316579_100117354 216
746 3300031731 Ga0307405_10001049 Ga0307405_100010498 216
747 3300031731 Ga0307405_10186857 Ga0307405_101868571 216
748 3300031911 Ga0307412_10000246 Ga0307412_100002462 216
749 3300031911 Ga0307412_10002548 Ga0307412_100025487 216
750 3300031911 Ga0307412_10177475 Ga0307412_101774752 216
751 3300031967 Ga0315914_1000002 Ga0315914_1000002332 216
752 3300032002 Ga0307416_100157299 Ga0307416_1001572992 216
753 3300032005 Ga0307411_10267088 Ga0307411_102670882 216
754 3300032133 Ga0316583_10003611 Ga0316583_100036114 216
755 3300033430 Ga0315913_1000009 Ga0315913_100000912 216
756 3300033464 Ga0315915_1000005 Ga0315915_1000005332 216
757 3300036647 Ga0316582_0006914 Ga0316582_0006914_1397_2077 216
758 3300036712 Ga0316584_0029608 Ga0316584_0029608_79_759 216
759 3300036712 Ga0316584_0183247 Ga0316584_0183247_306_986 216
760 3300037471 Ga0395905_0000521 Ga0395905_0000521_22607_23320 216
761 3300037471 Ga0395905_0019240 Ga0395905_0019240_5130_5831 216
762 3300037588 Ga0316581_0009120 Ga0316581_0009120_1052_1732 216
763 3300038705 Ga0237819_01643 Ga0237819_01643_310_996 216
764 3300041413 Ga0439465_0002237 Ga0439465_0002237_1637_2338 216
765 3300041456 Ga0451795_0811535 Ga0451795_0811535_292_993 216
766 3300041501 Ga0451845_0821845 Ga0451845_0821845_4505_5206 216
767 3300041503 Ga0451847_0466867 Ga0451847_0466867_88_789 216
768 3300041507 Ga0451851_0182692 Ga0451851_0182692_4412_5113 216
769 3300041511 Ga0451855_0583055 Ga0451855_0583055_3214_3915 216
770 3300041512 Ga0451853_0501375 Ga0451853_0501375_194_895 216
771 3300042006 Ga0439432_003862 Ga0439432_003862_3989_4690 216
772 3300042007 Ga0439449_0005690 Ga0439449_0005690_2727_3428 216
773 3300042007 Ga0439449_0023717 Ga0439449_0023717_366_1091 216
774 3300042015 Ga0439462_0010789 Ga0439462_0010789_1509_2186 216
775 3300044683 Ga0466965_0028532 Ga0466965_0028532_1564_2262 216
776 3300046460 Ga0495638_0022829 Ga0495638_0022829_1035_1736 216
777 3300046460 Ga0495638_0053543 Ga0495638_0053543_514_1215 216
778 3300046474 Ga0495605_0045314 Ga0495605_0045314_601_1302 216
779 3300046492 Ga0495585_0001982 Ga0495585_0001982_1529_2230 216
780 3300046492 Ga0495585_0012019 Ga0495585_0012019_3975_4676 216
781 3300046500 Ga0495596_0194173 Ga0495596_0194173_41_742 216
782 3300046501 Ga0495607_0030981 Ga0495607_0030981_1852_2553 216
783 3300046507 Ga0495606_0047962 Ga0495606_0047962_2031_2732 216
784 3300046512 Ga0495610_0018932 Ga0495610_0018932_2972_3673 216
785 3300046513 Ga0495616_0035167 Ga0495616_0035167_1137_1838 216
786 3300046515 Ga0495620_0021271 Ga0495620_0021271_1281_1982 216
787 3300046515 Ga0495620_0025613 Ga0495620_0025613_511_1212 216
788 3300046515 Ga0495620_0045305 Ga0495620_0045305_371_1072 216
789 3300046518 Ga0495631_0027399 Ga0495631_0027399_641_1342 216
790 3300046519 Ga0495632_0022048 Ga0495632_0022048_2377_3078 216
791 3300046522 Ga0495643_0072378 Ga0495643_0072378_809_1510 216
792 3300046524 Ga0495648_0068667 Ga0495648_0068667_359_1060 216
793 3300046530 Ga0495654_0097510 Ga0495654_0097510_348_1049 216
794 3300046537 Ga0495598_0021693 Ga0495598_0021693_976_1653 216
795 3300046538 Ga0495609_0054787 Ga0495609_0054787_822_1523 216
796 3300046538 Ga0495609_0103295 Ga0495609_0103295_233_934 216
797 3300046542 Ga0495597_0055298 Ga0495597_0055298_891_1592 216
798 3300046558 Ga0495633_0004895 Ga0495633_0004895_5567_6268 216
799 3300046615 Ga0495656_0075848 Ga0495656_0075848_206_907 216
800 3300046616 Ga0495668_0153859 Ga0495668_0153859_42_743 216
801 3300046648 Ga0495611_0263382 Ga0495611_0263382_41_742 216
802 3300046660 Ga0495625_0018986 Ga0495625_0018986_2082_2783 216
803 3300046660 Ga0495625_0031047 Ga0495625_0031047_43_744 216
804 3300046660 Ga0495625_0107606 Ga0495625_0107606_883_1584 216
805 3300046665 Ga0495661_0036716 Ga0495661_0036716_429_1130 216
806 3300046674 Ga0495588_0002321 Ga0495588_0002321_1033_1725 216
807 3300046674 Ga0495588_0014657 Ga0495588_0014657_2122_2823 216
808 3300046691 Ga0495670_0005457 Ga0495670_0005457_2372_3073 216
809 3300046691 Ga0495670_0054408 Ga0495670_0054408_1188_1889 216
810 3300046810 Ga0495660_0006753 Ga0495660_0006753_2368_3069 216
811 3300047323 Ga0495683_0055292 Ga0495683_0055292_791_1492 216
812 3300047443 Ga0495687_010720 Ga0495687_010720_2187_2888 216
813 3300047470 Ga0495681_0008166 Ga0495681_0008166_3406_4098 216
814 3300047472 Ga0495686_0005354 Ga0495686_0005354_7375_8076 216
815 3300047472 Ga0495686_0122466 Ga0495686_0122466_825_1526 216
816 3300048091 Ga0495626_0034066 Ga0495626_0034066_10_711 216
817 3300048905 Ga0496102_0573176 Ga0496102_0573176_292_1002 216
818 3300048906 Ga0496103_0032151 Ga0496103_0032151_483_1193 216
819 3300048907 Ga0496104_0056916 Ga0496104_0056916_2712_3422 216
820 3300048907 Ga0496104_0494010 Ga0496104_0494010_86_778 216
821 3300048908 Ga0496105_0044437 Ga0496105_0044437_2640_3350 216
822 3300048909 Ga0496106_0226385 Ga0496106_0226385_190_900 216
823 3300048911 Ga0496108_0001008 Ga0496108_0001008_11367_12065 216
824 3300048911 Ga0496108_0223073 Ga0496108_0223073_73_768 216
825 3300048911 Ga0496108_0232544 Ga0496108_0232544_308_1018 216
826 3300048912 Ga0496109_0519933 Ga0496109_0519933_215_925 216
827 3300048912 Ga0496109_0672836 Ga0496109_0672836_192_887 216
828 3300048913 Ga0496110_0037288 Ga0496110_0037288_3366_4076 216
829 3300048914 Ga0496111_0195050 Ga0496111_0195050_461_1171 216
830 3300048914 Ga0496111_0280728 Ga0496111_0280728_414_1109 216
831 3300048916 Ga0496113_0054141 Ga0496113_0054141_1739_2449 216
832 3300048917 Ga0496114_0187500 Ga0496114_0187500_494_1204 216
833 3300048919 Ga0496116_0003197 Ga0496116_0003197_12405_13106 216
834 3300048919 Ga0496116_0003578 Ga0496116_0003578_12516_13208 216
835 3300048919 Ga0496116_0026733 Ga0496116_0026733_3333_4034 216
836 3300048919 Ga0496116_0178163 Ga0496116_0178163_132_830 216
837 3300048920 Ga0496117_0000002 Ga0496117_0000002_123903_124595 216
838 3300048920 Ga0496117_0004238 Ga0496117_0004238_3743_4444 216
839 3300048920 Ga0496117_0077700 Ga0496117_0077700_1451_2152 216
840 3300048921 Ga0496118_0001712 Ga0496118_0001712_18332_19024 216
841 3300048921 Ga0496118_0001964 Ga0496118_0001964_14697_15398 216
842 3300048921 Ga0496118_0107433 Ga0496118_0107433_38_739 216
843 3300048922 Ga0496119_0014395 Ga0496119_0014395_483_1193 216
844 3300048923 Ga0496120_0000093 Ga0496120_0000093_22623_23315 216
845 3300048924 Ga0496121_0000065 Ga0496121_0000065_207185_207883 216
846 3300048924 Ga0496121_0002534 Ga0496121_0002534_12229_12930 216
847 3300048924 Ga0496121_0027017 Ga0496121_0027017_3765_4466 216
848 3300048924 Ga0496121_0198900 Ga0496121_0198900_254_964 216
849 3300048925 Ga0496122_0000004 Ga0496122_0000004_521081_521773 216
850 3300048925 Ga0496122_0008704 Ga0496122_0008704_3227_3928 216
851 3300048925 Ga0496122_0012168 Ga0496122_0012168_1688_2383 216
852 3300048925 Ga0496122_0012991 Ga0496122_0012991_2627_3328 216
853 3300048925 Ga0496122_0057805 Ga0496122_0057805_1461_2171 216
854 3300048925 Ga0496122_0232757 Ga0496122_0232757_303_1001 216
855 3300048926 Ga0496123_0000007 Ga0496123_0000007_521081_521773 216
856 3300048926 Ga0496123_0006417 Ga0496123_0006417_10239_10940 216
857 3300048926 Ga0496123_0035386 Ga0496123_0035386_458_1153 216
858 3300048926 Ga0496123_0038163 Ga0496123_0038163_2502_3203 216
859 3300048927 Ga0496124_0001193 Ga0496124_0001193_25812_26507 216
860 3300048927 Ga0496124_0001771 Ga0496124_0001771_6939_7640 216
861 3300048927 Ga0496124_0003788 Ga0496124_0003788_5814_6506 216
862 3300048927 Ga0496124_0089421 Ga0496124_0089421_1604_2305 216
863 3300048927 Ga0496124_0177667 Ga0496124_0177667_708_1418 216
864 3300048928 Ga0496125_0000425 Ga0496125_0000425_22659_23354 216
865 3300048928 Ga0496125_0002655 Ga0496125_0002655_19310_20011 216
866 3300048928 Ga0496125_0042107 Ga0496125_0042107_2453_3163 216
867 3300048928 Ga0496125_0077718 Ga0496125_0077718_242_937 216
868 3300048928 Ga0496125_0106789 Ga0496125_0106789_89_787 216
869 3300048929 Ga0496126_0011280 Ga0496126_0011280_4917_5618 216
870 3300048929 Ga0496126_0079811 Ga0496126_0079811_836_1546 216
871 3300048929 Ga0496126_0145320 Ga0496126_0145320_1048_1740 216
872 3300048929 Ga0496126_0268818 Ga0496126_0268818_552_1250 216
873 3300049459 Ga0495678_023893 Ga0495678_023893_652_1353 216
874 3300049570 Ga0501033_0224335 Ga0501033_0224335_139_828 216
875 3300049571 Ga0501034_0160607 Ga0501034_0160607_37_726 216
876 3300049571 Ga0501034_0197078 Ga0501034_0197078_1098_1790 216
877 3300049573 Ga0501037_0100104 Ga0501037_0100104_962_1651 216
878 3300049574 Ga0501038_0030755 Ga0501038_0030755_529_1218 216
879 3300049575 Ga0501039_0032247 Ga0501039_0032247_2650_3339 216
880 3300049663 Ga0501223_000030 Ga0501223_000030_13821_14516 216
881 3300049663 Ga0501223_000062 Ga0501223_000062_31723_32415 216
882 3300049664 Ga0501224_000018 Ga0501224_000018_77601_78293 216
883 3300049668 Ga0501233_000149 Ga0501233_000149_3139_3831 216
884 3300049669 Ga0501235_002383 Ga0501235_002383_2571_3266 216
885 3300049705 Ga0501225_0000050 Ga0501225_0000050_8805_9500 216
886 3300049705 Ga0501225_0001835 Ga0501225_0001835_2694_3386 216
887 3300049707 Ga0501234_001523 Ga0501234_001523_892_1584 216
888 3300049744 Ga0501083_0023886 Ga0501083_0023886_1962_2651 216
889 3300049778 Ga0501282_001771 Ga0501282_001771_1055_1744 216
890 3300049822 Ga0501035_0374756 Ga0501035_0374756_379_1095 216
891 3300049823 Ga0501044_0286980 Ga0501044_0286980_625_1314 216
892 3300049853 Ga0501226_000030 Ga0501226_000030_2678_3370 216
893 3300050489 nmdc:mga03683_30323_c1 nmdc:mga03683_30323_c1_571_1272 216
894 3300050489 nmdc:mga03683_86714_c1 nmdc:mga03683_86714_c1_566_1258 216
895 3300050491 nmdc:mga00v17_7_c1 nmdc:mga00v17_7_c1_146404_147096 216
896 3300050492 nmdc:mga0yw44_13633_c1 nmdc:mga0yw44_13633_c1_2694_3386 216
897 3300050492 nmdc:mga0yw44_456530_c1 nmdc:mga0yw44_456530_c1_128_829 216
898 3300050493 nmdc:mga0k408_195079_c1 nmdc:mga0k408_195079_c1_128_829 216
899 3300050493 nmdc:mga0k408_397485_c1 nmdc:mga0k408_397485_c1_86_796 216
900 3300050493 nmdc:mga0k408_54499_c1 nmdc:mga0k408_54499_c1_1550_2242 216
901 3300050494 nmdc:mga06z11_35099_c1 nmdc:mga06z11_35099_c1_1432_2133 216
902 3300050494 nmdc:mga06z11_39161_c1 nmdc:mga06z11_39161_c1_77_769 216
903 3300050495 nmdc:mga04h51_1148_c1 nmdc:mga04h51_1148_c1_3288_3980 216
904 3300050496 nmdc:mga07m45_127685_c1 nmdc:mga07m45_127685_c1_128_829 216
905 3300050516 nmdc:mga0sz30_26_c1 nmdc:mga0sz30_26_c1_38554_39246 216
906 3300053086 Ga0500578_0268480 Ga0500578_0268480_23_724 216
907 3300053087 Ga0500643_000385 Ga0500643_000385_21747_22448 216
908 3300053109 Ga0500569_011645 Ga0500569_011645_622_1323 216
909 3300053134 Ga0500658_0000390 Ga0500658_0000390_3215_3916 216
910 3300053137 Ga0500561_0000103 Ga0500561_0000103_9922_10614 216
911 3300053137 Ga0500561_0049655 Ga0500561_0049655_356_1057 216
912 3300053156 Ga0500622_0022475 Ga0500622_0022475_749_1450 216
913 3300053157 Ga0500624_000237 Ga0500624_000237_7586_8299 216
914 3300053161 Ga0500634_0020849 Ga0500634_0020849_1797_2510 216
915 3300055283 Ga0500661_000716 Ga0500661_000716_4405_5106 216
916 iso_pu_bacteria 2643221637 2644209785 216
917 iso_pu_bacteria 2643221718 2644653336 216
918 iso_pu_bacteria 2850079185 2850082390 216
919 3300005344 Ga0070661_100009868 Ga0070661_1000098685 217
920 3300005366 Ga0070659_100211978 Ga0070659_1002119782 217
921 3300005455 Ga0070663_100035253 Ga0070663_1000352533 217
922 3300005458 Ga0070681_10171694 Ga0070681_101716942 217
923 3300005530 Ga0070679_100196813 Ga0070679_1001968131 217
924 3300005563 Ga0068855_100005402 Ga0068855_1000054028 217
925 3300005616 Ga0068852_100003939 Ga0068852_1000039396 217
926 3300013102 Ga0157371_10004669 Ga0157371_100046696 217
927 3300013104 Ga0157370_10073377 Ga0157370_100733773 217
928 3300013105 Ga0157369_10016418 Ga0157369_100164188 217
929 3300013307 Ga0157372_10492359 Ga0157372_104923591 217
930 3300025904 Ga0207647_10143071 Ga0207647_101430712 217
931 3300025909 Ga0207705_10000692 Ga0207705_1000069212 217
932 3300025912 Ga0207707_10141066 Ga0207707_101410663 217
933 3300025919 Ga0207657_10001140 Ga0207657_100011407 217
934 3300025920 Ga0207649_10049464 Ga0207649_100494643 217
935 3300025949 Ga0207667_10008267 Ga0207667_100082678 217
936 3300026067 Ga0207678_10015475 Ga0207678_100154756 217
937 3300026078 Ga0207702_10004475 Ga0207702_100044758 217
938 3300037312 Ga0395899_0005230 Ga0395899_0005230_7513_8214 217
939 3300037418 Ga0395900_0001684 Ga0395900_0001684_17511_18212 217
940 3300038443 Ga0395901_0000047 Ga0395901_0000047_164306_165007 217
941 3300041456 Ga0451795_1587801 Ga0451795_1587801_538_1233 217
942 3300053140 Ga0500573_0000039 Ga0500573_0000039_7212_7910 217
943 iso_pu_bacteria 2739367756 2739793307 217
944 iso_pu_bacteria 2844163670 2844167634 217
945 3300005327 Ga0070658_10000042 Ga0070658_1000004288 218
946 3300005539 Ga0068853_100266400 Ga0068853_1002664002 218
947 3300005563 Ga0068855_100140990 Ga0068855_1001409902 218
948 3300005577 Ga0068857_100621831 Ga0068857_1006218311 218
949 3300005578 Ga0068854_100000219 Ga0068854_10000021933 218
950 3300005614 Ga0068856_100007045 Ga0068856_1000070452 218
951 3300005616 Ga0068852_100000061 Ga0068852_10000006161 218
952 3300009093 Ga0105240_10020551 Ga0105240_100205514 218
953 3300025904 Ga0207647_10227424 Ga0207647_102274241 218
954 3300025909 Ga0207705_10000007 Ga0207705_10000007312 218
955 3300025913 Ga0207695_10014948 Ga0207695_100149486 218
956 3300025949 Ga0207667_10018847 Ga0207667_100188473 218
957 3300025949 Ga0207667_10024905 Ga0207667_100249052 218
958 3300025981 Ga0207640_10056760 Ga0207640_100567602 218
959 3300025981 Ga0207640_10131020 Ga0207640_101310202 218
960 3300026078 Ga0207702_10212462 Ga0207702_102124622 218
961 3300026116 Ga0207674_10681417 Ga0207674_106814172 218
962 3300026142 Ga0207698_10000337 Ga0207698_100003376 218
963 3300026142 Ga0207698_10017734 Ga0207698_100177344 218
964 3300046558 Ga0495633_0020894 Ga0495633_0020894_2379_3083 218
965 3300047445 Ga0495677_0078569 Ga0495677_0078569_364_1068 218
966 3300005333 Ga0070677_10000549 Ga0070677_100005494 219
967 3300005577 Ga0068857_100043573 Ga0068857_1000435734 219
968 3300005578 Ga0068854_100078231 Ga0068854_1000782312 219
969 3300005843 Ga0068860_100046822 Ga0068860_1000468223 219
970 3300006195 Ga0075366_10176830 Ga0075366_101768302 219
971 3300009551 Ga0105238_10962504 Ga0105238_109625041 219
972 3300012513 Ga0157326_1000035 Ga0157326_100003511 219
973 3300025893 Ga0207682_10006559 Ga0207682_100065592 219
974 3300025981 Ga0207640_10034263 Ga0207640_100342634 219
975 3300026116 Ga0207674_10084278 Ga0207674_100842784 219
976 3300028381 Ga0268264_10096786 Ga0268264_100967862 219
977 3300045051 Ga0451576_0000017 Ga0451576_0000017_100199_100885 219
978 3300048925 Ga0496122_0002878 Ga0496122_0002878_5304_6005 219
979 3300050493 nmdc:mga0k408_134463_c1 nmdc:mga0k408_134463_c1_416_1120 219
980 3300050496 nmdc:mga07m45_159489_c1 nmdc:mga07m45_159489_c1_574_1278 219
981 3300005617 Ga0068859_100043467 Ga0068859_1000434674 220
982 3300006931 Ga0097620_100043468 Ga0097620_1000434684 220
983 3300031731 Ga0307405_10150079 Ga0307405_101500792 220
984 3300031852 Ga0307410_10496527 Ga0307410_104965271 220
985 3300031911 Ga0307412_10048614 Ga0307412_100486142 220
986 3300049579 Ga0501043_0005362 Ga0501043_0005362_2466_3176 220
987 3300049581 Ga0501047_0007006 Ga0501047_0007006_2605_3315 220
988 3300049679 Ga0501249_000229 Ga0501249_000229_6243_6953 220
989 3300049823 Ga0501044_0044666 Ga0501044_0044666_2436_3146 220
990 3300049850 Ga0501204_007800 Ga0501204_007800_149_859 220
991 3300053087 Ga0500643_009309 Ga0500643_009309_1089_1793 220
992 3300053087 Ga0500643_013251 Ga0500643_013251_1931_2635 220
993 3300053087 Ga0500643_033750 Ga0500643_033750_591_1295 220
994 3300005331 Ga0070670_100006818 Ga0070670_10000681810 223
995 3300021327 Ga0214543_1000008 Ga0214543_1000008302 223
996 3300025919 Ga0207657_10496335 Ga0207657_104963352 223
997 3300025925 Ga0207650_10036708 Ga0207650_100367082 223
998 3300041413 Ga0439465_0012736 Ga0439465_0012736_935_1660 223
999 iso_pu_bacteria 2558860100 2558860493 223
1000 3300032005 Ga0307411_10175707 Ga0307411_101757072 224
1001 3300053116 Ga0500592_005960 Ga0500592_005960_249_968 226
1002 2162886007 SwRhRL2b_contig_241682 SwRhRL2b_0905.00002410 227
1003 3300005289 Ga0065704_10084786 Ga0065704_100847864 227
1004 3300005347 Ga0070668_100421347 Ga0070668_1004213472 227
1005 3300013306 Ga0163162_10526805 Ga0163162_105268052 227
1006 3300030522 Ga0307512_10248325 Ga0307512_102483251 227
1007 3300031456 Ga0307513_10008757 Ga0307513_100087574 227
1008 3300046506 Ga0495583_0009288 Ga0495583_0009288_3397_4122 227
1009 3300046522 Ga0495643_0061860 Ga0495643_0061860_554_1279 227
1010 3300046660 Ga0495625_0015697 Ga0495625_0015697_5197_5922 227
1011 3300047445 Ga0495677_0001002 Ga0495677_0001002_6328_7053 227
1012 3300053087 Ga0500643_005394 Ga0500643_005394_2716_3441 227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

52

214

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jhq-assembly1.cif.gz_A crystal structure of uracil dna-glycosylase from vibrio cholerae 0.9366 18 226
2uug-assembly2.cif.gz_B escherichia coli uracil-dna glycosylase:inhibitor complex with h187d mutant udg and wild-type ugi 0.9365 18 226
3eug-assembly1.cif.gz_A crystal structure of escherichia coli uracil dna glycosylase and its complexes with uracil and glycerol: structure and glycosylase mechanism revisited 0.9339 18 226
3fcl-assembly1.cif.gz_A complex of ung2 and a fragment-based designed inhibitor 0.9335 14 226
1eug-assembly1.cif.gz_A crystal structure of escherichia coli uracil dna glycosylase and its complexes with uracil and glycerol: structure and glycosylase mechanism revisited 0.933 18 226
ID Description Score Start End Superfamily
1okbB00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9283 14 226 3.40.470.10
af_Q1ZXM2_175_429_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9239 15 227 3.40.470.10
af_O74834_61_307_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9221 14 225 3.40.470.10
3a7nA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9016 14 227 3.40.470.10
4l5nB00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8988 14 227 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A3N5CR12-F1-model_v4 Uracil-DNA glycosylase (UDG) (EC 3.2.2.27) 0.9651 15 227 GO:0004844
GO:0005737
GO:0097510
AF-A0A1T5AYS2-F1-model_v4 Uracil-DNA glycosylase (UDG) (EC 3.2.2.27) 0.9589 16 227 GO:0004844
GO:0005737
GO:0097510
AF-A0A2A4X350-F1-model_v4 Uracil-DNA glycosylase (UDG) (EC 3.2.2.27) 0.9565 11 227 GO:0004844
GO:0005737
GO:0097510
AF-A0A3P3YKY9-F1-model_v4 Uracil-DNA glycosylase (UDG) (EC 3.2.2.27) 0.9546 17 227 GO:0004844
GO:0005634
GO:0005739
GO:0097510
AF-C0XMN2-F1-model_v4 Uracil-DNA glycosylase (EC 3.2.2.27) 0.9543 14 158 GO:0004844
GO:0005737
GO:0097510

Feature Viewer

pLDDT pTM Quality
80.2 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map