F487959

General Info

Members Datasets Scaffolds Average Seq Length
1004 256 2008 154

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10079228|Ga0105245_100792282
Length 162
Sequence MFKECSSMPLPHNALVLVADGRKMLFFRNHGDEGQIDLRTEAHDARFVRKDRDIKTDAPGMTRQSFGFGRSTYEEADFQQQEEDRWVKEVAEELKTRVLRNDFEALAIIAPPKALGVMKRYLHKEVEKRIVCTVNKEMSGRTVPDIEGLLDGHTRAAELPSV

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
192 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
194 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
195 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
208 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
209 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
210 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
211 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
212 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
215 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
216 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
217 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
224 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
225 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
246 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
247 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
248 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
252 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 2.69
Rhizosphere 96.71
Stem 0
Stem Tuber 0
Unclassified 3.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10079228 3300009098 Bacteria 2999
2 JGI24736J21556_1012661 3300001904 Bacteria 1365
3 JGI24741J21665_1042821 3300001915 Bacteria 667
4 JGI24741J21665_1055634 3300001915 Bacteria 583
5 JGI24741J21665_1057883 3300001915 Bacteria 572
6 JGI24740J21852_10036305 3300001979 Unclassified 1533
7 JGI24740J21852_10093268 3300001979 Bacteria 774
8 JGI24740J21852_10098656 3300001979 Bacteria 746
9 JGI24739J22299_10003665 3300001989 Bacteria 5860
10 JGI24739J22299_10004275 3300001989 Bacteria 5472
11 JGI24739J22299_10042244 3300001989 Bacteria 1513
12 JGI24739J22299_10050203 3300001989 Bacteria 1350
13 JGI24739J22299_10117140 3300001989 Bacteria 797
14 JGI24739J22299_10140382 3300001989 Bacteria 716
15 JGI24737J22298_10000016 3300001990 Bacteria 49280
16 JGI24737J22298_10003155 3300001990 Bacteria 5851
17 JGI24737J22298_10004505 3300001990 Bacteria 4851
18 JGI24737J22298_10012430 3300001990 Bacteria 2776
19 JGI24737J22298_10023189 3300001990 Bacteria 1970
20 JGI24737J22298_10152611 3300001990 Bacteria 682
21 JGI24743J22301_10088074 3300001991 Bacteria 660
22 JGI24735J21928_10012119 3300002067 Bacteria 2727
23 JGI24735J21928_10072447 3300002067 Bacteria 987
24 JGI24750J21931_1060741 3300002070 Bacteria 604
25 JGI24748J21848_1006301 3300002074 Bacteria 1381
26 JGI24738J21930_10000066 3300002075 Bacteria 21866
27 JGI24738J21930_10006636 3300002075 Bacteria 2696
28 JGI24738J21930_10030609 3300002075 Bacteria 1099
29 JGI24738J21930_10060358 3300002075 Unclassified 778
30 JGI24744J21845_10024878 3300002077 Bacteria 1169
31 JGI24035J26624_1010184 3300002126 Bacteria 932
32 JGI24034J26672_10049671 3300002239 Bacteria 719
33 Ga0065715_10153538 3300005293 Bacteria 1702
34 Ga0065707_11076697 3300005295 Unclassified 521
35 Ga0070658_10009978 3300005327 Bacteria 7628
36 Ga0070658_10014335 3300005327 Bacteria 6359
37 Ga0070658_10041641 3300005327 Bacteria 3705
38 Ga0070658_10113116 3300005327 Bacteria 2250
39 Ga0070658_10124649 3300005327 Bacteria 2143
40 Ga0070658_10309236 3300005327 Bacteria 1348
41 Ga0070658_10342086 3300005327 Bacteria 1280
42 Ga0070658_10399536 3300005327 Bacteria 1180
43 Ga0070676_10030392 3300005328 Bacteria 3080
44 Ga0070676_10037776 3300005328 Bacteria 2786
45 Ga0070676_10076848 3300005328 Bacteria 2017
46 Ga0070676_10085238 3300005328 Bacteria 1925
47 Ga0070676_10219631 3300005328 Unclassified 1255
48 Ga0070676_10267187 3300005328 Bacteria 1147
49 Ga0070683_100012530 3300005329 Bacteria 7371
50 Ga0070683_100015287 3300005329 Bacteria 6738
51 Ga0070683_100036720 3300005329 Bacteria 4485
52 Ga0070683_100437785 3300005329 Bacteria 1247
53 Ga0070683_100459908 3300005329 Bacteria 1214
54 Ga0070690_100015806 3300005330 Bacteria 4509
55 Ga0070670_100058524 3300005331 Bacteria 3308
56 Ga0070670_100209980 3300005331 Bacteria 1693
57 Ga0070670_100249261 3300005331 Bacteria 1547
58 Ga0070670_100296478 3300005331 Bacteria 1414
59 Ga0070677_10332958 3300005333 Bacteria 781
60 Ga0070666_10004467 3300005335 Bacteria 8518
61 Ga0070666_10008694 3300005335 Bacteria 6314
62 Ga0070666_10021588 3300005335 Bacteria 4174
63 Ga0070666_10173967 3300005335 Bacteria 1509
64 Ga0070666_10322073 3300005335 Bacteria 1103
65 Ga0070680_100008383 3300005336 Bacteria 7913
66 Ga0070680_100026279 3300005336 Bacteria 4655
67 Ga0070682_100043699 3300005337 Bacteria 2771
68 Ga0070682_100086628 3300005337 Bacteria 2040
69 Ga0070682_100102373 3300005337 Bacteria 1893
70 Ga0070682_100102993 3300005337 Bacteria 1888
71 Ga0068868_100008558 3300005338 Bacteria 7326
72 Ga0068868_100008869 3300005338 Bacteria 7205
73 Ga0068868_100111307 3300005338 Bacteria 2225
74 Ga0068868_100293889 3300005338 Bacteria 1378
75 Ga0068868_100360613 3300005338 Bacteria 1247
76 Ga0068868_100462853 3300005338 Bacteria 1105
77 Ga0068868_100547420 3300005338 Bacteria 1019
78 Ga0070660_100008914 3300005339 Bacteria 7033
79 Ga0070660_100022040 3300005339 Bacteria 4706
80 Ga0070660_100026129 3300005339 Bacteria 4346
81 Ga0070660_100036641 3300005339 Bacteria 3716
82 Ga0070660_100064826 3300005339 Bacteria 2843
83 Ga0070660_100071153 3300005339 Bacteria 2715
84 Ga0070660_100074958 3300005339 Bacteria 2648
85 Ga0070660_100263261 3300005339 Bacteria 1408
86 Ga0070660_100288847 3300005339 Bacteria 1343
87 Ga0070660_100346072 3300005339 Bacteria 1224
88 Ga0070660_100550374 3300005339 Bacteria 963
89 Ga0070689_100410071 3300005340 Bacteria 1147
90 Ga0070689_100764323 3300005340 Bacteria 848
91 Ga0070691_10000860 3300005341 Bacteria 12285
92 Ga0070687_100879370 3300005343 Bacteria 641
93 Ga0070661_100008509 3300005344 Bacteria 7098
94 Ga0070661_100008531 3300005344 Bacteria 7088
95 Ga0070661_100033695 3300005344 Bacteria 3711
96 Ga0070661_100060594 3300005344 Bacteria 2777
97 Ga0070661_100087280 3300005344 Bacteria 2307
98 Ga0070661_100090138 3300005344 Bacteria 2271
99 Ga0070661_100137739 3300005344 Bacteria 1838
100 Ga0070661_100191209 3300005344 Bacteria 1561
101 Ga0070661_100219476 3300005344 Bacteria 1458
102 Ga0070692_10012038 3300005345 Bacteria 3990
103 Ga0070692_10022984 3300005345 Bacteria 3051
104 Ga0070692_10316677 3300005345 Bacteria 958
105 Ga0070668_100002981 3300005347 Bacteria 12519
106 Ga0070668_100039375 3300005347 Bacteria 3615
107 Ga0070668_100063545 3300005347 Bacteria 2861
108 Ga0070668_100081964 3300005347 Bacteria 2530
109 Ga0070668_100241765 3300005347 Bacteria 1495
110 Ga0070669_100000811 3300005353 Bacteria 22744
111 Ga0070669_100078731 3300005353 Bacteria 2450
112 Ga0070669_100088050 3300005353 Bacteria 2323
113 Ga0070669_100396229 3300005353 Bacteria 1129
114 Ga0070669_100775233 3300005353 Bacteria 814
115 Ga0070669_101141843 3300005353 Bacteria 672
116 Ga0070675_100087782 3300005354 Bacteria 2601
117 Ga0070675_100147970 3300005354 Bacteria 2012
118 Ga0070671_100000417 3300005355 Bacteria 29560
119 Ga0070671_100026515 3300005355 Bacteria 4763
120 Ga0070671_100050835 3300005355 Bacteria 3447
121 Ga0070671_100078988 3300005355 Bacteria 2750
122 Ga0070671_100263776 3300005355 Bacteria 1464
123 Ga0070671_100777996 3300005355 Bacteria 833
124 Ga0070674_100006227 3300005356 Bacteria 6944
125 Ga0070674_100010348 3300005356 Bacteria 5634
126 Ga0070674_100026187 3300005356 Bacteria 3806
127 Ga0070674_100244804 3300005356 Bacteria 1406
128 Ga0070673_100000661 3300005364 Bacteria 18949
129 Ga0070673_100005423 3300005364 Bacteria 8161
130 Ga0070673_100007346 3300005364 Bacteria 7258
131 Ga0070673_100061297 3300005364 Bacteria 2984
132 Ga0070673_100128924 3300005364 Bacteria 2120
133 Ga0070673_100170236 3300005364 Bacteria 1859
134 Ga0070673_100319759 3300005364 Bacteria 1371
135 Ga0070673_100790351 3300005364 Bacteria 876
136 Ga0070659_100001375 3300005366 Bacteria 17524
137 Ga0070659_100007488 3300005366 Bacteria 7931
138 Ga0070659_100020785 3300005366 Bacteria 4991
139 Ga0070659_100057095 3300005366 Bacteria 3077
140 Ga0070659_100067465 3300005366 Bacteria 2837
141 Ga0070659_100108796 3300005366 Bacteria 2237
142 Ga0070659_100164585 3300005366 Bacteria 1814
143 Ga0070659_100164703 3300005366 Bacteria 1814
144 Ga0070659_100327857 3300005366 Bacteria 1281
145 Ga0070659_100344972 3300005366 Bacteria 1248
146 Ga0070659_100373036 3300005366 Bacteria 1201
147 Ga0070659_100401114 3300005366 Bacteria 1158
148 Ga0070667_100001733 3300005367 Bacteria 19484
149 Ga0070667_100014955 3300005367 Bacteria 6410
150 Ga0070667_100017525 3300005367 Bacteria 5936
151 Ga0070667_100028726 3300005367 Bacteria 4631
152 Ga0070667_100076113 3300005367 Bacteria 2865
153 Ga0070667_100132002 3300005367 Bacteria 2180
154 Ga0070667_100193905 3300005367 Bacteria 1801
155 Ga0070667_100257533 3300005367 Bacteria 1561
156 Ga0070667_101350471 3300005367 Unclassified 668
157 Ga0070709_10008800 3300005434 Bacteria 5556
158 Ga0070714_100017416 3300005435 Bacteria 5819
159 Ga0070714_100095116 3300005435 Bacteria 2616
160 Ga0070714_100414634 3300005435 Bacteria 1275
161 Ga0070714_100638803 3300005435 Bacteria 1024
162 Ga0070713_100003318 3300005436 Bacteria 10616
163 Ga0070713_101401235 3300005436 Bacteria 678
164 Ga0070705_100746379 3300005440 Bacteria 773
165 Ga0070694_100004307 3300005444 Bacteria 8552
166 Ga0070663_100015878 3300005455 Bacteria 4874
167 Ga0070663_100071896 3300005455 Bacteria 2518
168 Ga0070663_100397647 3300005455 Bacteria 1126
169 Ga0070663_100407389 3300005455 Bacteria 1113
170 Ga0070663_100469811 3300005455 Bacteria 1040
171 Ga0070663_100622055 3300005455 Bacteria 910
172 Ga0070663_100719493 3300005455 Bacteria 850
173 Ga0070663_100863515 3300005455 Bacteria 779
174 Ga0070663_100866659 3300005455 Bacteria 778
175 Ga0070678_100013692 3300005456 Bacteria 5096
176 Ga0070678_100016448 3300005456 Bacteria 4733
177 Ga0070662_100000475 3300005457 Bacteria 23818
178 Ga0070662_100008521 3300005457 Bacteria 6689
179 Ga0070662_100016737 3300005457 Bacteria 4928
180 Ga0070662_100017857 3300005457 Bacteria 4788
181 Ga0070662_100018187 3300005457 Bacteria 4750
182 Ga0070662_100034765 3300005457 Bacteria 3555
183 Ga0070662_100070136 3300005457 Bacteria 2582
184 Ga0070662_100171571 3300005457 Bacteria 1703
185 Ga0070662_100187690 3300005457 Bacteria 1633
186 Ga0070662_100190808 3300005457 Bacteria 1620
187 Ga0070662_100196640 3300005457 Bacteria 1597
188 Ga0070662_100380466 3300005457 Bacteria 1162
189 Ga0070681_10067162 3300005458 Bacteria 3554
190 Ga0070681_10077454 3300005458 Bacteria 3283
191 Ga0070681_11322097 3300005458 Bacteria 644
192 Ga0068867_100008448 3300005459 Bacteria 7263
193 Ga0068867_100015417 3300005459 Bacteria 5420
194 Ga0068867_100115917 3300005459 Bacteria 2064
195 Ga0068867_100477195 3300005459 Bacteria 1068
196 Ga0070685_10084545 3300005466 Bacteria 1909
197 Ga0070679_100129166 3300005530 Bacteria 2508
198 Ga0070679_100148712 3300005530 Bacteria 2319
199 Ga0070679_100183877 3300005530 Bacteria 2062
200 Ga0070679_101145325 3300005530 Bacteria 723
201 Ga0070679_101148485 3300005530 Bacteria 722
202 Ga0070684_100005253 3300005535 Bacteria 9910
203 Ga0070684_100108474 3300005535 Bacteria 2487
204 Ga0070684_100523066 3300005535 Bacteria 1100
205 Ga0068853_100033351 3300005539 Bacteria 4368
206 Ga0068853_100038331 3300005539 Bacteria 4081
207 Ga0068853_100046645 3300005539 Bacteria 3716
208 Ga0068853_100058003 3300005539 Bacteria 3342
209 Ga0068853_100065439 3300005539 Bacteria 3155
210 Ga0068853_100147798 3300005539 Bacteria 2113
211 Ga0068853_100317050 3300005539 Bacteria 1445
212 Ga0068853_100379058 3300005539 Unclassified 1321
213 Ga0068853_101877186 3300005539 Bacteria 581
214 Ga0070672_100000284 3300005543 Bacteria 28813
215 Ga0070672_100019705 3300005543 Bacteria 4903
216 Ga0070672_100077356 3300005543 Bacteria 2660
217 Ga0070672_100197150 3300005543 Bacteria 1683
218 Ga0070672_100217773 3300005543 Bacteria 1601
219 Ga0070672_100226420 3300005543 Bacteria 1570
220 Ga0070672_100561672 3300005543 Bacteria 992
221 Ga0070686_100082056 3300005544 Bacteria 2137
222 Ga0070695_100089353 3300005545 Bacteria 2053
223 Ga0070696_100226525 3300005546 Bacteria 1405
224 Ga0070665_100111971 3300005548 Bacteria 2732
225 Ga0068855_100014948 3300005563 Bacteria 9352
226 Ga0068855_100146366 3300005563 Bacteria 2689
227 Ga0068855_100146954 3300005563 Bacteria 2683
228 Ga0068855_100174361 3300005563 Bacteria 2434
229 Ga0068855_100306140 3300005563 Bacteria 1759
230 Ga0068855_100346398 3300005563 Bacteria 1637
231 Ga0068855_100422199 3300005563 Bacteria 1458
232 Ga0068855_100635663 3300005563 Bacteria 1148
233 Ga0068855_100751842 3300005563 Bacteria 1039
234 Ga0070664_100005642 3300005564 Bacteria 10075
235 Ga0070664_100013402 3300005564 Bacteria 6678
236 Ga0070664_100018295 3300005564 Bacteria 5752
237 Ga0070664_100020503 3300005564 Bacteria 5443
238 Ga0070664_100041124 3300005564 Bacteria 3899
239 Ga0070664_100129645 3300005564 Bacteria 2214
240 Ga0070664_100293204 3300005564 Bacteria 1469
241 Ga0070664_100500844 3300005564 Bacteria 1119
242 Ga0070664_100550408 3300005564 Unclassified 1067
243 Ga0070664_100575562 3300005564 Bacteria 1043
244 Ga0068857_100002439 3300005577 Bacteria 15178
245 Ga0068857_100004560 3300005577 Bacteria 11721
246 Ga0068857_100009210 3300005577 Bacteria 8564
247 Ga0068857_100031955 3300005577 Bacteria 4652
248 Ga0068857_100033858 3300005577 Bacteria 4519
249 Ga0068857_100090230 3300005577 Bacteria 2743
250 Ga0068857_100186522 3300005577 Bacteria 1888
251 Ga0068857_100666926 3300005577 Bacteria 986
252 Ga0068854_100005153 3300005578 Bacteria 8239
253 Ga0068854_100005537 3300005578 Bacteria 7979
254 Ga0068854_100018924 3300005578 Bacteria 4630
255 Ga0068854_100058462 3300005578 Bacteria 2783
256 Ga0068854_100192359 3300005578 Bacteria 1599
257 Ga0068854_101593360 3300005578 Bacteria 595
258 Ga0068856_100053082 3300005614 Bacteria 3998
259 Ga0068856_100079698 3300005614 Bacteria 3247
260 Ga0068856_100095097 3300005614 Bacteria 2967
261 Ga0068856_100133269 3300005614 Bacteria 2490
262 Ga0068856_100166347 3300005614 Bacteria 2216
263 Ga0068856_100376973 3300005614 Bacteria 1438
264 Ga0068856_101423399 3300005614 Bacteria 707
265 Ga0068856_101630196 3300005614 Unclassified 658
266 Ga0070702_100327422 3300005615 Bacteria 1070
267 Ga0070702_100794463 3300005615 Unclassified 731
268 Ga0068852_100001669 3300005616 Bacteria 15127
269 Ga0068852_100014747 3300005616 Bacteria 6032
270 Ga0068852_100019190 3300005616 Bacteria 5404
271 Ga0068852_100031088 3300005616 Bacteria 4401
272 Ga0068852_100056474 3300005616 Bacteria 3393
273 Ga0068852_100115948 3300005616 Bacteria 2443
274 Ga0068852_100270343 3300005616 Bacteria 1635
275 Ga0068852_100655582 3300005616 Bacteria 1057
276 Ga0068852_100711546 3300005616 Bacteria 1015
277 Ga0068852_101383985 3300005616 Bacteria 725
278 Ga0068859_100018796 3300005617 Bacteria 6944
279 Ga0068859_100034050 3300005617 Bacteria 5114
280 Ga0068859_100042204 3300005617 Bacteria 4581
281 Ga0068859_100050979 3300005617 Bacteria 4159
282 Ga0068859_100163865 3300005617 Bacteria 2302
283 Ga0068859_100249486 3300005617 Bacteria 1865
284 Ga0068859_101625089 3300005617 Bacteria 714
285 Ga0068864_100001467 3300005618 Bacteria 19438
286 Ga0068864_100002129 3300005618 Bacteria 16377
287 Ga0068864_100012677 3300005618 Bacteria 6969
288 Ga0068864_100198537 3300005618 Bacteria 1842
289 Ga0068864_100244754 3300005618 Unclassified 1663
290 Ga0068866_10003114 3300005718 Bacteria 6836
291 Ga0068866_10548472 3300005718 Bacteria 773
292 Ga0068866_10621621 3300005718 Bacteria 732
293 Ga0068861_100051097 3300005719 Bacteria 3137
294 Ga0068861_100669786 3300005719 Bacteria 961
295 Ga0068851_10011075 3300005834 Bacteria 4223
296 Ga0068851_10012432 3300005834 Bacteria 4013
297 Ga0068863_100001129 3300005841 Bacteria 26682
298 Ga0068863_100008776 3300005841 Bacteria 9870
299 Ga0068863_100034400 3300005841 Bacteria 4827
300 Ga0068863_100252756 3300005841 Bacteria 1703
301 Ga0068863_100547900 3300005841 Bacteria 1142
302 Ga0068863_100788963 3300005841 Bacteria 947
303 Ga0068858_100003837 3300005842 Bacteria 14863
304 Ga0068858_100042385 3300005842 Bacteria 4220
305 Ga0068858_100048012 3300005842 Bacteria 3957
306 Ga0068858_100057001 3300005842 Bacteria 3610
307 Ga0068858_100385174 3300005842 Bacteria 1346
308 Ga0068858_100917883 3300005842 Bacteria 856
309 Ga0068860_100007140 3300005843 Bacteria 11174
310 Ga0068860_100030489 3300005843 Bacteria 5186
311 Ga0068860_100044792 3300005843 Bacteria 4216
312 Ga0068860_100159486 3300005843 Bacteria 2174
313 Ga0068860_100176550 3300005843 Bacteria 2064
314 Ga0068862_100041359 3300005844 Bacteria 3921
315 Ga0068862_100153990 3300005844 Bacteria 2048
316 Ga0068862_100214333 3300005844 Unclassified 1741
317 Ga0068862_100382821 3300005844 Bacteria 1312
318 Ga0068862_101018354 3300005844 Bacteria 820
319 Ga0081540_1112534 3300005983 Bacteria 1147
320 Ga0070717_10009085 3300006028 Bacteria 7462
321 Ga0070717_10039961 3300006028 Bacteria 3819
322 Ga0070717_10560205 3300006028 Bacteria 1035
323 Ga0070716_100528150 3300006173 Bacteria 876
324 Ga0070712_100013495 3300006175 Bacteria 5223
325 Ga0075362_10027094 3300006177 Bacteria 2452
326 Ga0097621_100020665 3300006237 Bacteria 5077
327 Ga0097621_100245849 3300006237 Bacteria 1565
328 Ga0097621_100564581 3300006237 Bacteria 1037
329 Ga0097621_101648561 3300006237 Bacteria 610
330 Ga0068871_100068039 3300006358 Bacteria 2923
331 Ga0068871_100070647 3300006358 Bacteria 2870
332 Ga0068871_100268904 3300006358 Bacteria 1489
333 Ga0068871_100522817 3300006358 Bacteria 1072
334 Ga0068871_101115950 3300006358 Bacteria 738
335 Ga0068871_101168897 3300006358 Unclassified 721
336 Ga0075433_10028690 3300006852 Bacteria 4733
337 Ga0075429_100473039 3300006880 Bacteria 1098
338 Ga0068865_100004261 3300006881 Bacteria 8629
339 Ga0068865_100008396 3300006881 Bacteria 6384
340 Ga0097620_100018796 3300006931 Bacteria 6944
341 Ga0097620_100034049 3300006931 Bacteria 5114
342 Ga0097620_100042204 3300006931 Bacteria 4581
343 Ga0097620_100050978 3300006931 Bacteria 4159
344 Ga0097620_100163880 3300006931 Bacteria 2302
345 Ga0097620_100249476 3300006931 Bacteria 1865
346 Ga0097620_101624901 3300006931 Bacteria 714
347 Ga0075435_101056347 3300007076 Bacteria 710
348 Ga0105240_10020543 3300009093 Bacteria 8803
349 Ga0105240_10274173 3300009093 Bacteria 1941
350 Ga0111539_10392989 3300009094 Bacteria 1615
351 Ga0105245_10001374 3300009098 Bacteria 22022
352 Ga0105245_10011486 3300009098 Bacteria 7714
353 Ga0105245_10679045 3300009098 Bacteria 1062
354 Ga0105247_10338668 3300009101 Bacteria 1054
355 Ga0105243_10047385 3300009148 Bacteria 3383
356 Ga0105243_10166368 3300009148 Bacteria 1906
357 Ga0105243_10201756 3300009148 Bacteria 1744
358 Ga0105241_10151222 3300009174 Bacteria 1899
359 Ga0105241_10727016 3300009174 Bacteria 908
360 Ga0105242_10007813 3300009176 Bacteria 8231
361 Ga0105242_10671242 3300009176 Bacteria 1010
362 Ga0105242_11488828 3300009176 Unclassified 707
363 Ga0105242_11787895 3300009176 Bacteria 653
364 Ga0105248_10001396 3300009177 Bacteria 26955
365 Ga0105248_10021620 3300009177 Bacteria 7126
366 Ga0105248_10064910 3300009177 Bacteria 4098
367 Ga0105248_10189362 3300009177 Bacteria 2318
368 Ga0105248_11110635 3300009177 Bacteria 894
369 Ga0105237_10062327 3300009545 Bacteria 3729
370 Ga0105238_10052817 3300009551 Bacteria 4084
371 Ga0105238_10077916 3300009551 Bacteria 3305
372 Ga0105238_11563637 3300009551 Bacteria 689
373 Ga0105249_10007160 3300009553 Bacteria 9739
374 Ga0105249_10010165 3300009553 Bacteria 8263
375 Ga0105249_10105735 3300009553 Bacteria 2654
376 Ga0105249_10373759 3300009553 Bacteria 1450
377 Ga0105249_11082388 3300009553 Bacteria 871
378 Ga0105239_10244209 3300010375 Bacteria 2015
379 Ga0105239_10256531 3300010375 Bacteria 1965
380 Ga0105239_10335878 3300010375 Bacteria 1705
381 Ga0105239_10398830 3300010375 Bacteria 1557
382 Ga0105246_10020885 3300011119 Bacteria 4205
383 Ga0105246_10053462 3300011119 Bacteria 2779
384 Ga0157373_10031807 3300013100 Bacteria 3799
385 Ga0157373_10040588 3300013100 Bacteria 3329
386 Ga0157373_10041510 3300013100 Bacteria 3291
387 Ga0157373_10119090 3300013100 Bacteria 1856
388 Ga0157373_10139027 3300013100 Bacteria 1708
389 Ga0157373_10143068 3300013100 Bacteria 1682
390 Ga0157373_10261059 3300013100 Bacteria 1226
391 Ga0157373_10320844 3300013100 Bacteria 1102
392 Ga0157373_10725610 3300013100 Bacteria 729
393 Ga0157373_10773839 3300013100 Bacteria 706
394 Ga0157371_10006646 3300013102 Bacteria 9473
395 Ga0157371_10017225 3300013102 Bacteria 5372
396 Ga0157371_10018093 3300013102 Bacteria 5217
397 Ga0157371_10036833 3300013102 Bacteria 3503
398 Ga0157371_10119977 3300013102 Bacteria 1869
399 Ga0157371_10137867 3300013102 Bacteria 1738
400 Ga0157371_10338659 3300013102 Bacteria 1094
401 Ga0157371_10385604 3300013102 Bacteria 1024
402 Ga0157371_10460222 3300013102 Bacteria 936
403 Ga0157370_10010372 3300013104 Bacteria 9822
404 Ga0157370_10028351 3300013104 Bacteria 5509
405 Ga0157370_10103209 3300013104 Bacteria 2669
406 Ga0157370_10103361 3300013104 Bacteria 2667
407 Ga0157370_10372718 3300013104 Bacteria 1315
408 Ga0157369_10062303 3300013105 Bacteria 4020
409 Ga0157369_10094810 3300013105 Bacteria 3185
410 Ga0157369_10122702 3300013105 Bacteria 2756
411 Ga0157369_10145603 3300013105 Bacteria 2505
412 Ga0157369_11337229 3300013105 Bacteria 730
413 Ga0157374_10019971 3300013296 Bacteria 5939
414 Ga0157374_10188596 3300013296 Bacteria 2017
415 Ga0157374_10232443 3300013296 Unclassified 1811
416 Ga0157378_10002115 3300013297 Bacteria 17699
417 Ga0157378_10072822 3300013297 Bacteria 3088
418 Ga0157378_10104336 3300013297 Bacteria 2591
419 Ga0157378_11356325 3300013297 Unclassified 753
420 Ga0157378_11771903 3300013297 Bacteria 665
421 Ga0157378_11842607 3300013297 Bacteria 653
422 Ga0163162_10014054 3300013306 Bacteria 7825
423 Ga0163162_10029515 3300013306 Bacteria 5428
424 Ga0163162_10040856 3300013306 Bacteria 4640
425 Ga0163162_10514884 3300013306 Bacteria 1326
426 Ga0163162_10622342 3300013306 Bacteria 1205
427 Ga0163162_10813427 3300013306 Bacteria 1051
428 Ga0157372_10031600 3300013307 Bacteria 5797
429 Ga0157372_10187330 3300013307 Bacteria 2396
430 Ga0157372_10518012 3300013307 Bacteria 1390
431 Ga0157375_10020757 3300013308 Bacteria 6011
432 Ga0157375_10101928 3300013308 Bacteria 2954
433 Ga0157375_10384043 3300013308 Bacteria 1571
434 Ga0157375_10543298 3300013308 Bacteria 1324
435 Ga0157375_10919086 3300013308 Bacteria 1018
436 Ga0157375_11179018 3300013308 Bacteria 898
437 Ga0163163_10026094 3300014325 Bacteria 5579
438 Ga0182008_10409900 3300014497 Bacteria 729
439 Ga0182008_10423711 3300014497 Bacteria 719
440 Ga0157377_10056311 3300014745 Bacteria 2232
441 Ga0157377_10417863 3300014745 Unclassified 917
442 Ga0157379_10066402 3300014968 Bacteria 3225
443 Ga0157379_11092909 3300014968 Bacteria 763
444 Ga0157376_10010934 3300014969 Bacteria 6667
445 Ga0163161_10078962 3300017792 Bacteria 2419
446 Ga0163161_11960505 3300017792 Bacteria 521
447 Ga0206352_10760739 3300020078 Bacteria 1042
448 Ga0206354_11245067 3300020081 Bacteria 1377
449 Ga0207697_10000144 3300025315 Bacteria 34657
450 Ga0207697_10119952 3300025315 Unclassified 1131
451 Ga0207697_10158860 3300025315 Bacteria 985
452 Ga0207656_10006948 3300025321 Bacteria 4104
453 Ga0207656_10045139 3300025321 Bacteria 1885
454 Ga0207682_10148480 3300025893 Bacteria 1056
455 Ga0207642_10173954 3300025899 Bacteria 1167
456 Ga0207642_10243988 3300025899 Bacteria 1016
457 Ga0207688_10000184 3300025901 Bacteria 27851
458 Ga0207688_10049186 3300025901 Bacteria 2356
459 Ga0207688_10636609 3300025901 Unclassified 673
460 Ga0207680_10005234 3300025903 Bacteria 6189
461 Ga0207680_10093408 3300025903 Bacteria 1919
462 Ga0207647_10000753 3300025904 Bacteria 25372
463 Ga0207647_10007510 3300025904 Bacteria 7870
464 Ga0207647_10007626 3300025904 Bacteria 7798
465 Ga0207647_10035280 3300025904 Bacteria 3188
466 Ga0207647_10044972 3300025904 Bacteria 2756
467 Ga0207647_10086761 3300025904 Bacteria 1870
468 Ga0207647_10094821 3300025904 Bacteria 1777
469 Ga0207647_10098369 3300025904 Bacteria 1739
470 Ga0207647_10427982 3300025904 Unclassified 743
471 Ga0207699_10096628 3300025906 Bacteria 1865
472 Ga0207645_10034317 3300025907 Bacteria 3260
473 Ga0207645_10081251 3300025907 Bacteria 2078
474 Ga0207645_10087299 3300025907 Bacteria 2005
475 Ga0207645_10143347 3300025907 Bacteria 1557
476 Ga0207645_10193375 3300025907 Bacteria 1337
477 Ga0207643_10079300 3300025908 Bacteria 1900
478 Ga0207643_10380450 3300025908 Bacteria 890
479 Ga0207705_10002750 3300025909 Bacteria 13476
480 Ga0207705_10017204 3300025909 Bacteria 5178
481 Ga0207705_10059964 3300025909 Bacteria 2747
482 Ga0207705_10083940 3300025909 Bacteria 2325
483 Ga0207705_10086311 3300025909 Bacteria 2293
484 Ga0207705_10144399 3300025909 Bacteria 1779
485 Ga0207705_10149452 3300025909 Bacteria 1750
486 Ga0207705_10152083 3300025909 Bacteria 1734
487 Ga0207705_10152462 3300025909 Bacteria 1732
488 Ga0207705_10307266 3300025909 Bacteria 1217
489 Ga0207654_10404880 3300025911 Bacteria 949
490 Ga0207654_10725398 3300025911 Bacteria 715
491 Ga0207695_10017368 3300025913 Bacteria 8373
492 Ga0207695_10383894 3300025913 Bacteria 1290
493 Ga0207693_10151047 3300025915 Bacteria 1827
494 Ga0207693_10653489 3300025915 Bacteria 817
495 Ga0207660_10011367 3300025917 Bacteria 5791
496 Ga0207660_10440393 3300025917 Bacteria 1053
497 Ga0207660_10948234 3300025917 Bacteria 702
498 Ga0207662_10151591 3300025918 Bacteria 1475
499 Ga0207662_10871048 3300025918 Bacteria 637
500 Ga0207657_10015054 3300025919 Bacteria 7512
501 Ga0207657_10016909 3300025919 Bacteria 7018
502 Ga0207657_10024629 3300025919 Bacteria 5567
503 Ga0207657_10050495 3300025919 Bacteria 3620
504 Ga0207657_10070840 3300025919 Bacteria 2954
505 Ga0207657_10076339 3300025919 Bacteria 2827
506 Ga0207657_10081880 3300025919 Bacteria 2710
507 Ga0207657_10125342 3300025919 Bacteria 2110
508 Ga0207657_10179804 3300025919 Bacteria 1710
509 Ga0207657_10199431 3300025919 Bacteria 1611
510 Ga0207657_10203543 3300025919 Bacteria 1591
511 Ga0207657_10402509 3300025919 Bacteria 1076
512 Ga0207649_10005177 3300025920 Bacteria 7044
513 Ga0207649_10016184 3300025920 Bacteria 4201
514 Ga0207649_10016225 3300025920 Bacteria 4196
515 Ga0207649_10033493 3300025920 Bacteria 3070
516 Ga0207649_10132509 3300025920 Bacteria 1695
517 Ga0207649_10285158 3300025920 Bacteria 1202
518 Ga0207649_10392530 3300025920 Bacteria 1037
519 Ga0207649_10594691 3300025920 Bacteria 850
520 Ga0207649_10652438 3300025920 Bacteria 813
521 Ga0207652_10011488 3300025921 Bacteria 7139
522 Ga0207652_10163587 3300025921 Bacteria 1995
523 Ga0207652_10941935 3300025921 Bacteria 761
524 Ga0207681_10053866 3300025923 Bacteria 2732
525 Ga0207681_10124846 3300025923 Bacteria 1893
526 Ga0207681_10292320 3300025923 Bacteria 1286
527 Ga0207681_10427969 3300025923 Bacteria 1073
528 Ga0207694_10033824 3300025924 Bacteria 3917
529 Ga0207694_10038548 3300025924 Bacteria 3674
530 Ga0207694_10230821 3300025924 Bacteria 1511
531 Ga0207694_10926993 3300025924 Bacteria 737
532 Ga0207650_10103478 3300025925 Bacteria 2195
533 Ga0207650_10139052 3300025925 Bacteria 1908
534 Ga0207650_10381347 3300025925 Bacteria 1164
535 Ga0207650_10407450 3300025925 Bacteria 1126
536 Ga0207659_10366524 3300025926 Bacteria 1198
537 Ga0207659_10844029 3300025926 Bacteria 787
538 Ga0207687_10005139 3300025927 Bacteria 8679
539 Ga0207687_10014733 3300025927 Bacteria 5120
540 Ga0207687_10090326 3300025927 Bacteria 2232
541 Ga0207700_10074384 3300025928 Bacteria 2628
542 Ga0207700_10591892 3300025928 Bacteria 987
543 Ga0207664_10678954 3300025929 Bacteria 926
544 Ga0207644_10003327 3300025931 Bacteria 10372
545 Ga0207644_10003793 3300025931 Bacteria 9788
546 Ga0207644_10017839 3300025931 Bacteria 4800
547 Ga0207644_10046703 3300025931 Bacteria 3086
548 Ga0207690_10004697 3300025932 Bacteria 8064
549 Ga0207690_10010885 3300025932 Bacteria 5421
550 Ga0207690_10012286 3300025932 Bacteria 5125
551 Ga0207690_10015195 3300025932 Bacteria 4661
552 Ga0207690_10135495 3300025932 Bacteria 1808
553 Ga0207690_10205876 3300025932 Bacteria 1497
554 Ga0207690_10243367 3300025932 Bacteria 1386
555 Ga0207690_10339079 3300025932 Bacteria 1186
556 Ga0207690_10723385 3300025932 Bacteria 819
557 Ga0207706_10001849 3300025933 Bacteria 20744
558 Ga0207706_10003612 3300025933 Bacteria 14778
559 Ga0207706_10005749 3300025933 Bacteria 11548
560 Ga0207706_10013108 3300025933 Bacteria 7541
561 Ga0207706_10013397 3300025933 Bacteria 7456
562 Ga0207706_10024451 3300025933 Bacteria 5416
563 Ga0207706_10054567 3300025933 Bacteria 3526
564 Ga0207706_10110345 3300025933 Bacteria 2420
565 Ga0207706_10135315 3300025933 Bacteria 2168
566 Ga0207706_10205920 3300025933 Bacteria 1725
567 Ga0207706_10247961 3300025933 Bacteria 1556
568 Ga0207686_10017508 3300025934 Bacteria 4039
569 Ga0207686_10932067 3300025934 Unclassified 702
570 Ga0207709_10045139 3300025935 Bacteria 2667
571 Ga0207709_10083702 3300025935 Unclassified 2063
572 Ga0207670_10257092 3300025936 Unclassified 1352
573 Ga0207670_10327427 3300025936 Bacteria 1207
574 Ga0207669_10022882 3300025937 Bacteria 3327
575 Ga0207669_10236883 3300025937 Bacteria 1350
576 Ga0207669_10285300 3300025937 Bacteria 1247
577 Ga0207669_10335433 3300025937 Bacteria 1162
578 Ga0207704_10021163 3300025938 Bacteria 3457
579 Ga0207704_10026168 3300025938 Bacteria 3197
580 Ga0207704_10383081 3300025938 Bacteria 1104
581 Ga0207704_10408366 3300025938 Bacteria 1073
582 Ga0207665_10069144 3300025939 Bacteria 2407
583 Ga0207665_10074586 3300025939 Bacteria 2322
584 Ga0207691_10000281 3300025940 Bacteria 50396
585 Ga0207691_10004027 3300025940 Bacteria 14244
586 Ga0207691_10040023 3300025940 Bacteria 4334
587 Ga0207691_10185703 3300025940 Bacteria 1815
588 Ga0207691_10520967 3300025940 Bacteria 1009
589 Ga0207691_10835457 3300025940 Unclassified 773
590 Ga0207711_10012854 3300025941 Bacteria 6955
591 Ga0207711_10038671 3300025941 Bacteria 4057
592 Ga0207711_10065198 3300025941 Bacteria 3148
593 Ga0207689_10000212 3300025942 Bacteria 51394
594 Ga0207689_10004329 3300025942 Bacteria 12928
595 Ga0207689_10054194 3300025942 Bacteria 3304
596 Ga0207661_10012094 3300025944 Bacteria 6269
597 Ga0207661_10045326 3300025944 Bacteria 3480
598 Ga0207661_10091922 3300025944 Bacteria 2529
599 Ga0207661_10097320 3300025944 Bacteria 2464
600 Ga0207661_10149108 3300025944 Bacteria 2020
601 Ga0207679_10003489 3300025945 Bacteria 9725
602 Ga0207679_10035962 3300025945 Bacteria 3508
603 Ga0207679_10166083 3300025945 Bacteria 1812
604 Ga0207679_10181306 3300025945 Bacteria 1742
605 Ga0207679_10440167 3300025945 Bacteria 1154
606 Ga0207679_10793144 3300025945 Bacteria 863
607 Ga0207679_11514006 3300025945 Bacteria 615
608 Ga0207667_10015196 3300025949 Bacteria 8752
609 Ga0207667_10188653 3300025949 Bacteria 2116
610 Ga0207667_10273300 3300025949 Bacteria 1727
611 Ga0207667_10312761 3300025949 Bacteria 1604
612 Ga0207667_10340373 3300025949 Bacteria 1531
613 Ga0207667_10345203 3300025949 Bacteria 1518
614 Ga0207667_10429364 3300025949 Bacteria 1344
615 Ga0207667_10734446 3300025949 Bacteria 988
616 Ga0207651_10003802 3300025960 Bacteria 7478
617 Ga0207651_10056505 3300025960 Bacteria 2701
618 Ga0207651_10140327 3300025960 Bacteria 1865
619 Ga0207651_10312027 3300025960 Bacteria 1312
620 Ga0207712_10009268 3300025961 Bacteria 6228
621 Ga0207712_10146602 3300025961 Bacteria 1818
622 Ga0207668_10000064 3300025972 Bacteria 87025
623 Ga0207668_10056489 3300025972 Bacteria 2734
624 Ga0207668_10981128 3300025972 Bacteria 754
625 Ga0207640_10014314 3300025981 Bacteria 4563
626 Ga0207640_10029707 3300025981 Bacteria 3358
627 Ga0207640_10125616 3300025981 Bacteria 1846
628 Ga0207640_10299607 3300025981 Bacteria 1271
629 Ga0207640_10714835 3300025981 Bacteria 860
630 Ga0207640_10820292 3300025981 Bacteria 807
631 Ga0207640_11431354 3300025981 Bacteria 620
632 Ga0207658_10015776 3300025986 Bacteria 5186
633 Ga0207658_10075666 3300025986 Bacteria 2562
634 Ga0207658_10107505 3300025986 Bacteria 2198
635 Ga0207658_10139291 3300025986 Bacteria 1961
636 Ga0207658_10572711 3300025986 Bacteria 1012
637 Ga0207658_10864264 3300025986 Bacteria 823
638 Ga0207677_10007923 3300026023 Bacteria 5907
639 Ga0207677_10026376 3300026023 Bacteria 3643
640 Ga0207677_11057522 3300026023 Bacteria 738
641 Ga0207677_11237127 3300026023 Bacteria 684
642 Ga0207703_10007135 3300026035 Bacteria 8890
643 Ga0207703_10014555 3300026035 Bacteria 6137
644 Ga0207703_10069293 3300026035 Bacteria 2908
645 Ga0207703_11015975 3300026035 Bacteria 796
646 Ga0207703_11373658 3300026035 Bacteria 679
647 Ga0207639_10014989 3300026041 Bacteria 5462
648 Ga0207639_10050330 3300026041 Bacteria 3164
649 Ga0207639_10050628 3300026041 Bacteria 3155
650 Ga0207639_10095379 3300026041 Bacteria 2391
651 Ga0207639_10204568 3300026041 Bacteria 1695
652 Ga0207639_10318210 3300026041 Bacteria 1381
653 Ga0207639_10613222 3300026041 Bacteria 1004
654 Ga0207639_10797686 3300026041 Bacteria 880
655 Ga0207639_11171291 3300026041 Bacteria 721
656 Ga0207639_11456418 3300026041 Bacteria 643
657 Ga0207678_10000804 3300026067 Bacteria 28814
658 Ga0207678_10002098 3300026067 Bacteria 18049
659 Ga0207678_10077678 3300026067 Bacteria 2844
660 Ga0207678_10082406 3300026067 Bacteria 2752
661 Ga0207678_10123303 3300026067 Bacteria 2211
662 Ga0207678_10171804 3300026067 Bacteria 1851
663 Ga0207678_10180073 3300026067 Bacteria 1805
664 Ga0207678_10358876 3300026067 Bacteria 1257
665 Ga0207678_10668986 3300026067 Bacteria 913
666 Ga0207702_10016269 3300026078 Bacteria 6155
667 Ga0207702_10029965 3300026078 Bacteria 4532
668 Ga0207702_10063638 3300026078 Bacteria 3155
669 Ga0207702_10312221 3300026078 Bacteria 1495
670 Ga0207702_10330686 3300026078 Bacteria 1453
671 Ga0207702_10923120 3300026078 Bacteria 865
672 Ga0207702_12234078 3300026078 Unclassified 536
673 Ga0207702_12280946 3300026078 Bacteria 529
674 Ga0207641_10005615 3300026088 Bacteria 10688
675 Ga0207641_10016531 3300026088 Bacteria 6042
676 Ga0207641_10038600 3300026088 Bacteria 3992
677 Ga0207641_10254322 3300026088 Bacteria 1642
678 Ga0207641_10392129 3300026088 Bacteria 1332
679 Ga0207641_10583423 3300026088 Bacteria 1093
680 Ga0207648_10001054 3300026089 Bacteria 30851
681 Ga0207648_10013836 3300026089 Bacteria 7485
682 Ga0207648_10040131 3300026089 Bacteria 4113
683 Ga0207648_10053902 3300026089 Bacteria 3514
684 Ga0207648_10244049 3300026089 Bacteria 1600
685 Ga0207648_10356006 3300026089 Bacteria 1320
686 Ga0207676_10002351 3300026095 Bacteria 13511
687 Ga0207676_10047528 3300026095 Bacteria 3326
688 Ga0207676_10079944 3300026095 Bacteria 2652
689 Ga0207676_10325634 3300026095 Bacteria 1412
690 Ga0207676_10745243 3300026095 Bacteria 952
691 Ga0207674_10006084 3300026116 Bacteria 14260
692 Ga0207674_10006227 3300026116 Bacteria 14065
693 Ga0207674_10008398 3300026116 Bacteria 11937
694 Ga0207674_10008991 3300026116 Bacteria 11477
695 Ga0207674_10039586 3300026116 Bacteria 4885
696 Ga0207674_10062538 3300026116 Bacteria 3760
697 Ga0207674_10102855 3300026116 Bacteria 2836
698 Ga0207674_10137948 3300026116 Bacteria 2400
699 Ga0207674_10485481 3300026116 Bacteria 1194
700 Ga0207675_100029226 3300026118 Bacteria 5136
701 Ga0207675_100076256 3300026118 Bacteria 3139
702 Ga0207683_10002743 3300026121 Bacteria 15379
703 Ga0207683_10005377 3300026121 Bacteria 10976
704 Ga0207683_10509751 3300026121 Bacteria 1111
705 Ga0207698_10016179 3300026142 Bacteria 5020
706 Ga0207698_10025363 3300026142 Bacteria 4175
707 Ga0207698_10035291 3300026142 Bacteria 3657
708 Ga0207698_10047245 3300026142 Bacteria 3259
709 Ga0207698_10097986 3300026142 Bacteria 2421
710 Ga0207698_10105067 3300026142 Bacteria 2352
711 Ga0207698_10145433 3300026142 Bacteria 2049
712 Ga0207698_10150605 3300026142 Bacteria 2018
713 Ga0207698_10186008 3300026142 Bacteria 1845
714 Ga0207698_11131367 3300026142 Bacteria 796
715 Ga0268266_10004707 3300028379 Bacteria 12987
716 Ga0268266_10038153 3300028379 Bacteria 4091
717 Ga0268266_10075597 3300028379 Bacteria 2926
718 Ga0268266_10078027 3300028379 Bacteria 2881
719 Ga0268266_10421019 3300028379 Bacteria 1266
720 Ga0268265_10030046 3300028380 Bacteria 3909
721 Ga0268265_10032703 3300028380 Bacteria 3772
722 Ga0268265_10058941 3300028380 Bacteria 2934
723 Ga0268265_10101063 3300028380 Bacteria 2329
724 Ga0268265_10314587 3300028380 Bacteria 1415
725 Ga0268265_10464092 3300028380 Unclassified 1185
726 Ga0268265_10719488 3300028380 Bacteria 966
727 Ga0268264_10002242 3300028381 Bacteria 17146
728 Ga0268264_10408544 3300028381 Bacteria 1306
729 Ga0268264_10411290 3300028381 Unclassified 1302
730 Ga0307515_10398277 3300028794 Bacteria 1003
731 Ga0307513_10296447 3300031456 Bacteria 1386
732 Ga0307405_10096429 3300031731 Bacteria 1972
733 Ga0307405_10344030 3300031731 Bacteria 1148
734 Ga0307413_10170681 3300031824 Bacteria 1539
735 Ga0307410_10149357 3300031852 Bacteria 1738
736 Ga0307410_10155300 3300031852 Bacteria 1708
737 Ga0307406_10167301 3300031901 Bacteria 1587
738 Ga0307406_10284464 3300031901 Bacteria 1263
739 Ga0307407_10120391 3300031903 Bacteria 1663
740 Ga0307412_10112166 3300031911 Bacteria 1949
741 Ga0307409_100016136 3300031995 Bacteria 4932
742 Ga0307409_100061748 3300031995 Bacteria 2930
743 Ga0307409_100171341 3300031995 Bacteria 1911
744 Ga0307416_100131840 3300032002 Bacteria 2251
745 Ga0307414_10054071 3300032004 Bacteria 2804
746 Ga0307414_10123236 3300032004 Bacteria 1997
747 Ga0307414_10266528 3300032004 Bacteria 1432
748 Ga0307411_10001293 3300032005 Bacteria 10051
749 Ga0307411_10016919 3300032005 Bacteria 4139
750 Ga0307411_10035027 3300032005 Bacteria 3130
751 Ga0307411_10137367 3300032005 Bacteria 1797
752 Ga0307411_10240052 3300032005 Bacteria 1418
753 Ga0307415_100016346 3300032126 Bacteria 4421
754 Ga0307415_100065466 3300032126 Bacteria 2532
755 Ga0373929_0059374 3300035085 Bacteria 892
756 Ga0373923_0520566 3300035111 Unclassified 581
757 Ga0373939_0041058 3300035114 Bacteria 1393
758 Ga0373953_0144298 3300035117 Bacteria 1019
759 Ga0373954_0145991 3300035118 Bacteria 1155
760 Ga0373946_0083678 3300035171 Bacteria 1402
761 Ga0373955_0005727 3300035172 Bacteria 5598
762 Ga0373962_0014133 3300035242 Bacteria 2031
763 Ga0373935_0377901 3300035692 Bacteria 1014
764 Ga0373935_0468868 3300035692 Bacteria 911
765 Ga0373937_0012842 3300036401 Bacteria 7376
766 Ga0373937_0222536 3300036401 Bacteria 1777
767 Ga0395899_0000700 3300037312 Bacteria 33694
768 Ga0395899_0001653 3300037312 Bacteria 18590
769 Ga0395899_0001731 3300037312 Bacteria 18144
770 Ga0395899_0020257 3300037312 Bacteria 5047
771 Ga0395899_0033353 3300037312 Bacteria 3866
772 Ga0395899_0042320 3300037312 Bacteria 3401
773 Ga0395899_0054807 3300037312 Bacteria 2950
774 Ga0395899_0057216 3300037312 Bacteria 2879
775 Ga0395899_0098411 3300037312 Bacteria 2113
776 Ga0395899_0125521 3300037312 Bacteria 1835
777 Ga0395899_0144683 3300037312 Bacteria 1689
778 Ga0395899_0145021 3300037312 Bacteria 1686
779 Ga0395899_0154739 3300037312 Bacteria 1623
780 Ga0395899_0179092 3300037312 Bacteria 1489
781 Ga0395899_0218355 3300037312 Bacteria 1322
782 Ga0395899_0242376 3300037312 Bacteria 1240
783 Ga0395899_0375395 3300037312 Bacteria 946
784 Ga0395899_0522183 3300037312 Bacteria 767
785 Ga0395899_0554905 3300037312 Bacteria 738
786 Ga0395899_0841355 3300037312 Bacteria 564
787 Ga0395899_0927237 3300037312 Bacteria 529
788 Ga0395900_0000238 3300037418 Bacteria 86469
789 Ga0395900_0001814 3300037418 Bacteria 24441
790 Ga0395900_0004257 3300037418 Bacteria 15191
791 Ga0395900_0007827 3300037418 Bacteria 11015
792 Ga0395900_0011226 3300037418 Bacteria 9162
793 Ga0395900_0028779 3300037418 Bacteria 5695
794 Ga0395900_0055865 3300037418 Bacteria 4065
795 Ga0395900_0069465 3300037418 Bacteria 3620
796 Ga0395900_0076856 3300037418 Bacteria 3431
797 Ga0395900_0078607 3300037418 Bacteria 3389
798 Ga0395900_0136666 3300037418 Bacteria 2511
799 Ga0395900_0164033 3300037418 Bacteria 2265
800 Ga0395900_0171030 3300037418 Bacteria 2212
801 Ga0395900_0187351 3300037418 Bacteria 2100
802 Ga0395900_0190951 3300037418 Bacteria 2077
803 Ga0395900_0193894 3300037418 Bacteria 2059
804 Ga0395900_0256590 3300037418 Bacteria 1747
805 Ga0395900_0307256 3300037418 Bacteria 1570
806 Ga0395900_0310686 3300037418 Bacteria 1559
807 Ga0395900_0349736 3300037418 Bacteria 1452
808 Ga0395900_0379182 3300037418 Bacteria 1382
809 Ga0395900_0437602 3300037418 Bacteria 1266
810 Ga0395900_0495322 3300037418 Bacteria 1173
811 Ga0395900_0512249 3300037418 Bacteria 1149
812 Ga0395900_0583218 3300037418 Bacteria 1060
813 Ga0395900_0597439 3300037418 Unclassified 1044
814 Ga0395900_0871153 3300037418 Bacteria 825
815 Ga0395900_0949902 3300037418 Bacteria 781
816 Ga0395900_1073911 3300037418 Bacteria 723
817 Ga0395900_1800665 3300037418 Bacteria 523
818 Ga0395898_0000245 3300037466 Bacteria 136315
819 Ga0395898_0001652 3300037466 Bacteria 30116
820 Ga0395898_0006981 3300037466 Bacteria 12005
821 Ga0395898_0027020 3300037466 Bacteria 5765
822 Ga0395898_0032280 3300037466 Bacteria 5226
823 Ga0395898_0045137 3300037466 Bacteria 4332
824 Ga0395898_0049823 3300037466 Bacteria 4102
825 Ga0395898_0053526 3300037466 Bacteria 3942
826 Ga0395898_0130881 3300037466 Bacteria 2403
827 Ga0395898_0160600 3300037466 Bacteria 2149
828 Ga0395898_0173600 3300037466 Bacteria 2060
829 Ga0395898_0180423 3300037466 Bacteria 2018
830 Ga0395898_0183484 3300037466 Bacteria 1999
831 Ga0395898_0217773 3300037466 Bacteria 1821
832 Ga0395898_0479600 3300037466 Bacteria 1183
833 Ga0395898_0537682 3300037466 Bacteria 1110
834 Ga0395898_0591449 3300037466 Bacteria 1052
835 Ga0395898_0664850 3300037466 Bacteria 984
836 Ga0395898_0996314 3300037466 Bacteria 774
837 Ga0395898_1247305 3300037466 Bacteria 674
838 Ga0395905_0000006 3300037471 Bacteria 549428
839 Ga0395905_0000207 3300037471 Bacteria 91620
840 Ga0395905_0001434 3300037471 Bacteria 28687
841 Ga0395905_0002904 3300037471 Bacteria 18697
842 Ga0395905_0003926 3300037471 Bacteria 15644
843 Ga0395905_0005557 3300037471 Bacteria 12851
844 Ga0395905_0013537 3300037471 Bacteria 7814
845 Ga0395905_0013951 3300037471 Bacteria 7685
846 Ga0395905_0020251 3300037471 Bacteria 6302
847 Ga0395905_0036687 3300037471 Bacteria 4605
848 Ga0395905_0043790 3300037471 Bacteria 4199
849 Ga0395905_0045333 3300037471 Bacteria 4124
850 Ga0395905_0051661 3300037471 Bacteria 3850
851 Ga0395905_0053115 3300037471 Bacteria 3793
852 Ga0395905_0061558 3300037471 Bacteria 3511
853 Ga0395905_0068266 3300037471 Bacteria 3330
854 Ga0395905_0081544 3300037471 Bacteria 3031
855 Ga0395905_0090341 3300037471 Bacteria 2871
856 Ga0395905_0094529 3300037471 Bacteria 2804
857 Ga0395905_0116695 3300037471 Bacteria 2509
858 Ga0395905_0123182 3300037471 Bacteria 2438
859 Ga0395905_0131639 3300037471 Bacteria 2352
860 Ga0395905_0136533 3300037471 Bacteria 2307
861 Ga0395905_0140690 3300037471 Bacteria 2270
862 Ga0395905_0146122 3300037471 Bacteria 2224
863 Ga0395905_0165598 3300037471 Bacteria 2077
864 Ga0395905_0167805 3300037471 Bacteria 2062
865 Ga0395905_0180766 3300037471 Bacteria 1980
866 Ga0395905_0207381 3300037471 Bacteria 1837
867 Ga0395905_0224630 3300037471 Bacteria 1757
868 Ga0395905_0260373 3300037471 Bacteria 1619
869 Ga0395905_0289671 3300037471 Bacteria 1524
870 Ga0395905_0294855 3300037471 Bacteria 1509
871 Ga0395905_0557083 3300037471 Bacteria 1047
872 Ga0395905_0581649 3300037471 Bacteria 1021
873 Ga0395905_0680159 3300037471 Bacteria 931
874 Ga0395901_0000156 3300038443 Bacteria 88513
875 Ga0395901_0000499 3300038443 Bacteria 45514
876 Ga0395901_0000707 3300038443 Bacteria 38127
877 Ga0395901_0017559 3300038443 Bacteria 7304
878 Ga0395901_0020576 3300038443 Bacteria 6752
879 Ga0395901_0063160 3300038443 Bacteria 3854
880 Ga0395901_0075324 3300038443 Bacteria 3520
881 Ga0395901_0082321 3300038443 Bacteria 3362
882 Ga0395901_0095103 3300038443 Bacteria 3122
883 Ga0395901_0119497 3300038443 Bacteria 2769
884 Ga0395901_0183230 3300038443 Bacteria 2196
885 Ga0395901_0190497 3300038443 Bacteria 2151
886 Ga0395901_0220164 3300038443 Bacteria 1984
887 Ga0395901_0221290 3300038443 Bacteria 1978
888 Ga0395901_0287649 3300038443 Bacteria 1706
889 Ga0395901_0345852 3300038443 Bacteria 1535
890 Ga0395901_0409426 3300038443 Bacteria 1392
891 Ga0395901_0457179 3300038443 Bacteria 1305
892 Ga0395901_0749888 3300038443 Bacteria 969
893 Ga0395901_1365518 3300038443 Bacteria 668
894 Ga0436365_1451682 3300039437 Bacteria 8284
895 Ga0436362_0319299 3300039453 Bacteria 984
896 Ga0439458_0001218 3300042157 Bacteria 6501
897 Ga0439458_0021631 3300042157 Bacteria 1491
898 Ga0439464_0000226 3300042439 Bacteria 10224
899 Ga0439464_0277465 3300042439 Bacteria 545
900 Ga0466972_0083639 3300044658 Bacteria 1518
901 Ga0466972_0146081 3300044658 Bacteria 1112
902 Ga0466972_0296989 3300044658 Bacteria 755
903 Ga0466965_0083201 3300044683 Bacteria 1620
904 Ga0466961_0015310 3300044693 Bacteria 4926
905 Ga0466961_0382601 3300044693 Bacteria 855
906 Ga0466961_0634188 3300044693 Bacteria 642
907 Ga0466963_0001409 3300044694 Bacteria 12914
908 Ga0466963_0023516 3300044694 Bacteria 3914
909 Ga0466963_0043473 3300044694 Bacteria 2954
910 Ga0466963_0137449 3300044694 Bacteria 1691
911 Ga0466963_0243449 3300044694 Bacteria 1261
912 Ga0466963_0297326 3300044694 Bacteria 1135
913 Ga0466963_0321231 3300044694 Bacteria 1089
914 Ga0466963_1220513 3300044694 Bacteria 528
915 Ga0466964_0058940 3300044706 Bacteria 1593
916 Ga0466964_0150468 3300044706 Bacteria 1078
917 Ga0466964_0682665 3300044706 Bacteria 571
918 Ga0466971_0014040 3300044719 Bacteria 3521
919 Ga0466971_0023501 3300044719 Bacteria 2748
920 Ga0466971_0121063 3300044719 Bacteria 1211
921 Ga0466971_0542705 3300044719 Bacteria 576
922 Ga0466968_0110308 3300044735 Bacteria 1237
923 Ga0466970_0298639 3300044765 Bacteria 908
924 Ga0466970_0422014 3300044765 Bacteria 763
925 Ga0466970_0747322 3300044765 Bacteria 571
926 Ga0466957_0001128 3300044842 Bacteria 13843
927 Ga0466957_0006513 3300044842 Bacteria 6595
928 Ga0466957_0034136 3300044842 Bacteria 3052
929 Ga0466957_0222609 3300044842 Bacteria 1246
930 Ga0466957_0541601 3300044842 Bacteria 810
931 Ga0466957_0542398 3300044842 Bacteria 810
932 Ga0466960_0054386 3300044901 Bacteria 1943
933 Ga0466960_0455111 3300044901 Bacteria 744
934 Ga0466960_0582937 3300044901 Bacteria 662
935 Ga0466960_0604586 3300044901 Bacteria 651
936 Ga0466959_0428798 3300045049 Unclassified 897
937 Ga0466958_0008532 3300045836 Bacteria 5690
938 Ga0466958_0213873 3300045836 Bacteria 1229
939 Ga0466967_0000368 3300045976 Bacteria 20984
940 Ga0466967_0010342 3300045976 Bacteria 6994
941 Ga0466967_0012867 3300045976 Bacteria 6431
942 Ga0466967_0055207 3300045976 Bacteria 3499
943 Ga0466967_0055233 3300045976 Bacteria 3498
944 Ga0466967_0075706 3300045976 Bacteria 3025
945 Ga0466967_0089336 3300045976 Bacteria 2797
946 Ga0466967_0091669 3300045976 Bacteria 2762
947 Ga0466967_0170906 3300045976 Bacteria 2045
948 Ga0466967_0186742 3300045976 Bacteria 1957
949 Ga0466967_0234977 3300045976 Bacteria 1746
950 Ga0466967_0305455 3300045976 Bacteria 1531
951 Ga0466967_0333680 3300045976 Bacteria 1465
952 Ga0466967_0400537 3300045976 Bacteria 1335
953 Ga0466967_0863601 3300045976 Unclassified 899
954 Ga0495663_0150670 3300046525 Bacteria 793
955 Ga0495598_0000085 3300046537 Bacteria 15414
956 Ga0495621_0000048 3300046539 Bacteria 23712
957 Ga0495668_0080566 3300046616 Bacteria 1787
958 Ga0495668_0184140 3300046616 Bacteria 1144
959 Ga0495669_0036025 3300046684 Bacteria 2186
960 Ga0495669_0082773 3300046684 Bacteria 1475
961 Ga0495677_0098022 3300047445 Bacteria 1108
962 Ga0495602_0038545 3300048088 Bacteria 4417
963 Ga0496100_0194477 3300048903 Bacteria 1474
964 Ga0496100_0364882 3300048903 Bacteria 1094
965 Ga0496101_0006891 3300048904 Bacteria 7333
966 Ga0496101_0114220 3300048904 Bacteria 2036
967 Ga0496102_0020081 3300048905 Bacteria 5898
968 Ga0496103_0032361 3300048906 Bacteria 3191
969 Ga0496104_0018630 3300048907 Bacteria 6337
970 Ga0496105_0049162 3300048908 Bacteria 3481
971 Ga0496105_0272755 3300048908 Bacteria 1366
972 Ga0496106_0012322 3300048909 Bacteria 6311
973 Ga0496107_0010319 3300048910 Bacteria 6487
974 Ga0496107_0355485 3300048910 Unclassified 1090
975 Ga0496107_0868544 3300048910 Bacteria 658
976 Ga0496108_0034896 3300048911 Bacteria 4179
977 Ga0496108_0073144 3300048911 Bacteria 2894
978 Ga0496109_0057525 3300048912 Bacteria 3549
979 Ga0496109_0898818 3300048912 Bacteria 823
980 Ga0496110_0006682 3300048913 Bacteria 9166
981 Ga0496110_0012193 3300048913 Bacteria 7061
982 Ga0496111_0014622 3300048914 Bacteria 5368
983 Ga0496112_0011451 3300048915 Bacteria 8100
984 Ga0496112_0062735 3300048915 Bacteria 3666
985 Ga0496112_0080660 3300048915 Bacteria 3217
986 Ga0496113_0032260 3300048916 Bacteria 3806
987 Ga0496113_0034921 3300048916 Bacteria 3673
988 Ga0496113_0039937 3300048916 Bacteria 3456
989 Ga0496114_0000021 3300048917 Bacteria 227038
990 Ga0501067_0030650 3300049583 Bacteria 2983
991 Ga0501068_0474743 3300049584 Bacteria 810
992 Ga0501204_003020 3300049850 Bacteria 1742
993 nmdc:mga03683_73317_c2 3300050489 Bacteria 1000
994 nmdc:mga07m45_308465_c1 3300050496 Bacteria 920
995 nmdc:mga0a205_19346_c1 3300050515 Bacteria 6418
996 Ga0495595_0559710 3300053084 Bacteria 584
997 Ga0587073_0074073 3300059492 Bacteria 829
998 Ga0587088_107901 3300059508 Bacteria 630
999 Ga0587106_015014 3300059605 Bacteria 1076
1000 Ga0587106_075673 3300059605 Bacteria 646
1001 Ga0466962_0001188 3300061719 Bacteria 12013
1002 Ga0466962_0061860 3300061719 Bacteria 1787
1003 Ga0466962_0067620 3300061719 Bacteria 1706
1004 Ga0530510_0324840 3300061734 Bacteria 1154
1005 Ga0105245_10079228
1006 JGI24736J21556_1012661
1007 JGI24741J21665_1042821
1008 JGI24741J21665_1055634
1009 JGI24741J21665_1057883
1010 JGI24740J21852_10036305
1011 JGI24740J21852_10093268
1012 JGI24740J21852_10098656
1013 JGI24739J22299_10003665
1014 JGI24739J22299_10004275
1015 JGI24739J22299_10042244
1016 JGI24739J22299_10050203
1017 JGI24739J22299_10117140
1018 JGI24739J22299_10140382
1019 JGI24737J22298_10000016
1020 JGI24737J22298_10003155
1021 JGI24737J22298_10004505
1022 JGI24737J22298_10012430
1023 JGI24737J22298_10023189
1024 JGI24737J22298_10152611
1025 JGI24743J22301_10088074
1026 JGI24735J21928_10012119
1027 JGI24735J21928_10072447
1028 JGI24750J21931_1060741
1029 JGI24748J21848_1006301
1030 JGI24738J21930_10000066
1031 JGI24738J21930_10006636
1032 JGI24738J21930_10030609
1033 JGI24738J21930_10060358
1034 JGI24744J21845_10024878
1035 JGI24035J26624_1010184
1036 JGI24034J26672_10049671
1037 Ga0065715_10153538
1038 Ga0065707_11076697
1039 Ga0070658_10009978
1040 Ga0070658_10014335
1041 Ga0070658_10041641
1042 Ga0070658_10113116
1043 Ga0070658_10124649
1044 Ga0070658_10309236
1045 Ga0070658_10342086
1046 Ga0070658_10399536
1047 Ga0070676_10030392
1048 Ga0070676_10037776
1049 Ga0070676_10076848
1050 Ga0070676_10085238
1051 Ga0070676_10219631
1052 Ga0070676_10267187
1053 Ga0070683_100012530
1054 Ga0070683_100015287
1055 Ga0070683_100036720
1056 Ga0070683_100437785
1057 Ga0070683_100459908
1058 Ga0070690_100015806
1059 Ga0070670_100058524
1060 Ga0070670_100209980
1061 Ga0070670_100249261
1062 Ga0070670_100296478
1063 Ga0070677_10332958
1064 Ga0070666_10004467
1065 Ga0070666_10008694
1066 Ga0070666_10021588
1067 Ga0070666_10173967
1068 Ga0070666_10322073
1069 Ga0070680_100008383
1070 Ga0070680_100026279
1071 Ga0070682_100043699
1072 Ga0070682_100086628
1073 Ga0070682_100102373
1074 Ga0070682_100102993
1075 Ga0068868_100008558
1076 Ga0068868_100008869
1077 Ga0068868_100111307
1078 Ga0068868_100293889
1079 Ga0068868_100360613
1080 Ga0068868_100462853
1081 Ga0068868_100547420
1082 Ga0070660_100008914
1083 Ga0070660_100022040
1084 Ga0070660_100026129
1085 Ga0070660_100036641
1086 Ga0070660_100064826
1087 Ga0070660_100071153
1088 Ga0070660_100074958
1089 Ga0070660_100263261
1090 Ga0070660_100288847
1091 Ga0070660_100346072
1092 Ga0070660_100550374
1093 Ga0070689_100410071
1094 Ga0070689_100764323
1095 Ga0070691_10000860
1096 Ga0070687_100879370
1097 Ga0070661_100008509
1098 Ga0070661_100008531
1099 Ga0070661_100033695
1100 Ga0070661_100060594
1101 Ga0070661_100087280
1102 Ga0070661_100090138
1103 Ga0070661_100137739
1104 Ga0070661_100191209
1105 Ga0070661_100219476
1106 Ga0070692_10012038
1107 Ga0070692_10022984
1108 Ga0070692_10316677
1109 Ga0070668_100002981
1110 Ga0070668_100039375
1111 Ga0070668_100063545
1112 Ga0070668_100081964
1113 Ga0070668_100241765
1114 Ga0070669_100000811
1115 Ga0070669_100078731
1116 Ga0070669_100088050
1117 Ga0070669_100396229
1118 Ga0070669_100775233
1119 Ga0070669_101141843
1120 Ga0070675_100087782
1121 Ga0070675_100147970
1122 Ga0070671_100000417
1123 Ga0070671_100026515
1124 Ga0070671_100050835
1125 Ga0070671_100078988
1126 Ga0070671_100263776
1127 Ga0070671_100777996
1128 Ga0070674_100006227
1129 Ga0070674_100010348
1130 Ga0070674_100026187
1131 Ga0070674_100244804
1132 Ga0070673_100000661
1133 Ga0070673_100005423
1134 Ga0070673_100007346
1135 Ga0070673_100061297
1136 Ga0070673_100128924
1137 Ga0070673_100170236
1138 Ga0070673_100319759
1139 Ga0070673_100790351
1140 Ga0070659_100001375
1141 Ga0070659_100007488
1142 Ga0070659_100020785
1143 Ga0070659_100057095
1144 Ga0070659_100067465
1145 Ga0070659_100108796
1146 Ga0070659_100164585
1147 Ga0070659_100164703
1148 Ga0070659_100327857
1149 Ga0070659_100344972
1150 Ga0070659_100373036
1151 Ga0070659_100401114
1152 Ga0070667_100001733
1153 Ga0070667_100014955
1154 Ga0070667_100017525
1155 Ga0070667_100028726
1156 Ga0070667_100076113
1157 Ga0070667_100132002
1158 Ga0070667_100193905
1159 Ga0070667_100257533
1160 Ga0070667_101350471
1161 Ga0070709_10008800
1162 Ga0070714_100017416
1163 Ga0070714_100095116
1164 Ga0070714_100414634
1165 Ga0070714_100638803
1166 Ga0070713_100003318
1167 Ga0070713_101401235
1168 Ga0070705_100746379
1169 Ga0070694_100004307
1170 Ga0070663_100015878
1171 Ga0070663_100071896
1172 Ga0070663_100397647
1173 Ga0070663_100407389
1174 Ga0070663_100469811
1175 Ga0070663_100622055
1176 Ga0070663_100719493
1177 Ga0070663_100863515
1178 Ga0070663_100866659
1179 Ga0070678_100013692
1180 Ga0070678_100016448
1181 Ga0070662_100000475
1182 Ga0070662_100008521
1183 Ga0070662_100016737
1184 Ga0070662_100017857
1185 Ga0070662_100018187
1186 Ga0070662_100034765
1187 Ga0070662_100070136
1188 Ga0070662_100171571
1189 Ga0070662_100187690
1190 Ga0070662_100190808
1191 Ga0070662_100196640
1192 Ga0070662_100380466
1193 Ga0070681_10067162
1194 Ga0070681_10077454
1195 Ga0070681_11322097
1196 Ga0068867_100008448
1197 Ga0068867_100015417
1198 Ga0068867_100115917
1199 Ga0068867_100477195
1200 Ga0070685_10084545
1201 Ga0070679_100129166
1202 Ga0070679_100148712
1203 Ga0070679_100183877
1204 Ga0070679_101145325
1205 Ga0070679_101148485
1206 Ga0070684_100005253
1207 Ga0070684_100108474
1208 Ga0070684_100523066
1209 Ga0068853_100033351
1210 Ga0068853_100038331
1211 Ga0068853_100046645
1212 Ga0068853_100058003
1213 Ga0068853_100065439
1214 Ga0068853_100147798
1215 Ga0068853_100317050
1216 Ga0068853_100379058
1217 Ga0068853_101877186
1218 Ga0070672_100000284
1219 Ga0070672_100019705
1220 Ga0070672_100077356
1221 Ga0070672_100197150
1222 Ga0070672_100217773
1223 Ga0070672_100226420
1224 Ga0070672_100561672
1225 Ga0070686_100082056
1226 Ga0070695_100089353
1227 Ga0070696_100226525
1228 Ga0070665_100111971
1229 Ga0068855_100014948
1230 Ga0068855_100146366
1231 Ga0068855_100146954
1232 Ga0068855_100174361
1233 Ga0068855_100306140
1234 Ga0068855_100346398
1235 Ga0068855_100422199
1236 Ga0068855_100635663
1237 Ga0068855_100751842
1238 Ga0070664_100005642
1239 Ga0070664_100013402
1240 Ga0070664_100018295
1241 Ga0070664_100020503
1242 Ga0070664_100041124
1243 Ga0070664_100129645
1244 Ga0070664_100293204
1245 Ga0070664_100500844
1246 Ga0070664_100550408
1247 Ga0070664_100575562
1248 Ga0068857_100002439
1249 Ga0068857_100004560
1250 Ga0068857_100009210
1251 Ga0068857_100031955
1252 Ga0068857_100033858
1253 Ga0068857_100090230
1254 Ga0068857_100186522
1255 Ga0068857_100666926
1256 Ga0068854_100005153
1257 Ga0068854_100005537
1258 Ga0068854_100018924
1259 Ga0068854_100058462
1260 Ga0068854_100192359
1261 Ga0068854_101593360
1262 Ga0068856_100053082
1263 Ga0068856_100079698
1264 Ga0068856_100095097
1265 Ga0068856_100133269
1266 Ga0068856_100166347
1267 Ga0068856_100376973
1268 Ga0068856_101423399
1269 Ga0068856_101630196
1270 Ga0070702_100327422
1271 Ga0070702_100794463
1272 Ga0068852_100001669
1273 Ga0068852_100014747
1274 Ga0068852_100019190
1275 Ga0068852_100031088
1276 Ga0068852_100056474
1277 Ga0068852_100115948
1278 Ga0068852_100270343
1279 Ga0068852_100655582
1280 Ga0068852_100711546
1281 Ga0068852_101383985
1282 Ga0068859_100018796
1283 Ga0068859_100034050
1284 Ga0068859_100042204
1285 Ga0068859_100050979
1286 Ga0068859_100163865
1287 Ga0068859_100249486
1288 Ga0068859_101625089
1289 Ga0068864_100001467
1290 Ga0068864_100002129
1291 Ga0068864_100012677
1292 Ga0068864_100198537
1293 Ga0068864_100244754
1294 Ga0068866_10003114
1295 Ga0068866_10548472
1296 Ga0068866_10621621
1297 Ga0068861_100051097
1298 Ga0068861_100669786
1299 Ga0068851_10011075
1300 Ga0068851_10012432
1301 Ga0068863_100001129
1302 Ga0068863_100008776
1303 Ga0068863_100034400
1304 Ga0068863_100252756
1305 Ga0068863_100547900
1306 Ga0068863_100788963
1307 Ga0068858_100003837
1308 Ga0068858_100042385
1309 Ga0068858_100048012
1310 Ga0068858_100057001
1311 Ga0068858_100385174
1312 Ga0068858_100917883
1313 Ga0068860_100007140
1314 Ga0068860_100030489
1315 Ga0068860_100044792
1316 Ga0068860_100159486
1317 Ga0068860_100176550
1318 Ga0068862_100041359
1319 Ga0068862_100153990
1320 Ga0068862_100214333
1321 Ga0068862_100382821
1322 Ga0068862_101018354
1323 Ga0081540_1112534
1324 Ga0070717_10009085
1325 Ga0070717_10039961
1326 Ga0070717_10560205
1327 Ga0070716_100528150
1328 Ga0070712_100013495
1329 Ga0075362_10027094
1330 Ga0097621_100020665
1331 Ga0097621_100245849
1332 Ga0097621_100564581
1333 Ga0097621_101648561
1334 Ga0068871_100068039
1335 Ga0068871_100070647
1336 Ga0068871_100268904
1337 Ga0068871_100522817
1338 Ga0068871_101115950
1339 Ga0068871_101168897
1340 Ga0075433_10028690
1341 Ga0075429_100473039
1342 Ga0068865_100004261
1343 Ga0068865_100008396
1344 Ga0097620_100018796
1345 Ga0097620_100034049
1346 Ga0097620_100042204
1347 Ga0097620_100050978
1348 Ga0097620_100163880
1349 Ga0097620_100249476
1350 Ga0097620_101624901
1351 Ga0075435_101056347
1352 Ga0105240_10020543
1353 Ga0105240_10274173
1354 Ga0111539_10392989
1355 Ga0105245_10001374
1356 Ga0105245_10011486
1357 Ga0105245_10679045
1358 Ga0105247_10338668
1359 Ga0105243_10047385
1360 Ga0105243_10166368
1361 Ga0105243_10201756
1362 Ga0105241_10151222
1363 Ga0105241_10727016
1364 Ga0105242_10007813
1365 Ga0105242_10671242
1366 Ga0105242_11488828
1367 Ga0105242_11787895
1368 Ga0105248_10001396
1369 Ga0105248_10021620
1370 Ga0105248_10064910
1371 Ga0105248_10189362
1372 Ga0105248_11110635
1373 Ga0105237_10062327
1374 Ga0105238_10052817
1375 Ga0105238_10077916
1376 Ga0105238_11563637
1377 Ga0105249_10007160
1378 Ga0105249_10010165
1379 Ga0105249_10105735
1380 Ga0105249_10373759
1381 Ga0105249_11082388
1382 Ga0105239_10244209
1383 Ga0105239_10256531
1384 Ga0105239_10335878
1385 Ga0105239_10398830
1386 Ga0105246_10020885
1387 Ga0105246_10053462
1388 Ga0157373_10031807
1389 Ga0157373_10040588
1390 Ga0157373_10041510
1391 Ga0157373_10119090
1392 Ga0157373_10139027
1393 Ga0157373_10143068
1394 Ga0157373_10261059
1395 Ga0157373_10320844
1396 Ga0157373_10725610
1397 Ga0157373_10773839
1398 Ga0157371_10006646
1399 Ga0157371_10017225
1400 Ga0157371_10018093
1401 Ga0157371_10036833
1402 Ga0157371_10119977
1403 Ga0157371_10137867
1404 Ga0157371_10338659
1405 Ga0157371_10385604
1406 Ga0157371_10460222
1407 Ga0157370_10010372
1408 Ga0157370_10028351
1409 Ga0157370_10103209
1410 Ga0157370_10103361
1411 Ga0157370_10372718
1412 Ga0157369_10062303
1413 Ga0157369_10094810
1414 Ga0157369_10122702
1415 Ga0157369_10145603
1416 Ga0157369_11337229
1417 Ga0157374_10019971
1418 Ga0157374_10188596
1419 Ga0157374_10232443
1420 Ga0157378_10002115
1421 Ga0157378_10072822
1422 Ga0157378_10104336
1423 Ga0157378_11356325
1424 Ga0157378_11771903
1425 Ga0157378_11842607
1426 Ga0163162_10014054
1427 Ga0163162_10029515
1428 Ga0163162_10040856
1429 Ga0163162_10514884
1430 Ga0163162_10622342
1431 Ga0163162_10813427
1432 Ga0157372_10031600
1433 Ga0157372_10187330
1434 Ga0157372_10518012
1435 Ga0157375_10020757
1436 Ga0157375_10101928
1437 Ga0157375_10384043
1438 Ga0157375_10543298
1439 Ga0157375_10919086
1440 Ga0157375_11179018
1441 Ga0163163_10026094
1442 Ga0182008_10409900
1443 Ga0182008_10423711
1444 Ga0157377_10056311
1445 Ga0157377_10417863
1446 Ga0157379_10066402
1447 Ga0157379_11092909
1448 Ga0157376_10010934
1449 Ga0163161_10078962
1450 Ga0163161_11960505
1451 Ga0206352_10760739
1452 Ga0206354_11245067
1453 Ga0207697_10000144
1454 Ga0207697_10119952
1455 Ga0207697_10158860
1456 Ga0207656_10006948
1457 Ga0207656_10045139
1458 Ga0207682_10148480
1459 Ga0207642_10173954
1460 Ga0207642_10243988
1461 Ga0207688_10000184
1462 Ga0207688_10049186
1463 Ga0207688_10636609
1464 Ga0207680_10005234
1465 Ga0207680_10093408
1466 Ga0207647_10000753
1467 Ga0207647_10007510
1468 Ga0207647_10007626
1469 Ga0207647_10035280
1470 Ga0207647_10044972
1471 Ga0207647_10086761
1472 Ga0207647_10094821
1473 Ga0207647_10098369
1474 Ga0207647_10427982
1475 Ga0207699_10096628
1476 Ga0207645_10034317
1477 Ga0207645_10081251
1478 Ga0207645_10087299
1479 Ga0207645_10143347
1480 Ga0207645_10193375
1481 Ga0207643_10079300
1482 Ga0207643_10380450
1483 Ga0207705_10002750
1484 Ga0207705_10017204
1485 Ga0207705_10059964
1486 Ga0207705_10083940
1487 Ga0207705_10086311
1488 Ga0207705_10144399
1489 Ga0207705_10149452
1490 Ga0207705_10152083
1491 Ga0207705_10152462
1492 Ga0207705_10307266
1493 Ga0207654_10404880
1494 Ga0207654_10725398
1495 Ga0207695_10017368
1496 Ga0207695_10383894
1497 Ga0207693_10151047
1498 Ga0207693_10653489
1499 Ga0207660_10011367
1500 Ga0207660_10440393
1501 Ga0207660_10948234
1502 Ga0207662_10151591
1503 Ga0207662_10871048
1504 Ga0207657_10015054
1505 Ga0207657_10016909
1506 Ga0207657_10024629
1507 Ga0207657_10050495
1508 Ga0207657_10070840
1509 Ga0207657_10076339
1510 Ga0207657_10081880
1511 Ga0207657_10125342
1512 Ga0207657_10179804
1513 Ga0207657_10199431
1514 Ga0207657_10203543
1515 Ga0207657_10402509
1516 Ga0207649_10005177
1517 Ga0207649_10016184
1518 Ga0207649_10016225
1519 Ga0207649_10033493
1520 Ga0207649_10132509
1521 Ga0207649_10285158
1522 Ga0207649_10392530
1523 Ga0207649_10594691
1524 Ga0207649_10652438
1525 Ga0207652_10011488
1526 Ga0207652_10163587
1527 Ga0207652_10941935
1528 Ga0207681_10053866
1529 Ga0207681_10124846
1530 Ga0207681_10292320
1531 Ga0207681_10427969
1532 Ga0207694_10033824
1533 Ga0207694_10038548
1534 Ga0207694_10230821
1535 Ga0207694_10926993
1536 Ga0207650_10103478
1537 Ga0207650_10139052
1538 Ga0207650_10381347
1539 Ga0207650_10407450
1540 Ga0207659_10366524
1541 Ga0207659_10844029
1542 Ga0207687_10005139
1543 Ga0207687_10014733
1544 Ga0207687_10090326
1545 Ga0207700_10074384
1546 Ga0207700_10591892
1547 Ga0207664_10678954
1548 Ga0207644_10003327
1549 Ga0207644_10003793
1550 Ga0207644_10017839
1551 Ga0207644_10046703
1552 Ga0207690_10004697
1553 Ga0207690_10010885
1554 Ga0207690_10012286
1555 Ga0207690_10015195
1556 Ga0207690_10135495
1557 Ga0207690_10205876
1558 Ga0207690_10243367
1559 Ga0207690_10339079
1560 Ga0207690_10723385
1561 Ga0207706_10001849
1562 Ga0207706_10003612
1563 Ga0207706_10005749
1564 Ga0207706_10013108
1565 Ga0207706_10013397
1566 Ga0207706_10024451
1567 Ga0207706_10054567
1568 Ga0207706_10110345
1569 Ga0207706_10135315
1570 Ga0207706_10205920
1571 Ga0207706_10247961
1572 Ga0207686_10017508
1573 Ga0207686_10932067
1574 Ga0207709_10045139
1575 Ga0207709_10083702
1576 Ga0207670_10257092
1577 Ga0207670_10327427
1578 Ga0207669_10022882
1579 Ga0207669_10236883
1580 Ga0207669_10285300
1581 Ga0207669_10335433
1582 Ga0207704_10021163
1583 Ga0207704_10026168
1584 Ga0207704_10383081
1585 Ga0207704_10408366
1586 Ga0207665_10069144
1587 Ga0207665_10074586
1588 Ga0207691_10000281
1589 Ga0207691_10004027
1590 Ga0207691_10040023
1591 Ga0207691_10185703
1592 Ga0207691_10520967
1593 Ga0207691_10835457
1594 Ga0207711_10012854
1595 Ga0207711_10038671
1596 Ga0207711_10065198
1597 Ga0207689_10000212
1598 Ga0207689_10004329
1599 Ga0207689_10054194
1600 Ga0207661_10012094
1601 Ga0207661_10045326
1602 Ga0207661_10091922
1603 Ga0207661_10097320
1604 Ga0207661_10149108
1605 Ga0207679_10003489
1606 Ga0207679_10035962
1607 Ga0207679_10166083
1608 Ga0207679_10181306
1609 Ga0207679_10440167
1610 Ga0207679_10793144
1611 Ga0207679_11514006
1612 Ga0207667_10015196
1613 Ga0207667_10188653
1614 Ga0207667_10273300
1615 Ga0207667_10312761
1616 Ga0207667_10340373
1617 Ga0207667_10345203
1618 Ga0207667_10429364
1619 Ga0207667_10734446
1620 Ga0207651_10003802
1621 Ga0207651_10056505
1622 Ga0207651_10140327
1623 Ga0207651_10312027
1624 Ga0207712_10009268
1625 Ga0207712_10146602
1626 Ga0207668_10000064
1627 Ga0207668_10056489
1628 Ga0207668_10981128
1629 Ga0207640_10014314
1630 Ga0207640_10029707
1631 Ga0207640_10125616
1632 Ga0207640_10299607
1633 Ga0207640_10714835
1634 Ga0207640_10820292
1635 Ga0207640_11431354
1636 Ga0207658_10015776
1637 Ga0207658_10075666
1638 Ga0207658_10107505
1639 Ga0207658_10139291
1640 Ga0207658_10572711
1641 Ga0207658_10864264
1642 Ga0207677_10007923
1643 Ga0207677_10026376
1644 Ga0207677_11057522
1645 Ga0207677_11237127
1646 Ga0207703_10007135
1647 Ga0207703_10014555
1648 Ga0207703_10069293
1649 Ga0207703_11015975
1650 Ga0207703_11373658
1651 Ga0207639_10014989
1652 Ga0207639_10050330
1653 Ga0207639_10050628
1654 Ga0207639_10095379
1655 Ga0207639_10204568
1656 Ga0207639_10318210
1657 Ga0207639_10613222
1658 Ga0207639_10797686
1659 Ga0207639_11171291
1660 Ga0207639_11456418
1661 Ga0207678_10000804
1662 Ga0207678_10002098
1663 Ga0207678_10077678
1664 Ga0207678_10082406
1665 Ga0207678_10123303
1666 Ga0207678_10171804
1667 Ga0207678_10180073
1668 Ga0207678_10358876
1669 Ga0207678_10668986
1670 Ga0207702_10016269
1671 Ga0207702_10029965
1672 Ga0207702_10063638
1673 Ga0207702_10312221
1674 Ga0207702_10330686
1675 Ga0207702_10923120
1676 Ga0207702_12234078
1677 Ga0207702_12280946
1678 Ga0207641_10005615
1679 Ga0207641_10016531
1680 Ga0207641_10038600
1681 Ga0207641_10254322
1682 Ga0207641_10392129
1683 Ga0207641_10583423
1684 Ga0207648_10001054
1685 Ga0207648_10013836
1686 Ga0207648_10040131
1687 Ga0207648_10053902
1688 Ga0207648_10244049
1689 Ga0207648_10356006
1690 Ga0207676_10002351
1691 Ga0207676_10047528
1692 Ga0207676_10079944
1693 Ga0207676_10325634
1694 Ga0207676_10745243
1695 Ga0207674_10006084
1696 Ga0207674_10006227
1697 Ga0207674_10008398
1698 Ga0207674_10008991
1699 Ga0207674_10039586
1700 Ga0207674_10062538
1701 Ga0207674_10102855
1702 Ga0207674_10137948
1703 Ga0207674_10485481
1704 Ga0207675_100029226
1705 Ga0207675_100076256
1706 Ga0207683_10002743
1707 Ga0207683_10005377
1708 Ga0207683_10509751
1709 Ga0207698_10016179
1710 Ga0207698_10025363
1711 Ga0207698_10035291
1712 Ga0207698_10047245
1713 Ga0207698_10097986
1714 Ga0207698_10105067
1715 Ga0207698_10145433
1716 Ga0207698_10150605
1717 Ga0207698_10186008
1718 Ga0207698_11131367
1719 Ga0268266_10004707
1720 Ga0268266_10038153
1721 Ga0268266_10075597
1722 Ga0268266_10078027
1723 Ga0268266_10421019
1724 Ga0268265_10030046
1725 Ga0268265_10032703
1726 Ga0268265_10058941
1727 Ga0268265_10101063
1728 Ga0268265_10314587
1729 Ga0268265_10464092
1730 Ga0268265_10719488
1731 Ga0268264_10002242
1732 Ga0268264_10408544
1733 Ga0268264_10411290
1734 Ga0307515_10398277
1735 Ga0307513_10296447
1736 Ga0307405_10096429
1737 Ga0307405_10344030
1738 Ga0307413_10170681
1739 Ga0307410_10149357
1740 Ga0307410_10155300
1741 Ga0307406_10167301
1742 Ga0307406_10284464
1743 Ga0307407_10120391
1744 Ga0307412_10112166
1745 Ga0307409_100016136
1746 Ga0307409_100061748
1747 Ga0307409_100171341
1748 Ga0307416_100131840
1749 Ga0307414_10054071
1750 Ga0307414_10123236
1751 Ga0307414_10266528
1752 Ga0307411_10001293
1753 Ga0307411_10016919
1754 Ga0307411_10035027
1755 Ga0307411_10137367
1756 Ga0307411_10240052
1757 Ga0307415_100016346
1758 Ga0307415_100065466
1759 Ga0373929_0059374
1760 Ga0373923_0520566
1761 Ga0373939_0041058
1762 Ga0373953_0144298
1763 Ga0373954_0145991
1764 Ga0373946_0083678
1765 Ga0373955_0005727
1766 Ga0373962_0014133
1767 Ga0373935_0377901
1768 Ga0373935_0468868
1769 Ga0373937_0012842
1770 Ga0373937_0222536
1771 Ga0395899_0000700
1772 Ga0395899_0001653
1773 Ga0395899_0001731
1774 Ga0395899_0020257
1775 Ga0395899_0033353
1776 Ga0395899_0042320
1777 Ga0395899_0054807
1778 Ga0395899_0057216
1779 Ga0395899_0098411
1780 Ga0395899_0125521
1781 Ga0395899_0144683
1782 Ga0395899_0145021
1783 Ga0395899_0154739
1784 Ga0395899_0179092
1785 Ga0395899_0218355
1786 Ga0395899_0242376
1787 Ga0395899_0375395
1788 Ga0395899_0522183
1789 Ga0395899_0554905
1790 Ga0395899_0841355
1791 Ga0395899_0927237
1792 Ga0395900_0000238
1793 Ga0395900_0001814
1794 Ga0395900_0004257
1795 Ga0395900_0007827
1796 Ga0395900_0011226
1797 Ga0395900_0028779
1798 Ga0395900_0055865
1799 Ga0395900_0069465
1800 Ga0395900_0076856
1801 Ga0395900_0078607
1802 Ga0395900_0136666
1803 Ga0395900_0164033
1804 Ga0395900_0171030
1805 Ga0395900_0187351
1806 Ga0395900_0190951
1807 Ga0395900_0193894
1808 Ga0395900_0256590
1809 Ga0395900_0307256
1810 Ga0395900_0310686
1811 Ga0395900_0349736
1812 Ga0395900_0379182
1813 Ga0395900_0437602
1814 Ga0395900_0495322
1815 Ga0395900_0512249
1816 Ga0395900_0583218
1817 Ga0395900_0597439
1818 Ga0395900_0871153
1819 Ga0395900_0949902
1820 Ga0395900_1073911
1821 Ga0395900_1800665
1822 Ga0395898_0000245
1823 Ga0395898_0001652
1824 Ga0395898_0006981
1825 Ga0395898_0027020
1826 Ga0395898_0032280
1827 Ga0395898_0045137
1828 Ga0395898_0049823
1829 Ga0395898_0053526
1830 Ga0395898_0130881
1831 Ga0395898_0160600
1832 Ga0395898_0173600
1833 Ga0395898_0180423
1834 Ga0395898_0183484
1835 Ga0395898_0217773
1836 Ga0395898_0479600
1837 Ga0395898_0537682
1838 Ga0395898_0591449
1839 Ga0395898_0664850
1840 Ga0395898_0996314
1841 Ga0395898_1247305
1842 Ga0395905_0000006
1843 Ga0395905_0000207
1844 Ga0395905_0001434
1845 Ga0395905_0002904
1846 Ga0395905_0003926
1847 Ga0395905_0005557
1848 Ga0395905_0013537
1849 Ga0395905_0013951
1850 Ga0395905_0020251
1851 Ga0395905_0036687
1852 Ga0395905_0043790
1853 Ga0395905_0045333
1854 Ga0395905_0051661
1855 Ga0395905_0053115
1856 Ga0395905_0061558
1857 Ga0395905_0068266
1858 Ga0395905_0081544
1859 Ga0395905_0090341
1860 Ga0395905_0094529
1861 Ga0395905_0116695
1862 Ga0395905_0123182
1863 Ga0395905_0131639
1864 Ga0395905_0136533
1865 Ga0395905_0140690
1866 Ga0395905_0146122
1867 Ga0395905_0165598
1868 Ga0395905_0167805
1869 Ga0395905_0180766
1870 Ga0395905_0207381
1871 Ga0395905_0224630
1872 Ga0395905_0260373
1873 Ga0395905_0289671
1874 Ga0395905_0294855
1875 Ga0395905_0557083
1876 Ga0395905_0581649
1877 Ga0395905_0680159
1878 Ga0395901_0000156
1879 Ga0395901_0000499
1880 Ga0395901_0000707
1881 Ga0395901_0017559
1882 Ga0395901_0020576
1883 Ga0395901_0063160
1884 Ga0395901_0075324
1885 Ga0395901_0082321
1886 Ga0395901_0095103
1887 Ga0395901_0119497
1888 Ga0395901_0183230
1889 Ga0395901_0190497
1890 Ga0395901_0220164
1891 Ga0395901_0221290
1892 Ga0395901_0287649
1893 Ga0395901_0345852
1894 Ga0395901_0409426
1895 Ga0395901_0457179
1896 Ga0395901_0749888
1897 Ga0395901_1365518
1898 Ga0436365_1451682
1899 Ga0436362_0319299
1900 Ga0439458_0001218
1901 Ga0439458_0021631
1902 Ga0439464_0000226
1903 Ga0439464_0277465
1904 Ga0466972_0083639
1905 Ga0466972_0146081
1906 Ga0466972_0296989
1907 Ga0466965_0083201
1908 Ga0466961_0015310
1909 Ga0466961_0382601
1910 Ga0466961_0634188
1911 Ga0466963_0001409
1912 Ga0466963_0023516
1913 Ga0466963_0043473
1914 Ga0466963_0137449
1915 Ga0466963_0243449
1916 Ga0466963_0297326
1917 Ga0466963_0321231
1918 Ga0466963_1220513
1919 Ga0466964_0058940
1920 Ga0466964_0150468
1921 Ga0466964_0682665
1922 Ga0466971_0014040
1923 Ga0466971_0023501
1924 Ga0466971_0121063
1925 Ga0466971_0542705
1926 Ga0466968_0110308
1927 Ga0466970_0298639
1928 Ga0466970_0422014
1929 Ga0466970_0747322
1930 Ga0466957_0001128
1931 Ga0466957_0006513
1932 Ga0466957_0034136
1933 Ga0466957_0222609
1934 Ga0466957_0541601
1935 Ga0466957_0542398
1936 Ga0466960_0054386
1937 Ga0466960_0455111
1938 Ga0466960_0582937
1939 Ga0466960_0604586
1940 Ga0466959_0428798
1941 Ga0466958_0008532
1942 Ga0466958_0213873
1943 Ga0466967_0000368
1944 Ga0466967_0010342
1945 Ga0466967_0012867
1946 Ga0466967_0055207
1947 Ga0466967_0055233
1948 Ga0466967_0075706
1949 Ga0466967_0089336
1950 Ga0466967_0091669
1951 Ga0466967_0170906
1952 Ga0466967_0186742
1953 Ga0466967_0234977
1954 Ga0466967_0305455
1955 Ga0466967_0333680
1956 Ga0466967_0400537
1957 Ga0466967_0863601
1958 Ga0495663_0150670
1959 Ga0495598_0000085
1960 Ga0495621_0000048
1961 Ga0495668_0080566
1962 Ga0495668_0184140
1963 Ga0495669_0036025
1964 Ga0495669_0082773
1965 Ga0495677_0098022
1966 Ga0495602_0038545
1967 Ga0496100_0194477
1968 Ga0496100_0364882
1969 Ga0496101_0006891
1970 Ga0496101_0114220
1971 Ga0496102_0020081
1972 Ga0496103_0032361
1973 Ga0496104_0018630
1974 Ga0496105_0049162
1975 Ga0496105_0272755
1976 Ga0496106_0012322
1977 Ga0496107_0010319
1978 Ga0496107_0355485
1979 Ga0496107_0868544
1980 Ga0496108_0034896
1981 Ga0496108_0073144
1982 Ga0496109_0057525
1983 Ga0496109_0898818
1984 Ga0496110_0006682
1985 Ga0496110_0012193
1986 Ga0496111_0014622
1987 Ga0496112_0011451
1988 Ga0496112_0062735
1989 Ga0496112_0080660
1990 Ga0496113_0032260
1991 Ga0496113_0034921
1992 Ga0496113_0039937
1993 Ga0496114_0000021
1994 Ga0501067_0030650
1995 Ga0501068_0474743
1996 Ga0501204_003020
1997 nmdc:mga03683_73317_c2
1998 nmdc:mga07m45_308465_c1
1999 nmdc:mga0a205_19346_c1
2000 Ga0495595_0559710
2001 Ga0587073_0074073
2002 Ga0587088_107901
2003 Ga0587106_015014
2004 Ga0587106_075673
2005 Ga0466962_0001188
2006 Ga0466962_0061860
2007 Ga0466962_0067620
2008 Ga0530510_0324840

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18856

baeRF_family12

Bacterial archaeo-eukaryotic release factor family 12

13

150

0.98

PF10116

Host_attach

Protein required for attachment to host cells

15

150

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8aet-assembly1.cif.gz_A-2 malonyl-coa reductase from chloroflexus aurantiacus - c-terminal e779w variant 0.7486 80 127
6x4k-assembly1.cif.gz_A-2 pank3 complex structure with compound pz-2890 0.7088 70 127
6clw-assembly1.cif.gz_A crystal structure of tnmh 0.6967 87 123
6dub-assembly2.cif.gz_B crystal structure of a methyltransferase 0.6949 96 127
6wh8-assembly1.cif.gz_B the structure of ntmt1 in complex with compound bm-30 0.6928 87 127
ID Description Score Start End Superfamily
af_Q9W4R9_257_436_3.10.310.30 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.7491 69 116 3.10.310.30
6clwA03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6967 87 123 3.40.50.150
af_F1QD19_221_392_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6874 80 124 3.30.420.10
af_A0A1D6ECY7_2_152_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.67 80 127 3.40.50.2000
4qvgD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6595 87 128 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A527YPQ6-F1-model_v4 Host attachment protein 0.869 67 136
AF-A0A527YPQ6-F1-model_v4 Host attachment protein 0.8477 67 136
AF-A0A327XLA5-F1-model_v4 deleted 0.8417 67 147
AF-A0A435LS04-F1-model_v4 deleted 0.8265 60 145
AF-A0A327XLA5-F1-model_v4 deleted 0.816 67 147

Map