F487894

General Info

Members Datasets Scaffolds Average Seq Length
1001 475 999 113

Family's Representative Sequence

Representative Sequence 3300042435|Ga0439434_0239228|Ga0439434_0239228_124_495
Length 123
Sequence MRRRTFRKLKAAVASPATLHHYVYVVLLDPAVLKLRKIRMTNPSRQKDKACLYVGMTGLTPPERFANHKAGIKAARIVQRYGVRLLPDLYEVFNPMPFDVAAQMEKELAEDLRAQGYTVAGGY

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
95 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
96 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
97 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
98 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
99 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
100 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
101 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
106 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
107 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
145 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
146 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
147 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
222 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
225 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
226 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
227 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
228 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
229 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
230 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
231 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
232 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
233 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
234 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
235 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
236 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
237 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
238 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
239 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
240 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
241 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
242 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
243 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
244 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
245 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
248 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
249 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
250 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
251 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
252 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
253 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
254 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
255 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
256 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
257 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
259 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
260 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
261 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
262 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
263 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
264 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
265 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
266 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
267 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
268 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
269 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
270 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
271 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
272 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
273 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
274 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
275 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
276 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
277 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
278 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
279 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
280 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
281 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
282 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
283 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
284 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
285 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
286 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
287 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
288 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
289 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
290 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
291 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
292 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
293 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
294 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
295 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
296 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
297 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
298 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
299 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
300 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
301 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
302 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
303 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
304 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
305 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
306 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
307 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
308 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
309 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
310 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
311 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
312 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
313 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
314 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
315 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
316 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
317 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
318 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
319 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
320 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
321 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
322 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
323 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
324 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
325 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
326 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
327 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
328 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
329 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
330 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
331 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
332 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
333 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
334 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
335 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
336 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
337 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
338 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
339 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
340 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
341 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
342 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
343 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
344 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
345 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
346 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
347 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
348 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
349 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
350 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
351 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
352 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
353 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
354 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
355 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
356 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
357 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
358 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
359 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
360 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
361 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
362 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
363 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
364 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
365 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
366 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
367 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
368 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
369 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
370 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
371 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
372 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
373 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
374 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
375 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
376 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
377 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
378 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
379 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
380 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
381 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
382 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
383 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
384 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
385 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
386 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
387 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
388 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
389 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
390 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
391 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
392 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
393 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
394 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
395 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
396 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
397 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
398 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
399 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
400 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
401 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
402 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
403 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
404 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
405 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
406 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
407 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
408 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
409 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
410 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
411 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
412 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
413 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
414 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
415 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
416 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
423 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
424 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
425 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
426 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
427 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
428 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
429 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
430 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
431 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
432 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
434 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
435 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
436 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
437 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
438 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
439 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
440 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
441 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
442 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
443 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
444 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
445 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
446 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
447 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
448 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
449 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
450 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
451 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
452 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
453 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
454 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
455 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
456 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
457 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
458 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
459 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
460 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
461 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
462 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
463 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
464 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
465 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
466 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
467 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
468 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
469 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
470 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
471 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
472 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
473 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
474 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
475 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.1
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.79
Nodule 0
Rhizoplane 3.7
Rhizosphere 77.52
Stem 0
Stem Tuber 0
Unclassified 5.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1040090 3300002070 Bacteria 709
2 JGI25152J39213_1003080 3300002773 Bacteria 5850
3 JGI25150J39212_1017737 3300002774 Bacteria 1144
4 JGI25153J46596_10000615 3300003215 Bacteria 21753
5 JGI25153J46596_10002602 3300003215 Bacteria 10335
6 rootH1_10008100 3300003316 Bacteria 9916
7 rootL2_10013911 3300003322 Bacteria 19208
8 rootL2_10156776 3300003322 Bacteria 1026
9 rootH1_10011242 3300003323 Bacteria 5505
10 rootH1_10054083 3300003323 Bacteria 2388
11 JGI26145J50221_1038583 3300003371 Bacteria 504
12 Ga0055526_1001543 3300003771 Bacteria 16295
13 Ga0055530_10069192 3300003791 Bacteria 765
14 Ga0055531_10000002 3300003794 Bacteria 421971
15 Ga0065165_1002659 3300005262 Bacteria 14440
16 Ga0065712_10223066 3300005290 Bacteria 1035
17 Ga0065715_10016577 3300005293 Bacteria 1829
18 Ga0070658_10300320 3300005327 Bacteria 1369
19 Ga0070658_10430712 3300005327 Bacteria 1135
20 Ga0070658_10745414 3300005327 Bacteria 850
21 Ga0070676_10001334 3300005328 Bacteria 12393
22 Ga0070676_10004760 3300005328 Bacteria 7174
23 Ga0070676_10165264 3300005328 Bacteria 1427
24 Ga0070676_11583033 3300005328 Bacteria 506
25 Ga0070683_100120080 3300005329 Bacteria 2482
26 Ga0070683_100436994 3300005329 Bacteria 1249
27 Ga0070683_101092304 3300005329 Bacteria 766
28 Ga0070690_100001815 3300005330 Bacteria 11312
29 Ga0070690_100498243 3300005330 Bacteria 911
30 Ga0070670_100011885 3300005331 Bacteria 7445
31 Ga0070670_100089787 3300005331 Bacteria 2641
32 Ga0070670_100263957 3300005331 Bacteria 1501
33 Ga0070670_100361204 3300005331 Bacteria 1277
34 Ga0070670_100441463 3300005331 Bacteria 1152
35 Ga0070677_10018563 3300005333 Bacteria 2506
36 Ga0070677_10131923 3300005333 Bacteria 1142
37 Ga0070677_10207347 3300005333 Bacteria 950
38 Ga0070677_10568647 3300005333 Bacteria 624
39 Ga0068869_100003785 3300005334 Bacteria 9322
40 Ga0068869_100141900 3300005334 Bacteria 1855
41 Ga0068869_101030603 3300005334 Bacteria 718
42 Ga0070666_10099909 3300005335 Bacteria 1998
43 Ga0070666_10634855 3300005335 Bacteria 781
44 Ga0070680_100007136 3300005336 Bacteria 8514
45 Ga0070680_101539448 3300005336 Bacteria 576
46 Ga0070682_100437029 3300005337 Bacteria 999
47 Ga0068868_100118748 3300005338 Bacteria 2155
48 Ga0068868_100324736 3300005338 Bacteria 1312
49 Ga0068868_100439542 3300005338 Bacteria 1133
50 Ga0068868_100671126 3300005338 Bacteria 925
51 Ga0070660_100250043 3300005339 Bacteria 1445
52 Ga0070660_100726075 3300005339 Bacteria 834
53 Ga0070660_100912575 3300005339 Bacteria 741
54 Ga0070689_100004554 3300005340 Bacteria 9385
55 Ga0070689_100749998 3300005340 Bacteria 855
56 Ga0070691_10377207 3300005341 Bacteria 794
57 Ga0070691_10595448 3300005341 Bacteria 652
58 Ga0070691_10642534 3300005341 Bacteria 631
59 Ga0070687_100121829 3300005343 Bacteria 1493
60 Ga0070687_100273690 3300005343 Bacteria 1059
61 Ga0070661_100336456 3300005344 Bacteria 1182
62 Ga0070661_101023945 3300005344 Bacteria 686
63 Ga0070661_101530449 3300005344 Bacteria 563
64 Ga0070692_10224130 3300005345 Bacteria 1113
65 Ga0070668_100007743 3300005347 Bacteria 7974
66 Ga0070669_100002211 3300005353 Bacteria 14098
67 Ga0070669_100456890 3300005353 Bacteria 1053
68 Ga0070675_100035230 3300005354 Bacteria 4066
69 Ga0070675_100300637 3300005354 Bacteria 1414
70 Ga0070675_100389196 3300005354 Bacteria 1242
71 Ga0070671_100000437 3300005355 Bacteria 28930
72 Ga0070671_100049662 3300005355 Bacteria 3490
73 Ga0070671_100240851 3300005355 Bacteria 1535
74 Ga0070671_100400910 3300005355 Bacteria 1173
75 Ga0070671_100491052 3300005355 Bacteria 1056
76 Ga0070674_100000965 3300005356 Bacteria 14986
77 Ga0070674_100024540 3300005356 Bacteria 3915
78 Ga0070673_100043415 3300005364 Bacteria 3474
79 Ga0070673_100085514 3300005364 Bacteria 2568
80 Ga0070673_100296467 3300005364 Bacteria 1422
81 Ga0070673_100950018 3300005364 Bacteria 799
82 Ga0070673_101095480 3300005364 Bacteria 744
83 Ga0070688_100159329 3300005365 Bacteria 1549
84 Ga0070688_101031075 3300005365 Bacteria 655
85 Ga0070659_100041833 3300005366 Bacteria 3583
86 Ga0070659_100139439 3300005366 Bacteria 1974
87 Ga0070659_100263208 3300005366 Bacteria 1431
88 Ga0070659_101490159 3300005366 Bacteria 603
89 Ga0070667_100000705 3300005367 Bacteria 32287
90 Ga0070667_100002738 3300005367 Bacteria 15240
91 Ga0070667_100020055 3300005367 Bacteria 5550
92 Ga0070667_100335409 3300005367 Bacteria 1367
93 Ga0070667_100449237 3300005367 Bacteria 1178
94 Ga0070667_100579539 3300005367 Bacteria 1033
95 Ga0070667_100815655 3300005367 Bacteria 866
96 Ga0070703_10447299 3300005406 Bacteria 572
97 Ga0070709_10088230 3300005434 Bacteria 2040
98 Ga0070710_10015522 3300005437 Bacteria 3858
99 Ga0070710_10244186 3300005437 Bacteria 1151
100 Ga0070701_10131369 3300005438 Bacteria 1423
101 Ga0070701_10571618 3300005438 Bacteria 744
102 Ga0070701_10855283 3300005438 Bacteria 625
103 Ga0070711_100038205 3300005439 Bacteria 3226
104 Ga0070705_100040034 3300005440 Bacteria 2663
105 Ga0070705_100432461 3300005440 Bacteria 983
106 Ga0070694_100011953 3300005444 Bacteria 5387
107 Ga0070694_100134098 3300005444 Bacteria 1792
108 Ga0070694_101013541 3300005444 Bacteria 690
109 Ga0070708_100233431 3300005445 Bacteria 1726
110 Ga0070663_101375257 3300005455 Bacteria 625
111 Ga0070678_100002439 3300005456 Bacteria 10188
112 Ga0070678_100079120 3300005456 Bacteria 2485
113 Ga0070678_100258411 3300005456 Bacteria 1463
114 Ga0070662_100004128 3300005457 Bacteria 9135
115 Ga0070662_100023060 3300005457 Bacteria 4272
116 Ga0070662_100042390 3300005457 Bacteria 3251
117 Ga0070662_100285042 3300005457 Bacteria 1338
118 Ga0070662_100446627 3300005457 Bacteria 1073
119 Ga0070662_100502238 3300005457 Bacteria 1012
120 Ga0070662_100813573 3300005457 Bacteria 795
121 Ga0070681_10045717 3300005458 Bacteria 4379
122 Ga0070681_10102497 3300005458 Bacteria 2807
123 Ga0068867_100000004 3300005459 Bacteria 180739
124 Ga0068867_100003930 3300005459 Bacteria 10463
125 Ga0068867_100009546 3300005459 Bacteria 6840
126 Ga0068867_100094233 3300005459 Bacteria 2276
127 Ga0068867_100472583 3300005459 Bacteria 1072
128 Ga0068867_101366914 3300005459 Bacteria 656
129 Ga0070685_10000493 3300005466 Bacteria 22875
130 Ga0070685_10183216 3300005466 Bacteria 1350
131 Ga0070706_100123600 3300005467 Bacteria 2413
132 Ga0070707_100301965 3300005468 Bacteria 1556
133 Ga0070698_100413024 3300005471 Bacteria 1284
134 Ga0070699_100607410 3300005518 Bacteria 997
135 Ga0070699_101414407 3300005518 Bacteria 638
136 Ga0070679_100005395 3300005530 Bacteria 11845
137 Ga0070679_100178492 3300005530 Bacteria 2096
138 Ga0070679_100654899 3300005530 Bacteria 993
139 Ga0070679_100829050 3300005530 Bacteria 868
140 Ga0070684_100125115 3300005535 Bacteria 2315
141 Ga0070684_100793668 3300005535 Bacteria 885
142 Ga0070697_100260777 3300005536 Bacteria 1484
143 Ga0070697_100437186 3300005536 Bacteria 1138
144 Ga0068853_100006975 3300005539 Bacteria 9024
145 Ga0068853_100063148 3300005539 Bacteria 3208
146 Ga0068853_100368490 3300005539 Bacteria 1340
147 Ga0068853_100691354 3300005539 Bacteria 972
148 Ga0070672_100003309 3300005543 Bacteria 10434
149 Ga0070672_100022475 3300005543 Bacteria 4633
150 Ga0070672_100043274 3300005543 Bacteria 3471
151 Ga0070672_100082357 3300005543 Bacteria 2581
152 Ga0070672_100100170 3300005543 Bacteria 2349
153 Ga0070672_100105091 3300005543 Bacteria 2295
154 Ga0070672_100161485 3300005543 Bacteria 1859
155 Ga0070672_101096915 3300005543 Unclassified 707
156 Ga0070672_101736624 3300005543 Bacteria 561
157 Ga0070686_100024368 3300005544 Bacteria 3626
158 Ga0070686_100035614 3300005544 Bacteria 3076
159 Ga0070686_101084404 3300005544 Bacteria 661
160 Ga0070695_100088980 3300005545 Bacteria 2057
161 Ga0070695_100126146 3300005545 Bacteria 1758
162 Ga0070695_100158395 3300005545 Bacteria 1587
163 Ga0070696_100010213 3300005546 Bacteria 6283
164 Ga0070696_100213444 3300005546 Bacteria 1445
165 Ga0070696_100667254 3300005546 Bacteria 844
166 Ga0070693_100003655 3300005547 Bacteria 7186
167 Ga0070693_100940888 3300005547 Bacteria 650
168 Ga0070693_101125818 3300005547 Bacteria 600
169 Ga0070665_100016649 3300005548 Bacteria 7368
170 Ga0070665_100350143 3300005548 Bacteria 1482
171 Ga0070704_100041018 3300005549 Bacteria 3191
172 Ga0070704_100245804 3300005549 Bacteria 1467
173 Ga0070704_101341913 3300005549 Bacteria 655
174 Ga0068855_100030561 3300005563 Bacteria 6441
175 Ga0068855_100033363 3300005563 Bacteria 6144
176 Ga0070664_100092663 3300005564 Bacteria 2616
177 Ga0070664_100287978 3300005564 Bacteria 1482
178 Ga0070664_100930323 3300005564 Bacteria 816
179 Ga0068857_100031528 3300005577 Bacteria 4684
180 Ga0068857_100664668 3300005577 Bacteria 988
181 Ga0068854_100028980 3300005578 Bacteria 3829
182 Ga0068854_100098256 3300005578 Bacteria 2191
183 Ga0068854_100136299 3300005578 Bacteria 1879
184 Ga0068854_100171311 3300005578 Bacteria 1689
185 Ga0068854_100327336 3300005578 Bacteria 1247
186 Ga0068854_100521527 3300005578 Bacteria 1004
187 Ga0068854_101034175 3300005578 Bacteria 729
188 Ga0068856_100053983 3300005614 Bacteria 3962
189 Ga0068856_100148032 3300005614 Bacteria 2356
190 Ga0068856_100280219 3300005614 Bacteria 1684
191 Ga0068856_100496054 3300005614 Bacteria 1242
192 Ga0068856_102671395 3300005614 Bacteria 505
193 Ga0070702_100158131 3300005615 Bacteria 1462
194 Ga0068852_100007596 3300005616 Bacteria 7927
195 Ga0068852_100137191 3300005616 Bacteria 2259
196 Ga0068852_100156509 3300005616 Bacteria 2123
197 Ga0068852_100291591 3300005616 Bacteria 1576
198 Ga0068852_100555599 3300005616 Bacteria 1149
199 Ga0068852_100758868 3300005616 Bacteria 982
200 Ga0068852_101297695 3300005616 Bacteria 750
201 Ga0068852_101332712 3300005616 Bacteria 740
202 Ga0068859_100191302 3300005617 Bacteria 2131
203 Ga0068859_100213952 3300005617 Bacteria 2014
204 Ga0068859_100374376 3300005617 Bacteria 1520
205 Ga0068864_100013261 3300005618 Bacteria 6827
206 Ga0068864_100087455 3300005618 Bacteria 2743
207 Ga0068864_100163563 3300005618 Bacteria 2024
208 Ga0068864_100176707 3300005618 Bacteria 1950
209 Ga0068866_10035408 3300005718 Bacteria 2438
210 Ga0068866_10171605 3300005718 Bacteria 1274
211 Ga0068866_10590868 3300005718 Bacteria 748
212 Ga0068861_100002811 3300005719 Bacteria 11447
213 Ga0068861_101120855 3300005719 Bacteria 757
214 Ga0068851_10069711 3300005834 Bacteria 1816
215 Ga0068851_10145064 3300005834 Bacteria 1294
216 Ga0068870_10178917 3300005840 Bacteria 1271
217 Ga0068870_10351895 3300005840 Bacteria 945
218 Ga0068870_10476397 3300005840 Bacteria 828
219 Ga0068870_10756597 3300005840 Bacteria 675
220 Ga0068863_100004699 3300005841 Bacteria 13460
221 Ga0068863_100078599 3300005841 Bacteria 3124
222 Ga0068863_100233429 3300005841 Bacteria 1775
223 Ga0068863_100899292 3300005841 Bacteria 885
224 Ga0068863_101127117 3300005841 Bacteria 789
225 Ga0068863_101438844 3300005841 Bacteria 697
226 Ga0068858_100010462 3300005842 Bacteria 8788
227 Ga0068858_100014064 3300005842 Bacteria 7547
228 Ga0068858_100101907 3300005842 Bacteria 2678
229 Ga0068860_100005300 3300005843 Bacteria 13093
230 Ga0068860_100129897 3300005843 Bacteria 2417
231 Ga0068860_101018895 3300005843 Bacteria 846
232 Ga0068862_101420419 3300005844 Bacteria 698
233 Ga0070717_10139912 3300006028 Bacteria 2087
234 Ga0075365_10001590 3300006038 Bacteria 10438
235 Ga0075365_10510754 3300006038 Bacteria 849
236 Ga0075368_10073404 3300006042 Bacteria 1385
237 Ga0075363_100051673 3300006048 Bacteria 2193
238 Ga0075363_100053330 3300006048 Bacteria 2161
239 Ga0075363_100066441 3300006048 Bacteria 1952
240 Ga0075363_100086718 3300006048 Bacteria 1719
241 Ga0075363_100529467 3300006048 Bacteria 702
242 Ga0075364_10168316 3300006051 Bacteria 1481
243 Ga0075364_10239523 3300006051 Bacteria 1232
244 Ga0075432_10216211 3300006058 Bacteria 765
245 Ga0070715_10142841 3300006163 Bacteria 1165
246 Ga0070716_100018816 3300006173 Bacteria 3602
247 Ga0070712_100060850 3300006175 Bacteria 2665
248 Ga0075362_10001615 3300006177 Bacteria 7311
249 Ga0075362_10038873 3300006177 Bacteria 2090
250 Ga0075362_10490156 3300006177 Bacteria 627
251 Ga0075367_10021159 3300006178 Bacteria 3632
252 Ga0075367_10024391 3300006178 Bacteria 3410
253 Ga0075367_10952134 3300006178 Bacteria 548
254 Ga0075369_10375818 3300006186 Bacteria 668
255 Ga0075369_10499793 3300006186 Bacteria 578
256 Ga0075366_10003855 3300006195 Bacteria 7988
257 Ga0075366_10013944 3300006195 Bacteria 4583
258 Ga0075366_10039097 3300006195 Bacteria 2803
259 Ga0075366_10042728 3300006195 Bacteria 2684
260 Ga0075366_10051655 3300006195 Bacteria 2442
261 Ga0075366_10060953 3300006195 Bacteria 2241
262 Ga0075366_10457705 3300006195 Bacteria 787
263 Ga0075366_10482727 3300006195 Bacteria 766
264 Ga0075366_10543742 3300006195 Bacteria 719
265 Ga0075366_10569553 3300006195 Bacteria 702
266 Ga0097621_100029731 3300006237 Bacteria 4318
267 Ga0097621_100204014 3300006237 Bacteria 1718
268 Ga0097621_100725900 3300006237 Bacteria 916
269 Ga0097621_101744881 3300006237 Bacteria 593
270 Ga0075370_10006405 3300006353 Bacteria 5918
271 Ga0075370_10022199 3300006353 Bacteria 3483
272 Ga0075370_10046000 3300006353 Bacteria 2469
273 Ga0075370_10173473 3300006353 Bacteria 1268
274 Ga0075370_10326090 3300006353 Bacteria 915
275 Ga0075370_10374263 3300006353 Bacteria 853
276 Ga0068871_100192218 3300006358 Bacteria 1759
277 Ga0068871_101358398 3300006358 Bacteria 669
278 Ga0075430_100119499 3300006846 Unclassified 2197
279 Ga0075434_100383728 3300006871 Bacteria 1426
280 Ga0075434_101557612 3300006871 Bacteria 670
281 Ga0075429_101772563 3300006880 Bacteria 536
282 Ga0068865_100002020 3300006881 Bacteria 11969
283 Ga0068865_100249670 3300006881 Bacteria 1400
284 Ga0068865_100255028 3300006881 Bacteria 1386
285 Ga0068865_100356371 3300006881 Bacteria 1187
286 Ga0068865_100593326 3300006881 Bacteria 935
287 Ga0068865_101321388 3300006881 Bacteria 642
288 Ga0075436_100142324 3300006914 Bacteria 1686
289 Ga0097620_100191296 3300006931 Bacteria 2131
290 Ga0097620_100213932 3300006931 Bacteria 2014
291 Ga0097620_100374388 3300006931 Bacteria 1520
292 Ga0075435_100057492 3300007076 Bacteria 3147
293 Ga0105240_10359587 3300009093 Bacteria 1649
294 Ga0111539_10031472 3300009094 Bacteria 6444
295 Ga0111539_12595239 3300009094 Bacteria 587
296 Ga0105245_10214229 3300009098 Bacteria 1855
297 Ga0105245_10537259 3300009098 Bacteria 1190
298 Ga0105247_10044989 3300009101 Bacteria 2708
299 Ga0114129_11064411 3300009147 Bacteria 1015
300 Ga0105243_10020827 3300009148 Bacteria 4975
301 Ga0105243_10056139 3300009148 Bacteria 3130
302 Ga0105243_10175926 3300009148 Bacteria 1857
303 Ga0105243_10248770 3300009148 Bacteria 1586
304 Ga0105243_10303204 3300009148 Bacteria 1449
305 Ga0105243_10375564 3300009148 Bacteria 1313
306 Ga0105241_10051833 3300009174 Bacteria 3131
307 Ga0105241_10277178 3300009174 Bacteria 1431
308 Ga0105242_10040381 3300009176 Bacteria 3760
309 Ga0105242_10435979 3300009176 Bacteria 1232
310 Ga0105242_12025665 3300009176 Bacteria 618
311 Ga0105248_10030887 3300009177 Bacteria 5984
312 Ga0105248_10065141 3300009177 Bacteria 4091
313 Ga0105248_10137185 3300009177 Bacteria 2760
314 Ga0105248_10173538 3300009177 Bacteria 2430
315 Ga0105248_10321725 3300009177 Bacteria 1742
316 Ga0105248_11460021 3300009177 Bacteria 774
317 Ga0105237_10018195 3300009545 Bacteria 7273
318 Ga0105237_10152202 3300009545 Bacteria 2310
319 Ga0105237_10253444 3300009545 Bacteria 1762
320 Ga0105237_10307107 3300009545 Bacteria 1589
321 Ga0105238_10076515 3300009551 Bacteria 3338
322 Ga0105238_10408632 3300009551 Bacteria 1351
323 Ga0105249_10481359 3300009553 Bacteria 1284
324 Ga0099796_10487772 3300010159 Bacteria 551
325 Ga0105239_10034914 3300010375 Bacteria 5523
326 Ga0105239_10492590 3300010375 Bacteria 1393
327 Ga0105239_10495806 3300010375 Bacteria 1388
328 Ga0105239_10605911 3300010375 Bacteria 1249
329 Ga0105246_10054492 3300011119 Bacteria 2756
330 Ga0157324_1029955 3300012506 Bacteria 610
331 Ga0157373_10432858 3300013100 Bacteria 945
332 Ga0157373_10686181 3300013100 Bacteria 750
333 Ga0157371_10118360 3300013102 Bacteria 1883
334 Ga0157370_10102175 3300013104 Bacteria 2685
335 Ga0157370_10148122 3300013104 Bacteria 2185
336 Ga0157370_10308010 3300013104 Bacteria 1462
337 Ga0157369_10352269 3300013105 Bacteria 1529
338 Ga0157369_10505965 3300013105 Bacteria 1250
339 Ga0157374_10035585 3300013296 Bacteria 4556
340 Ga0157374_10078384 3300013296 Bacteria 3129
341 Ga0157374_10227604 3300013296 Bacteria 1831
342 Ga0157374_10296005 3300013296 Bacteria 1600
343 Ga0157378_10190217 3300013297 Bacteria 1935
344 Ga0157378_11072788 3300013297 Bacteria 842
345 Ga0157378_12753114 3300013297 Bacteria 544
346 Ga0163162_10004467 3300013306 Bacteria 13476
347 Ga0163162_10920246 3300013306 Bacteria 987
348 Ga0163162_11058169 3300013306 Bacteria 918
349 Ga0163162_11179515 3300013306 Bacteria 869
350 Ga0157372_10615787 3300013307 Bacteria 1265
351 Ga0157372_11934594 3300013307 Bacteria 678
352 Ga0157375_10001941 3300013308 Bacteria 17817
353 Ga0157375_10003497 3300013308 Bacteria 13616
354 Ga0157375_10453168 3300013308 Bacteria 1448
355 Ga0163163_10142007 3300014325 Bacteria 2444
356 Ga0163163_10259377 3300014325 Bacteria 1789
357 Ga0163163_12388977 3300014325 Bacteria 587
358 Ga0163163_13186746 3300014325 Bacteria 512
359 Ga0157380_10001564 3300014326 Bacteria 15067
360 Ga0157380_10531573 3300014326 Bacteria 1149
361 Ga0157380_11399788 3300014326 Bacteria 750
362 Ga0157377_10000010 3300014745 Bacteria 380929
363 Ga0157377_10011551 3300014745 Bacteria 4413
364 Ga0157377_11288283 3300014745 Bacteria 571
365 Ga0157379_10004770 3300014968 Bacteria 11650
366 Ga0157379_10010571 3300014968 Bacteria 8048
367 Ga0157379_10024408 3300014968 Bacteria 5368
368 Ga0157379_10047949 3300014968 Bacteria 3813
369 Ga0157379_10504571 3300014968 Bacteria 1122
370 Ga0157379_10999508 3300014968 Bacteria 797
371 Ga0157379_11201137 3300014968 Bacteria 729
372 Ga0157379_11579548 3300014968 Bacteria 640
373 Ga0157376_10260162 3300014969 Bacteria 1625
374 Ga0157376_10294489 3300014969 Bacteria 1534
375 Ga0157376_11074029 3300014969 Bacteria 830
376 Ga0157376_11208231 3300014969 Bacteria 784
377 Ga0163161_10145390 3300017792 Bacteria 1798
378 Ga0206354_11215456 3300020081 Bacteria 511
379 Ga0213872_10000034 3300021361 Bacteria 133158
380 Ga0207425_1000807 3300025245 Bacteria 15838
381 Ga0207425_1071545 3300025245 Bacteria 593
382 Ga0209129_1000038 3300025258 Bacteria 322778
383 Ga0209673_1017657 3300025273 Bacteria 2624
384 Ga0209564_1000129 3300025295 Bacteria 195163
385 Ga0209758_1000177 3300025297 Bacteria 142824
386 Ga0209758_1000197 3300025297 Bacteria 133706
387 Ga0209050_1001630 3300025298 Bacteria 23020
388 Ga0209050_1002016 3300025298 Bacteria 18929
389 Ga0209050_1013067 3300025298 Bacteria 3738
390 Ga0209256_1026046 3300025299 Bacteria 1692
391 Ga0209256_1044894 3300025299 Bacteria 1101
392 Ga0209051_1003663 3300025303 Bacteria 9942
393 Ga0209051_1011255 3300025303 Bacteria 4435
394 Ga0209257_1000049 3300025304 Bacteria 441224
395 Ga0209257_1015569 3300025304 Bacteria 3154
396 Ga0207697_10036312 3300025315 Bacteria 2017
397 Ga0207697_10110271 3300025315 Bacteria 1178
398 Ga0207656_10091976 3300025321 Bacteria 1378
399 Ga0207682_10013198 3300025893 Bacteria 3221
400 Ga0207682_10024588 3300025893 Bacteria 2386
401 Ga0207682_10058677 3300025893 Bacteria 1607
402 Ga0207682_10130831 3300025893 Bacteria 1120
403 Ga0207642_10001813 3300025899 Bacteria 6604
404 Ga0207710_10181729 3300025900 Bacteria 1032
405 Ga0207680_10004093 3300025903 Bacteria 6894
406 Ga0207680_10771515 3300025903 Bacteria 689
407 Ga0207699_10790676 3300025906 Bacteria 697
408 Ga0207645_10000870 3300025907 Bacteria 25116
409 Ga0207645_10002088 3300025907 Bacteria 15984
410 Ga0207645_10168255 3300025907 Bacteria 1435
411 Ga0207643_10029590 3300025908 Bacteria 3046
412 Ga0207643_10062086 3300025908 Bacteria 2135
413 Ga0207705_10616837 3300025909 Bacteria 843
414 Ga0207654_10184614 3300025911 Bacteria 1363
415 Ga0207707_10031988 3300025912 Bacteria 4606
416 Ga0207707_10032477 3300025912 Bacteria 4569
417 Ga0207707_11231887 3300025912 Bacteria 604
418 Ga0207671_10017616 3300025914 Bacteria 5500
419 Ga0207660_10004466 3300025917 Bacteria 9121
420 Ga0207662_10338305 3300025918 Bacteria 1008
421 Ga0207662_10515370 3300025918 Bacteria 825
422 Ga0207662_10575494 3300025918 Bacteria 782
423 Ga0207657_10113522 3300025919 Bacteria 2235
424 Ga0207657_10177437 3300025919 Bacteria 1723
425 Ga0207649_10046929 3300025920 Bacteria 2656
426 Ga0207652_10013046 3300025921 Bacteria 6725
427 Ga0207652_10067476 3300025921 Bacteria 3102
428 Ga0207652_10671784 3300025921 Bacteria 926
429 Ga0207652_10873248 3300025921 Bacteria 796
430 Ga0207681_10000967 3300025923 Bacteria 18742
431 Ga0207681_10830657 3300025923 Bacteria 772
432 Ga0207694_10196753 3300025924 Bacteria 1639
433 Ga0207650_10009880 3300025925 Bacteria 6527
434 Ga0207650_10014689 3300025925 Bacteria 5441
435 Ga0207650_10554415 3300025925 Bacteria 964
436 Ga0207650_10777031 3300025925 Bacteria 811
437 Ga0207659_10282424 3300025926 Bacteria 1358
438 Ga0207659_10383587 3300025926 Bacteria 1172
439 Ga0207659_10547711 3300025926 Bacteria 983
440 Ga0207659_10578344 3300025926 Bacteria 956
441 Ga0207659_10824796 3300025926 Bacteria 797
442 Ga0207687_10240542 3300025927 Bacteria 1434
443 Ga0207687_10315089 3300025927 Bacteria 1264
444 Ga0207687_10900063 3300025927 Bacteria 757
445 Ga0207644_10000278 3300025931 Bacteria 33992
446 Ga0207644_10022498 3300025931 Bacteria 4307
447 Ga0207644_10109251 3300025931 Bacteria 2089
448 Ga0207644_10710444 3300025931 Bacteria 838
449 Ga0207690_10270139 3300025932 Bacteria 1321
450 Ga0207706_10011095 3300025933 Bacteria 8213
451 Ga0207706_10013502 3300025933 Bacteria 7423
452 Ga0207706_10038294 3300025933 Bacteria 4254
453 Ga0207706_10224079 3300025933 Bacteria 1646
454 Ga0207706_10384106 3300025933 Bacteria 1218
455 Ga0207686_10019438 3300025934 Bacteria 3864
456 Ga0207709_10004574 3300025935 Bacteria 7964
457 Ga0207709_10092825 3300025935 Bacteria 1977
458 Ga0207709_10159618 3300025935 Bacteria 1571
459 Ga0207670_11424459 3300025936 Bacteria 588
460 Ga0207669_10002687 3300025937 Bacteria 7606
461 Ga0207669_10109216 3300025937 Bacteria 1849
462 Ga0207669_10252024 3300025937 Bacteria 1315
463 Ga0207704_10321742 3300025938 Bacteria 1193
464 Ga0207704_10470665 3300025938 Bacteria 1007
465 Ga0207691_10006361 3300025940 Bacteria 11410
466 Ga0207691_10017845 3300025940 Bacteria 6724
467 Ga0207691_10041139 3300025940 Bacteria 4269
468 Ga0207691_10062163 3300025940 Bacteria 3390
469 Ga0207691_10106912 3300025940 Bacteria 2491
470 Ga0207691_10714400 3300025940 Bacteria 845
471 Ga0207711_10019406 3300025941 Bacteria 5661
472 Ga0207711_10038028 3300025941 Bacteria 4091
473 Ga0207711_10055496 3300025941 Bacteria 3401
474 Ga0207711_10100159 3300025941 Bacteria 2562
475 Ga0207711_10895220 3300025941 Bacteria 825
476 Ga0207689_10008584 3300025942 Bacteria 8902
477 Ga0207689_10151885 3300025942 Bacteria 1909
478 Ga0207661_11785985 3300025944 Bacteria 560
479 Ga0207661_11814878 3300025944 Bacteria 555
480 Ga0207679_10421429 3300025945 Bacteria 1178
481 Ga0207679_10428307 3300025945 Bacteria 1169
482 Ga0207667_10033716 3300025949 Bacteria 5503
483 Ga0207667_10086275 3300025949 Bacteria 3248
484 Ga0207651_10270837 3300025960 Bacteria 1398
485 Ga0207651_10323459 3300025960 Bacteria 1290
486 Ga0207651_10899738 3300025960 Bacteria 788
487 Ga0207651_10996878 3300025960 Bacteria 748
488 Ga0207712_10321904 3300025961 Bacteria 1276
489 Ga0207712_10449324 3300025961 Bacteria 1093
490 Ga0207668_10047628 3300025972 Bacteria 2936
491 Ga0207668_10536402 3300025972 Bacteria 1012
492 Ga0207640_10861141 3300025981 Bacteria 789
493 Ga0207640_11553041 3300025981 Bacteria 596
494 Ga0207658_10002231 3300025986 Bacteria 14379
495 Ga0207658_10002288 3300025986 Bacteria 14152
496 Ga0207658_10068991 3300025986 Bacteria 2670
497 Ga0207658_10803205 3300025986 Bacteria 854
498 Ga0207658_11018975 3300025986 Bacteria 755
499 Ga0207677_10087009 3300026023 Bacteria 2261
500 Ga0207677_10111697 3300026023 Bacteria 2037
501 Ga0207677_10593827 3300026023 Bacteria 971
502 Ga0207677_11509366 3300026023 Bacteria 621
503 Ga0207677_11992603 3300026023 Bacteria 540
504 Ga0207703_10012466 3300026035 Bacteria 6628
505 Ga0207639_10100380 3300026041 Bacteria 2338
506 Ga0207639_11239149 3300026041 Bacteria 700
507 Ga0207639_11629304 3300026041 Bacteria 605
508 Ga0207708_10091222 3300026075 Bacteria 2349
509 Ga0207708_10416819 3300026075 Bacteria 1113
510 Ga0207708_10422056 3300026075 Bacteria 1106
511 Ga0207702_10097785 3300026078 Bacteria 2584
512 Ga0207702_10301584 3300026078 Bacteria 1520
513 Ga0207641_10006486 3300026088 Bacteria 9852
514 Ga0207641_10157257 3300026088 Bacteria 2063
515 Ga0207641_11297837 3300026088 Bacteria 728
516 Ga0207648_10000002 3300026089 Bacteria 307909
517 Ga0207648_10003517 3300026089 Bacteria 16406
518 Ga0207648_10022364 3300026089 Bacteria 5681
519 Ga0207648_10943619 3300026089 Bacteria 807
520 Ga0207648_11564530 3300026089 Bacteria 620
521 Ga0207676_10027632 3300026095 Bacteria 4228
522 Ga0207676_10129451 3300026095 Bacteria 2143
523 Ga0207676_10201663 3300026095 Bacteria 1758
524 Ga0207676_11515846 3300026095 Bacteria 667
525 Ga0207674_10009884 3300026116 Bacteria 10854
526 Ga0207674_10047774 3300026116 Bacteria 4385
527 Ga0207674_10427372 3300026116 Bacteria 1280
528 Ga0207675_100001416 3300026118 Bacteria 24021
529 Ga0207675_101137454 3300026118 Bacteria 801
530 Ga0207683_10009129 3300026121 Bacteria 8451
531 Ga0207683_10016135 3300026121 Bacteria 6357
532 Ga0207683_10105127 3300026121 Bacteria 2524
533 Ga0207683_10545982 3300026121 Bacteria 1071
534 Ga0207683_10798456 3300026121 Bacteria 876
535 Ga0207683_10937691 3300026121 Bacteria 804
536 Ga0207698_10127571 3300026142 Bacteria 2167
537 Ga0207698_10441685 3300026142 Bacteria 1253
538 Ga0209969_1002240 3300027360 Bacteria 2667
539 Ga0209967_1004872 3300027364 Bacteria 1794
540 Ga0209981_1003673 3300027378 Bacteria 1995
541 Ga0209996_1019517 3300027395 Bacteria 947
542 Ga0210000_1001764 3300027462 Bacteria 3061
543 Ga0209995_1002050 3300027471 Bacteria 3163
544 Ga0209968_1003838 3300027526 Bacteria 2255
545 Ga0209999_1001732 3300027543 Bacteria 3782
546 Ga0209970_1022078 3300027614 Bacteria 1079
547 Ga0209983_1036827 3300027665 Bacteria 1053
548 Ga0209971_1021982 3300027682 Bacteria 1519
549 Ga0209966_1045950 3300027695 Bacteria 921
550 Ga0209974_10007325 3300027876 Bacteria 3803
551 Ga0207428_10159956 3300027907 Bacteria 1710
552 Ga0268265_10007737 3300028380 Bacteria 7253
553 Ga0268264_10004913 3300028381 Bacteria 11330
554 Ga0268264_10099285 3300028381 Bacteria 2526
555 Ga0268264_11401834 3300028381 Bacteria 709
556 Ga0307517_10008069 3300028786 Bacteria 15177
557 Ga0307517_10087798 3300028786 Bacteria 2579
558 Ga0307517_10153995 3300028786 Bacteria 1567
559 Ga0307517_10457924 3300028786 Bacteria 659
560 Ga0307515_10000179 3300028794 Bacteria 156716
561 Ga0307515_10000586 3300028794 Bacteria 85517
562 Ga0307515_10000873 3300028794 Bacteria 69237
563 Ga0307515_10236777 3300028794 Bacteria 1605
564 Ga0307515_10239345 3300028794 Bacteria 1589
565 Ga0265324_10224448 3300029957 Bacteria 638
566 Ga0307512_10066557 3300030522 Bacteria 2721
567 Ga0307513_10032823 3300031456 Bacteria 5847
568 Ga0307513_10074607 3300031456 Bacteria 3526
569 Ga0307513_10236611 3300031456 Bacteria 1635
570 Ga0307513_10434627 3300031456 Bacteria 1040
571 Ga0307513_10962798 3300031456 Bacteria 562
572 Ga0307509_10052253 3300031507 Bacteria 4363
573 Ga0307509_10240890 3300031507 Bacteria 1601
574 Ga0307509_10297731 3300031507 Bacteria 1363
575 Ga0307509_10705268 3300031507 Bacteria 675
576 Ga0307408_100053233 3300031548 Bacteria 2922
577 Ga0307408_100133327 3300031548 Bacteria 1940
578 Ga0307408_100305013 3300031548 Bacteria 1335
579 Ga0307408_100314965 3300031548 Bacteria 1316
580 Ga0307508_10000122 3300031616 Bacteria 92612
581 Ga0307508_10000222 3300031616 Bacteria 69029
582 Ga0307508_10016751 3300031616 Bacteria 6668
583 Ga0307508_10026831 3300031616 Bacteria 5219
584 Ga0307508_10058972 3300031616 Bacteria 3395
585 Ga0307508_10114356 3300031616 Bacteria 2299
586 Ga0307508_10453277 3300031616 Bacteria 875
587 Ga0307514_10272910 3300031649 Bacteria 977
588 Ga0307516_10000662 3300031730 Bacteria 46543
589 Ga0307516_10029866 3300031730 Bacteria 5507
590 Ga0307516_10111433 3300031730 Bacteria 2538
591 Ga0307516_10371420 3300031730 Bacteria 1093
592 Ga0307405_10018973 3300031731 Bacteria 3809
593 Ga0307405_10126957 3300031731 Bacteria 1755
594 Ga0307406_10136632 3300031901 Bacteria 1729
595 Ga0307412_10017084 3300031911 Bacteria 4338
596 Ga0307412_10046588 3300031911 Bacteria 2841
597 Ga0307412_10735366 3300031911 Bacteria 850
598 Ga0307412_10768831 3300031911 Bacteria 833
599 Ga0307409_100004643 3300031995 Bacteria 7762
600 Ga0307416_100018756 3300032002 Bacteria 4884
601 Ga0307416_100056724 3300032002 Bacteria 3163
602 Ga0307414_10048754 3300032004 Bacteria 2924
603 Ga0307414_10563759 3300032004 Bacteria 1017
604 Ga0307414_11108514 3300032004 Bacteria 731
605 Ga0307411_10000112 3300032005 Bacteria 25459
606 Ga0307411_10021299 3300032005 Bacteria 3790
607 Ga0307411_10619137 3300032005 Bacteria 933
608 Ga0307411_11520526 3300032005 Bacteria 616
609 Ga0307415_100001031 3300032126 Bacteria 12888
610 Ga0307507_10069984 3300033179 Bacteria 3187
611 Ga0307507_10231018 3300033179 Bacteria 1226
612 Ga0307507_10292572 3300033179 Bacteria 1006
613 Ga0307507_10516061 3300033179 Bacteria 639
614 Ga0307510_10178973 3300033180 Bacteria 1686
615 Ga0373951_0007298 3300035091 Bacteria 2515
616 Ga0373923_0071975 3300035111 Bacteria 1486
617 Ga0373936_0337503 3300035113 Bacteria 685
618 Ga0373939_0000031 3300035114 Bacteria 50064
619 Ga0373945_0008025 3300035116 Bacteria 3429
620 Ga0373953_0081213 3300035117 Bacteria 1348
621 Ga0373960_0009104 3300035121 Bacteria 2397
622 Ga0373943_0173390 3300035170 Bacteria 1181
623 Ga0373955_0112668 3300035172 Bacteria 1574
624 Ga0373955_0522590 3300035172 Bacteria 725
625 Ga0373931_0001294 3300035691 Bacteria 10706
626 Ga0373927_0261288 3300035695 Bacteria 1139
627 Ga0373927_0559429 3300035695 Bacteria 756
628 Ga0373933_0295583 3300035724 Bacteria 1048
629 Ga0373947_0020189 3300035725 Bacteria 3845
630 Ga0373937_0026003 3300036401 Bacteria 5287
631 Ga0373937_0081817 3300036401 Bacteria 2987
632 Ga0373925_0033167 3300037068 Bacteria 3806
633 Ga0373925_0189829 3300037068 Bacteria 1630
634 Ga0373925_0806431 3300037068 Bacteria 774
635 Ga0373925_1276151 3300037068 Bacteria 603
636 Ga0395905_0002410 3300037471 Bacteria 20775
637 Ga0395905_0279462 3300037471 Bacteria 1556
638 Ga0395905_0858837 3300037471 Bacteria 810
639 Ga0436365_1108553 3300039437 Bacteria 1141
640 Ga0436361_0436689 3300039447 Bacteria 47478
641 Ga0439436_0000149 3300041404 Bacteria 16201
642 Ga0439439_0003522 3300041406 Bacteria 3459
643 Ga0439439_0012659 3300041406 Bacteria 2042
644 Ga0439447_008609 3300041407 Bacteria 3151
645 Ga0439447_071367 3300041407 Bacteria 807
646 Ga0439461_0008282 3300041410 Bacteria 1859
647 Ga0439461_0037843 3300041410 Bacteria 1032
648 Ga0439461_0063307 3300041410 Bacteria 844
649 Ga0439466_0003514 3300041411 Bacteria 6064
650 Ga0439466_0014241 3300041411 Bacteria 2899
651 Ga0439465_0013878 3300041413 Bacteria 2508
652 Ga0451787_469218 3300041441 Bacteria 574
653 Ga0451789_0443499 3300041443 Bacteria 858
654 Ga0451789_1004478 3300041443 Bacteria 2758
655 Ga0451791_1774605 3300041451 Bacteria 671
656 Ga0451795_0417844 3300041456 Bacteria 4270
657 Ga0451795_0723237 3300041456 Bacteria 1869
658 Ga0451798_0109225 3300041458 Bacteria 2347
659 Ga0451800_0129709 3300041459 Bacteria 534
660 Ga0451800_1183513 3300041459 Bacteria 584
661 Ga0451800_1257440 3300041459 Bacteria 1442
662 Ga0451802_0213386 3300041460 Bacteria 1374
663 Ga0451802_0459691 3300041460 Bacteria 1157
664 Ga0451802_0491871 3300041460 Bacteria 1328
665 Ga0451802_1483943 3300041460 Bacteria 813
666 Ga0451804_0920644 3300041463 Bacteria 2287
667 Ga0451804_1039343 3300041463 Bacteria 775
668 Ga0451807_0588167 3300041486 Bacteria 1019
669 Ga0451833_0412951 3300041491 Bacteria 858
670 Ga0451835_0304909 3300041492 Bacteria 557
671 Ga0451839_0471582 3300041496 Bacteria 1025
672 Ga0451839_1533245 3300041496 Bacteria 1009
673 Ga0451841_1424262 3300041498 Bacteria 540
674 Ga0451849_0264779 3300041505 Bacteria 787
675 Ga0451849_1033926 3300041505 Bacteria 2421
676 Ga0451851_0873834 3300041507 Bacteria 960
677 Ga0451843_0009642 3300041509 Bacteria 2024
678 Ga0451843_1553242 3300041509 Bacteria 792
679 Ga0451853_2066207 3300041512 Bacteria 1442
680 Ga0451853_2123395 3300041512 Bacteria 609
681 Ga0439431_0005212 3300041997 Bacteria 2864
682 Ga0439431_0022000 3300041997 Bacteria 1534
683 Ga0439433_0000311 3300041999 Bacteria 8445
684 Ga0439433_0005036 3300041999 Bacteria 2834
685 Ga0439437_000343 3300042000 Bacteria 4411
686 Ga0439442_001752 3300042002 Bacteria 4248
687 Ga0439445_0088537 3300042004 Bacteria 870
688 Ga0439432_000358 3300042006 Bacteria 16718
689 Ga0439432_011446 3300042006 Bacteria 3058
690 Ga0439449_0000747 3300042007 Bacteria 12487
691 Ga0439449_0002278 3300042007 Bacteria 7532
692 Ga0439449_0003803 3300042007 Bacteria 5841
693 Ga0439452_001926 3300042010 Bacteria 7955
694 Ga0439452_023649 3300042010 Bacteria 1579
695 Ga0439457_008390 3300042014 Bacteria 2439
696 Ga0439457_058945 3300042014 Bacteria 868
697 Ga0439462_0026016 3300042015 Bacteria 1541
698 Ga0439462_0064016 3300042015 Bacteria 995
699 Ga0450911_025166 3300042115 Bacteria 772
700 Ga0450917_000047 3300042120 Bacteria 6242
701 Ga0450923_005313 3300042125 Bacteria 2072
702 Ga0450888_000072 3300042126 Bacteria 7693
703 Ga0450890_002329 3300042127 Bacteria 2625
704 Ga0450897_010218 3300042128 Bacteria 899
705 Ga0450891_000672 3300042129 Bacteria 3570
706 Ga0450892_001742 3300042130 Bacteria 1995
707 Ga0450894_006623 3300042131 Bacteria 1493
708 Ga0450896_007651 3300042133 Bacteria 1490
709 Ga0450899_002990 3300042135 Bacteria 1821
710 Ga0450903_008057 3300042138 Bacteria 1726
711 Ga0450904_018185 3300042139 Bacteria 707
712 Ga0450889_000337 3300042144 Bacteria 5220
713 Ga0450906_020888 3300042145 Bacteria 1170
714 Ga0439446_0017646 3300042156 Bacteria 1996
715 Ga0439446_0293705 3300042156 Bacteria 569
716 Ga0450908_057455 3300042184 Bacteria 681
717 Ga0450908_079923 3300042184 Bacteria 586
718 Ga0450909_003136 3300042185 Bacteria 2351
719 Ga0439434_0000586 3300042435 Bacteria 10519
720 Ga0439434_0017599 3300042435 Bacteria 2138
721 Ga0439434_0239228 3300042435 Unclassified 619
722 Ga0450918_060621 3300042531 Bacteria 699
723 Ga0450893_0001474 3300042532 Bacteria 3612
724 Ga0450893_0003843 3300042532 Bacteria 2380
725 Ga0466965_0086013 3300044683 Bacteria 1594
726 Ga0466966_0008651 3300044684 Bacteria 6737
727 Ga0466961_0099070 3300044693 Bacteria 1837
728 Ga0466964_0026898 3300044706 Bacteria 2254
729 Ga0466970_0008735 3300044765 Bacteria 5105
730 Ga0466960_0087446 3300044901 Bacteria 1582
731 Ga0466959_0488788 3300045049 Bacteria 832
732 Ga0451576_0294932 3300045051 Bacteria 1695
733 Ga0451576_0876413 3300045051 Bacteria 942
734 Ga0495617_268891 3300046452 Bacteria 523
735 Ga0495592_0006561 3300046454 Bacteria 8670
736 Ga0495603_0207942 3300046455 Bacteria 1130
737 Ga0495603_0598063 3300046455 Bacteria 631
738 Ga0495590_0066222 3300046457 Bacteria 1265
739 Ga0495590_0124979 3300046457 Bacteria 923
740 Ga0495629_0001758 3300046459 Bacteria 16997
741 Ga0495629_0221240 3300046459 Bacteria 1306
742 Ga0495629_0265655 3300046459 Bacteria 1179
743 Ga0495638_0172203 3300046460 Bacteria 1241
744 Ga0495641_0264922 3300046461 Bacteria 773
745 Ga0495651_0184789 3300046462 Bacteria 1472
746 Ga0495651_0357186 3300046462 Bacteria 964
747 Ga0495653_0208192 3300046463 Bacteria 1323
748 Ga0495650_0002383 3300046471 Bacteria 15397
749 Ga0495580_0070354 3300046472 Bacteria 2444
750 Ga0495580_0360701 3300046472 Bacteria 984
751 Ga0495582_0089087 3300046473 Bacteria 1719
752 Ga0495582_0277524 3300046473 Bacteria 962
753 Ga0495582_0616189 3300046473 Bacteria 628
754 Ga0495582_0732550 3300046473 Bacteria 572
755 Ga0495582_0737772 3300046473 Bacteria 570
756 Ga0495605_0073081 3300046474 Bacteria 1616
757 Ga0495639_0598279 3300046475 Bacteria 567
758 Ga0495662_0012546 3300046476 Bacteria 4134
759 Ga0495662_0052122 3300046476 Bacteria 1975
760 Ga0495584_0429976 3300046491 Bacteria 671
761 Ga0495608_0012778 3300046511 Bacteria 5826
762 Ga0495608_0628951 3300046511 Bacteria 643
763 Ga0495610_0012246 3300046512 Bacteria 5179
764 Ga0495610_0136617 3300046512 Bacteria 1059
765 Ga0495616_0197204 3300046513 Bacteria 887
766 Ga0495618_0727316 3300046514 Bacteria 582
767 Ga0495618_0737504 3300046514 Bacteria 577
768 Ga0495620_0144253 3300046515 Bacteria 930
769 Ga0495620_0204779 3300046515 Bacteria 758
770 Ga0495620_0368431 3300046515 Bacteria 544
771 Ga0495628_0066117 3300046516 Bacteria 2826
772 Ga0495628_0164618 3300046516 Bacteria 1684
773 Ga0495630_0001728 3300046517 Bacteria 15247
774 Ga0495630_0038696 3300046517 Bacteria 3568
775 Ga0495630_0266826 3300046517 Bacteria 1308
776 Ga0495630_0694475 3300046517 Bacteria 779
777 Ga0495631_0138775 3300046518 Bacteria 1044
778 Ga0495632_0017543 3300046519 Bacteria 3947
779 Ga0495632_0076186 3300046519 Bacteria 1604
780 Ga0495632_0099632 3300046519 Bacteria 1370
781 Ga0495643_0041054 3300046522 Bacteria 2524
782 Ga0495648_0204432 3300046524 Bacteria 986
783 Ga0495648_0249714 3300046524 Bacteria 857
784 Ga0495666_0026411 3300046526 Bacteria 2862
785 Ga0495666_0061797 3300046526 Bacteria 1789
786 Ga0495666_0333748 3300046526 Bacteria 684
787 Ga0495666_0496798 3300046526 Bacteria 545
788 Ga0495642_0040146 3300046528 Bacteria 1900
789 Ga0495642_0266434 3300046528 Bacteria 750
790 Ga0495652_0067036 3300046529 Bacteria 3010
791 Ga0495652_0188341 3300046529 Bacteria 1577
792 Ga0495652_0737678 3300046529 Bacteria 660
793 Ga0495654_0059525 3300046530 Bacteria 1839
794 Ga0495640_0005587 3300046533 Bacteria 9999
795 Ga0495640_0012886 3300046533 Bacteria 6377
796 Ga0495586_0011166 3300046535 Bacteria 4774
797 Ga0495586_0063428 3300046535 Bacteria 2013
798 Ga0495587_0056143 3300046536 Bacteria 2317
799 Ga0495587_0448019 3300046536 Bacteria 715
800 Ga0495598_0038050 3300046537 Bacteria 1391
801 Ga0495621_0055952 3300046539 Bacteria 1421
802 Ga0495621_0128326 3300046539 Bacteria 985
803 Ga0495621_0478782 3300046539 Bacteria 535
804 Ga0495597_0049821 3300046542 Bacteria 1850
805 Ga0495597_0074206 3300046542 Bacteria 1461
806 Ga0495645_0000309 3300046543 Bacteria 35183
807 Ga0495645_0088941 3300046543 Bacteria 2208
808 Ga0495622_0458416 3300046557 Bacteria 546
809 Ga0495633_0293281 3300046558 Bacteria 739
810 Ga0495667_0047388 3300046559 Bacteria 2840
811 Ga0495656_0002670 3300046615 Bacteria 5953
812 Ga0495656_0094696 3300046615 Bacteria 1372
813 Ga0495668_0210643 3300046616 Bacteria 1064
814 Ga0495668_0762803 3300046616 Bacteria 535
815 Ga0495634_0010834 3300046642 Bacteria 6667
816 Ga0495634_0123338 3300046642 Bacteria 1658
817 Ga0495634_0612452 3300046642 Bacteria 631
818 Ga0495625_0036918 3300046660 Bacteria 3587
819 Ga0495625_0069555 3300046660 Bacteria 2473
820 Ga0495657_0415615 3300046675 Bacteria 790
821 Ga0495599_0033235 3300046678 Bacteria 3240
822 Ga0495623_0327390 3300046679 Bacteria 840
823 Ga0495646_0022134 3300046680 Bacteria 4011
824 Ga0495647_0012321 3300046681 Bacteria 2943
825 Ga0495647_0055762 3300046681 Bacteria 1548
826 Ga0495647_0374932 3300046681 Bacteria 651
827 Ga0495658_0019833 3300046683 Bacteria 3515
828 Ga0495658_0039204 3300046683 Bacteria 2628
829 Ga0495658_0063173 3300046683 Bacteria 2130
830 Ga0495658_0415223 3300046683 Bacteria 858
831 Ga0495658_0441988 3300046683 Bacteria 830
832 Ga0495658_0526725 3300046683 Bacteria 756
833 Ga0495669_0096688 3300046684 Bacteria 1368
834 Ga0495613_0022406 3300046689 Bacteria 4708
835 Ga0495613_0161628 3300046689 Bacteria 1593
836 Ga0495613_0222595 3300046689 Bacteria 1324
837 Ga0495670_0132057 3300046691 Bacteria 1302
838 Ga0495670_0188188 3300046691 Bacteria 1091
839 Ga0495649_0008009 3300046694 Bacteria 6386
840 Ga0495649_0162861 3300046694 Bacteria 1169
841 Ga0495589_0028340 3300046794 Bacteria 2827
842 Ga0495589_0255838 3300046794 Bacteria 817
843 Ga0495600_0229217 3300046809 Bacteria 1186
844 Ga0495600_0307718 3300046809 Bacteria 999
845 Ga0495581_0001544 3300047315 Bacteria 12850
846 Ga0495581_0279300 3300047315 Bacteria 976
847 Ga0495604_0018716 3300047317 Bacteria 5547
848 Ga0495604_0236559 3300047317 Bacteria 1251
849 Ga0495636_0002229 3300047318 Bacteria 7441
850 Ga0495674_0069160 3300047319 Bacteria 3054
851 Ga0495680_0004705 3300047322 Bacteria 12987
852 Ga0495680_0605395 3300047322 Bacteria 733
853 Ga0495683_0199671 3300047323 Bacteria 903
854 Ga0495687_000330 3300047443 Bacteria 60838
855 Ga0495687_010458 3300047443 Bacteria 5088
856 Ga0495687_015164 3300047443 Bacteria 3930
857 Ga0495687_040493 3300047443 Bacteria 2052
858 Ga0495675_0120522 3300047444 Bacteria 1634
859 Ga0495675_0403243 3300047444 Bacteria 797
860 Ga0495679_037921 3300047446 Bacteria 1513
861 Ga0495673_0312798 3300047469 Bacteria 561
862 Ga0495681_0095694 3300047470 Bacteria 1305
863 Ga0495681_0291429 3300047470 Bacteria 634
864 Ga0495684_0109601 3300047471 Bacteria 2085
865 Ga0495684_0605090 3300047471 Bacteria 739
866 Ga0495686_0162084 3300047472 Bacteria 1306
867 Ga0495686_0201281 3300047472 Bacteria 1143
868 Ga0495593_0065478 3300047673 Bacteria 1895
869 Ga0495593_0182545 3300047673 Bacteria 1056
870 Ga0495593_0280166 3300047673 Bacteria 834
871 Ga0495614_0028296 3300048089 Bacteria 2415
872 Ga0495615_0011601 3300048090 Bacteria 1796
873 Ga0495626_0056643 3300048091 Bacteria 1794
874 Ga0496100_0016608 3300048903 Bacteria 4327
875 Ga0496100_0279692 3300048903 Bacteria 1244
876 Ga0496101_0190107 3300048904 Bacteria 1584
877 Ga0496102_0845522 3300048905 Bacteria 837
878 Ga0496104_0038949 3300048907 Bacteria 4449
879 Ga0496104_0734914 3300048907 Bacteria 894
880 Ga0496106_0294609 3300048909 Bacteria 1301
881 Ga0496107_0145047 3300048910 Bacteria 1755
882 Ga0496107_0790580 3300048910 Bacteria 695
883 Ga0496108_0040663 3300048911 Bacteria 3878
884 Ga0496108_1660631 3300048911 Bacteria 527
885 Ga0496109_0389761 3300048912 Bacteria 1316
886 Ga0496110_0389172 3300048913 Bacteria 1271
887 Ga0496110_1899729 3300048913 Bacteria 505
888 Ga0496111_0218977 3300048914 Bacteria 1414
889 Ga0496111_0947198 3300048914 Bacteria 619
890 Ga0496114_0023648 3300048917 Bacteria 5015
891 Ga0496114_0067421 3300048917 Bacteria 3002
892 Ga0496114_0250949 3300048917 Bacteria 1557
893 Ga0496115_0082785 3300048918 Bacteria 2615
894 Ga0496116_0039170 3300048919 Bacteria 3280
895 Ga0496121_0100190 3300048924 Bacteria 2237
896 Ga0496123_0041868 3300048926 Bacteria 3169
897 Ga0496124_0217019 3300048927 Bacteria 1442
898 Ga0496125_0000313 3300048928 Bacteria 95423
899 Ga0495682_0132834 3300049460 Bacteria 890
900 Ga0501032_0024130 3300049569 Bacteria 4200
901 Ga0501041_0824026 3300049577 Bacteria 595
902 Ga0501042_0945943 3300049578 Bacteria 628
903 Ga0501043_0000024 3300049579 Bacteria 154045
904 Ga0501046_0000173 3300049580 Bacteria 65571
905 Ga0501047_0000051 3300049581 Bacteria 154281
906 Ga0501048_0004089 3300049582 Bacteria 11111
907 Ga0501072_1100069 3300049588 Bacteria 618
908 Ga0501075_0612134 3300049591 Bacteria 831
909 Ga0501077_0183595 3300049593 Bacteria 1329
910 Ga0501206_010989 3300049653 Bacteria 1218
911 Ga0501227_002679 3300049665 Bacteria 3907
912 Ga0501242_076279 3300049674 Bacteria 532
913 Ga0501079_0278594 3300049741 Bacteria 1308
914 Ga0501081_1113446 3300049743 Bacteria 598
915 Ga0501267_000121 3300049764 Bacteria 5065
916 Ga0501044_0825540 3300049823 Bacteria 805
917 Ga0501045_0019498 3300049824 Bacteria 4836
918 nmdc:mga03683_202345_c1 3300050489 Bacteria 912
919 nmdc:mga03683_39851_c1 3300050489 Bacteria 1924
920 nmdc:mga03683_399431_c1 3300050489 Bacteria 656
921 nmdc:mga03683_697026_c1 3300050489 Bacteria 502
922 nmdc:mga03683_91934_c1 3300050489 Bacteria 1324
923 nmdc:mga03n38_146736_c1 3300050490 Bacteria 1183
924 nmdc:mga03n38_30849_c1 3300050490 Bacteria 2257
925 nmdc:mga03n38_882484_c1 3300050490 Bacteria 525
926 nmdc:mga00v17_111671_c1 3300050491 Bacteria 1734
927 nmdc:mga00v17_12372_c1 3300050491 Bacteria 4707
928 nmdc:mga0yw44_233681_c1 3300050492 Bacteria 1221
929 nmdc:mga0yw44_398016_c1 3300050492 Bacteria 931
930 nmdc:mga0k408_1110_c1 3300050493 Bacteria 14744
931 nmdc:mga0k408_204254_c1 3300050493 Bacteria 1180
932 nmdc:mga0k408_23096_c1 3300050493 Bacteria 3505
933 nmdc:mga0k408_241823_c1 3300050493 Bacteria 1078
934 nmdc:mga0k408_28362_c1 3300050493 Bacteria 3182
935 nmdc:mga0k408_288994_c1 3300050493 Bacteria 979
936 nmdc:mga0k408_337776_c1 3300050493 Bacteria 898
937 nmdc:mga0k408_42338_c1 3300050493 Bacteria 2623
938 nmdc:mga0k408_442217_c1 3300050493 Bacteria 772
939 nmdc:mga0k408_7671_c1 3300050493 Bacteria 5765
940 nmdc:mga06z11_182458_c1 3300050494 Bacteria 1211
941 nmdc:mga06z11_44682_c1 3300050494 Bacteria 2235
942 nmdc:mga04h51_107551_c1 3300050495 Bacteria 1024
943 nmdc:mga07m45_130733_c1 3300050496 Bacteria 1452
944 nmdc:mga07m45_14548_c1 3300050496 Bacteria 4195
945 nmdc:mga07m45_311732_c1 3300050496 Bacteria 915
946 nmdc:mga07m45_3282_c1 3300050496 Bacteria 7782
947 nmdc:mga07m45_45272_c1 3300050496 Bacteria 2470
948 nmdc:mga07m45_52835_c1 3300050496 Bacteria 2295
949 nmdc:mga07m45_655472_c1 3300050496 Bacteria 605
950 nmdc:mga07m45_7161_c1 3300050496 Bacteria 5684
951 nmdc:mga07m45_7700_c1 3300050496 Bacteria 5513
952 nmdc:mga07m45_94756_c1 3300050496 Bacteria 1712
953 nmdc:mga09592_241612_c1 3300050508 Bacteria 1565
954 nmdc:mga09592_384058_c1 3300050508 Bacteria 1214
955 nmdc:mga08y16_1106325_c1 3300050511 Bacteria 767
956 nmdc:mga08y16_171167_c1 3300050511 Bacteria 2256
957 nmdc:mga08y16_649380_c1 3300050511 Bacteria 1059
958 nmdc:mga0n895_422388_c1 3300050512 Bacteria 1347
959 nmdc:mga0sz30_245089_c1 3300050516 Bacteria 798
960 nmdc:mga0sz30_535499_c1 3300050516 Bacteria 528
961 Ga0495601_0018194 3300053077 Bacteria 4274
962 Ga0495612_0112261 3300053078 Bacteria 1168
963 Ga0495612_0190400 3300053078 Bacteria 903
964 Ga0495619_0052855 3300053085 Bacteria 2686
965 Ga0495619_0107214 3300053085 Bacteria 1906
966 Ga0500578_0000342 3300053086 Bacteria 56948
967 Ga0500578_0041368 3300053086 Bacteria 2960
968 Ga0500644_0220452 3300053088 Bacteria 791
969 Ga0500646_0037799 3300053090 Bacteria 1349
970 Ga0500583_0075468 3300053092 Bacteria 1620
971 Ga0500583_0347107 3300053092 Bacteria 720
972 Ga0500651_0053252 3300053093 Bacteria 2537
973 Ga0500651_0079073 3300053093 Bacteria 2039
974 Ga0500650_0271161 3300053098 Bacteria 756
975 Ga0500554_131828 3300053102 Bacteria 844
976 Ga0500569_006616 3300053109 Bacteria 2554
977 Ga0500621_223356 3300053126 Bacteria 651
978 Ga0500623_075565 3300053127 Bacteria 1620
979 Ga0500628_003123 3300053129 Bacteria 2722
980 Ga0500628_184997 3300053129 Bacteria 596
981 Ga0500642_0001586 3300053130 Bacteria 6554
982 Ga0500652_005414 3300053131 Bacteria 4016
983 Ga0500658_0015723 3300053134 Bacteria 2813
984 Ga0500568_0090637 3300053139 Bacteria 1153
985 Ga0500577_0039092 3300053142 Bacteria 1717
986 Ga0500604_0013131 3300053151 Bacteria 2242
987 Ga0500604_0193398 3300053151 Bacteria 699
988 Ga0500619_000041 3300053154 Bacteria 39742
989 Ga0500619_100300 3300053154 Bacteria 982
990 Ga0500620_111999 3300053155 Bacteria 956
991 Ga0500622_0000091 3300053156 Bacteria 93307
992 Ga0500622_0152603 3300053156 Bacteria 1090
993 Ga0500627_0202947 3300053158 Bacteria 888
994 Ga0500634_0048186 3300053161 Bacteria 2299
995 Ga0500649_158335 3300053722 Bacteria 801
996 Ga0500584_081850 3300053726 Bacteria 1379
997 Ga0500645_002331 3300053730 Bacteria 8559
998 Ga0500587_002054 3300053739 Bacteria 2874
999 Ga0501084_0421593 3300054114 Bacteria 1128

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10156776 rootL2_101567762 108
2 3300003323 rootH1_10054083 rootH1_100540832 108
3 3300005290 Ga0065712_10223066 Ga0065712_102230662 108
4 3300005293 Ga0065715_10016577 Ga0065715_100165772 108
5 3300005327 Ga0070658_10430712 Ga0070658_104307122 108
6 3300005329 Ga0070683_100120080 Ga0070683_1001200802 108
7 3300005330 Ga0070690_100001815 Ga0070690_10000181512 108
8 3300005331 Ga0070670_100361204 Ga0070670_1003612042 108
9 3300005334 Ga0068869_100141900 Ga0068869_1001419001 108
10 3300005334 Ga0068869_101030603 Ga0068869_1010306032 108
11 3300005335 Ga0070666_10099909 Ga0070666_100999092 108
12 3300005337 Ga0070682_100437029 Ga0070682_1004370292 108
13 3300005339 Ga0070660_100250043 Ga0070660_1002500432 108
14 3300005340 Ga0070689_100004554 Ga0070689_1000045545 108
15 3300005341 Ga0070691_10377207 Ga0070691_103772072 108
16 3300005344 Ga0070661_100336456 Ga0070661_1003364562 108
17 3300005344 Ga0070661_101530449 Ga0070661_1015304492 108
18 3300005345 Ga0070692_10224130 Ga0070692_102241302 108
19 3300005354 Ga0070675_100389196 Ga0070675_1003891961 108
20 3300005356 Ga0070674_100024540 Ga0070674_1000245402 108
21 3300005364 Ga0070673_100043415 Ga0070673_1000434153 108
22 3300005365 Ga0070688_100159329 Ga0070688_1001593292 108
23 3300005366 Ga0070659_100041833 Ga0070659_1000418332 108
24 3300005434 Ga0070709_10088230 Ga0070709_100882302 108
25 3300005437 Ga0070710_10015522 Ga0070710_100155222 108
26 3300005437 Ga0070710_10244186 Ga0070710_102441862 108
27 3300005438 Ga0070701_10571618 Ga0070701_105716182 108
28 3300005439 Ga0070711_100038205 Ga0070711_1000382055 108
29 3300005440 Ga0070705_100040034 Ga0070705_1000400343 108
30 3300005444 Ga0070694_100134098 Ga0070694_1001340982 108
31 3300005445 Ga0070708_100233431 Ga0070708_1002334312 108
32 3300005456 Ga0070678_100002439 Ga0070678_1000024392 108
33 3300005457 Ga0070662_100446627 Ga0070662_1004466271 108
34 3300005459 Ga0068867_100472583 Ga0068867_1004725831 108
35 3300005466 Ga0070685_10000493 Ga0070685_1000049321 108
36 3300005467 Ga0070706_100123600 Ga0070706_1001236002 108
37 3300005468 Ga0070707_100301965 Ga0070707_1003019652 108
38 3300005471 Ga0070698_100413024 Ga0070698_1004130242 108
39 3300005518 Ga0070699_100607410 Ga0070699_1006074101 108
40 3300005530 Ga0070679_100178492 Ga0070679_1001784923 108
41 3300005535 Ga0070684_100125115 Ga0070684_1001251152 108
42 3300005536 Ga0070697_100437186 Ga0070697_1004371862 108
43 3300005539 Ga0068853_100368490 Ga0068853_1003684901 108
44 3300005539 Ga0068853_100691354 Ga0068853_1006913542 108
45 3300005543 Ga0070672_101736624 Ga0070672_1017366241 108
46 3300005544 Ga0070686_100035614 Ga0070686_1000356142 108
47 3300005545 Ga0070695_100088980 Ga0070695_1000889802 108
48 3300005546 Ga0070696_100213444 Ga0070696_1002134442 108
49 3300005546 Ga0070696_100667254 Ga0070696_1006672542 108
50 3300005547 Ga0070693_100003655 Ga0070693_1000036552 108
51 3300005548 Ga0070665_100016649 Ga0070665_1000166492 108
52 3300005549 Ga0070704_100041018 Ga0070704_1000410183 108
53 3300005549 Ga0070704_101341913 Ga0070704_1013419131 108
54 3300005564 Ga0070664_100287978 Ga0070664_1002879782 108
55 3300005578 Ga0068854_100136299 Ga0068854_1001362992 108
56 3300005578 Ga0068854_100171311 Ga0068854_1001713112 108
57 3300005614 Ga0068856_100053983 Ga0068856_1000539832 108
58 3300005616 Ga0068852_100758868 Ga0068852_1007588682 108
59 3300005617 Ga0068859_100213952 Ga0068859_1002139522 108
60 3300005718 Ga0068866_10035408 Ga0068866_100354082 108
61 3300005834 Ga0068851_10069711 Ga0068851_100697112 108
62 3300005841 Ga0068863_100078599 Ga0068863_1000785993 108
63 3300005841 Ga0068863_100899292 Ga0068863_1008992922 108
64 3300005842 Ga0068858_100014064 Ga0068858_1000140642 108
65 3300005842 Ga0068858_100101907 Ga0068858_1001019071 108
66 3300006028 Ga0070717_10139912 Ga0070717_101399122 108
67 3300006173 Ga0070716_100018816 Ga0070716_1000188164 108
68 3300006175 Ga0070712_100060850 Ga0070712_1000608502 108
69 3300006871 Ga0075434_100383728 Ga0075434_1003837282 108
70 3300006881 Ga0068865_100356371 Ga0068865_1003563712 108
71 3300006914 Ga0075436_100142324 Ga0075436_1001423242 108
72 3300006931 Ga0097620_100213932 Ga0097620_1002139322 108
73 3300009093 Ga0105240_10359587 Ga0105240_103595872 108
74 3300009098 Ga0105245_10214229 Ga0105245_102142293 108
75 3300009101 Ga0105247_10044989 Ga0105247_100449892 108
76 3300009148 Ga0105243_10375564 Ga0105243_103755642 108
77 3300009174 Ga0105241_10277178 Ga0105241_102771782 108
78 3300009177 Ga0105248_10321725 Ga0105248_103217251 108
79 3300009545 Ga0105237_10253444 Ga0105237_102534443 108
80 3300009551 Ga0105238_10076515 Ga0105238_100765154 108
81 3300009551 Ga0105238_10408632 Ga0105238_104086322 108
82 3300010375 Ga0105239_10605911 Ga0105239_106059112 108
83 3300011119 Ga0105246_10054492 Ga0105246_100544922 108
84 3300013100 Ga0157373_10432858 Ga0157373_104328582 108
85 3300013100 Ga0157373_10686181 Ga0157373_106861811 108
86 3300013102 Ga0157371_10118360 Ga0157371_101183602 108
87 3300013104 Ga0157370_10148122 Ga0157370_101481223 108
88 3300013307 Ga0157372_11934594 Ga0157372_119345942 108
89 3300014325 Ga0163163_10142007 Ga0163163_101420072 108
90 3300014745 Ga0157377_10011551 Ga0157377_100115512 108
91 3300014968 Ga0157379_10004770 Ga0157379_1000477014 108
92 3300014968 Ga0157379_10024408 Ga0157379_100244085 108
93 3300014969 Ga0157376_10294489 Ga0157376_102944892 108
94 3300025245 Ga0207425_1071545 Ga0207425_10715451 108
95 3300005329 Ga0070683_101092304 Ga0070683_1010923041 109
96 3300005330 Ga0070690_100498243 Ga0070690_1004982432 109
97 3300005341 Ga0070691_10595448 Ga0070691_105954482 109
98 3300005355 Ga0070671_100049662 Ga0070671_1000496624 109
99 3300005364 Ga0070673_101095480 Ga0070673_1010954802 109
100 3300005438 Ga0070701_10855283 Ga0070701_108552832 109
101 3300005440 Ga0070705_100432461 Ga0070705_1004324613 109
102 3300005444 Ga0070694_100011953 Ga0070694_1000119532 109
103 3300005444 Ga0070694_101013541 Ga0070694_1010135412 109
104 3300005536 Ga0070697_100260777 Ga0070697_1002607773 109
105 3300005544 Ga0070686_101084404 Ga0070686_1010844041 109
106 3300005545 Ga0070695_100126146 Ga0070695_1001261463 109
107 3300005545 Ga0070695_100158395 Ga0070695_1001583953 109
108 3300005546 Ga0070696_100010213 Ga0070696_1000102137 109
109 3300005549 Ga0070704_100245804 Ga0070704_1002458044 109
110 3300005617 Ga0068859_100374376 Ga0068859_1003743764 109
111 3300005618 Ga0068864_100163563 Ga0068864_1001635633 109
112 3300005719 Ga0068861_101120855 Ga0068861_1011208552 109
113 3300005841 Ga0068863_101438844 Ga0068863_1014388442 109
114 3300005844 Ga0068862_101420419 Ga0068862_1014204192 109
115 3300006163 Ga0070715_10142841 Ga0070715_101428412 109
116 3300006353 Ga0075370_10173473 Ga0075370_101734732 109
117 3300006871 Ga0075434_101557612 Ga0075434_1015576122 109
118 3300006931 Ga0097620_100374388 Ga0097620_1003743884 109
119 3300007076 Ga0075435_100057492 Ga0075435_1000574927 109
120 3300009094 Ga0111539_10031472 Ga0111539_100314729 109
121 3300009094 Ga0111539_12595239 Ga0111539_125952391 109
122 3300010159 Ga0099796_10487772 Ga0099796_104877721 109
123 3300013307 Ga0157372_10615787 Ga0157372_106157872 109
124 3300014326 Ga0157380_11399788 Ga0157380_113997882 109
125 3300014968 Ga0157379_11579548 Ga0157379_115795482 109
126 3300014969 Ga0157376_10260162 Ga0157376_102601623 109
127 3300025931 Ga0207644_10109251 Ga0207644_101092512 109
128 3300025944 Ga0207661_11814878 Ga0207661_118148781 109
129 3300025960 Ga0207651_10996878 Ga0207651_109968782 109
130 3300026075 Ga0207708_10416819 Ga0207708_104168193 109
131 3300026088 Ga0207641_11297837 Ga0207641_112978372 109
132 3300026095 Ga0207676_10201663 Ga0207676_102016633 109
133 3300027907 Ga0207428_10159956 Ga0207428_101599563 109
134 3300031548 Ga0307408_100053233 Ga0307408_1000532333 109
135 3300031548 Ga0307408_100305013 Ga0307408_1003050131 109
136 3300031548 Ga0307408_100314965 Ga0307408_1003149652 109
137 3300031911 Ga0307412_10735366 Ga0307412_107353662 109
138 3300031911 Ga0307412_10768831 Ga0307412_107688312 109
139 3300032005 Ga0307411_10619137 Ga0307411_106191372 109
140 3300035091 Ga0373951_0007298 Ga0373951_0007298_722_1054 109
141 3300035114 Ga0373939_0000031 Ga0373939_0000031_41606_41938 109
142 3300035117 Ga0373953_0081213 Ga0373953_0081213_347_676 109
143 3300035121 Ga0373960_0009104 Ga0373960_0009104_914_1246 109
144 3300035691 Ga0373931_0001294 Ga0373931_0001294_6544_6876 109
145 3300036401 Ga0373937_0026003 Ga0373937_0026003_4226_4555 109
146 3300037068 Ga0373925_1276151 Ga0373925_1276151_16_345 109
147 3300045051 Ga0451576_0294932 Ga0451576_0294932_1078_1407 109
148 3300046454 Ga0495592_0006561 Ga0495592_0006561_6923_7252 109
149 3300046462 Ga0495651_0357186 Ga0495651_0357186_361_690 109
150 3300046463 Ga0495653_0208192 Ga0495653_0208192_656_985 109
151 3300046473 Ga0495582_0616189 Ga0495582_0616189_155_484 109
152 3300046476 Ga0495662_0012546 Ga0495662_0012546_3282_3611 109
153 3300046511 Ga0495608_0012778 Ga0495608_0012778_4420_4749 109
154 3300046516 Ga0495628_0066117 Ga0495628_0066117_2029_2358 109
155 3300046517 Ga0495630_0001728 Ga0495630_0001728_6526_6855 109
156 3300046526 Ga0495666_0026411 Ga0495666_0026411_2443_2772 109
157 3300046529 Ga0495652_0067036 Ga0495652_0067036_578_907 109
158 3300046533 Ga0495640_0005587 Ga0495640_0005587_8475_8804 109
159 3300046535 Ga0495586_0011166 Ga0495586_0011166_3392_3721 109
160 3300046536 Ga0495587_0056143 Ga0495587_0056143_652_981 109
161 3300046559 Ga0495667_0047388 Ga0495667_0047388_2145_2474 109
162 3300046642 Ga0495634_0010834 Ga0495634_0010834_914_1243 109
163 3300046678 Ga0495599_0033235 Ga0495599_0033235_242_571 109
164 3300046681 Ga0495647_0055762 Ga0495647_0055762_561_890 109
165 3300046683 Ga0495658_0019833 Ga0495658_0019833_1082_1411 109
166 3300046689 Ga0495613_0022406 Ga0495613_0022406_3991_4320 109
167 3300046809 Ga0495600_0229217 Ga0495600_0229217_308_637 109
168 3300047317 Ga0495604_0018716 Ga0495604_0018716_1474_1803 109
169 3300047318 Ga0495636_0002229 Ga0495636_0002229_1085_1414 109
170 3300047319 Ga0495674_0069160 Ga0495674_0069160_1502_1831 109
171 3300047322 Ga0495680_0004705 Ga0495680_0004705_7302_7631 109
172 3300047444 Ga0495675_0120522 Ga0495675_0120522_1045_1374 109
173 3300047471 Ga0495684_0109601 Ga0495684_0109601_102_431 109
174 3300047673 Ga0495593_0280166 Ga0495593_0280166_140_469 109
175 3300048928 Ga0496125_0000313 Ga0496125_0000313_11929_12294 109
176 3300050496 nmdc:mga07m45_655472_c1 nmdc:mga07m45_655472_c1_250_579 109
177 3300050508 nmdc:mga09592_241612_c1 nmdc:mga09592_241612_c1_33_362 109
178 3300050511 nmdc:mga08y16_171167_c1 nmdc:mga08y16_171167_c1_1172_1501 109
179 3300050512 nmdc:mga0n895_422388_c1 nmdc:mga0n895_422388_c1_350_679 109
180 3300053077 Ga0495601_0018194 Ga0495601_0018194_168_497 109
181 3300053085 Ga0495619_0107214 Ga0495619_0107214_1252_1581 109
182 3300002773 JGI25152J39213_1003080 JGI25152J39213_10030801 110
183 3300002774 JGI25150J39212_1017737 JGI25150J39212_10177372 110
184 3300003215 JGI25153J46596_10000615 JGI25153J46596_100006156 110
185 3300003215 JGI25153J46596_10002602 JGI25153J46596_100026023 110
186 3300003323 rootH1_10011242 rootH1_100112423 110
187 3300003771 Ga0055526_1001543 Ga0055526_100154310 110
188 3300003791 Ga0055530_10069192 Ga0055530_100691921 110
189 3300003794 Ga0055531_10000002 Ga0055531_10000002198 110
190 3300005262 Ga0065165_1002659 Ga0065165_100265913 110
191 3300005327 Ga0070658_10300320 Ga0070658_103003202 110
192 3300005328 Ga0070676_11583033 Ga0070676_115830331 110
193 3300005336 Ga0070680_100007136 Ga0070680_1000071367 110
194 3300005438 Ga0070701_10131369 Ga0070701_101313692 110
195 3300005458 Ga0070681_10045717 Ga0070681_100457173 110
196 3300005459 Ga0068867_100000004 Ga0068867_10000000410 110
197 3300005530 Ga0070679_100005395 Ga0070679_1000053958 110
198 3300005543 Ga0070672_101096915 Ga0070672_1010969151 110
199 3300005547 Ga0070693_100940888 Ga0070693_1009408882 110
200 3300005614 Ga0068856_100148032 Ga0068856_1001480323 110
201 3300005614 Ga0068856_100280219 Ga0068856_1002802193 110
202 3300005718 Ga0068866_10590868 Ga0068866_105908682 110
203 3300006048 Ga0075363_100051673 Ga0075363_1000516733 110
204 3300006048 Ga0075363_100086718 Ga0075363_1000867183 110
205 3300006177 Ga0075362_10001615 Ga0075362_100016152 110
206 3300006178 Ga0075367_10024391 Ga0075367_100243914 110
207 3300006186 Ga0075369_10375818 Ga0075369_103758182 110
208 3300006195 Ga0075366_10013944 Ga0075366_100139445 110
209 3300006195 Ga0075366_10051655 Ga0075366_100516553 110
210 3300006195 Ga0075366_10060953 Ga0075366_100609534 110
211 3300006237 Ga0097621_101744881 Ga0097621_1017448811 110
212 3300006353 Ga0075370_10006405 Ga0075370_100064054 110
213 3300006353 Ga0075370_10022199 Ga0075370_100221994 110
214 3300006846 Ga0075430_100119499 Ga0075430_1001194993 110
215 3300006881 Ga0068865_100255028 Ga0068865_1002550282 110
216 3300009147 Ga0114129_11064411 Ga0114129_110644112 110
217 3300009148 Ga0105243_10020827 Ga0105243_100208275 110
218 3300009176 Ga0105242_12025665 Ga0105242_120256651 110
219 3300013296 Ga0157374_10227604 Ga0157374_102276042 110
220 3300013297 Ga0157378_11072788 Ga0157378_110727882 110
221 3300014745 Ga0157377_10000010 Ga0157377_1000001074 110
222 3300021361 Ga0213872_10000034 Ga0213872_1000003493 110
223 3300025245 Ga0207425_1000807 Ga0207425_10008071 110
224 3300025258 Ga0209129_1000038 Ga0209129_100003886 110
225 3300025273 Ga0209673_1017657 Ga0209673_10176573 110
226 3300025295 Ga0209564_1000129 Ga0209564_1000129101 110
227 3300025297 Ga0209758_1000177 Ga0209758_100017787 110
228 3300025297 Ga0209758_1000197 Ga0209758_1000197101 110
229 3300025298 Ga0209050_1001630 Ga0209050_100163021 110
230 3300025298 Ga0209050_1002016 Ga0209050_10020163 110
231 3300025299 Ga0209256_1026046 Ga0209256_10260461 110
232 3300025299 Ga0209256_1044894 Ga0209256_10448942 110
233 3300025303 Ga0209051_1003663 Ga0209051_100366311 110
234 3300025303 Ga0209051_1011255 Ga0209051_10112553 110
235 3300025304 Ga0209257_1000049 Ga0209257_1000049234 110
236 3300025304 Ga0209257_1015569 Ga0209257_10155692 110
237 3300025909 Ga0207705_10616837 Ga0207705_106168372 110
238 3300025912 Ga0207707_10031988 Ga0207707_100319883 110
239 3300025917 Ga0207660_10004466 Ga0207660_100044662 110
240 3300025918 Ga0207662_10515370 Ga0207662_105153702 110
241 3300025921 Ga0207652_10013046 Ga0207652_100130464 110
242 3300025926 Ga0207659_10282424 Ga0207659_102824242 110
243 3300025935 Ga0207709_10004574 Ga0207709_100045747 110
244 3300025938 Ga0207704_10321742 Ga0207704_103217422 110
245 3300026078 Ga0207702_10301584 Ga0207702_103015842 110
246 3300026089 Ga0207648_10000002 Ga0207648_1000000210 110
247 3300026116 Ga0207674_10427372 Ga0207674_104273723 110
248 3300026118 Ga0207675_101137454 Ga0207675_1011374542 110
249 3300028786 Ga0307517_10153995 Ga0307517_101539952 110
250 3300028794 Ga0307515_10000873 Ga0307515_1000087344 110
251 3300031548 Ga0307408_100133327 Ga0307408_1001333272 110
252 3300031731 Ga0307405_10126957 Ga0307405_101269572 110
253 3300031911 Ga0307412_10046588 Ga0307412_100465883 110
254 3300032002 Ga0307416_100056724 Ga0307416_1000567245 110
255 3300032004 Ga0307414_10048754 Ga0307414_100487544 110
256 3300032004 Ga0307414_10563759 Ga0307414_105637592 110
257 3300032005 Ga0307411_10000112 Ga0307411_100001125 110
258 3300032005 Ga0307411_11520526 Ga0307411_115205262 110
259 3300035172 Ga0373955_0522590 Ga0373955_0522590_54_386 110
260 3300037471 Ga0395905_0002410 Ga0395905_0002410_10097_10432 110
261 3300037471 Ga0395905_0279462 Ga0395905_0279462_254_586 110
262 3300037471 Ga0395905_0858837 Ga0395905_0858837_103_435 110
263 3300039447 Ga0436361_0436689 Ga0436361_0436689_10703_11038 110
264 3300041404 Ga0439436_0000149 Ga0439436_0000149_9991_10323 110
265 3300041406 Ga0439439_0003522 Ga0439439_0003522_1910_2242 110
266 3300041406 Ga0439439_0012659 Ga0439439_0012659_109_441 110
267 3300041407 Ga0439447_008609 Ga0439447_008609_2399_2731 110
268 3300041407 Ga0439447_071367 Ga0439447_071367_146_478 110
269 3300041410 Ga0439461_0008282 Ga0439461_0008282_1251_1583 110
270 3300041410 Ga0439461_0037843 Ga0439461_0037843_58_390 110
271 3300041410 Ga0439461_0063307 Ga0439461_0063307_225_560 110
272 3300041411 Ga0439466_0003514 Ga0439466_0003514_565_897 110
273 3300041411 Ga0439466_0014241 Ga0439466_0014241_1310_1642 110
274 3300041413 Ga0439465_0013878 Ga0439465_0013878_178_510 110
275 3300041441 Ga0451787_469218 Ga0451787_469218_196_528 110
276 3300041443 Ga0451789_1004478 Ga0451789_1004478_1698_2030 110
277 3300041451 Ga0451791_1774605 Ga0451791_1774605_230_562 110
278 3300041456 Ga0451795_0417844 Ga0451795_0417844_3127_3459 110
279 3300041458 Ga0451798_0109225 Ga0451798_0109225_233_565 110
280 3300041459 Ga0451800_1257440 Ga0451800_1257440_686_1018 110
281 3300041460 Ga0451802_0491871 Ga0451802_0491871_812_1144 110
282 3300041463 Ga0451804_0920644 Ga0451804_0920644_795_1127 110
283 3300041463 Ga0451804_1039343 Ga0451804_1039343_75_407 110
284 3300041498 Ga0451841_1424262 Ga0451841_1424262_15_347 110
285 3300041507 Ga0451851_0873834 Ga0451851_0873834_582_914 110
286 3300041512 Ga0451853_2123395 Ga0451853_2123395_117_449 110
287 3300041997 Ga0439431_0005212 Ga0439431_0005212_999_1331 110
288 3300041997 Ga0439431_0022000 Ga0439431_0022000_754_1086 110
289 3300041999 Ga0439433_0000311 Ga0439433_0000311_4324_4656 110
290 3300041999 Ga0439433_0005036 Ga0439433_0005036_1400_1732 110
291 3300042000 Ga0439437_000343 Ga0439437_000343_2379_2714 110
292 3300042002 Ga0439442_001752 Ga0439442_001752_2046_2378 110
293 3300042004 Ga0439445_0088537 Ga0439445_0088537_212_544 110
294 3300042006 Ga0439432_000358 Ga0439432_000358_6595_6927 110
295 3300042006 Ga0439432_011446 Ga0439432_011446_946_1278 110
296 3300042007 Ga0439449_0000747 Ga0439449_0000747_3401_3733 110
297 3300042007 Ga0439449_0002278 Ga0439449_0002278_152_484 110
298 3300042007 Ga0439449_0003803 Ga0439449_0003803_1380_1712 110
299 3300042010 Ga0439452_001926 Ga0439452_001926_3989_4321 110
300 3300042010 Ga0439452_023649 Ga0439452_023649_346_678 110
301 3300042014 Ga0439457_008390 Ga0439457_008390_1249_1581 110
302 3300042014 Ga0439457_058945 Ga0439457_058945_207_539 110
303 3300042015 Ga0439462_0026016 Ga0439462_0026016_1066_1398 110
304 3300042015 Ga0439462_0064016 Ga0439462_0064016_603_935 110
305 3300042115 Ga0450911_025166 Ga0450911_025166_410_742 110
306 3300042120 Ga0450917_000047 Ga0450917_000047_3867_4202 110
307 3300042125 Ga0450923_005313 Ga0450923_005313_1034_1366 110
308 3300042126 Ga0450888_000072 Ga0450888_000072_2095_2430 110
309 3300042127 Ga0450890_002329 Ga0450890_002329_1982_2317 110
310 3300042128 Ga0450897_010218 Ga0450897_010218_314_646 110
311 3300042129 Ga0450891_000672 Ga0450891_000672_1703_2038 110
312 3300042130 Ga0450892_001742 Ga0450892_001742_312_647 110
313 3300042131 Ga0450894_006623 Ga0450894_006623_101_433 110
314 3300042133 Ga0450896_007651 Ga0450896_007651_530_862 110
315 3300042135 Ga0450899_002990 Ga0450899_002990_1091_1423 110
316 3300042138 Ga0450903_008057 Ga0450903_008057_323_658 110
317 3300042139 Ga0450904_018185 Ga0450904_018185_295_630 110
318 3300042144 Ga0450889_000337 Ga0450889_000337_4780_5115 110
319 3300042145 Ga0450906_020888 Ga0450906_020888_234_566 110
320 3300042156 Ga0439446_0017646 Ga0439446_0017646_81_413 110
321 3300042156 Ga0439446_0293705 Ga0439446_0293705_49_381 110
322 3300042184 Ga0450908_057455 Ga0450908_057455_49_381 110
323 3300042184 Ga0450908_079923 Ga0450908_079923_128_460 110
324 3300042185 Ga0450909_003136 Ga0450909_003136_891_1223 110
325 3300042435 Ga0439434_0000586 Ga0439434_0000586_6326_6658 110
326 3300042435 Ga0439434_0017599 Ga0439434_0017599_783_1115 110
327 3300042435 Ga0439434_0239228 Ga0439434_0239228_124_495 110
328 3300042531 Ga0450918_060621 Ga0450918_060621_106_438 110
329 3300042532 Ga0450893_0001474 Ga0450893_0001474_1147_1482 110
330 3300042532 Ga0450893_0003843 Ga0450893_0003843_242_574 110
331 3300044683 Ga0466965_0086013 Ga0466965_0086013_709_1041 110
332 3300044684 Ga0466966_0008651 Ga0466966_0008651_4386_4724 110
333 3300044693 Ga0466961_0099070 Ga0466961_0099070_440_778 110
334 3300044765 Ga0466970_0008735 Ga0466970_0008735_2019_2357 110
335 3300044901 Ga0466960_0087446 Ga0466960_0087446_500_832 110
336 3300045049 Ga0466959_0488788 Ga0466959_0488788_241_579 110
337 3300046455 Ga0495603_0598063 Ga0495603_0598063_274_606 110
338 3300046459 Ga0495629_0265655 Ga0495629_0265655_612_944 110
339 3300046460 Ga0495638_0172203 Ga0495638_0172203_257_589 110
340 3300046473 Ga0495582_0737772 Ga0495582_0737772_63_395 110
341 3300046475 Ga0495639_0598279 Ga0495639_0598279_32_364 110
342 3300046476 Ga0495662_0052122 Ga0495662_0052122_1017_1349 110
343 3300046511 Ga0495608_0628951 Ga0495608_0628951_247_579 110
344 3300046514 Ga0495618_0727316 Ga0495618_0727316_85_417 110
345 3300046515 Ga0495620_0144253 Ga0495620_0144253_443_775 110
346 3300046516 Ga0495628_0164618 Ga0495628_0164618_886_1218 110
347 3300046517 Ga0495630_0038696 Ga0495630_0038696_1063_1395 110
348 3300046526 Ga0495666_0496798 Ga0495666_0496798_103_435 110
349 3300046533 Ga0495640_0012886 Ga0495640_0012886_3874_4206 110
350 3300046642 Ga0495634_0123338 Ga0495634_0123338_463_795 110
351 3300046683 Ga0495658_0526725 Ga0495658_0526725_259_591 110
352 3300047315 Ga0495581_0279300 Ga0495581_0279300_285_617 110
353 3300047317 Ga0495604_0236559 Ga0495604_0236559_330_662 110
354 3300047322 Ga0495680_0605395 Ga0495680_0605395_117_449 110
355 3300047673 Ga0495593_0182545 Ga0495593_0182545_287_619 110
356 3300049653 Ga0501206_010989 Ga0501206_010989_162_494 110
357 3300049665 Ga0501227_002679 Ga0501227_002679_947_1282 110
358 3300049674 Ga0501242_076279 Ga0501242_076279_34_369 110
359 3300049764 Ga0501267_000121 Ga0501267_000121_285_620 110
360 3300050490 nmdc:mga03n38_146736_c1 nmdc:mga03n38_146736_c1_333_665 110
361 3300050490 nmdc:mga03n38_30849_c1 nmdc:mga03n38_30849_c1_694_1026 110
362 3300050491 nmdc:mga00v17_111671_c1 nmdc:mga00v17_111671_c1_729_1061 110
363 3300050493 nmdc:mga0k408_28362_c1 nmdc:mga0k408_28362_c1_748_1080 110
364 3300050493 nmdc:mga0k408_288994_c1 nmdc:mga0k408_288994_c1_465_797 110
365 3300050493 nmdc:mga0k408_7671_c1 nmdc:mga0k408_7671_c1_3224_3556 110
366 3300050494 nmdc:mga06z11_44682_c1 nmdc:mga06z11_44682_c1_1770_2102 110
367 3300050496 nmdc:mga07m45_3282_c1 nmdc:mga07m45_3282_c1_2929_3261 110
368 3300050496 nmdc:mga07m45_7161_c1 nmdc:mga07m45_7161_c1_4027_4359 110
369 3300053078 Ga0495612_0112261 Ga0495612_0112261_702_1034 110
370 3300053086 Ga0500578_0000342 Ga0500578_0000342_38092_38424 110
371 3300053090 Ga0500646_0037799 Ga0500646_0037799_36_368 110
372 3300053093 Ga0500651_0053252 Ga0500651_0053252_633_965 110
373 3300053093 Ga0500651_0079073 Ga0500651_0079073_691_1023 110
374 3300053098 Ga0500650_0271161 Ga0500650_0271161_14_346 110
375 3300053109 Ga0500569_006616 Ga0500569_006616_1718_2050 110
376 3300053127 Ga0500623_075565 Ga0500623_075565_881_1213 110
377 3300053129 Ga0500628_003123 Ga0500628_003123_810_1142 110
378 3300053129 Ga0500628_184997 Ga0500628_184997_217_549 110
379 3300053130 Ga0500642_0001586 Ga0500642_0001586_4215_4547 110
380 3300053131 Ga0500652_005414 Ga0500652_005414_377_709 110
381 3300053142 Ga0500577_0039092 Ga0500577_0039092_608_940 110
382 3300053151 Ga0500604_0013131 Ga0500604_0013131_466_798 110
383 3300053151 Ga0500604_0193398 Ga0500604_0193398_213_545 110
384 3300053156 Ga0500622_0000091 Ga0500622_0000091_43229_43561 110
385 3300053156 Ga0500622_0152603 Ga0500622_0152603_224_556 110
386 3300053158 Ga0500627_0202947 Ga0500627_0202947_115_447 110
387 3300053161 Ga0500634_0048186 Ga0500634_0048186_1063_1395 110
388 3300053726 Ga0500584_081850 Ga0500584_081850_675_1007 110
389 3300003371 JGI26145J50221_1038583 JGI26145J50221_10385831 111
390 3300005339 Ga0070660_100912575 Ga0070660_1009125751 111
391 3300005366 Ga0070659_100263208 Ga0070659_1002632082 111
392 3300005406 Ga0070703_10447299 Ga0070703_104472991 111
393 3300005458 Ga0070681_10102497 Ga0070681_101024972 111
394 3300005530 Ga0070679_100829050 Ga0070679_1008290501 111
395 3300005535 Ga0070684_100793668 Ga0070684_1007936681 111
396 3300005539 Ga0068853_100006975 Ga0068853_1000069756 111
397 3300005563 Ga0068855_100030561 Ga0068855_1000305616 111
398 3300005563 Ga0068855_100033363 Ga0068855_1000333633 111
399 3300005577 Ga0068857_100664668 Ga0068857_1006646682 111
400 3300005843 Ga0068860_101018895 Ga0068860_1010188952 111
401 3300006038 Ga0075365_10001590 Ga0075365_1000159010 111
402 3300006038 Ga0075365_10510754 Ga0075365_105107542 111
403 3300006042 Ga0075368_10073404 Ga0075368_100734043 111
404 3300006048 Ga0075363_100066441 Ga0075363_1000664412 111
405 3300006177 Ga0075362_10038873 Ga0075362_100388732 111
406 3300006178 Ga0075367_10021159 Ga0075367_100211592 111
407 3300006195 Ga0075366_10042728 Ga0075366_100427281 111
408 3300006237 Ga0097621_100725900 Ga0097621_1007259002 111
409 3300006358 Ga0068871_101358398 Ga0068871_1013583981 111
410 3300006880 Ga0075429_101772563 Ga0075429_1017725631 111
411 3300009174 Ga0105241_10051833 Ga0105241_100518332 111
412 3300009545 Ga0105237_10018195 Ga0105237_100181953 111
413 3300010375 Ga0105239_10034914 Ga0105239_100349145 111
414 3300013105 Ga0157369_10352269 Ga0157369_103522692 111
415 3300013306 Ga0163162_10920246 Ga0163162_109202462 111
416 3300025911 Ga0207654_10184614 Ga0207654_101846142 111
417 3300025912 Ga0207707_10032477 Ga0207707_100324773 111
418 3300025914 Ga0207671_10017616 Ga0207671_100176163 111
419 3300025921 Ga0207652_10067476 Ga0207652_100674763 111
420 3300025924 Ga0207694_10196753 Ga0207694_101967532 111
421 3300025949 Ga0207667_10033716 Ga0207667_100337163 111
422 3300025949 Ga0207667_10086275 Ga0207667_100862754 111
423 3300026041 Ga0207639_10100380 Ga0207639_101003801 111
424 3300026089 Ga0207648_11564530 Ga0207648_115645302 111
425 3300026116 Ga0207674_10047774 Ga0207674_100477744 111
426 3300027876 Ga0209974_10007325 Ga0209974_100073254 111
427 3300028381 Ga0268264_11401834 Ga0268264_114018341 111
428 3300041460 Ga0451802_1483943 Ga0451802_1483943_342_677 111
429 3300041486 Ga0451807_0588167 Ga0451807_0588167_229_564 111
430 3300044706 Ga0466964_0026898 Ga0466964_0026898_385_723 111
431 3300045051 Ga0451576_0876413 Ga0451576_0876413_488_826 111
432 3300046462 Ga0495651_0184789 Ga0495651_0184789_334_669 111
433 3300046473 Ga0495582_0732550 Ga0495582_0732550_169_504 111
434 3300046514 Ga0495618_0737504 Ga0495618_0737504_220_555 111
435 3300046529 Ga0495652_0737678 Ga0495652_0737678_276_611 111
436 3300049569 Ga0501032_0024130 Ga0501032_0024130_487_822 111
437 3300049579 Ga0501043_0000024 Ga0501043_0000024_44154_44489 111
438 3300049580 Ga0501046_0000173 Ga0501046_0000173_44154_44489 111
439 3300049581 Ga0501047_0000051 Ga0501047_0000051_109793_110128 111
440 3300049582 Ga0501048_0004089 Ga0501048_0004089_8808_9143 111
441 3300049823 Ga0501044_0825540 Ga0501044_0825540_451_786 111
442 3300049824 Ga0501045_0019498 Ga0501045_0019498_2558_2893 111
443 3300050489 nmdc:mga03683_39851_c1 nmdc:mga03683_39851_c1_186_521 111
444 3300050489 nmdc:mga03683_697026_c1 nmdc:mga03683_697026_c1_110_451 111
445 3300050489 nmdc:mga03683_91934_c1 nmdc:mga03683_91934_c1_54_389 111
446 3300050492 nmdc:mga0yw44_233681_c1 nmdc:mga0yw44_233681_c1_748_1089 111
447 3300050492 nmdc:mga0yw44_398016_c1 nmdc:mga0yw44_398016_c1_485_820 111
448 3300050493 nmdc:mga0k408_23096_c1 nmdc:mga0k408_23096_c1_1112_1447 111
449 3300050493 nmdc:mga0k408_442217_c1 nmdc:mga0k408_442217_c1_298_633 111
450 3300050495 nmdc:mga04h51_107551_c1 nmdc:mga04h51_107551_c1_636_971 111
451 3300050496 nmdc:mga07m45_45272_c1 nmdc:mga07m45_45272_c1_1355_1690 111
452 3300050508 nmdc:mga09592_384058_c1 nmdc:mga09592_384058_c1_184_519 111
453 3300053102 Ga0500554_131828 Ga0500554_131828_315_650 111
454 3300053154 Ga0500619_000041 Ga0500619_000041_15134_15469 111
455 iso_pu_bacteria 2643221654 2644305386 111
456 3300003316 rootH1_10008100 rootH1_1000810010 112
457 3300003322 rootL2_10013911 rootL2_1001391113 112
458 3300005328 Ga0070676_10004760 Ga0070676_100047604 112
459 3300005329 Ga0070683_100436994 Ga0070683_1004369942 112
460 3300005331 Ga0070670_100011885 Ga0070670_1000118856 112
461 3300005333 Ga0070677_10207347 Ga0070677_102073472 112
462 3300005336 Ga0070680_101539448 Ga0070680_1015394481 112
463 3300005338 Ga0068868_100439542 Ga0068868_1004395422 112
464 3300005354 Ga0070675_100300637 Ga0070675_1003006372 112
465 3300005364 Ga0070673_100950018 Ga0070673_1009500182 112
466 3300005365 Ga0070688_101031075 Ga0070688_1010310751 112
467 3300005366 Ga0070659_100139439 Ga0070659_1001394392 112
468 3300005367 Ga0070667_100000705 Ga0070667_10000070522 112
469 3300005367 Ga0070667_100020055 Ga0070667_1000200552 112
470 3300005367 Ga0070667_100449237 Ga0070667_1004492372 112
471 3300005367 Ga0070667_100579539 Ga0070667_1005795392 112
472 3300005457 Ga0070662_100285042 Ga0070662_1002850421 112
473 3300005457 Ga0070662_100502238 Ga0070662_1005022382 112
474 3300005459 Ga0068867_100009546 Ga0068867_1000095462 112
475 3300005459 Ga0068867_101366914 Ga0068867_1013669142 112
476 3300005518 Ga0070699_101414407 Ga0070699_1014144072 112
477 3300005530 Ga0070679_100654899 Ga0070679_1006548992 112
478 3300005543 Ga0070672_100022475 Ga0070672_1000224756 112
479 3300005564 Ga0070664_100092663 Ga0070664_1000926633 112
480 3300005577 Ga0068857_100031528 Ga0068857_1000315287 112
481 3300005578 Ga0068854_100327336 Ga0068854_1003273362 112
482 3300005578 Ga0068854_101034175 Ga0068854_1010341752 112
483 3300005616 Ga0068852_101332712 Ga0068852_1013327122 112
484 3300005840 Ga0068870_10351895 Ga0068870_103518952 112
485 3300005840 Ga0068870_10756597 Ga0068870_107565972 112
486 3300006048 Ga0075363_100053330 Ga0075363_1000533302 112
487 3300006048 Ga0075363_100529467 Ga0075363_1005294672 112
488 3300006051 Ga0075364_10168316 Ga0075364_101683163 112
489 3300006051 Ga0075364_10239523 Ga0075364_102395233 112
490 3300006058 Ga0075432_10216211 Ga0075432_102162112 112
491 3300006177 Ga0075362_10490156 Ga0075362_104901561 112
492 3300006186 Ga0075369_10499793 Ga0075369_104997932 112
493 3300006195 Ga0075366_10003855 Ga0075366_100038554 112
494 3300006195 Ga0075366_10482727 Ga0075366_104827272 112
495 3300006195 Ga0075366_10543742 Ga0075366_105437422 112
496 3300006195 Ga0075366_10569553 Ga0075366_105695532 112
497 3300006353 Ga0075370_10046000 Ga0075370_100460002 112
498 3300006353 Ga0075370_10326090 Ga0075370_103260902 112
499 3300006353 Ga0075370_10374263 Ga0075370_103742632 112
500 3300006881 Ga0068865_100249670 Ga0068865_1002496702 112
501 3300006881 Ga0068865_100593326 Ga0068865_1005933262 112
502 3300009098 Ga0105245_10537259 Ga0105245_105372592 112
503 3300009148 Ga0105243_10248770 Ga0105243_102487703 112
504 3300009148 Ga0105243_10303204 Ga0105243_103032042 112
505 3300009545 Ga0105237_10152202 Ga0105237_101522021 112
506 3300009545 Ga0105237_10307107 Ga0105237_103071073 112
507 3300009553 Ga0105249_10481359 Ga0105249_104813593 112
508 3300010375 Ga0105239_10492590 Ga0105239_104925902 112
509 3300010375 Ga0105239_10495806 Ga0105239_104958062 112
510 3300013104 Ga0157370_10102175 Ga0157370_101021754 112
511 3300013308 Ga0157375_10453168 Ga0157375_104531682 112
512 3300014325 Ga0163163_10259377 Ga0163163_102593771 112
513 3300014968 Ga0157379_10504571 Ga0157379_105045713 112
514 3300014968 Ga0157379_11201137 Ga0157379_112011372 112
515 3300014969 Ga0157376_11208231 Ga0157376_112082311 112
516 3300025893 Ga0207682_10058677 Ga0207682_100586772 112
517 3300025900 Ga0207710_10181729 Ga0207710_101817292 112
518 3300025907 Ga0207645_10000870 Ga0207645_1000087018 112
519 3300025907 Ga0207645_10168255 Ga0207645_101682553 112
520 3300025908 Ga0207643_10062086 Ga0207643_100620862 112
521 3300025912 Ga0207707_11231887 Ga0207707_112318872 112
522 3300025921 Ga0207652_10671784 Ga0207652_106717842 112
523 3300025921 Ga0207652_10873248 Ga0207652_108732482 112
524 3300025925 Ga0207650_10009880 Ga0207650_100098807 112
525 3300025926 Ga0207659_10547711 Ga0207659_105477112 112
526 3300025927 Ga0207687_10240542 Ga0207687_102405422 112
527 3300025927 Ga0207687_10315089 Ga0207687_103150892 112
528 3300025933 Ga0207706_10013502 Ga0207706_100135024 112
529 3300025935 Ga0207709_10159618 Ga0207709_101596183 112
530 3300025937 Ga0207669_10252024 Ga0207669_102520243 112
531 3300025938 Ga0207704_10470665 Ga0207704_104706652 112
532 3300025940 Ga0207691_10017845 Ga0207691_100178457 112
533 3300025942 Ga0207689_10151885 Ga0207689_101518853 112
534 3300025944 Ga0207661_11785985 Ga0207661_117859852 112
535 3300025945 Ga0207679_10421429 Ga0207679_104214292 112
536 3300025960 Ga0207651_10323459 Ga0207651_103234592 112
537 3300025960 Ga0207651_10899738 Ga0207651_108997382 112
538 3300025961 Ga0207712_10321904 Ga0207712_103219043 112
539 3300025972 Ga0207668_10536402 Ga0207668_105364021 112
540 3300025981 Ga0207640_10861141 Ga0207640_108611412 112
541 3300025986 Ga0207658_10002288 Ga0207658_1000228810 112
542 3300025986 Ga0207658_10068991 Ga0207658_100689911 112
543 3300025986 Ga0207658_10803205 Ga0207658_108032052 112
544 3300025986 Ga0207658_11018975 Ga0207658_110189752 112
545 3300026023 Ga0207677_10111697 Ga0207677_101116973 112
546 3300026041 Ga0207639_11629304 Ga0207639_116293041 112
547 3300026089 Ga0207648_10022364 Ga0207648_100223646 112
548 3300026116 Ga0207674_10009884 Ga0207674_100098846 112
549 3300028786 Ga0307517_10008069 Ga0307517_100080695 112
550 3300028786 Ga0307517_10087798 Ga0307517_100877982 112
551 3300028786 Ga0307517_10457924 Ga0307517_104579241 112
552 3300028794 Ga0307515_10239345 Ga0307515_102393452 112
553 3300029957 Ga0265324_10224448 Ga0265324_102244481 112
554 3300030522 Ga0307512_10066557 Ga0307512_100665574 112
555 3300031456 Ga0307513_10032823 Ga0307513_100328234 112
556 3300031456 Ga0307513_10074607 Ga0307513_100746075 112
557 3300031456 Ga0307513_10434627 Ga0307513_104346272 112
558 3300031507 Ga0307509_10052253 Ga0307509_100522535 112
559 3300031507 Ga0307509_10240890 Ga0307509_102408903 112
560 3300031507 Ga0307509_10297731 Ga0307509_102977313 112
561 3300031507 Ga0307509_10705268 Ga0307509_107052681 112
562 3300031616 Ga0307508_10000222 Ga0307508_100002227 112
563 3300031616 Ga0307508_10016751 Ga0307508_100167517 112
564 3300031616 Ga0307508_10026831 Ga0307508_100268316 112
565 3300031616 Ga0307508_10058972 Ga0307508_100589723 112
566 3300031616 Ga0307508_10114356 Ga0307508_101143564 112
567 3300031616 Ga0307508_10453277 Ga0307508_104532772 112
568 3300031730 Ga0307516_10000662 Ga0307516_1000066221 112
569 3300031730 Ga0307516_10111433 Ga0307516_101114331 112
570 3300031730 Ga0307516_10371420 Ga0307516_103714202 112
571 3300033179 Ga0307507_10231018 Ga0307507_102310183 112
572 3300033179 Ga0307507_10292572 Ga0307507_102925722 112
573 3300033179 Ga0307507_10516061 Ga0307507_105160612 112
574 3300033180 Ga0307510_10178973 Ga0307510_101789733 112
575 3300035695 Ga0373927_0559429 Ga0373927_0559429_70_423 112
576 3300037068 Ga0373925_0189829 Ga0373925_0189829_736_1089 112
577 3300041443 Ga0451789_0443499 Ga0451789_0443499_107_445 112
578 3300041509 Ga0451843_1553242 Ga0451843_1553242_97_435 112
579 3300046457 Ga0495590_0066222 Ga0495590_0066222_839_1177 112
580 3300046457 Ga0495590_0124979 Ga0495590_0124979_572_910 112
581 3300046461 Ga0495641_0264922 Ga0495641_0264922_347_685 112
582 3300046474 Ga0495605_0073081 Ga0495605_0073081_1082_1420 112
583 3300046491 Ga0495584_0429976 Ga0495584_0429976_133_471 112
584 3300046512 Ga0495610_0136617 Ga0495610_0136617_49_387 112
585 3300046513 Ga0495616_0197204 Ga0495616_0197204_312_650 112
586 3300046515 Ga0495620_0204779 Ga0495620_0204779_380_718 112
587 3300046518 Ga0495631_0138775 Ga0495631_0138775_153_491 112
588 3300046519 Ga0495632_0017543 Ga0495632_0017543_910_1248 112
589 3300046519 Ga0495632_0076186 Ga0495632_0076186_627_965 112
590 3300046524 Ga0495648_0204432 Ga0495648_0204432_175_513 112
591 3300046526 Ga0495666_0061797 Ga0495666_0061797_1159_1497 112
592 3300046528 Ga0495642_0266434 Ga0495642_0266434_99_437 112
593 3300046539 Ga0495621_0055952 Ga0495621_0055952_62_403 112
594 3300046542 Ga0495597_0049821 Ga0495597_0049821_736_1074 112
595 3300046542 Ga0495597_0074206 Ga0495597_0074206_601_939 112
596 3300046557 Ga0495622_0458416 Ga0495622_0458416_107_445 112
597 3300046615 Ga0495656_0002670 Ga0495656_0002670_4130_4471 112
598 3300046616 Ga0495668_0210643 Ga0495668_0210643_473_811 112
599 3300046616 Ga0495668_0762803 Ga0495668_0762803_93_431 112
600 3300046660 Ga0495625_0036918 Ga0495625_0036918_2550_2888 112
601 3300046660 Ga0495625_0069555 Ga0495625_0069555_93_431 112
602 3300046683 Ga0495658_0415223 Ga0495658_0415223_135_473 112
603 3300046691 Ga0495670_0132057 Ga0495670_0132057_568_909 112
604 3300046694 Ga0495649_0008009 Ga0495649_0008009_789_1127 112
605 3300046694 Ga0495649_0162861 Ga0495649_0162861_80_418 112
606 3300046794 Ga0495589_0255838 Ga0495589_0255838_141_479 112
607 3300047323 Ga0495683_0199671 Ga0495683_0199671_354_692 112
608 3300047443 Ga0495687_000330 Ga0495687_000330_8474_8812 112
609 3300047443 Ga0495687_010458 Ga0495687_010458_1125_1463 112
610 3300047443 Ga0495687_015164 Ga0495687_015164_1125_1463 112
611 3300047469 Ga0495673_0312798 Ga0495673_0312798_135_473 112
612 3300047472 Ga0495686_0162084 Ga0495686_0162084_792_1136 112
613 3300048090 Ga0495615_0011601 Ga0495615_0011601_401_742 112
614 3300048091 Ga0495626_0056643 Ga0495626_0056643_461_799 112
615 3300048903 Ga0496100_0279692 Ga0496100_0279692_586_924 112
616 3300048909 Ga0496106_0294609 Ga0496106_0294609_660_1004 112
617 3300048917 Ga0496114_0250949 Ga0496114_0250949_570_908 112
618 3300048924 Ga0496121_0100190 Ga0496121_0100190_1699_2037 112
619 3300049460 Ga0495682_0132834 Ga0495682_0132834_212_550 112
620 3300049577 Ga0501041_0824026 Ga0501041_0824026_89_427 112
621 3300049578 Ga0501042_0945943 Ga0501042_0945943_185_523 112
622 3300049588 Ga0501072_1100069 Ga0501072_1100069_222_560 112
623 3300049591 Ga0501075_0612134 Ga0501075_0612134_362_700 112
624 3300049593 Ga0501077_0183595 Ga0501077_0183595_661_999 112
625 3300049741 Ga0501079_0278594 Ga0501079_0278594_665_1003 112
626 3300049743 Ga0501081_1113446 Ga0501081_1113446_77_415 112
627 3300050489 nmdc:mga03683_202345_c1 nmdc:mga03683_202345_c1_108_446 112
628 3300050489 nmdc:mga03683_399431_c1 nmdc:mga03683_399431_c1_177_515 112
629 3300050490 nmdc:mga03n38_882484_c1 nmdc:mga03n38_882484_c1_99_437 112
630 3300050491 nmdc:mga00v17_12372_c1 nmdc:mga00v17_12372_c1_471_809 112
631 3300050493 nmdc:mga0k408_1110_c1 nmdc:mga0k408_1110_c1_4547_4885 112
632 3300050493 nmdc:mga0k408_204254_c1 nmdc:mga0k408_204254_c1_526_864 112
633 3300050493 nmdc:mga0k408_337776_c1 nmdc:mga0k408_337776_c1_107_445 112
634 3300050493 nmdc:mga0k408_42338_c1 nmdc:mga0k408_42338_c1_753_1091 112
635 3300050494 nmdc:mga06z11_182458_c1 nmdc:mga06z11_182458_c1_558_896 112
636 3300050496 nmdc:mga07m45_130733_c1 nmdc:mga07m45_130733_c1_725_1063 112
637 3300050496 nmdc:mga07m45_14548_c1 nmdc:mga07m45_14548_c1_102_440 112
638 3300050496 nmdc:mga07m45_311732_c1 nmdc:mga07m45_311732_c1_418_756 112
639 3300050496 nmdc:mga07m45_7700_c1 nmdc:mga07m45_7700_c1_3345_3683 112
640 3300050496 nmdc:mga07m45_94756_c1 nmdc:mga07m45_94756_c1_975_1313 112
641 3300050511 nmdc:mga08y16_649380_c1 nmdc:mga08y16_649380_c1_633_992 112
642 3300050516 nmdc:mga0sz30_245089_c1 nmdc:mga0sz30_245089_c1_52_390 112
643 3300050516 nmdc:mga0sz30_535499_c1 nmdc:mga0sz30_535499_c1_48_386 112
644 3300053086 Ga0500578_0041368 Ga0500578_0041368_541_885 112
645 3300053092 Ga0500583_0075468 Ga0500583_0075468_1240_1578 112
646 3300053092 Ga0500583_0347107 Ga0500583_0347107_141_479 112
647 3300053134 Ga0500658_0015723 Ga0500658_0015723_1288_1626 112
648 3300053154 Ga0500619_100300 Ga0500619_100300_172_510 112
649 3300053155 Ga0500620_111999 Ga0500620_111999_572_910 112
650 3300053722 Ga0500649_158335 Ga0500649_158335_265_603 112
651 3300053730 Ga0500645_002331 Ga0500645_002331_8155_8499 112
652 3300054114 Ga0501084_0421593 Ga0501084_0421593_298_636 112
653 3300006195 Ga0075366_10457705 Ga0075366_104577051 113
654 3300009148 Ga0105243_10175926 Ga0105243_101759262 113
655 3300020081 Ga0206354_11215456 Ga0206354_112154562 113
656 3300025298 Ga0209050_1013067 Ga0209050_10130676 113
657 3300031731 Ga0307405_10018973 Ga0307405_100189733 113
658 3300031901 Ga0307406_10136632 Ga0307406_101366322 113
659 3300031911 Ga0307412_10017084 Ga0307412_100170845 113
660 3300031995 Ga0307409_100004643 Ga0307409_1000046439 113
661 3300032002 Ga0307416_100018756 Ga0307416_1000187564 113
662 3300032004 Ga0307414_11108514 Ga0307414_111085142 113
663 3300032005 Ga0307411_10021299 Ga0307411_100212993 113
664 3300032126 Ga0307415_100001031 Ga0307415_10000103110 113
665 3300035113 Ga0373936_0337503 Ga0373936_0337503_298_639 113
666 3300046452 Ga0495617_268891 Ga0495617_268891_62_403 113
667 3300046455 Ga0495603_0207942 Ga0495603_0207942_529_870 113
668 3300046459 Ga0495629_0001758 Ga0495629_0001758_1368_1709 113
669 3300046471 Ga0495650_0002383 Ga0495650_0002383_674_1015 113
670 3300046473 Ga0495582_0089087 Ga0495582_0089087_479_820 113
671 3300046517 Ga0495630_0266826 Ga0495630_0266826_748_1089 113
672 3300046524 Ga0495648_0249714 Ga0495648_0249714_34_375 113
673 3300046526 Ga0495666_0333748 Ga0495666_0333748_129_470 113
674 3300046528 Ga0495642_0040146 Ga0495642_0040146_493_834 113
675 3300046529 Ga0495652_0188341 Ga0495652_0188341_1192_1533 113
676 3300046530 Ga0495654_0059525 Ga0495654_0059525_630_971 113
677 3300046535 Ga0495586_0063428 Ga0495586_0063428_171_512 113
678 3300046536 Ga0495587_0448019 Ga0495587_0448019_147_488 113
679 3300046543 Ga0495645_0000309 Ga0495645_0000309_6623_6964 113
680 3300046675 Ga0495657_0415615 Ga0495657_0415615_72_413 113
681 3300046680 Ga0495646_0022134 Ga0495646_0022134_2188_2529 113
682 3300046684 Ga0495669_0096688 Ga0495669_0096688_28_369 113
683 3300046689 Ga0495613_0222595 Ga0495613_0222595_653_994 113
684 3300046794 Ga0495589_0028340 Ga0495589_0028340_1098_1439 113
685 3300046809 Ga0495600_0307718 Ga0495600_0307718_21_362 113
686 3300047315 Ga0495581_0001544 Ga0495581_0001544_10121_10462 113
687 3300047443 Ga0495687_040493 Ga0495687_040493_618_959 113
688 3300047446 Ga0495679_037921 Ga0495679_037921_974_1315 113
689 3300047470 Ga0495681_0095694 Ga0495681_0095694_443_784 113
690 3300047471 Ga0495684_0605090 Ga0495684_0605090_272_613 113
691 3300047673 Ga0495593_0065478 Ga0495593_0065478_1520_1861 113
692 3300048089 Ga0495614_0028296 Ga0495614_0028296_578_919 113
693 3300048903 Ga0496100_0016608 Ga0496100_0016608_3497_3838 113
694 3300048905 Ga0496102_0845522 Ga0496102_0845522_446_787 113
695 3300048907 Ga0496104_0038949 Ga0496104_0038949_1054_1395 113
696 3300048910 Ga0496107_0145047 Ga0496107_0145047_1166_1507 113
697 3300048913 Ga0496110_1899729 Ga0496110_1899729_26_367 113
698 3300048914 Ga0496111_0218977 Ga0496111_0218977_872_1213 113
699 3300048917 Ga0496114_0023648 Ga0496114_0023648_133_474 113
700 3300048918 Ga0496115_0082785 Ga0496115_0082785_1145_1486 113
701 3300048919 Ga0496116_0039170 Ga0496116_0039170_1096_1476 113
702 3300048926 Ga0496123_0041868 Ga0496123_0041868_1556_1936 113
703 3300048927 Ga0496124_0217019 Ga0496124_0217019_146_526 113
704 3300002070 JGI24750J21931_1040090 JGI24750J21931_10400902 114
705 3300005327 Ga0070658_10745414 Ga0070658_107454142 114
706 3300005328 Ga0070676_10001334 Ga0070676_100013348 114
707 3300005328 Ga0070676_10165264 Ga0070676_101652642 114
708 3300005331 Ga0070670_100089787 Ga0070670_1000897873 114
709 3300005331 Ga0070670_100263957 Ga0070670_1002639572 114
710 3300005331 Ga0070670_100441463 Ga0070670_1004414632 114
711 3300005333 Ga0070677_10018563 Ga0070677_100185631 114
712 3300005333 Ga0070677_10131923 Ga0070677_101319232 114
713 3300005333 Ga0070677_10568647 Ga0070677_105686471 114
714 3300005334 Ga0068869_100003785 Ga0068869_1000037852 114
715 3300005335 Ga0070666_10634855 Ga0070666_106348552 114
716 3300005338 Ga0068868_100118748 Ga0068868_1001187482 114
717 3300005338 Ga0068868_100324736 Ga0068868_1003247361 114
718 3300005338 Ga0068868_100671126 Ga0068868_1006711262 114
719 3300005339 Ga0070660_100726075 Ga0070660_1007260752 114
720 3300005340 Ga0070689_100749998 Ga0070689_1007499982 114
721 3300005341 Ga0070691_10642534 Ga0070691_106425342 114
722 3300005343 Ga0070687_100121829 Ga0070687_1001218292 114
723 3300005343 Ga0070687_100273690 Ga0070687_1002736902 114
724 3300005344 Ga0070661_101023945 Ga0070661_1010239452 114
725 3300005347 Ga0070668_100007743 Ga0070668_1000077431 114
726 3300005353 Ga0070669_100002211 Ga0070669_1000022118 114
727 3300005353 Ga0070669_100456890 Ga0070669_1004568902 114
728 3300005354 Ga0070675_100035230 Ga0070675_1000352302 114
729 3300005355 Ga0070671_100000437 Ga0070671_10000043719 114
730 3300005355 Ga0070671_100240851 Ga0070671_1002408512 114
731 3300005355 Ga0070671_100400910 Ga0070671_1004009102 114
732 3300005355 Ga0070671_100491052 Ga0070671_1004910522 114
733 3300005356 Ga0070674_100000965 Ga0070674_10000096510 114
734 3300005364 Ga0070673_100085514 Ga0070673_1000855142 114
735 3300005364 Ga0070673_100296467 Ga0070673_1002964672 114
736 3300005366 Ga0070659_101490159 Ga0070659_1014901592 114
737 3300005367 Ga0070667_100002738 Ga0070667_10000273810 114
738 3300005367 Ga0070667_100335409 Ga0070667_1003354092 114
739 3300005367 Ga0070667_100815655 Ga0070667_1008156552 114
740 3300005455 Ga0070663_101375257 Ga0070663_1013752571 114
741 3300005456 Ga0070678_100079120 Ga0070678_1000791202 114
742 3300005456 Ga0070678_100258411 Ga0070678_1002584112 114
743 3300005457 Ga0070662_100004128 Ga0070662_1000041283 114
744 3300005457 Ga0070662_100023060 Ga0070662_1000230603 114
745 3300005457 Ga0070662_100042390 Ga0070662_1000423904 114
746 3300005457 Ga0070662_100813573 Ga0070662_1008135732 114
747 3300005459 Ga0068867_100003930 Ga0068867_1000039308 114
748 3300005459 Ga0068867_100094233 Ga0068867_1000942332 114
749 3300005466 Ga0070685_10183216 Ga0070685_101832162 114
750 3300005539 Ga0068853_100063148 Ga0068853_1000631483 114
751 3300005543 Ga0070672_100003309 Ga0070672_1000033099 114
752 3300005543 Ga0070672_100043274 Ga0070672_1000432743 114
753 3300005543 Ga0070672_100082357 Ga0070672_1000823572 114
754 3300005543 Ga0070672_100100170 Ga0070672_1001001703 114
755 3300005543 Ga0070672_100105091 Ga0070672_1001050912 114
756 3300005543 Ga0070672_100161485 Ga0070672_1001614852 114
757 3300005544 Ga0070686_100024368 Ga0070686_1000243682 114
758 3300005547 Ga0070693_101125818 Ga0070693_1011258182 114
759 3300005548 Ga0070665_100350143 Ga0070665_1003501432 114
760 3300005564 Ga0070664_100930323 Ga0070664_1009303232 114
761 3300005578 Ga0068854_100028980 Ga0068854_1000289803 114
762 3300005578 Ga0068854_100098256 Ga0068854_1000982563 114
763 3300005578 Ga0068854_100521527 Ga0068854_1005215272 114
764 3300005614 Ga0068856_100496054 Ga0068856_1004960542 114
765 3300005614 Ga0068856_102671395 Ga0068856_1026713952 114
766 3300005615 Ga0070702_100158131 Ga0070702_1001581312 114
767 3300005616 Ga0068852_100007596 Ga0068852_1000075963 114
768 3300005616 Ga0068852_100137191 Ga0068852_1001371912 114
769 3300005616 Ga0068852_100156509 Ga0068852_1001565092 114
770 3300005616 Ga0068852_100291591 Ga0068852_1002915912 114
771 3300005616 Ga0068852_100555599 Ga0068852_1005555992 114
772 3300005616 Ga0068852_101297695 Ga0068852_1012976952 114
773 3300005617 Ga0068859_100191302 Ga0068859_1001913022 114
774 3300005618 Ga0068864_100013261 Ga0068864_1000132613 114
775 3300005618 Ga0068864_100087455 Ga0068864_1000874552 114
776 3300005618 Ga0068864_100176707 Ga0068864_1001767072 114
777 3300005718 Ga0068866_10171605 Ga0068866_101716052 114
778 3300005719 Ga0068861_100002811 Ga0068861_1000028115 114
779 3300005834 Ga0068851_10145064 Ga0068851_101450642 114
780 3300005840 Ga0068870_10178917 Ga0068870_101789172 114
781 3300005840 Ga0068870_10476397 Ga0068870_104763972 114
782 3300005841 Ga0068863_100004699 Ga0068863_10000469910 114
783 3300005841 Ga0068863_100233429 Ga0068863_1002334292 114
784 3300005841 Ga0068863_101127117 Ga0068863_1011271172 114
785 3300005842 Ga0068858_100010462 Ga0068858_1000104627 114
786 3300005843 Ga0068860_100005300 Ga0068860_1000053007 114
787 3300005843 Ga0068860_100129897 Ga0068860_1001298972 114
788 3300006178 Ga0075367_10952134 Ga0075367_109521341 114
789 3300006195 Ga0075366_10039097 Ga0075366_100390972 114
790 3300006237 Ga0097621_100029731 Ga0097621_1000297312 114
791 3300006237 Ga0097621_100204014 Ga0097621_1002040142 114
792 3300006358 Ga0068871_100192218 Ga0068871_1001922182 114
793 3300006881 Ga0068865_100002020 Ga0068865_1000020208 114
794 3300006881 Ga0068865_101321388 Ga0068865_1013213881 114
795 3300006931 Ga0097620_100191296 Ga0097620_1001912962 114
796 3300009148 Ga0105243_10056139 Ga0105243_100561393 114
797 3300009176 Ga0105242_10040381 Ga0105242_100403813 114
798 3300009176 Ga0105242_10435979 Ga0105242_104359792 114
799 3300009177 Ga0105248_10030887 Ga0105248_100308875 114
800 3300009177 Ga0105248_10065141 Ga0105248_100651415 114
801 3300009177 Ga0105248_10137185 Ga0105248_101371852 114
802 3300009177 Ga0105248_10173538 Ga0105248_101735382 114
803 3300009177 Ga0105248_11460021 Ga0105248_114600212 114
804 3300012506 Ga0157324_1029955 Ga0157324_10299552 114
805 3300013104 Ga0157370_10308010 Ga0157370_103080102 114
806 3300013105 Ga0157369_10505965 Ga0157369_105059652 114
807 3300013296 Ga0157374_10035585 Ga0157374_100355853 114
808 3300013296 Ga0157374_10078384 Ga0157374_100783842 114
809 3300013296 Ga0157374_10296005 Ga0157374_102960052 114
810 3300013297 Ga0157378_10190217 Ga0157378_101902171 114
811 3300013297 Ga0157378_12753114 Ga0157378_127531142 114
812 3300013306 Ga0163162_10004467 Ga0163162_100044678 114
813 3300013306 Ga0163162_11058169 Ga0163162_110581692 114
814 3300013306 Ga0163162_11179515 Ga0163162_111795152 114
815 3300013308 Ga0157375_10001941 Ga0157375_1000194120 114
816 3300013308 Ga0157375_10003497 Ga0157375_100034978 114
817 3300014325 Ga0163163_12388977 Ga0163163_123889772 114
818 3300014325 Ga0163163_13186746 Ga0163163_131867462 114
819 3300014326 Ga0157380_10001564 Ga0157380_1000156415 114
820 3300014326 Ga0157380_10531573 Ga0157380_105315732 114
821 3300014745 Ga0157377_11288283 Ga0157377_112882832 114
822 3300014968 Ga0157379_10010571 Ga0157379_100105718 114
823 3300014968 Ga0157379_10047949 Ga0157379_100479495 114
824 3300014968 Ga0157379_10999508 Ga0157379_109995082 114
825 3300014969 Ga0157376_11074029 Ga0157376_110740292 114
826 3300017792 Ga0163161_10145390 Ga0163161_101453901 114
827 3300025315 Ga0207697_10036312 Ga0207697_100363121 114
828 3300025315 Ga0207697_10110271 Ga0207697_101102712 114
829 3300025321 Ga0207656_10091976 Ga0207656_100919762 114
830 3300025893 Ga0207682_10013198 Ga0207682_100131982 114
831 3300025893 Ga0207682_10024588 Ga0207682_100245882 114
832 3300025893 Ga0207682_10130831 Ga0207682_101308312 114
833 3300025899 Ga0207642_10001813 Ga0207642_100018133 114
834 3300025903 Ga0207680_10004093 Ga0207680_100040932 114
835 3300025903 Ga0207680_10771515 Ga0207680_107715152 114
836 3300025906 Ga0207699_10790676 Ga0207699_107906762 114
837 3300025907 Ga0207645_10002088 Ga0207645_100020889 114
838 3300025908 Ga0207643_10029590 Ga0207643_100295904 114
839 3300025918 Ga0207662_10338305 Ga0207662_103383052 114
840 3300025918 Ga0207662_10575494 Ga0207662_105754942 114
841 3300025919 Ga0207657_10113522 Ga0207657_101135222 114
842 3300025919 Ga0207657_10177437 Ga0207657_101774372 114
843 3300025920 Ga0207649_10046929 Ga0207649_100469293 114
844 3300025923 Ga0207681_10000967 Ga0207681_1000096711 114
845 3300025923 Ga0207681_10830657 Ga0207681_108306572 114
846 3300025925 Ga0207650_10014689 Ga0207650_100146894 114
847 3300025925 Ga0207650_10554415 Ga0207650_105544152 114
848 3300025925 Ga0207650_10777031 Ga0207650_107770312 114
849 3300025926 Ga0207659_10383587 Ga0207659_103835872 114
850 3300025926 Ga0207659_10578344 Ga0207659_105783441 114
851 3300025926 Ga0207659_10824796 Ga0207659_108247962 114
852 3300025927 Ga0207687_10900063 Ga0207687_109000632 114
853 3300025931 Ga0207644_10000278 Ga0207644_1000027834 114
854 3300025931 Ga0207644_10022498 Ga0207644_100224984 114
855 3300025931 Ga0207644_10710444 Ga0207644_107104441 114
856 3300025932 Ga0207690_10270139 Ga0207690_102701392 114
857 3300025933 Ga0207706_10011095 Ga0207706_100110952 114
858 3300025933 Ga0207706_10038294 Ga0207706_100382944 114
859 3300025933 Ga0207706_10224079 Ga0207706_102240792 114
860 3300025933 Ga0207706_10384106 Ga0207706_103841062 114
861 3300025934 Ga0207686_10019438 Ga0207686_100194382 114
862 3300025935 Ga0207709_10092825 Ga0207709_100928252 114
863 3300025936 Ga0207670_11424459 Ga0207670_114244592 114
864 3300025937 Ga0207669_10002687 Ga0207669_100026872 114
865 3300025937 Ga0207669_10109216 Ga0207669_101092162 114
866 3300025940 Ga0207691_10006361 Ga0207691_100063614 114
867 3300025940 Ga0207691_10041139 Ga0207691_100411396 114
868 3300025940 Ga0207691_10062163 Ga0207691_100621632 114
869 3300025940 Ga0207691_10106912 Ga0207691_101069122 114
870 3300025940 Ga0207691_10714400 Ga0207691_107144001 114
871 3300025941 Ga0207711_10019406 Ga0207711_100194066 114
872 3300025941 Ga0207711_10038028 Ga0207711_100380285 114
873 3300025941 Ga0207711_10055496 Ga0207711_100554962 114
874 3300025941 Ga0207711_10100159 Ga0207711_101001593 114
875 3300025941 Ga0207711_10895220 Ga0207711_108952202 114
876 3300025942 Ga0207689_10008584 Ga0207689_1000858410 114
877 3300025945 Ga0207679_10428307 Ga0207679_104283072 114
878 3300025960 Ga0207651_10270837 Ga0207651_102708372 114
879 3300025961 Ga0207712_10449324 Ga0207712_104493242 114
880 3300025972 Ga0207668_10047628 Ga0207668_100476283 114
881 3300025981 Ga0207640_11553041 Ga0207640_115530412 114
882 3300025986 Ga0207658_10002231 Ga0207658_1000223110 114
883 3300026023 Ga0207677_10087009 Ga0207677_100870092 114
884 3300026023 Ga0207677_10593827 Ga0207677_105938271 114
885 3300026023 Ga0207677_11509366 Ga0207677_115093662 114
886 3300026023 Ga0207677_11992603 Ga0207677_119926031 114
887 3300026035 Ga0207703_10012466 Ga0207703_100124662 114
888 3300026041 Ga0207639_11239149 Ga0207639_112391491 114
889 3300026075 Ga0207708_10091222 Ga0207708_100912223 114
890 3300026075 Ga0207708_10422056 Ga0207708_104220562 114
891 3300026078 Ga0207702_10097785 Ga0207702_100977853 114
892 3300026088 Ga0207641_10006486 Ga0207641_100064868 114
893 3300026088 Ga0207641_10157257 Ga0207641_101572572 114
894 3300026089 Ga0207648_10003517 Ga0207648_1000351710 114
895 3300026089 Ga0207648_10943619 Ga0207648_109436192 114
896 3300026095 Ga0207676_10027632 Ga0207676_100276323 114
897 3300026095 Ga0207676_10129451 Ga0207676_101294512 114
898 3300026095 Ga0207676_11515846 Ga0207676_115158462 114
899 3300026118 Ga0207675_100001416 Ga0207675_10000141617 114
900 3300026121 Ga0207683_10009129 Ga0207683_100091292 114
901 3300026121 Ga0207683_10016135 Ga0207683_100161352 114
902 3300026121 Ga0207683_10105127 Ga0207683_101051273 114
903 3300026121 Ga0207683_10545982 Ga0207683_105459822 114
904 3300026121 Ga0207683_10798456 Ga0207683_107984562 114
905 3300026121 Ga0207683_10937691 Ga0207683_109376912 114
906 3300026142 Ga0207698_10127571 Ga0207698_101275712 114
907 3300026142 Ga0207698_10441685 Ga0207698_104416852 114
908 3300027360 Ga0209969_1002240 Ga0209969_10022404 114
909 3300027364 Ga0209967_1004872 Ga0209967_10048723 114
910 3300027378 Ga0209981_1003673 Ga0209981_10036732 114
911 3300027395 Ga0209996_1019517 Ga0209996_10195172 114
912 3300027462 Ga0210000_1001764 Ga0210000_10017644 114
913 3300027471 Ga0209995_1002050 Ga0209995_10020504 114
914 3300027526 Ga0209968_1003838 Ga0209968_10038382 114
915 3300027543 Ga0209999_1001732 Ga0209999_10017323 114
916 3300027614 Ga0209970_1022078 Ga0209970_10220782 114
917 3300027665 Ga0209983_1036827 Ga0209983_10368272 114
918 3300027682 Ga0209971_1021982 Ga0209971_10219822 114
919 3300027695 Ga0209966_1045950 Ga0209966_10459502 114
920 3300028380 Ga0268265_10007737 Ga0268265_100077378 114
921 3300028381 Ga0268264_10004913 Ga0268264_100049139 114
922 3300028381 Ga0268264_10099285 Ga0268264_100992852 114
923 3300028794 Ga0307515_10000179 Ga0307515_1000017962 114
924 3300028794 Ga0307515_10000586 Ga0307515_1000058653 114
925 3300028794 Ga0307515_10236777 Ga0307515_102367772 114
926 3300031456 Ga0307513_10236611 Ga0307513_102366112 114
927 3300031456 Ga0307513_10962798 Ga0307513_109627981 114
928 3300031616 Ga0307508_10000122 Ga0307508_100001228 114
929 3300031649 Ga0307514_10272910 Ga0307514_102729102 114
930 3300031730 Ga0307516_10029866 Ga0307516_100298662 114
931 3300033179 Ga0307507_10069984 Ga0307507_100699845 114
932 3300035111 Ga0373923_0071975 Ga0373923_0071975_282_626 114
933 3300035116 Ga0373945_0008025 Ga0373945_0008025_1249_1593 114
934 3300035170 Ga0373943_0173390 Ga0373943_0173390_441_785 114
935 3300035172 Ga0373955_0112668 Ga0373955_0112668_420_764 114
936 3300035695 Ga0373927_0261288 Ga0373927_0261288_471_815 114
937 3300035724 Ga0373933_0295583 Ga0373933_0295583_120_464 114
938 3300035725 Ga0373947_0020189 Ga0373947_0020189_692_1036 114
939 3300036401 Ga0373937_0081817 Ga0373937_0081817_391_735 114
940 3300037068 Ga0373925_0033167 Ga0373925_0033167_2137_2481 114
941 3300037068 Ga0373925_0806431 Ga0373925_0806431_336_680 114
942 3300039437 Ga0436365_1108553 Ga0436365_1108553_460_804 114
943 3300041456 Ga0451795_0723237 Ga0451795_0723237_1443_1838 114
944 3300041459 Ga0451800_0129709 Ga0451800_0129709_19_363 114
945 3300041459 Ga0451800_1183513 Ga0451800_1183513_42_386 114
946 3300041460 Ga0451802_0213386 Ga0451802_0213386_181_576 114
947 3300041460 Ga0451802_0459691 Ga0451802_0459691_730_1074 114
948 3300041491 Ga0451833_0412951 Ga0451833_0412951_276_671 114
949 3300041492 Ga0451835_0304909 Ga0451835_0304909_80_424 114
950 3300041496 Ga0451839_0471582 Ga0451839_0471582_257_601 114
951 3300041496 Ga0451839_1533245 Ga0451839_1533245_215_622 114
952 3300041505 Ga0451849_0264779 Ga0451849_0264779_162_506 114
953 3300041505 Ga0451849_1033926 Ga0451849_1033926_306_701 114
954 3300041509 Ga0451843_0009642 Ga0451843_0009642_1339_1734 114
955 3300041512 Ga0451853_2066207 Ga0451853_2066207_703_1098 114
956 3300046459 Ga0495629_0221240 Ga0495629_0221240_338_682 114
957 3300046472 Ga0495580_0070354 Ga0495580_0070354_725_1069 114
958 3300046472 Ga0495580_0360701 Ga0495580_0360701_205_549 114
959 3300046473 Ga0495582_0277524 Ga0495582_0277524_578_922 114
960 3300046512 Ga0495610_0012246 Ga0495610_0012246_3058_3453 114
961 3300046515 Ga0495620_0368431 Ga0495620_0368431_47_454 114
962 3300046517 Ga0495630_0694475 Ga0495630_0694475_180_539 114
963 3300046519 Ga0495632_0099632 Ga0495632_0099632_66_473 114
964 3300046522 Ga0495643_0041054 Ga0495643_0041054_615_1022 114
965 3300046537 Ga0495598_0038050 Ga0495598_0038050_604_948 114
966 3300046539 Ga0495621_0128326 Ga0495621_0128326_564_908 114
967 3300046539 Ga0495621_0478782 Ga0495621_0478782_149_493 114
968 3300046543 Ga0495645_0088941 Ga0495645_0088941_394_738 114
969 3300046558 Ga0495633_0293281 Ga0495633_0293281_322_666 114
970 3300046615 Ga0495656_0094696 Ga0495656_0094696_68_412 114
971 3300046642 Ga0495634_0612452 Ga0495634_0612452_46_390 114
972 3300046679 Ga0495623_0327390 Ga0495623_0327390_130_474 114
973 3300046681 Ga0495647_0012321 Ga0495647_0012321_1570_1914 114
974 3300046681 Ga0495647_0374932 Ga0495647_0374932_75_419 114
975 3300046683 Ga0495658_0039204 Ga0495658_0039204_1029_1373 114
976 3300046683 Ga0495658_0063173 Ga0495658_0063173_1774_2118 114
977 3300046683 Ga0495658_0441988 Ga0495658_0441988_391_735 114
978 3300046689 Ga0495613_0161628 Ga0495613_0161628_258_602 114
979 3300046691 Ga0495670_0188188 Ga0495670_0188188_265_609 114
980 3300047444 Ga0495675_0403243 Ga0495675_0403243_36_380 114
981 3300047470 Ga0495681_0291429 Ga0495681_0291429_16_360 114
982 3300047472 Ga0495686_0201281 Ga0495686_0201281_26_433 114
983 3300048904 Ga0496101_0190107 Ga0496101_0190107_1133_1543 114
984 3300048907 Ga0496104_0734914 Ga0496104_0734914_146_490 114
985 3300048910 Ga0496107_0790580 Ga0496107_0790580_305_649 114
986 3300048911 Ga0496108_0040663 Ga0496108_0040663_2883_3227 114
987 3300048911 Ga0496108_1660631 Ga0496108_1660631_156_500 114
988 3300048912 Ga0496109_0389761 Ga0496109_0389761_234_578 114
989 3300048913 Ga0496110_0389172 Ga0496110_0389172_792_1136 114
990 3300048914 Ga0496111_0947198 Ga0496111_0947198_209_553 114
991 3300048917 Ga0496114_0067421 Ga0496114_0067421_2255_2599 114
992 3300050493 nmdc:mga0k408_241823_c1 nmdc:mga0k408_241823_c1_56_463 114
993 3300050496 nmdc:mga07m45_52835_c1 nmdc:mga07m45_52835_c1_674_1069 114
994 3300050511 nmdc:mga08y16_1106325_c1 nmdc:mga08y16_1106325_c1_391_735 114
995 3300053078 Ga0495612_0190400 Ga0495612_0190400_545_889 114
996 3300053085 Ga0495619_0052855 Ga0495619_0052855_950_1294 114
997 3300053088 Ga0500644_0220452 Ga0500644_0220452_357_752 114
998 3300053126 Ga0500621_223356 Ga0500621_223356_216_611 114
999 3300053139 Ga0500568_0090637 Ga0500568_0090637_11_505 114
1000 3300053739 Ga0500587_002054 Ga0500587_002054_190_585 114
1001 iso_pu_bacteria 2585428062 2587756806 114

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lzd-assembly1.cif.gz_B crystal structure of dph2 from pyrococcus horikoshii with 4fe-4s cluster 0.7429 91 114
4lwo-assembly2.cif.gz_G crystal structure of prmt6 0.3873 10 36
6s77-assembly1.cif.gz_A crystal structure of carm1 n265y mutant in complex with inhibitor aa183 0.3752 10 38
5lv3-assembly1.cif.gz_D crystal structure of mouse carm1 in complex with ligand lh1561br 0.3747 10 38
7mi5-assembly1.cif.gz_F asymmetrical pam-non pam prespacer bound cas4/cas1/cas2 complex 0.3698 13 86
ID Description Score Start End Superfamily
3lzcA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Diphthamide synthesis DPH1/DPH2 domain 1 0.7314 91 114 3.40.50.11840
af_Q9FHS4_48_158_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.6248 8 106 3.40.1440.10
af_A4I1H7_2_94_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.58 10 97 3.40.1440.10
af_Q9P7M3_4_108_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.5623 11 98 3.40.1440.10
af_Q9FHS4_48_158_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.4713 8 106 3.40.1440.10
ID Description Score Start End GO Terms
AF-A0A246JET8-F1-model_v4 GIY-YIG domain-containing protein 0.9968 16 114
AF-A0A536Y8U5-F1-model_v4 GIY-YIG nuclease family protein 0.9933 11 114
AF-A0A520B9W0-F1-model_v4 GIY-YIG nuclease family protein 0.9928 19 114
AF-F5Y6F3-F1-model_v4 GIY-YIG domain-containing protein 0.9907 41 114
AF-A0A848VHQ4-F1-model_v4 GIY-YIG domain-containing protein 0.9856 10 114

Feature Viewer

pLDDT pTM Quality
91.75 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map