F487894
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1001 | 475 | 999 | 113 |
Family's Representative Sequence
| Representative Sequence | 3300042435|Ga0439434_0239228|Ga0439434_0239228_124_495 |
| Length | 123 |
| Sequence | MRRRTFRKLKAAVASPATLHHYVYVVLLDPAVLKLRKIRMTNPSRQKDKACLYVGMTGLTPPERFANHKAGIKAARIVQRYGVRLLPDLYEVFNPMPFDVAAQMEKELAEDLRAQGYTVAGGY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 2 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 3 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 4 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 5 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 91 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 92 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 93 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 94 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 95 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 99 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 100 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 101 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 102 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 104 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 105 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 106 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 107 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 108 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 109 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 112 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 128 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 145 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 222 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 225 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 226 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 228 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 229 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 230 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 231 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 232 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 233 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 234 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 235 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 236 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 237 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 238 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 239 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 240 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 241 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 242 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 243 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 244 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 245 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 247 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 248 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 249 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 250 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 251 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 252 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 254 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 255 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 256 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 257 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 260 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 261 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 262 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 263 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 264 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 265 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 266 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 267 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 268 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 278 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 279 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 280 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 281 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 282 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 283 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 284 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 285 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 286 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 287 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 288 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 289 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 290 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 291 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 292 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 293 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 294 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 295 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 296 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 297 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 298 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 299 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 300 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 301 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 302 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 303 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 304 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 305 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 306 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 307 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 308 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 309 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 310 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 311 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 312 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 313 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 314 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 315 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 316 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 317 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 318 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 319 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 320 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 321 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 322 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 323 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 324 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 399 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 400 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 401 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 402 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 403 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 404 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 405 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 406 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 407 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 408 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 409 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 410 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 411 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 412 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 413 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 414 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 415 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 427 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 428 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 429 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 432 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 435 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 436 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 437 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 438 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 439 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 440 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 441 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 442 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 446 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 450 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 451 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 452 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 453 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 454 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 455 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 456 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 457 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 458 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 459 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 460 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 461 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 462 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 463 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 464 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 465 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 466 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 467 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 468 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 469 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 470 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 471 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 472 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 473 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 474 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 475 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0.1 |
| Isolates | 0.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.79 |
| Nodule | 0 |
| Rhizoplane | 3.7 |
| Rhizosphere | 77.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1040090 | 3300002070 | Bacteria | 709 |
| 2 | JGI25152J39213_1003080 | 3300002773 | Bacteria | 5850 |
| 3 | JGI25150J39212_1017737 | 3300002774 | Bacteria | 1144 |
| 4 | JGI25153J46596_10000615 | 3300003215 | Bacteria | 21753 |
| 5 | JGI25153J46596_10002602 | 3300003215 | Bacteria | 10335 |
| 6 | rootH1_10008100 | 3300003316 | Bacteria | 9916 |
| 7 | rootL2_10013911 | 3300003322 | Bacteria | 19208 |
| 8 | rootL2_10156776 | 3300003322 | Bacteria | 1026 |
| 9 | rootH1_10011242 | 3300003323 | Bacteria | 5505 |
| 10 | rootH1_10054083 | 3300003323 | Bacteria | 2388 |
| 11 | JGI26145J50221_1038583 | 3300003371 | Bacteria | 504 |
| 12 | Ga0055526_1001543 | 3300003771 | Bacteria | 16295 |
| 13 | Ga0055530_10069192 | 3300003791 | Bacteria | 765 |
| 14 | Ga0055531_10000002 | 3300003794 | Bacteria | 421971 |
| 15 | Ga0065165_1002659 | 3300005262 | Bacteria | 14440 |
| 16 | Ga0065712_10223066 | 3300005290 | Bacteria | 1035 |
| 17 | Ga0065715_10016577 | 3300005293 | Bacteria | 1829 |
| 18 | Ga0070658_10300320 | 3300005327 | Bacteria | 1369 |
| 19 | Ga0070658_10430712 | 3300005327 | Bacteria | 1135 |
| 20 | Ga0070658_10745414 | 3300005327 | Bacteria | 850 |
| 21 | Ga0070676_10001334 | 3300005328 | Bacteria | 12393 |
| 22 | Ga0070676_10004760 | 3300005328 | Bacteria | 7174 |
| 23 | Ga0070676_10165264 | 3300005328 | Bacteria | 1427 |
| 24 | Ga0070676_11583033 | 3300005328 | Bacteria | 506 |
| 25 | Ga0070683_100120080 | 3300005329 | Bacteria | 2482 |
| 26 | Ga0070683_100436994 | 3300005329 | Bacteria | 1249 |
| 27 | Ga0070683_101092304 | 3300005329 | Bacteria | 766 |
| 28 | Ga0070690_100001815 | 3300005330 | Bacteria | 11312 |
| 29 | Ga0070690_100498243 | 3300005330 | Bacteria | 911 |
| 30 | Ga0070670_100011885 | 3300005331 | Bacteria | 7445 |
| 31 | Ga0070670_100089787 | 3300005331 | Bacteria | 2641 |
| 32 | Ga0070670_100263957 | 3300005331 | Bacteria | 1501 |
| 33 | Ga0070670_100361204 | 3300005331 | Bacteria | 1277 |
| 34 | Ga0070670_100441463 | 3300005331 | Bacteria | 1152 |
| 35 | Ga0070677_10018563 | 3300005333 | Bacteria | 2506 |
| 36 | Ga0070677_10131923 | 3300005333 | Bacteria | 1142 |
| 37 | Ga0070677_10207347 | 3300005333 | Bacteria | 950 |
| 38 | Ga0070677_10568647 | 3300005333 | Bacteria | 624 |
| 39 | Ga0068869_100003785 | 3300005334 | Bacteria | 9322 |
| 40 | Ga0068869_100141900 | 3300005334 | Bacteria | 1855 |
| 41 | Ga0068869_101030603 | 3300005334 | Bacteria | 718 |
| 42 | Ga0070666_10099909 | 3300005335 | Bacteria | 1998 |
| 43 | Ga0070666_10634855 | 3300005335 | Bacteria | 781 |
| 44 | Ga0070680_100007136 | 3300005336 | Bacteria | 8514 |
| 45 | Ga0070680_101539448 | 3300005336 | Bacteria | 576 |
| 46 | Ga0070682_100437029 | 3300005337 | Bacteria | 999 |
| 47 | Ga0068868_100118748 | 3300005338 | Bacteria | 2155 |
| 48 | Ga0068868_100324736 | 3300005338 | Bacteria | 1312 |
| 49 | Ga0068868_100439542 | 3300005338 | Bacteria | 1133 |
| 50 | Ga0068868_100671126 | 3300005338 | Bacteria | 925 |
| 51 | Ga0070660_100250043 | 3300005339 | Bacteria | 1445 |
| 52 | Ga0070660_100726075 | 3300005339 | Bacteria | 834 |
| 53 | Ga0070660_100912575 | 3300005339 | Bacteria | 741 |
| 54 | Ga0070689_100004554 | 3300005340 | Bacteria | 9385 |
| 55 | Ga0070689_100749998 | 3300005340 | Bacteria | 855 |
| 56 | Ga0070691_10377207 | 3300005341 | Bacteria | 794 |
| 57 | Ga0070691_10595448 | 3300005341 | Bacteria | 652 |
| 58 | Ga0070691_10642534 | 3300005341 | Bacteria | 631 |
| 59 | Ga0070687_100121829 | 3300005343 | Bacteria | 1493 |
| 60 | Ga0070687_100273690 | 3300005343 | Bacteria | 1059 |
| 61 | Ga0070661_100336456 | 3300005344 | Bacteria | 1182 |
| 62 | Ga0070661_101023945 | 3300005344 | Bacteria | 686 |
| 63 | Ga0070661_101530449 | 3300005344 | Bacteria | 563 |
| 64 | Ga0070692_10224130 | 3300005345 | Bacteria | 1113 |
| 65 | Ga0070668_100007743 | 3300005347 | Bacteria | 7974 |
| 66 | Ga0070669_100002211 | 3300005353 | Bacteria | 14098 |
| 67 | Ga0070669_100456890 | 3300005353 | Bacteria | 1053 |
| 68 | Ga0070675_100035230 | 3300005354 | Bacteria | 4066 |
| 69 | Ga0070675_100300637 | 3300005354 | Bacteria | 1414 |
| 70 | Ga0070675_100389196 | 3300005354 | Bacteria | 1242 |
| 71 | Ga0070671_100000437 | 3300005355 | Bacteria | 28930 |
| 72 | Ga0070671_100049662 | 3300005355 | Bacteria | 3490 |
| 73 | Ga0070671_100240851 | 3300005355 | Bacteria | 1535 |
| 74 | Ga0070671_100400910 | 3300005355 | Bacteria | 1173 |
| 75 | Ga0070671_100491052 | 3300005355 | Bacteria | 1056 |
| 76 | Ga0070674_100000965 | 3300005356 | Bacteria | 14986 |
| 77 | Ga0070674_100024540 | 3300005356 | Bacteria | 3915 |
| 78 | Ga0070673_100043415 | 3300005364 | Bacteria | 3474 |
| 79 | Ga0070673_100085514 | 3300005364 | Bacteria | 2568 |
| 80 | Ga0070673_100296467 | 3300005364 | Bacteria | 1422 |
| 81 | Ga0070673_100950018 | 3300005364 | Bacteria | 799 |
| 82 | Ga0070673_101095480 | 3300005364 | Bacteria | 744 |
| 83 | Ga0070688_100159329 | 3300005365 | Bacteria | 1549 |
| 84 | Ga0070688_101031075 | 3300005365 | Bacteria | 655 |
| 85 | Ga0070659_100041833 | 3300005366 | Bacteria | 3583 |
| 86 | Ga0070659_100139439 | 3300005366 | Bacteria | 1974 |
| 87 | Ga0070659_100263208 | 3300005366 | Bacteria | 1431 |
| 88 | Ga0070659_101490159 | 3300005366 | Bacteria | 603 |
| 89 | Ga0070667_100000705 | 3300005367 | Bacteria | 32287 |
| 90 | Ga0070667_100002738 | 3300005367 | Bacteria | 15240 |
| 91 | Ga0070667_100020055 | 3300005367 | Bacteria | 5550 |
| 92 | Ga0070667_100335409 | 3300005367 | Bacteria | 1367 |
| 93 | Ga0070667_100449237 | 3300005367 | Bacteria | 1178 |
| 94 | Ga0070667_100579539 | 3300005367 | Bacteria | 1033 |
| 95 | Ga0070667_100815655 | 3300005367 | Bacteria | 866 |
| 96 | Ga0070703_10447299 | 3300005406 | Bacteria | 572 |
| 97 | Ga0070709_10088230 | 3300005434 | Bacteria | 2040 |
| 98 | Ga0070710_10015522 | 3300005437 | Bacteria | 3858 |
| 99 | Ga0070710_10244186 | 3300005437 | Bacteria | 1151 |
| 100 | Ga0070701_10131369 | 3300005438 | Bacteria | 1423 |
| 101 | Ga0070701_10571618 | 3300005438 | Bacteria | 744 |
| 102 | Ga0070701_10855283 | 3300005438 | Bacteria | 625 |
| 103 | Ga0070711_100038205 | 3300005439 | Bacteria | 3226 |
| 104 | Ga0070705_100040034 | 3300005440 | Bacteria | 2663 |
| 105 | Ga0070705_100432461 | 3300005440 | Bacteria | 983 |
| 106 | Ga0070694_100011953 | 3300005444 | Bacteria | 5387 |
| 107 | Ga0070694_100134098 | 3300005444 | Bacteria | 1792 |
| 108 | Ga0070694_101013541 | 3300005444 | Bacteria | 690 |
| 109 | Ga0070708_100233431 | 3300005445 | Bacteria | 1726 |
| 110 | Ga0070663_101375257 | 3300005455 | Bacteria | 625 |
| 111 | Ga0070678_100002439 | 3300005456 | Bacteria | 10188 |
| 112 | Ga0070678_100079120 | 3300005456 | Bacteria | 2485 |
| 113 | Ga0070678_100258411 | 3300005456 | Bacteria | 1463 |
| 114 | Ga0070662_100004128 | 3300005457 | Bacteria | 9135 |
| 115 | Ga0070662_100023060 | 3300005457 | Bacteria | 4272 |
| 116 | Ga0070662_100042390 | 3300005457 | Bacteria | 3251 |
| 117 | Ga0070662_100285042 | 3300005457 | Bacteria | 1338 |
| 118 | Ga0070662_100446627 | 3300005457 | Bacteria | 1073 |
| 119 | Ga0070662_100502238 | 3300005457 | Bacteria | 1012 |
| 120 | Ga0070662_100813573 | 3300005457 | Bacteria | 795 |
| 121 | Ga0070681_10045717 | 3300005458 | Bacteria | 4379 |
| 122 | Ga0070681_10102497 | 3300005458 | Bacteria | 2807 |
| 123 | Ga0068867_100000004 | 3300005459 | Bacteria | 180739 |
| 124 | Ga0068867_100003930 | 3300005459 | Bacteria | 10463 |
| 125 | Ga0068867_100009546 | 3300005459 | Bacteria | 6840 |
| 126 | Ga0068867_100094233 | 3300005459 | Bacteria | 2276 |
| 127 | Ga0068867_100472583 | 3300005459 | Bacteria | 1072 |
| 128 | Ga0068867_101366914 | 3300005459 | Bacteria | 656 |
| 129 | Ga0070685_10000493 | 3300005466 | Bacteria | 22875 |
| 130 | Ga0070685_10183216 | 3300005466 | Bacteria | 1350 |
| 131 | Ga0070706_100123600 | 3300005467 | Bacteria | 2413 |
| 132 | Ga0070707_100301965 | 3300005468 | Bacteria | 1556 |
| 133 | Ga0070698_100413024 | 3300005471 | Bacteria | 1284 |
| 134 | Ga0070699_100607410 | 3300005518 | Bacteria | 997 |
| 135 | Ga0070699_101414407 | 3300005518 | Bacteria | 638 |
| 136 | Ga0070679_100005395 | 3300005530 | Bacteria | 11845 |
| 137 | Ga0070679_100178492 | 3300005530 | Bacteria | 2096 |
| 138 | Ga0070679_100654899 | 3300005530 | Bacteria | 993 |
| 139 | Ga0070679_100829050 | 3300005530 | Bacteria | 868 |
| 140 | Ga0070684_100125115 | 3300005535 | Bacteria | 2315 |
| 141 | Ga0070684_100793668 | 3300005535 | Bacteria | 885 |
| 142 | Ga0070697_100260777 | 3300005536 | Bacteria | 1484 |
| 143 | Ga0070697_100437186 | 3300005536 | Bacteria | 1138 |
| 144 | Ga0068853_100006975 | 3300005539 | Bacteria | 9024 |
| 145 | Ga0068853_100063148 | 3300005539 | Bacteria | 3208 |
| 146 | Ga0068853_100368490 | 3300005539 | Bacteria | 1340 |
| 147 | Ga0068853_100691354 | 3300005539 | Bacteria | 972 |
| 148 | Ga0070672_100003309 | 3300005543 | Bacteria | 10434 |
| 149 | Ga0070672_100022475 | 3300005543 | Bacteria | 4633 |
| 150 | Ga0070672_100043274 | 3300005543 | Bacteria | 3471 |
| 151 | Ga0070672_100082357 | 3300005543 | Bacteria | 2581 |
| 152 | Ga0070672_100100170 | 3300005543 | Bacteria | 2349 |
| 153 | Ga0070672_100105091 | 3300005543 | Bacteria | 2295 |
| 154 | Ga0070672_100161485 | 3300005543 | Bacteria | 1859 |
| 155 | Ga0070672_101096915 | 3300005543 | Unclassified | 707 |
| 156 | Ga0070672_101736624 | 3300005543 | Bacteria | 561 |
| 157 | Ga0070686_100024368 | 3300005544 | Bacteria | 3626 |
| 158 | Ga0070686_100035614 | 3300005544 | Bacteria | 3076 |
| 159 | Ga0070686_101084404 | 3300005544 | Bacteria | 661 |
| 160 | Ga0070695_100088980 | 3300005545 | Bacteria | 2057 |
| 161 | Ga0070695_100126146 | 3300005545 | Bacteria | 1758 |
| 162 | Ga0070695_100158395 | 3300005545 | Bacteria | 1587 |
| 163 | Ga0070696_100010213 | 3300005546 | Bacteria | 6283 |
| 164 | Ga0070696_100213444 | 3300005546 | Bacteria | 1445 |
| 165 | Ga0070696_100667254 | 3300005546 | Bacteria | 844 |
| 166 | Ga0070693_100003655 | 3300005547 | Bacteria | 7186 |
| 167 | Ga0070693_100940888 | 3300005547 | Bacteria | 650 |
| 168 | Ga0070693_101125818 | 3300005547 | Bacteria | 600 |
| 169 | Ga0070665_100016649 | 3300005548 | Bacteria | 7368 |
| 170 | Ga0070665_100350143 | 3300005548 | Bacteria | 1482 |
| 171 | Ga0070704_100041018 | 3300005549 | Bacteria | 3191 |
| 172 | Ga0070704_100245804 | 3300005549 | Bacteria | 1467 |
| 173 | Ga0070704_101341913 | 3300005549 | Bacteria | 655 |
| 174 | Ga0068855_100030561 | 3300005563 | Bacteria | 6441 |
| 175 | Ga0068855_100033363 | 3300005563 | Bacteria | 6144 |
| 176 | Ga0070664_100092663 | 3300005564 | Bacteria | 2616 |
| 177 | Ga0070664_100287978 | 3300005564 | Bacteria | 1482 |
| 178 | Ga0070664_100930323 | 3300005564 | Bacteria | 816 |
| 179 | Ga0068857_100031528 | 3300005577 | Bacteria | 4684 |
| 180 | Ga0068857_100664668 | 3300005577 | Bacteria | 988 |
| 181 | Ga0068854_100028980 | 3300005578 | Bacteria | 3829 |
| 182 | Ga0068854_100098256 | 3300005578 | Bacteria | 2191 |
| 183 | Ga0068854_100136299 | 3300005578 | Bacteria | 1879 |
| 184 | Ga0068854_100171311 | 3300005578 | Bacteria | 1689 |
| 185 | Ga0068854_100327336 | 3300005578 | Bacteria | 1247 |
| 186 | Ga0068854_100521527 | 3300005578 | Bacteria | 1004 |
| 187 | Ga0068854_101034175 | 3300005578 | Bacteria | 729 |
| 188 | Ga0068856_100053983 | 3300005614 | Bacteria | 3962 |
| 189 | Ga0068856_100148032 | 3300005614 | Bacteria | 2356 |
| 190 | Ga0068856_100280219 | 3300005614 | Bacteria | 1684 |
| 191 | Ga0068856_100496054 | 3300005614 | Bacteria | 1242 |
| 192 | Ga0068856_102671395 | 3300005614 | Bacteria | 505 |
| 193 | Ga0070702_100158131 | 3300005615 | Bacteria | 1462 |
| 194 | Ga0068852_100007596 | 3300005616 | Bacteria | 7927 |
| 195 | Ga0068852_100137191 | 3300005616 | Bacteria | 2259 |
| 196 | Ga0068852_100156509 | 3300005616 | Bacteria | 2123 |
| 197 | Ga0068852_100291591 | 3300005616 | Bacteria | 1576 |
| 198 | Ga0068852_100555599 | 3300005616 | Bacteria | 1149 |
| 199 | Ga0068852_100758868 | 3300005616 | Bacteria | 982 |
| 200 | Ga0068852_101297695 | 3300005616 | Bacteria | 750 |
| 201 | Ga0068852_101332712 | 3300005616 | Bacteria | 740 |
| 202 | Ga0068859_100191302 | 3300005617 | Bacteria | 2131 |
| 203 | Ga0068859_100213952 | 3300005617 | Bacteria | 2014 |
| 204 | Ga0068859_100374376 | 3300005617 | Bacteria | 1520 |
| 205 | Ga0068864_100013261 | 3300005618 | Bacteria | 6827 |
| 206 | Ga0068864_100087455 | 3300005618 | Bacteria | 2743 |
| 207 | Ga0068864_100163563 | 3300005618 | Bacteria | 2024 |
| 208 | Ga0068864_100176707 | 3300005618 | Bacteria | 1950 |
| 209 | Ga0068866_10035408 | 3300005718 | Bacteria | 2438 |
| 210 | Ga0068866_10171605 | 3300005718 | Bacteria | 1274 |
| 211 | Ga0068866_10590868 | 3300005718 | Bacteria | 748 |
| 212 | Ga0068861_100002811 | 3300005719 | Bacteria | 11447 |
| 213 | Ga0068861_101120855 | 3300005719 | Bacteria | 757 |
| 214 | Ga0068851_10069711 | 3300005834 | Bacteria | 1816 |
| 215 | Ga0068851_10145064 | 3300005834 | Bacteria | 1294 |
| 216 | Ga0068870_10178917 | 3300005840 | Bacteria | 1271 |
| 217 | Ga0068870_10351895 | 3300005840 | Bacteria | 945 |
| 218 | Ga0068870_10476397 | 3300005840 | Bacteria | 828 |
| 219 | Ga0068870_10756597 | 3300005840 | Bacteria | 675 |
| 220 | Ga0068863_100004699 | 3300005841 | Bacteria | 13460 |
| 221 | Ga0068863_100078599 | 3300005841 | Bacteria | 3124 |
| 222 | Ga0068863_100233429 | 3300005841 | Bacteria | 1775 |
| 223 | Ga0068863_100899292 | 3300005841 | Bacteria | 885 |
| 224 | Ga0068863_101127117 | 3300005841 | Bacteria | 789 |
| 225 | Ga0068863_101438844 | 3300005841 | Bacteria | 697 |
| 226 | Ga0068858_100010462 | 3300005842 | Bacteria | 8788 |
| 227 | Ga0068858_100014064 | 3300005842 | Bacteria | 7547 |
| 228 | Ga0068858_100101907 | 3300005842 | Bacteria | 2678 |
| 229 | Ga0068860_100005300 | 3300005843 | Bacteria | 13093 |
| 230 | Ga0068860_100129897 | 3300005843 | Bacteria | 2417 |
| 231 | Ga0068860_101018895 | 3300005843 | Bacteria | 846 |
| 232 | Ga0068862_101420419 | 3300005844 | Bacteria | 698 |
| 233 | Ga0070717_10139912 | 3300006028 | Bacteria | 2087 |
| 234 | Ga0075365_10001590 | 3300006038 | Bacteria | 10438 |
| 235 | Ga0075365_10510754 | 3300006038 | Bacteria | 849 |
| 236 | Ga0075368_10073404 | 3300006042 | Bacteria | 1385 |
| 237 | Ga0075363_100051673 | 3300006048 | Bacteria | 2193 |
| 238 | Ga0075363_100053330 | 3300006048 | Bacteria | 2161 |
| 239 | Ga0075363_100066441 | 3300006048 | Bacteria | 1952 |
| 240 | Ga0075363_100086718 | 3300006048 | Bacteria | 1719 |
| 241 | Ga0075363_100529467 | 3300006048 | Bacteria | 702 |
| 242 | Ga0075364_10168316 | 3300006051 | Bacteria | 1481 |
| 243 | Ga0075364_10239523 | 3300006051 | Bacteria | 1232 |
| 244 | Ga0075432_10216211 | 3300006058 | Bacteria | 765 |
| 245 | Ga0070715_10142841 | 3300006163 | Bacteria | 1165 |
| 246 | Ga0070716_100018816 | 3300006173 | Bacteria | 3602 |
| 247 | Ga0070712_100060850 | 3300006175 | Bacteria | 2665 |
| 248 | Ga0075362_10001615 | 3300006177 | Bacteria | 7311 |
| 249 | Ga0075362_10038873 | 3300006177 | Bacteria | 2090 |
| 250 | Ga0075362_10490156 | 3300006177 | Bacteria | 627 |
| 251 | Ga0075367_10021159 | 3300006178 | Bacteria | 3632 |
| 252 | Ga0075367_10024391 | 3300006178 | Bacteria | 3410 |
| 253 | Ga0075367_10952134 | 3300006178 | Bacteria | 548 |
| 254 | Ga0075369_10375818 | 3300006186 | Bacteria | 668 |
| 255 | Ga0075369_10499793 | 3300006186 | Bacteria | 578 |
| 256 | Ga0075366_10003855 | 3300006195 | Bacteria | 7988 |
| 257 | Ga0075366_10013944 | 3300006195 | Bacteria | 4583 |
| 258 | Ga0075366_10039097 | 3300006195 | Bacteria | 2803 |
| 259 | Ga0075366_10042728 | 3300006195 | Bacteria | 2684 |
| 260 | Ga0075366_10051655 | 3300006195 | Bacteria | 2442 |
| 261 | Ga0075366_10060953 | 3300006195 | Bacteria | 2241 |
| 262 | Ga0075366_10457705 | 3300006195 | Bacteria | 787 |
| 263 | Ga0075366_10482727 | 3300006195 | Bacteria | 766 |
| 264 | Ga0075366_10543742 | 3300006195 | Bacteria | 719 |
| 265 | Ga0075366_10569553 | 3300006195 | Bacteria | 702 |
| 266 | Ga0097621_100029731 | 3300006237 | Bacteria | 4318 |
| 267 | Ga0097621_100204014 | 3300006237 | Bacteria | 1718 |
| 268 | Ga0097621_100725900 | 3300006237 | Bacteria | 916 |
| 269 | Ga0097621_101744881 | 3300006237 | Bacteria | 593 |
| 270 | Ga0075370_10006405 | 3300006353 | Bacteria | 5918 |
| 271 | Ga0075370_10022199 | 3300006353 | Bacteria | 3483 |
| 272 | Ga0075370_10046000 | 3300006353 | Bacteria | 2469 |
| 273 | Ga0075370_10173473 | 3300006353 | Bacteria | 1268 |
| 274 | Ga0075370_10326090 | 3300006353 | Bacteria | 915 |
| 275 | Ga0075370_10374263 | 3300006353 | Bacteria | 853 |
| 276 | Ga0068871_100192218 | 3300006358 | Bacteria | 1759 |
| 277 | Ga0068871_101358398 | 3300006358 | Bacteria | 669 |
| 278 | Ga0075430_100119499 | 3300006846 | Unclassified | 2197 |
| 279 | Ga0075434_100383728 | 3300006871 | Bacteria | 1426 |
| 280 | Ga0075434_101557612 | 3300006871 | Bacteria | 670 |
| 281 | Ga0075429_101772563 | 3300006880 | Bacteria | 536 |
| 282 | Ga0068865_100002020 | 3300006881 | Bacteria | 11969 |
| 283 | Ga0068865_100249670 | 3300006881 | Bacteria | 1400 |
| 284 | Ga0068865_100255028 | 3300006881 | Bacteria | 1386 |
| 285 | Ga0068865_100356371 | 3300006881 | Bacteria | 1187 |
| 286 | Ga0068865_100593326 | 3300006881 | Bacteria | 935 |
| 287 | Ga0068865_101321388 | 3300006881 | Bacteria | 642 |
| 288 | Ga0075436_100142324 | 3300006914 | Bacteria | 1686 |
| 289 | Ga0097620_100191296 | 3300006931 | Bacteria | 2131 |
| 290 | Ga0097620_100213932 | 3300006931 | Bacteria | 2014 |
| 291 | Ga0097620_100374388 | 3300006931 | Bacteria | 1520 |
| 292 | Ga0075435_100057492 | 3300007076 | Bacteria | 3147 |
| 293 | Ga0105240_10359587 | 3300009093 | Bacteria | 1649 |
| 294 | Ga0111539_10031472 | 3300009094 | Bacteria | 6444 |
| 295 | Ga0111539_12595239 | 3300009094 | Bacteria | 587 |
| 296 | Ga0105245_10214229 | 3300009098 | Bacteria | 1855 |
| 297 | Ga0105245_10537259 | 3300009098 | Bacteria | 1190 |
| 298 | Ga0105247_10044989 | 3300009101 | Bacteria | 2708 |
| 299 | Ga0114129_11064411 | 3300009147 | Bacteria | 1015 |
| 300 | Ga0105243_10020827 | 3300009148 | Bacteria | 4975 |
| 301 | Ga0105243_10056139 | 3300009148 | Bacteria | 3130 |
| 302 | Ga0105243_10175926 | 3300009148 | Bacteria | 1857 |
| 303 | Ga0105243_10248770 | 3300009148 | Bacteria | 1586 |
| 304 | Ga0105243_10303204 | 3300009148 | Bacteria | 1449 |
| 305 | Ga0105243_10375564 | 3300009148 | Bacteria | 1313 |
| 306 | Ga0105241_10051833 | 3300009174 | Bacteria | 3131 |
| 307 | Ga0105241_10277178 | 3300009174 | Bacteria | 1431 |
| 308 | Ga0105242_10040381 | 3300009176 | Bacteria | 3760 |
| 309 | Ga0105242_10435979 | 3300009176 | Bacteria | 1232 |
| 310 | Ga0105242_12025665 | 3300009176 | Bacteria | 618 |
| 311 | Ga0105248_10030887 | 3300009177 | Bacteria | 5984 |
| 312 | Ga0105248_10065141 | 3300009177 | Bacteria | 4091 |
| 313 | Ga0105248_10137185 | 3300009177 | Bacteria | 2760 |
| 314 | Ga0105248_10173538 | 3300009177 | Bacteria | 2430 |
| 315 | Ga0105248_10321725 | 3300009177 | Bacteria | 1742 |
| 316 | Ga0105248_11460021 | 3300009177 | Bacteria | 774 |
| 317 | Ga0105237_10018195 | 3300009545 | Bacteria | 7273 |
| 318 | Ga0105237_10152202 | 3300009545 | Bacteria | 2310 |
| 319 | Ga0105237_10253444 | 3300009545 | Bacteria | 1762 |
| 320 | Ga0105237_10307107 | 3300009545 | Bacteria | 1589 |
| 321 | Ga0105238_10076515 | 3300009551 | Bacteria | 3338 |
| 322 | Ga0105238_10408632 | 3300009551 | Bacteria | 1351 |
| 323 | Ga0105249_10481359 | 3300009553 | Bacteria | 1284 |
| 324 | Ga0099796_10487772 | 3300010159 | Bacteria | 551 |
| 325 | Ga0105239_10034914 | 3300010375 | Bacteria | 5523 |
| 326 | Ga0105239_10492590 | 3300010375 | Bacteria | 1393 |
| 327 | Ga0105239_10495806 | 3300010375 | Bacteria | 1388 |
| 328 | Ga0105239_10605911 | 3300010375 | Bacteria | 1249 |
| 329 | Ga0105246_10054492 | 3300011119 | Bacteria | 2756 |
| 330 | Ga0157324_1029955 | 3300012506 | Bacteria | 610 |
| 331 | Ga0157373_10432858 | 3300013100 | Bacteria | 945 |
| 332 | Ga0157373_10686181 | 3300013100 | Bacteria | 750 |
| 333 | Ga0157371_10118360 | 3300013102 | Bacteria | 1883 |
| 334 | Ga0157370_10102175 | 3300013104 | Bacteria | 2685 |
| 335 | Ga0157370_10148122 | 3300013104 | Bacteria | 2185 |
| 336 | Ga0157370_10308010 | 3300013104 | Bacteria | 1462 |
| 337 | Ga0157369_10352269 | 3300013105 | Bacteria | 1529 |
| 338 | Ga0157369_10505965 | 3300013105 | Bacteria | 1250 |
| 339 | Ga0157374_10035585 | 3300013296 | Bacteria | 4556 |
| 340 | Ga0157374_10078384 | 3300013296 | Bacteria | 3129 |
| 341 | Ga0157374_10227604 | 3300013296 | Bacteria | 1831 |
| 342 | Ga0157374_10296005 | 3300013296 | Bacteria | 1600 |
| 343 | Ga0157378_10190217 | 3300013297 | Bacteria | 1935 |
| 344 | Ga0157378_11072788 | 3300013297 | Bacteria | 842 |
| 345 | Ga0157378_12753114 | 3300013297 | Bacteria | 544 |
| 346 | Ga0163162_10004467 | 3300013306 | Bacteria | 13476 |
| 347 | Ga0163162_10920246 | 3300013306 | Bacteria | 987 |
| 348 | Ga0163162_11058169 | 3300013306 | Bacteria | 918 |
| 349 | Ga0163162_11179515 | 3300013306 | Bacteria | 869 |
| 350 | Ga0157372_10615787 | 3300013307 | Bacteria | 1265 |
| 351 | Ga0157372_11934594 | 3300013307 | Bacteria | 678 |
| 352 | Ga0157375_10001941 | 3300013308 | Bacteria | 17817 |
| 353 | Ga0157375_10003497 | 3300013308 | Bacteria | 13616 |
| 354 | Ga0157375_10453168 | 3300013308 | Bacteria | 1448 |
| 355 | Ga0163163_10142007 | 3300014325 | Bacteria | 2444 |
| 356 | Ga0163163_10259377 | 3300014325 | Bacteria | 1789 |
| 357 | Ga0163163_12388977 | 3300014325 | Bacteria | 587 |
| 358 | Ga0163163_13186746 | 3300014325 | Bacteria | 512 |
| 359 | Ga0157380_10001564 | 3300014326 | Bacteria | 15067 |
| 360 | Ga0157380_10531573 | 3300014326 | Bacteria | 1149 |
| 361 | Ga0157380_11399788 | 3300014326 | Bacteria | 750 |
| 362 | Ga0157377_10000010 | 3300014745 | Bacteria | 380929 |
| 363 | Ga0157377_10011551 | 3300014745 | Bacteria | 4413 |
| 364 | Ga0157377_11288283 | 3300014745 | Bacteria | 571 |
| 365 | Ga0157379_10004770 | 3300014968 | Bacteria | 11650 |
| 366 | Ga0157379_10010571 | 3300014968 | Bacteria | 8048 |
| 367 | Ga0157379_10024408 | 3300014968 | Bacteria | 5368 |
| 368 | Ga0157379_10047949 | 3300014968 | Bacteria | 3813 |
| 369 | Ga0157379_10504571 | 3300014968 | Bacteria | 1122 |
| 370 | Ga0157379_10999508 | 3300014968 | Bacteria | 797 |
| 371 | Ga0157379_11201137 | 3300014968 | Bacteria | 729 |
| 372 | Ga0157379_11579548 | 3300014968 | Bacteria | 640 |
| 373 | Ga0157376_10260162 | 3300014969 | Bacteria | 1625 |
| 374 | Ga0157376_10294489 | 3300014969 | Bacteria | 1534 |
| 375 | Ga0157376_11074029 | 3300014969 | Bacteria | 830 |
| 376 | Ga0157376_11208231 | 3300014969 | Bacteria | 784 |
| 377 | Ga0163161_10145390 | 3300017792 | Bacteria | 1798 |
| 378 | Ga0206354_11215456 | 3300020081 | Bacteria | 511 |
| 379 | Ga0213872_10000034 | 3300021361 | Bacteria | 133158 |
| 380 | Ga0207425_1000807 | 3300025245 | Bacteria | 15838 |
| 381 | Ga0207425_1071545 | 3300025245 | Bacteria | 593 |
| 382 | Ga0209129_1000038 | 3300025258 | Bacteria | 322778 |
| 383 | Ga0209673_1017657 | 3300025273 | Bacteria | 2624 |
| 384 | Ga0209564_1000129 | 3300025295 | Bacteria | 195163 |
| 385 | Ga0209758_1000177 | 3300025297 | Bacteria | 142824 |
| 386 | Ga0209758_1000197 | 3300025297 | Bacteria | 133706 |
| 387 | Ga0209050_1001630 | 3300025298 | Bacteria | 23020 |
| 388 | Ga0209050_1002016 | 3300025298 | Bacteria | 18929 |
| 389 | Ga0209050_1013067 | 3300025298 | Bacteria | 3738 |
| 390 | Ga0209256_1026046 | 3300025299 | Bacteria | 1692 |
| 391 | Ga0209256_1044894 | 3300025299 | Bacteria | 1101 |
| 392 | Ga0209051_1003663 | 3300025303 | Bacteria | 9942 |
| 393 | Ga0209051_1011255 | 3300025303 | Bacteria | 4435 |
| 394 | Ga0209257_1000049 | 3300025304 | Bacteria | 441224 |
| 395 | Ga0209257_1015569 | 3300025304 | Bacteria | 3154 |
| 396 | Ga0207697_10036312 | 3300025315 | Bacteria | 2017 |
| 397 | Ga0207697_10110271 | 3300025315 | Bacteria | 1178 |
| 398 | Ga0207656_10091976 | 3300025321 | Bacteria | 1378 |
| 399 | Ga0207682_10013198 | 3300025893 | Bacteria | 3221 |
| 400 | Ga0207682_10024588 | 3300025893 | Bacteria | 2386 |
| 401 | Ga0207682_10058677 | 3300025893 | Bacteria | 1607 |
| 402 | Ga0207682_10130831 | 3300025893 | Bacteria | 1120 |
| 403 | Ga0207642_10001813 | 3300025899 | Bacteria | 6604 |
| 404 | Ga0207710_10181729 | 3300025900 | Bacteria | 1032 |
| 405 | Ga0207680_10004093 | 3300025903 | Bacteria | 6894 |
| 406 | Ga0207680_10771515 | 3300025903 | Bacteria | 689 |
| 407 | Ga0207699_10790676 | 3300025906 | Bacteria | 697 |
| 408 | Ga0207645_10000870 | 3300025907 | Bacteria | 25116 |
| 409 | Ga0207645_10002088 | 3300025907 | Bacteria | 15984 |
| 410 | Ga0207645_10168255 | 3300025907 | Bacteria | 1435 |
| 411 | Ga0207643_10029590 | 3300025908 | Bacteria | 3046 |
| 412 | Ga0207643_10062086 | 3300025908 | Bacteria | 2135 |
| 413 | Ga0207705_10616837 | 3300025909 | Bacteria | 843 |
| 414 | Ga0207654_10184614 | 3300025911 | Bacteria | 1363 |
| 415 | Ga0207707_10031988 | 3300025912 | Bacteria | 4606 |
| 416 | Ga0207707_10032477 | 3300025912 | Bacteria | 4569 |
| 417 | Ga0207707_11231887 | 3300025912 | Bacteria | 604 |
| 418 | Ga0207671_10017616 | 3300025914 | Bacteria | 5500 |
| 419 | Ga0207660_10004466 | 3300025917 | Bacteria | 9121 |
| 420 | Ga0207662_10338305 | 3300025918 | Bacteria | 1008 |
| 421 | Ga0207662_10515370 | 3300025918 | Bacteria | 825 |
| 422 | Ga0207662_10575494 | 3300025918 | Bacteria | 782 |
| 423 | Ga0207657_10113522 | 3300025919 | Bacteria | 2235 |
| 424 | Ga0207657_10177437 | 3300025919 | Bacteria | 1723 |
| 425 | Ga0207649_10046929 | 3300025920 | Bacteria | 2656 |
| 426 | Ga0207652_10013046 | 3300025921 | Bacteria | 6725 |
| 427 | Ga0207652_10067476 | 3300025921 | Bacteria | 3102 |
| 428 | Ga0207652_10671784 | 3300025921 | Bacteria | 926 |
| 429 | Ga0207652_10873248 | 3300025921 | Bacteria | 796 |
| 430 | Ga0207681_10000967 | 3300025923 | Bacteria | 18742 |
| 431 | Ga0207681_10830657 | 3300025923 | Bacteria | 772 |
| 432 | Ga0207694_10196753 | 3300025924 | Bacteria | 1639 |
| 433 | Ga0207650_10009880 | 3300025925 | Bacteria | 6527 |
| 434 | Ga0207650_10014689 | 3300025925 | Bacteria | 5441 |
| 435 | Ga0207650_10554415 | 3300025925 | Bacteria | 964 |
| 436 | Ga0207650_10777031 | 3300025925 | Bacteria | 811 |
| 437 | Ga0207659_10282424 | 3300025926 | Bacteria | 1358 |
| 438 | Ga0207659_10383587 | 3300025926 | Bacteria | 1172 |
| 439 | Ga0207659_10547711 | 3300025926 | Bacteria | 983 |
| 440 | Ga0207659_10578344 | 3300025926 | Bacteria | 956 |
| 441 | Ga0207659_10824796 | 3300025926 | Bacteria | 797 |
| 442 | Ga0207687_10240542 | 3300025927 | Bacteria | 1434 |
| 443 | Ga0207687_10315089 | 3300025927 | Bacteria | 1264 |
| 444 | Ga0207687_10900063 | 3300025927 | Bacteria | 757 |
| 445 | Ga0207644_10000278 | 3300025931 | Bacteria | 33992 |
| 446 | Ga0207644_10022498 | 3300025931 | Bacteria | 4307 |
| 447 | Ga0207644_10109251 | 3300025931 | Bacteria | 2089 |
| 448 | Ga0207644_10710444 | 3300025931 | Bacteria | 838 |
| 449 | Ga0207690_10270139 | 3300025932 | Bacteria | 1321 |
| 450 | Ga0207706_10011095 | 3300025933 | Bacteria | 8213 |
| 451 | Ga0207706_10013502 | 3300025933 | Bacteria | 7423 |
| 452 | Ga0207706_10038294 | 3300025933 | Bacteria | 4254 |
| 453 | Ga0207706_10224079 | 3300025933 | Bacteria | 1646 |
| 454 | Ga0207706_10384106 | 3300025933 | Bacteria | 1218 |
| 455 | Ga0207686_10019438 | 3300025934 | Bacteria | 3864 |
| 456 | Ga0207709_10004574 | 3300025935 | Bacteria | 7964 |
| 457 | Ga0207709_10092825 | 3300025935 | Bacteria | 1977 |
| 458 | Ga0207709_10159618 | 3300025935 | Bacteria | 1571 |
| 459 | Ga0207670_11424459 | 3300025936 | Bacteria | 588 |
| 460 | Ga0207669_10002687 | 3300025937 | Bacteria | 7606 |
| 461 | Ga0207669_10109216 | 3300025937 | Bacteria | 1849 |
| 462 | Ga0207669_10252024 | 3300025937 | Bacteria | 1315 |
| 463 | Ga0207704_10321742 | 3300025938 | Bacteria | 1193 |
| 464 | Ga0207704_10470665 | 3300025938 | Bacteria | 1007 |
| 465 | Ga0207691_10006361 | 3300025940 | Bacteria | 11410 |
| 466 | Ga0207691_10017845 | 3300025940 | Bacteria | 6724 |
| 467 | Ga0207691_10041139 | 3300025940 | Bacteria | 4269 |
| 468 | Ga0207691_10062163 | 3300025940 | Bacteria | 3390 |
| 469 | Ga0207691_10106912 | 3300025940 | Bacteria | 2491 |
| 470 | Ga0207691_10714400 | 3300025940 | Bacteria | 845 |
| 471 | Ga0207711_10019406 | 3300025941 | Bacteria | 5661 |
| 472 | Ga0207711_10038028 | 3300025941 | Bacteria | 4091 |
| 473 | Ga0207711_10055496 | 3300025941 | Bacteria | 3401 |
| 474 | Ga0207711_10100159 | 3300025941 | Bacteria | 2562 |
| 475 | Ga0207711_10895220 | 3300025941 | Bacteria | 825 |
| 476 | Ga0207689_10008584 | 3300025942 | Bacteria | 8902 |
| 477 | Ga0207689_10151885 | 3300025942 | Bacteria | 1909 |
| 478 | Ga0207661_11785985 | 3300025944 | Bacteria | 560 |
| 479 | Ga0207661_11814878 | 3300025944 | Bacteria | 555 |
| 480 | Ga0207679_10421429 | 3300025945 | Bacteria | 1178 |
| 481 | Ga0207679_10428307 | 3300025945 | Bacteria | 1169 |
| 482 | Ga0207667_10033716 | 3300025949 | Bacteria | 5503 |
| 483 | Ga0207667_10086275 | 3300025949 | Bacteria | 3248 |
| 484 | Ga0207651_10270837 | 3300025960 | Bacteria | 1398 |
| 485 | Ga0207651_10323459 | 3300025960 | Bacteria | 1290 |
| 486 | Ga0207651_10899738 | 3300025960 | Bacteria | 788 |
| 487 | Ga0207651_10996878 | 3300025960 | Bacteria | 748 |
| 488 | Ga0207712_10321904 | 3300025961 | Bacteria | 1276 |
| 489 | Ga0207712_10449324 | 3300025961 | Bacteria | 1093 |
| 490 | Ga0207668_10047628 | 3300025972 | Bacteria | 2936 |
| 491 | Ga0207668_10536402 | 3300025972 | Bacteria | 1012 |
| 492 | Ga0207640_10861141 | 3300025981 | Bacteria | 789 |
| 493 | Ga0207640_11553041 | 3300025981 | Bacteria | 596 |
| 494 | Ga0207658_10002231 | 3300025986 | Bacteria | 14379 |
| 495 | Ga0207658_10002288 | 3300025986 | Bacteria | 14152 |
| 496 | Ga0207658_10068991 | 3300025986 | Bacteria | 2670 |
| 497 | Ga0207658_10803205 | 3300025986 | Bacteria | 854 |
| 498 | Ga0207658_11018975 | 3300025986 | Bacteria | 755 |
| 499 | Ga0207677_10087009 | 3300026023 | Bacteria | 2261 |
| 500 | Ga0207677_10111697 | 3300026023 | Bacteria | 2037 |
| 501 | Ga0207677_10593827 | 3300026023 | Bacteria | 971 |
| 502 | Ga0207677_11509366 | 3300026023 | Bacteria | 621 |
| 503 | Ga0207677_11992603 | 3300026023 | Bacteria | 540 |
| 504 | Ga0207703_10012466 | 3300026035 | Bacteria | 6628 |
| 505 | Ga0207639_10100380 | 3300026041 | Bacteria | 2338 |
| 506 | Ga0207639_11239149 | 3300026041 | Bacteria | 700 |
| 507 | Ga0207639_11629304 | 3300026041 | Bacteria | 605 |
| 508 | Ga0207708_10091222 | 3300026075 | Bacteria | 2349 |
| 509 | Ga0207708_10416819 | 3300026075 | Bacteria | 1113 |
| 510 | Ga0207708_10422056 | 3300026075 | Bacteria | 1106 |
| 511 | Ga0207702_10097785 | 3300026078 | Bacteria | 2584 |
| 512 | Ga0207702_10301584 | 3300026078 | Bacteria | 1520 |
| 513 | Ga0207641_10006486 | 3300026088 | Bacteria | 9852 |
| 514 | Ga0207641_10157257 | 3300026088 | Bacteria | 2063 |
| 515 | Ga0207641_11297837 | 3300026088 | Bacteria | 728 |
| 516 | Ga0207648_10000002 | 3300026089 | Bacteria | 307909 |
| 517 | Ga0207648_10003517 | 3300026089 | Bacteria | 16406 |
| 518 | Ga0207648_10022364 | 3300026089 | Bacteria | 5681 |
| 519 | Ga0207648_10943619 | 3300026089 | Bacteria | 807 |
| 520 | Ga0207648_11564530 | 3300026089 | Bacteria | 620 |
| 521 | Ga0207676_10027632 | 3300026095 | Bacteria | 4228 |
| 522 | Ga0207676_10129451 | 3300026095 | Bacteria | 2143 |
| 523 | Ga0207676_10201663 | 3300026095 | Bacteria | 1758 |
| 524 | Ga0207676_11515846 | 3300026095 | Bacteria | 667 |
| 525 | Ga0207674_10009884 | 3300026116 | Bacteria | 10854 |
| 526 | Ga0207674_10047774 | 3300026116 | Bacteria | 4385 |
| 527 | Ga0207674_10427372 | 3300026116 | Bacteria | 1280 |
| 528 | Ga0207675_100001416 | 3300026118 | Bacteria | 24021 |
| 529 | Ga0207675_101137454 | 3300026118 | Bacteria | 801 |
| 530 | Ga0207683_10009129 | 3300026121 | Bacteria | 8451 |
| 531 | Ga0207683_10016135 | 3300026121 | Bacteria | 6357 |
| 532 | Ga0207683_10105127 | 3300026121 | Bacteria | 2524 |
| 533 | Ga0207683_10545982 | 3300026121 | Bacteria | 1071 |
| 534 | Ga0207683_10798456 | 3300026121 | Bacteria | 876 |
| 535 | Ga0207683_10937691 | 3300026121 | Bacteria | 804 |
| 536 | Ga0207698_10127571 | 3300026142 | Bacteria | 2167 |
| 537 | Ga0207698_10441685 | 3300026142 | Bacteria | 1253 |
| 538 | Ga0209969_1002240 | 3300027360 | Bacteria | 2667 |
| 539 | Ga0209967_1004872 | 3300027364 | Bacteria | 1794 |
| 540 | Ga0209981_1003673 | 3300027378 | Bacteria | 1995 |
| 541 | Ga0209996_1019517 | 3300027395 | Bacteria | 947 |
| 542 | Ga0210000_1001764 | 3300027462 | Bacteria | 3061 |
| 543 | Ga0209995_1002050 | 3300027471 | Bacteria | 3163 |
| 544 | Ga0209968_1003838 | 3300027526 | Bacteria | 2255 |
| 545 | Ga0209999_1001732 | 3300027543 | Bacteria | 3782 |
| 546 | Ga0209970_1022078 | 3300027614 | Bacteria | 1079 |
| 547 | Ga0209983_1036827 | 3300027665 | Bacteria | 1053 |
| 548 | Ga0209971_1021982 | 3300027682 | Bacteria | 1519 |
| 549 | Ga0209966_1045950 | 3300027695 | Bacteria | 921 |
| 550 | Ga0209974_10007325 | 3300027876 | Bacteria | 3803 |
| 551 | Ga0207428_10159956 | 3300027907 | Bacteria | 1710 |
| 552 | Ga0268265_10007737 | 3300028380 | Bacteria | 7253 |
| 553 | Ga0268264_10004913 | 3300028381 | Bacteria | 11330 |
| 554 | Ga0268264_10099285 | 3300028381 | Bacteria | 2526 |
| 555 | Ga0268264_11401834 | 3300028381 | Bacteria | 709 |
| 556 | Ga0307517_10008069 | 3300028786 | Bacteria | 15177 |
| 557 | Ga0307517_10087798 | 3300028786 | Bacteria | 2579 |
| 558 | Ga0307517_10153995 | 3300028786 | Bacteria | 1567 |
| 559 | Ga0307517_10457924 | 3300028786 | Bacteria | 659 |
| 560 | Ga0307515_10000179 | 3300028794 | Bacteria | 156716 |
| 561 | Ga0307515_10000586 | 3300028794 | Bacteria | 85517 |
| 562 | Ga0307515_10000873 | 3300028794 | Bacteria | 69237 |
| 563 | Ga0307515_10236777 | 3300028794 | Bacteria | 1605 |
| 564 | Ga0307515_10239345 | 3300028794 | Bacteria | 1589 |
| 565 | Ga0265324_10224448 | 3300029957 | Bacteria | 638 |
| 566 | Ga0307512_10066557 | 3300030522 | Bacteria | 2721 |
| 567 | Ga0307513_10032823 | 3300031456 | Bacteria | 5847 |
| 568 | Ga0307513_10074607 | 3300031456 | Bacteria | 3526 |
| 569 | Ga0307513_10236611 | 3300031456 | Bacteria | 1635 |
| 570 | Ga0307513_10434627 | 3300031456 | Bacteria | 1040 |
| 571 | Ga0307513_10962798 | 3300031456 | Bacteria | 562 |
| 572 | Ga0307509_10052253 | 3300031507 | Bacteria | 4363 |
| 573 | Ga0307509_10240890 | 3300031507 | Bacteria | 1601 |
| 574 | Ga0307509_10297731 | 3300031507 | Bacteria | 1363 |
| 575 | Ga0307509_10705268 | 3300031507 | Bacteria | 675 |
| 576 | Ga0307408_100053233 | 3300031548 | Bacteria | 2922 |
| 577 | Ga0307408_100133327 | 3300031548 | Bacteria | 1940 |
| 578 | Ga0307408_100305013 | 3300031548 | Bacteria | 1335 |
| 579 | Ga0307408_100314965 | 3300031548 | Bacteria | 1316 |
| 580 | Ga0307508_10000122 | 3300031616 | Bacteria | 92612 |
| 581 | Ga0307508_10000222 | 3300031616 | Bacteria | 69029 |
| 582 | Ga0307508_10016751 | 3300031616 | Bacteria | 6668 |
| 583 | Ga0307508_10026831 | 3300031616 | Bacteria | 5219 |
| 584 | Ga0307508_10058972 | 3300031616 | Bacteria | 3395 |
| 585 | Ga0307508_10114356 | 3300031616 | Bacteria | 2299 |
| 586 | Ga0307508_10453277 | 3300031616 | Bacteria | 875 |
| 587 | Ga0307514_10272910 | 3300031649 | Bacteria | 977 |
| 588 | Ga0307516_10000662 | 3300031730 | Bacteria | 46543 |
| 589 | Ga0307516_10029866 | 3300031730 | Bacteria | 5507 |
| 590 | Ga0307516_10111433 | 3300031730 | Bacteria | 2538 |
| 591 | Ga0307516_10371420 | 3300031730 | Bacteria | 1093 |
| 592 | Ga0307405_10018973 | 3300031731 | Bacteria | 3809 |
| 593 | Ga0307405_10126957 | 3300031731 | Bacteria | 1755 |
| 594 | Ga0307406_10136632 | 3300031901 | Bacteria | 1729 |
| 595 | Ga0307412_10017084 | 3300031911 | Bacteria | 4338 |
| 596 | Ga0307412_10046588 | 3300031911 | Bacteria | 2841 |
| 597 | Ga0307412_10735366 | 3300031911 | Bacteria | 850 |
| 598 | Ga0307412_10768831 | 3300031911 | Bacteria | 833 |
| 599 | Ga0307409_100004643 | 3300031995 | Bacteria | 7762 |
| 600 | Ga0307416_100018756 | 3300032002 | Bacteria | 4884 |
| 601 | Ga0307416_100056724 | 3300032002 | Bacteria | 3163 |
| 602 | Ga0307414_10048754 | 3300032004 | Bacteria | 2924 |
| 603 | Ga0307414_10563759 | 3300032004 | Bacteria | 1017 |
| 604 | Ga0307414_11108514 | 3300032004 | Bacteria | 731 |
| 605 | Ga0307411_10000112 | 3300032005 | Bacteria | 25459 |
| 606 | Ga0307411_10021299 | 3300032005 | Bacteria | 3790 |
| 607 | Ga0307411_10619137 | 3300032005 | Bacteria | 933 |
| 608 | Ga0307411_11520526 | 3300032005 | Bacteria | 616 |
| 609 | Ga0307415_100001031 | 3300032126 | Bacteria | 12888 |
| 610 | Ga0307507_10069984 | 3300033179 | Bacteria | 3187 |
| 611 | Ga0307507_10231018 | 3300033179 | Bacteria | 1226 |
| 612 | Ga0307507_10292572 | 3300033179 | Bacteria | 1006 |
| 613 | Ga0307507_10516061 | 3300033179 | Bacteria | 639 |
| 614 | Ga0307510_10178973 | 3300033180 | Bacteria | 1686 |
| 615 | Ga0373951_0007298 | 3300035091 | Bacteria | 2515 |
| 616 | Ga0373923_0071975 | 3300035111 | Bacteria | 1486 |
| 617 | Ga0373936_0337503 | 3300035113 | Bacteria | 685 |
| 618 | Ga0373939_0000031 | 3300035114 | Bacteria | 50064 |
| 619 | Ga0373945_0008025 | 3300035116 | Bacteria | 3429 |
| 620 | Ga0373953_0081213 | 3300035117 | Bacteria | 1348 |
| 621 | Ga0373960_0009104 | 3300035121 | Bacteria | 2397 |
| 622 | Ga0373943_0173390 | 3300035170 | Bacteria | 1181 |
| 623 | Ga0373955_0112668 | 3300035172 | Bacteria | 1574 |
| 624 | Ga0373955_0522590 | 3300035172 | Bacteria | 725 |
| 625 | Ga0373931_0001294 | 3300035691 | Bacteria | 10706 |
| 626 | Ga0373927_0261288 | 3300035695 | Bacteria | 1139 |
| 627 | Ga0373927_0559429 | 3300035695 | Bacteria | 756 |
| 628 | Ga0373933_0295583 | 3300035724 | Bacteria | 1048 |
| 629 | Ga0373947_0020189 | 3300035725 | Bacteria | 3845 |
| 630 | Ga0373937_0026003 | 3300036401 | Bacteria | 5287 |
| 631 | Ga0373937_0081817 | 3300036401 | Bacteria | 2987 |
| 632 | Ga0373925_0033167 | 3300037068 | Bacteria | 3806 |
| 633 | Ga0373925_0189829 | 3300037068 | Bacteria | 1630 |
| 634 | Ga0373925_0806431 | 3300037068 | Bacteria | 774 |
| 635 | Ga0373925_1276151 | 3300037068 | Bacteria | 603 |
| 636 | Ga0395905_0002410 | 3300037471 | Bacteria | 20775 |
| 637 | Ga0395905_0279462 | 3300037471 | Bacteria | 1556 |
| 638 | Ga0395905_0858837 | 3300037471 | Bacteria | 810 |
| 639 | Ga0436365_1108553 | 3300039437 | Bacteria | 1141 |
| 640 | Ga0436361_0436689 | 3300039447 | Bacteria | 47478 |
| 641 | Ga0439436_0000149 | 3300041404 | Bacteria | 16201 |
| 642 | Ga0439439_0003522 | 3300041406 | Bacteria | 3459 |
| 643 | Ga0439439_0012659 | 3300041406 | Bacteria | 2042 |
| 644 | Ga0439447_008609 | 3300041407 | Bacteria | 3151 |
| 645 | Ga0439447_071367 | 3300041407 | Bacteria | 807 |
| 646 | Ga0439461_0008282 | 3300041410 | Bacteria | 1859 |
| 647 | Ga0439461_0037843 | 3300041410 | Bacteria | 1032 |
| 648 | Ga0439461_0063307 | 3300041410 | Bacteria | 844 |
| 649 | Ga0439466_0003514 | 3300041411 | Bacteria | 6064 |
| 650 | Ga0439466_0014241 | 3300041411 | Bacteria | 2899 |
| 651 | Ga0439465_0013878 | 3300041413 | Bacteria | 2508 |
| 652 | Ga0451787_469218 | 3300041441 | Bacteria | 574 |
| 653 | Ga0451789_0443499 | 3300041443 | Bacteria | 858 |
| 654 | Ga0451789_1004478 | 3300041443 | Bacteria | 2758 |
| 655 | Ga0451791_1774605 | 3300041451 | Bacteria | 671 |
| 656 | Ga0451795_0417844 | 3300041456 | Bacteria | 4270 |
| 657 | Ga0451795_0723237 | 3300041456 | Bacteria | 1869 |
| 658 | Ga0451798_0109225 | 3300041458 | Bacteria | 2347 |
| 659 | Ga0451800_0129709 | 3300041459 | Bacteria | 534 |
| 660 | Ga0451800_1183513 | 3300041459 | Bacteria | 584 |
| 661 | Ga0451800_1257440 | 3300041459 | Bacteria | 1442 |
| 662 | Ga0451802_0213386 | 3300041460 | Bacteria | 1374 |
| 663 | Ga0451802_0459691 | 3300041460 | Bacteria | 1157 |
| 664 | Ga0451802_0491871 | 3300041460 | Bacteria | 1328 |
| 665 | Ga0451802_1483943 | 3300041460 | Bacteria | 813 |
| 666 | Ga0451804_0920644 | 3300041463 | Bacteria | 2287 |
| 667 | Ga0451804_1039343 | 3300041463 | Bacteria | 775 |
| 668 | Ga0451807_0588167 | 3300041486 | Bacteria | 1019 |
| 669 | Ga0451833_0412951 | 3300041491 | Bacteria | 858 |
| 670 | Ga0451835_0304909 | 3300041492 | Bacteria | 557 |
| 671 | Ga0451839_0471582 | 3300041496 | Bacteria | 1025 |
| 672 | Ga0451839_1533245 | 3300041496 | Bacteria | 1009 |
| 673 | Ga0451841_1424262 | 3300041498 | Bacteria | 540 |
| 674 | Ga0451849_0264779 | 3300041505 | Bacteria | 787 |
| 675 | Ga0451849_1033926 | 3300041505 | Bacteria | 2421 |
| 676 | Ga0451851_0873834 | 3300041507 | Bacteria | 960 |
| 677 | Ga0451843_0009642 | 3300041509 | Bacteria | 2024 |
| 678 | Ga0451843_1553242 | 3300041509 | Bacteria | 792 |
| 679 | Ga0451853_2066207 | 3300041512 | Bacteria | 1442 |
| 680 | Ga0451853_2123395 | 3300041512 | Bacteria | 609 |
| 681 | Ga0439431_0005212 | 3300041997 | Bacteria | 2864 |
| 682 | Ga0439431_0022000 | 3300041997 | Bacteria | 1534 |
| 683 | Ga0439433_0000311 | 3300041999 | Bacteria | 8445 |
| 684 | Ga0439433_0005036 | 3300041999 | Bacteria | 2834 |
| 685 | Ga0439437_000343 | 3300042000 | Bacteria | 4411 |
| 686 | Ga0439442_001752 | 3300042002 | Bacteria | 4248 |
| 687 | Ga0439445_0088537 | 3300042004 | Bacteria | 870 |
| 688 | Ga0439432_000358 | 3300042006 | Bacteria | 16718 |
| 689 | Ga0439432_011446 | 3300042006 | Bacteria | 3058 |
| 690 | Ga0439449_0000747 | 3300042007 | Bacteria | 12487 |
| 691 | Ga0439449_0002278 | 3300042007 | Bacteria | 7532 |
| 692 | Ga0439449_0003803 | 3300042007 | Bacteria | 5841 |
| 693 | Ga0439452_001926 | 3300042010 | Bacteria | 7955 |
| 694 | Ga0439452_023649 | 3300042010 | Bacteria | 1579 |
| 695 | Ga0439457_008390 | 3300042014 | Bacteria | 2439 |
| 696 | Ga0439457_058945 | 3300042014 | Bacteria | 868 |
| 697 | Ga0439462_0026016 | 3300042015 | Bacteria | 1541 |
| 698 | Ga0439462_0064016 | 3300042015 | Bacteria | 995 |
| 699 | Ga0450911_025166 | 3300042115 | Bacteria | 772 |
| 700 | Ga0450917_000047 | 3300042120 | Bacteria | 6242 |
| 701 | Ga0450923_005313 | 3300042125 | Bacteria | 2072 |
| 702 | Ga0450888_000072 | 3300042126 | Bacteria | 7693 |
| 703 | Ga0450890_002329 | 3300042127 | Bacteria | 2625 |
| 704 | Ga0450897_010218 | 3300042128 | Bacteria | 899 |
| 705 | Ga0450891_000672 | 3300042129 | Bacteria | 3570 |
| 706 | Ga0450892_001742 | 3300042130 | Bacteria | 1995 |
| 707 | Ga0450894_006623 | 3300042131 | Bacteria | 1493 |
| 708 | Ga0450896_007651 | 3300042133 | Bacteria | 1490 |
| 709 | Ga0450899_002990 | 3300042135 | Bacteria | 1821 |
| 710 | Ga0450903_008057 | 3300042138 | Bacteria | 1726 |
| 711 | Ga0450904_018185 | 3300042139 | Bacteria | 707 |
| 712 | Ga0450889_000337 | 3300042144 | Bacteria | 5220 |
| 713 | Ga0450906_020888 | 3300042145 | Bacteria | 1170 |
| 714 | Ga0439446_0017646 | 3300042156 | Bacteria | 1996 |
| 715 | Ga0439446_0293705 | 3300042156 | Bacteria | 569 |
| 716 | Ga0450908_057455 | 3300042184 | Bacteria | 681 |
| 717 | Ga0450908_079923 | 3300042184 | Bacteria | 586 |
| 718 | Ga0450909_003136 | 3300042185 | Bacteria | 2351 |
| 719 | Ga0439434_0000586 | 3300042435 | Bacteria | 10519 |
| 720 | Ga0439434_0017599 | 3300042435 | Bacteria | 2138 |
| 721 | Ga0439434_0239228 | 3300042435 | Unclassified | 619 |
| 722 | Ga0450918_060621 | 3300042531 | Bacteria | 699 |
| 723 | Ga0450893_0001474 | 3300042532 | Bacteria | 3612 |
| 724 | Ga0450893_0003843 | 3300042532 | Bacteria | 2380 |
| 725 | Ga0466965_0086013 | 3300044683 | Bacteria | 1594 |
| 726 | Ga0466966_0008651 | 3300044684 | Bacteria | 6737 |
| 727 | Ga0466961_0099070 | 3300044693 | Bacteria | 1837 |
| 728 | Ga0466964_0026898 | 3300044706 | Bacteria | 2254 |
| 729 | Ga0466970_0008735 | 3300044765 | Bacteria | 5105 |
| 730 | Ga0466960_0087446 | 3300044901 | Bacteria | 1582 |
| 731 | Ga0466959_0488788 | 3300045049 | Bacteria | 832 |
| 732 | Ga0451576_0294932 | 3300045051 | Bacteria | 1695 |
| 733 | Ga0451576_0876413 | 3300045051 | Bacteria | 942 |
| 734 | Ga0495617_268891 | 3300046452 | Bacteria | 523 |
| 735 | Ga0495592_0006561 | 3300046454 | Bacteria | 8670 |
| 736 | Ga0495603_0207942 | 3300046455 | Bacteria | 1130 |
| 737 | Ga0495603_0598063 | 3300046455 | Bacteria | 631 |
| 738 | Ga0495590_0066222 | 3300046457 | Bacteria | 1265 |
| 739 | Ga0495590_0124979 | 3300046457 | Bacteria | 923 |
| 740 | Ga0495629_0001758 | 3300046459 | Bacteria | 16997 |
| 741 | Ga0495629_0221240 | 3300046459 | Bacteria | 1306 |
| 742 | Ga0495629_0265655 | 3300046459 | Bacteria | 1179 |
| 743 | Ga0495638_0172203 | 3300046460 | Bacteria | 1241 |
| 744 | Ga0495641_0264922 | 3300046461 | Bacteria | 773 |
| 745 | Ga0495651_0184789 | 3300046462 | Bacteria | 1472 |
| 746 | Ga0495651_0357186 | 3300046462 | Bacteria | 964 |
| 747 | Ga0495653_0208192 | 3300046463 | Bacteria | 1323 |
| 748 | Ga0495650_0002383 | 3300046471 | Bacteria | 15397 |
| 749 | Ga0495580_0070354 | 3300046472 | Bacteria | 2444 |
| 750 | Ga0495580_0360701 | 3300046472 | Bacteria | 984 |
| 751 | Ga0495582_0089087 | 3300046473 | Bacteria | 1719 |
| 752 | Ga0495582_0277524 | 3300046473 | Bacteria | 962 |
| 753 | Ga0495582_0616189 | 3300046473 | Bacteria | 628 |
| 754 | Ga0495582_0732550 | 3300046473 | Bacteria | 572 |
| 755 | Ga0495582_0737772 | 3300046473 | Bacteria | 570 |
| 756 | Ga0495605_0073081 | 3300046474 | Bacteria | 1616 |
| 757 | Ga0495639_0598279 | 3300046475 | Bacteria | 567 |
| 758 | Ga0495662_0012546 | 3300046476 | Bacteria | 4134 |
| 759 | Ga0495662_0052122 | 3300046476 | Bacteria | 1975 |
| 760 | Ga0495584_0429976 | 3300046491 | Bacteria | 671 |
| 761 | Ga0495608_0012778 | 3300046511 | Bacteria | 5826 |
| 762 | Ga0495608_0628951 | 3300046511 | Bacteria | 643 |
| 763 | Ga0495610_0012246 | 3300046512 | Bacteria | 5179 |
| 764 | Ga0495610_0136617 | 3300046512 | Bacteria | 1059 |
| 765 | Ga0495616_0197204 | 3300046513 | Bacteria | 887 |
| 766 | Ga0495618_0727316 | 3300046514 | Bacteria | 582 |
| 767 | Ga0495618_0737504 | 3300046514 | Bacteria | 577 |
| 768 | Ga0495620_0144253 | 3300046515 | Bacteria | 930 |
| 769 | Ga0495620_0204779 | 3300046515 | Bacteria | 758 |
| 770 | Ga0495620_0368431 | 3300046515 | Bacteria | 544 |
| 771 | Ga0495628_0066117 | 3300046516 | Bacteria | 2826 |
| 772 | Ga0495628_0164618 | 3300046516 | Bacteria | 1684 |
| 773 | Ga0495630_0001728 | 3300046517 | Bacteria | 15247 |
| 774 | Ga0495630_0038696 | 3300046517 | Bacteria | 3568 |
| 775 | Ga0495630_0266826 | 3300046517 | Bacteria | 1308 |
| 776 | Ga0495630_0694475 | 3300046517 | Bacteria | 779 |
| 777 | Ga0495631_0138775 | 3300046518 | Bacteria | 1044 |
| 778 | Ga0495632_0017543 | 3300046519 | Bacteria | 3947 |
| 779 | Ga0495632_0076186 | 3300046519 | Bacteria | 1604 |
| 780 | Ga0495632_0099632 | 3300046519 | Bacteria | 1370 |
| 781 | Ga0495643_0041054 | 3300046522 | Bacteria | 2524 |
| 782 | Ga0495648_0204432 | 3300046524 | Bacteria | 986 |
| 783 | Ga0495648_0249714 | 3300046524 | Bacteria | 857 |
| 784 | Ga0495666_0026411 | 3300046526 | Bacteria | 2862 |
| 785 | Ga0495666_0061797 | 3300046526 | Bacteria | 1789 |
| 786 | Ga0495666_0333748 | 3300046526 | Bacteria | 684 |
| 787 | Ga0495666_0496798 | 3300046526 | Bacteria | 545 |
| 788 | Ga0495642_0040146 | 3300046528 | Bacteria | 1900 |
| 789 | Ga0495642_0266434 | 3300046528 | Bacteria | 750 |
| 790 | Ga0495652_0067036 | 3300046529 | Bacteria | 3010 |
| 791 | Ga0495652_0188341 | 3300046529 | Bacteria | 1577 |
| 792 | Ga0495652_0737678 | 3300046529 | Bacteria | 660 |
| 793 | Ga0495654_0059525 | 3300046530 | Bacteria | 1839 |
| 794 | Ga0495640_0005587 | 3300046533 | Bacteria | 9999 |
| 795 | Ga0495640_0012886 | 3300046533 | Bacteria | 6377 |
| 796 | Ga0495586_0011166 | 3300046535 | Bacteria | 4774 |
| 797 | Ga0495586_0063428 | 3300046535 | Bacteria | 2013 |
| 798 | Ga0495587_0056143 | 3300046536 | Bacteria | 2317 |
| 799 | Ga0495587_0448019 | 3300046536 | Bacteria | 715 |
| 800 | Ga0495598_0038050 | 3300046537 | Bacteria | 1391 |
| 801 | Ga0495621_0055952 | 3300046539 | Bacteria | 1421 |
| 802 | Ga0495621_0128326 | 3300046539 | Bacteria | 985 |
| 803 | Ga0495621_0478782 | 3300046539 | Bacteria | 535 |
| 804 | Ga0495597_0049821 | 3300046542 | Bacteria | 1850 |
| 805 | Ga0495597_0074206 | 3300046542 | Bacteria | 1461 |
| 806 | Ga0495645_0000309 | 3300046543 | Bacteria | 35183 |
| 807 | Ga0495645_0088941 | 3300046543 | Bacteria | 2208 |
| 808 | Ga0495622_0458416 | 3300046557 | Bacteria | 546 |
| 809 | Ga0495633_0293281 | 3300046558 | Bacteria | 739 |
| 810 | Ga0495667_0047388 | 3300046559 | Bacteria | 2840 |
| 811 | Ga0495656_0002670 | 3300046615 | Bacteria | 5953 |
| 812 | Ga0495656_0094696 | 3300046615 | Bacteria | 1372 |
| 813 | Ga0495668_0210643 | 3300046616 | Bacteria | 1064 |
| 814 | Ga0495668_0762803 | 3300046616 | Bacteria | 535 |
| 815 | Ga0495634_0010834 | 3300046642 | Bacteria | 6667 |
| 816 | Ga0495634_0123338 | 3300046642 | Bacteria | 1658 |
| 817 | Ga0495634_0612452 | 3300046642 | Bacteria | 631 |
| 818 | Ga0495625_0036918 | 3300046660 | Bacteria | 3587 |
| 819 | Ga0495625_0069555 | 3300046660 | Bacteria | 2473 |
| 820 | Ga0495657_0415615 | 3300046675 | Bacteria | 790 |
| 821 | Ga0495599_0033235 | 3300046678 | Bacteria | 3240 |
| 822 | Ga0495623_0327390 | 3300046679 | Bacteria | 840 |
| 823 | Ga0495646_0022134 | 3300046680 | Bacteria | 4011 |
| 824 | Ga0495647_0012321 | 3300046681 | Bacteria | 2943 |
| 825 | Ga0495647_0055762 | 3300046681 | Bacteria | 1548 |
| 826 | Ga0495647_0374932 | 3300046681 | Bacteria | 651 |
| 827 | Ga0495658_0019833 | 3300046683 | Bacteria | 3515 |
| 828 | Ga0495658_0039204 | 3300046683 | Bacteria | 2628 |
| 829 | Ga0495658_0063173 | 3300046683 | Bacteria | 2130 |
| 830 | Ga0495658_0415223 | 3300046683 | Bacteria | 858 |
| 831 | Ga0495658_0441988 | 3300046683 | Bacteria | 830 |
| 832 | Ga0495658_0526725 | 3300046683 | Bacteria | 756 |
| 833 | Ga0495669_0096688 | 3300046684 | Bacteria | 1368 |
| 834 | Ga0495613_0022406 | 3300046689 | Bacteria | 4708 |
| 835 | Ga0495613_0161628 | 3300046689 | Bacteria | 1593 |
| 836 | Ga0495613_0222595 | 3300046689 | Bacteria | 1324 |
| 837 | Ga0495670_0132057 | 3300046691 | Bacteria | 1302 |
| 838 | Ga0495670_0188188 | 3300046691 | Bacteria | 1091 |
| 839 | Ga0495649_0008009 | 3300046694 | Bacteria | 6386 |
| 840 | Ga0495649_0162861 | 3300046694 | Bacteria | 1169 |
| 841 | Ga0495589_0028340 | 3300046794 | Bacteria | 2827 |
| 842 | Ga0495589_0255838 | 3300046794 | Bacteria | 817 |
| 843 | Ga0495600_0229217 | 3300046809 | Bacteria | 1186 |
| 844 | Ga0495600_0307718 | 3300046809 | Bacteria | 999 |
| 845 | Ga0495581_0001544 | 3300047315 | Bacteria | 12850 |
| 846 | Ga0495581_0279300 | 3300047315 | Bacteria | 976 |
| 847 | Ga0495604_0018716 | 3300047317 | Bacteria | 5547 |
| 848 | Ga0495604_0236559 | 3300047317 | Bacteria | 1251 |
| 849 | Ga0495636_0002229 | 3300047318 | Bacteria | 7441 |
| 850 | Ga0495674_0069160 | 3300047319 | Bacteria | 3054 |
| 851 | Ga0495680_0004705 | 3300047322 | Bacteria | 12987 |
| 852 | Ga0495680_0605395 | 3300047322 | Bacteria | 733 |
| 853 | Ga0495683_0199671 | 3300047323 | Bacteria | 903 |
| 854 | Ga0495687_000330 | 3300047443 | Bacteria | 60838 |
| 855 | Ga0495687_010458 | 3300047443 | Bacteria | 5088 |
| 856 | Ga0495687_015164 | 3300047443 | Bacteria | 3930 |
| 857 | Ga0495687_040493 | 3300047443 | Bacteria | 2052 |
| 858 | Ga0495675_0120522 | 3300047444 | Bacteria | 1634 |
| 859 | Ga0495675_0403243 | 3300047444 | Bacteria | 797 |
| 860 | Ga0495679_037921 | 3300047446 | Bacteria | 1513 |
| 861 | Ga0495673_0312798 | 3300047469 | Bacteria | 561 |
| 862 | Ga0495681_0095694 | 3300047470 | Bacteria | 1305 |
| 863 | Ga0495681_0291429 | 3300047470 | Bacteria | 634 |
| 864 | Ga0495684_0109601 | 3300047471 | Bacteria | 2085 |
| 865 | Ga0495684_0605090 | 3300047471 | Bacteria | 739 |
| 866 | Ga0495686_0162084 | 3300047472 | Bacteria | 1306 |
| 867 | Ga0495686_0201281 | 3300047472 | Bacteria | 1143 |
| 868 | Ga0495593_0065478 | 3300047673 | Bacteria | 1895 |
| 869 | Ga0495593_0182545 | 3300047673 | Bacteria | 1056 |
| 870 | Ga0495593_0280166 | 3300047673 | Bacteria | 834 |
| 871 | Ga0495614_0028296 | 3300048089 | Bacteria | 2415 |
| 872 | Ga0495615_0011601 | 3300048090 | Bacteria | 1796 |
| 873 | Ga0495626_0056643 | 3300048091 | Bacteria | 1794 |
| 874 | Ga0496100_0016608 | 3300048903 | Bacteria | 4327 |
| 875 | Ga0496100_0279692 | 3300048903 | Bacteria | 1244 |
| 876 | Ga0496101_0190107 | 3300048904 | Bacteria | 1584 |
| 877 | Ga0496102_0845522 | 3300048905 | Bacteria | 837 |
| 878 | Ga0496104_0038949 | 3300048907 | Bacteria | 4449 |
| 879 | Ga0496104_0734914 | 3300048907 | Bacteria | 894 |
| 880 | Ga0496106_0294609 | 3300048909 | Bacteria | 1301 |
| 881 | Ga0496107_0145047 | 3300048910 | Bacteria | 1755 |
| 882 | Ga0496107_0790580 | 3300048910 | Bacteria | 695 |
| 883 | Ga0496108_0040663 | 3300048911 | Bacteria | 3878 |
| 884 | Ga0496108_1660631 | 3300048911 | Bacteria | 527 |
| 885 | Ga0496109_0389761 | 3300048912 | Bacteria | 1316 |
| 886 | Ga0496110_0389172 | 3300048913 | Bacteria | 1271 |
| 887 | Ga0496110_1899729 | 3300048913 | Bacteria | 505 |
| 888 | Ga0496111_0218977 | 3300048914 | Bacteria | 1414 |
| 889 | Ga0496111_0947198 | 3300048914 | Bacteria | 619 |
| 890 | Ga0496114_0023648 | 3300048917 | Bacteria | 5015 |
| 891 | Ga0496114_0067421 | 3300048917 | Bacteria | 3002 |
| 892 | Ga0496114_0250949 | 3300048917 | Bacteria | 1557 |
| 893 | Ga0496115_0082785 | 3300048918 | Bacteria | 2615 |
| 894 | Ga0496116_0039170 | 3300048919 | Bacteria | 3280 |
| 895 | Ga0496121_0100190 | 3300048924 | Bacteria | 2237 |
| 896 | Ga0496123_0041868 | 3300048926 | Bacteria | 3169 |
| 897 | Ga0496124_0217019 | 3300048927 | Bacteria | 1442 |
| 898 | Ga0496125_0000313 | 3300048928 | Bacteria | 95423 |
| 899 | Ga0495682_0132834 | 3300049460 | Bacteria | 890 |
| 900 | Ga0501032_0024130 | 3300049569 | Bacteria | 4200 |
| 901 | Ga0501041_0824026 | 3300049577 | Bacteria | 595 |
| 902 | Ga0501042_0945943 | 3300049578 | Bacteria | 628 |
| 903 | Ga0501043_0000024 | 3300049579 | Bacteria | 154045 |
| 904 | Ga0501046_0000173 | 3300049580 | Bacteria | 65571 |
| 905 | Ga0501047_0000051 | 3300049581 | Bacteria | 154281 |
| 906 | Ga0501048_0004089 | 3300049582 | Bacteria | 11111 |
| 907 | Ga0501072_1100069 | 3300049588 | Bacteria | 618 |
| 908 | Ga0501075_0612134 | 3300049591 | Bacteria | 831 |
| 909 | Ga0501077_0183595 | 3300049593 | Bacteria | 1329 |
| 910 | Ga0501206_010989 | 3300049653 | Bacteria | 1218 |
| 911 | Ga0501227_002679 | 3300049665 | Bacteria | 3907 |
| 912 | Ga0501242_076279 | 3300049674 | Bacteria | 532 |
| 913 | Ga0501079_0278594 | 3300049741 | Bacteria | 1308 |
| 914 | Ga0501081_1113446 | 3300049743 | Bacteria | 598 |
| 915 | Ga0501267_000121 | 3300049764 | Bacteria | 5065 |
| 916 | Ga0501044_0825540 | 3300049823 | Bacteria | 805 |
| 917 | Ga0501045_0019498 | 3300049824 | Bacteria | 4836 |
| 918 | nmdc:mga03683_202345_c1 | 3300050489 | Bacteria | 912 |
| 919 | nmdc:mga03683_39851_c1 | 3300050489 | Bacteria | 1924 |
| 920 | nmdc:mga03683_399431_c1 | 3300050489 | Bacteria | 656 |
| 921 | nmdc:mga03683_697026_c1 | 3300050489 | Bacteria | 502 |
| 922 | nmdc:mga03683_91934_c1 | 3300050489 | Bacteria | 1324 |
| 923 | nmdc:mga03n38_146736_c1 | 3300050490 | Bacteria | 1183 |
| 924 | nmdc:mga03n38_30849_c1 | 3300050490 | Bacteria | 2257 |
| 925 | nmdc:mga03n38_882484_c1 | 3300050490 | Bacteria | 525 |
| 926 | nmdc:mga00v17_111671_c1 | 3300050491 | Bacteria | 1734 |
| 927 | nmdc:mga00v17_12372_c1 | 3300050491 | Bacteria | 4707 |
| 928 | nmdc:mga0yw44_233681_c1 | 3300050492 | Bacteria | 1221 |
| 929 | nmdc:mga0yw44_398016_c1 | 3300050492 | Bacteria | 931 |
| 930 | nmdc:mga0k408_1110_c1 | 3300050493 | Bacteria | 14744 |
| 931 | nmdc:mga0k408_204254_c1 | 3300050493 | Bacteria | 1180 |
| 932 | nmdc:mga0k408_23096_c1 | 3300050493 | Bacteria | 3505 |
| 933 | nmdc:mga0k408_241823_c1 | 3300050493 | Bacteria | 1078 |
| 934 | nmdc:mga0k408_28362_c1 | 3300050493 | Bacteria | 3182 |
| 935 | nmdc:mga0k408_288994_c1 | 3300050493 | Bacteria | 979 |
| 936 | nmdc:mga0k408_337776_c1 | 3300050493 | Bacteria | 898 |
| 937 | nmdc:mga0k408_42338_c1 | 3300050493 | Bacteria | 2623 |
| 938 | nmdc:mga0k408_442217_c1 | 3300050493 | Bacteria | 772 |
| 939 | nmdc:mga0k408_7671_c1 | 3300050493 | Bacteria | 5765 |
| 940 | nmdc:mga06z11_182458_c1 | 3300050494 | Bacteria | 1211 |
| 941 | nmdc:mga06z11_44682_c1 | 3300050494 | Bacteria | 2235 |
| 942 | nmdc:mga04h51_107551_c1 | 3300050495 | Bacteria | 1024 |
| 943 | nmdc:mga07m45_130733_c1 | 3300050496 | Bacteria | 1452 |
| 944 | nmdc:mga07m45_14548_c1 | 3300050496 | Bacteria | 4195 |
| 945 | nmdc:mga07m45_311732_c1 | 3300050496 | Bacteria | 915 |
| 946 | nmdc:mga07m45_3282_c1 | 3300050496 | Bacteria | 7782 |
| 947 | nmdc:mga07m45_45272_c1 | 3300050496 | Bacteria | 2470 |
| 948 | nmdc:mga07m45_52835_c1 | 3300050496 | Bacteria | 2295 |
| 949 | nmdc:mga07m45_655472_c1 | 3300050496 | Bacteria | 605 |
| 950 | nmdc:mga07m45_7161_c1 | 3300050496 | Bacteria | 5684 |
| 951 | nmdc:mga07m45_7700_c1 | 3300050496 | Bacteria | 5513 |
| 952 | nmdc:mga07m45_94756_c1 | 3300050496 | Bacteria | 1712 |
| 953 | nmdc:mga09592_241612_c1 | 3300050508 | Bacteria | 1565 |
| 954 | nmdc:mga09592_384058_c1 | 3300050508 | Bacteria | 1214 |
| 955 | nmdc:mga08y16_1106325_c1 | 3300050511 | Bacteria | 767 |
| 956 | nmdc:mga08y16_171167_c1 | 3300050511 | Bacteria | 2256 |
| 957 | nmdc:mga08y16_649380_c1 | 3300050511 | Bacteria | 1059 |
| 958 | nmdc:mga0n895_422388_c1 | 3300050512 | Bacteria | 1347 |
| 959 | nmdc:mga0sz30_245089_c1 | 3300050516 | Bacteria | 798 |
| 960 | nmdc:mga0sz30_535499_c1 | 3300050516 | Bacteria | 528 |
| 961 | Ga0495601_0018194 | 3300053077 | Bacteria | 4274 |
| 962 | Ga0495612_0112261 | 3300053078 | Bacteria | 1168 |
| 963 | Ga0495612_0190400 | 3300053078 | Bacteria | 903 |
| 964 | Ga0495619_0052855 | 3300053085 | Bacteria | 2686 |
| 965 | Ga0495619_0107214 | 3300053085 | Bacteria | 1906 |
| 966 | Ga0500578_0000342 | 3300053086 | Bacteria | 56948 |
| 967 | Ga0500578_0041368 | 3300053086 | Bacteria | 2960 |
| 968 | Ga0500644_0220452 | 3300053088 | Bacteria | 791 |
| 969 | Ga0500646_0037799 | 3300053090 | Bacteria | 1349 |
| 970 | Ga0500583_0075468 | 3300053092 | Bacteria | 1620 |
| 971 | Ga0500583_0347107 | 3300053092 | Bacteria | 720 |
| 972 | Ga0500651_0053252 | 3300053093 | Bacteria | 2537 |
| 973 | Ga0500651_0079073 | 3300053093 | Bacteria | 2039 |
| 974 | Ga0500650_0271161 | 3300053098 | Bacteria | 756 |
| 975 | Ga0500554_131828 | 3300053102 | Bacteria | 844 |
| 976 | Ga0500569_006616 | 3300053109 | Bacteria | 2554 |
| 977 | Ga0500621_223356 | 3300053126 | Bacteria | 651 |
| 978 | Ga0500623_075565 | 3300053127 | Bacteria | 1620 |
| 979 | Ga0500628_003123 | 3300053129 | Bacteria | 2722 |
| 980 | Ga0500628_184997 | 3300053129 | Bacteria | 596 |
| 981 | Ga0500642_0001586 | 3300053130 | Bacteria | 6554 |
| 982 | Ga0500652_005414 | 3300053131 | Bacteria | 4016 |
| 983 | Ga0500658_0015723 | 3300053134 | Bacteria | 2813 |
| 984 | Ga0500568_0090637 | 3300053139 | Bacteria | 1153 |
| 985 | Ga0500577_0039092 | 3300053142 | Bacteria | 1717 |
| 986 | Ga0500604_0013131 | 3300053151 | Bacteria | 2242 |
| 987 | Ga0500604_0193398 | 3300053151 | Bacteria | 699 |
| 988 | Ga0500619_000041 | 3300053154 | Bacteria | 39742 |
| 989 | Ga0500619_100300 | 3300053154 | Bacteria | 982 |
| 990 | Ga0500620_111999 | 3300053155 | Bacteria | 956 |
| 991 | Ga0500622_0000091 | 3300053156 | Bacteria | 93307 |
| 992 | Ga0500622_0152603 | 3300053156 | Bacteria | 1090 |
| 993 | Ga0500627_0202947 | 3300053158 | Bacteria | 888 |
| 994 | Ga0500634_0048186 | 3300053161 | Bacteria | 2299 |
| 995 | Ga0500649_158335 | 3300053722 | Bacteria | 801 |
| 996 | Ga0500584_081850 | 3300053726 | Bacteria | 1379 |
| 997 | Ga0500645_002331 | 3300053730 | Bacteria | 8559 |
| 998 | Ga0500587_002054 | 3300053739 | Bacteria | 2874 |
| 999 | Ga0501084_0421593 | 3300054114 | Bacteria | 1128 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003322 | rootL2_10156776 | rootL2_101567762 | 108 |
| 2 | 3300003323 | rootH1_10054083 | rootH1_100540832 | 108 |
| 3 | 3300005290 | Ga0065712_10223066 | Ga0065712_102230662 | 108 |
| 4 | 3300005293 | Ga0065715_10016577 | Ga0065715_100165772 | 108 |
| 5 | 3300005327 | Ga0070658_10430712 | Ga0070658_104307122 | 108 |
| 6 | 3300005329 | Ga0070683_100120080 | Ga0070683_1001200802 | 108 |
| 7 | 3300005330 | Ga0070690_100001815 | Ga0070690_10000181512 | 108 |
| 8 | 3300005331 | Ga0070670_100361204 | Ga0070670_1003612042 | 108 |
| 9 | 3300005334 | Ga0068869_100141900 | Ga0068869_1001419001 | 108 |
| 10 | 3300005334 | Ga0068869_101030603 | Ga0068869_1010306032 | 108 |
| 11 | 3300005335 | Ga0070666_10099909 | Ga0070666_100999092 | 108 |
| 12 | 3300005337 | Ga0070682_100437029 | Ga0070682_1004370292 | 108 |
| 13 | 3300005339 | Ga0070660_100250043 | Ga0070660_1002500432 | 108 |
| 14 | 3300005340 | Ga0070689_100004554 | Ga0070689_1000045545 | 108 |
| 15 | 3300005341 | Ga0070691_10377207 | Ga0070691_103772072 | 108 |
| 16 | 3300005344 | Ga0070661_100336456 | Ga0070661_1003364562 | 108 |
| 17 | 3300005344 | Ga0070661_101530449 | Ga0070661_1015304492 | 108 |
| 18 | 3300005345 | Ga0070692_10224130 | Ga0070692_102241302 | 108 |
| 19 | 3300005354 | Ga0070675_100389196 | Ga0070675_1003891961 | 108 |
| 20 | 3300005356 | Ga0070674_100024540 | Ga0070674_1000245402 | 108 |
| 21 | 3300005364 | Ga0070673_100043415 | Ga0070673_1000434153 | 108 |
| 22 | 3300005365 | Ga0070688_100159329 | Ga0070688_1001593292 | 108 |
| 23 | 3300005366 | Ga0070659_100041833 | Ga0070659_1000418332 | 108 |
| 24 | 3300005434 | Ga0070709_10088230 | Ga0070709_100882302 | 108 |
| 25 | 3300005437 | Ga0070710_10015522 | Ga0070710_100155222 | 108 |
| 26 | 3300005437 | Ga0070710_10244186 | Ga0070710_102441862 | 108 |
| 27 | 3300005438 | Ga0070701_10571618 | Ga0070701_105716182 | 108 |
| 28 | 3300005439 | Ga0070711_100038205 | Ga0070711_1000382055 | 108 |
| 29 | 3300005440 | Ga0070705_100040034 | Ga0070705_1000400343 | 108 |
| 30 | 3300005444 | Ga0070694_100134098 | Ga0070694_1001340982 | 108 |
| 31 | 3300005445 | Ga0070708_100233431 | Ga0070708_1002334312 | 108 |
| 32 | 3300005456 | Ga0070678_100002439 | Ga0070678_1000024392 | 108 |
| 33 | 3300005457 | Ga0070662_100446627 | Ga0070662_1004466271 | 108 |
| 34 | 3300005459 | Ga0068867_100472583 | Ga0068867_1004725831 | 108 |
| 35 | 3300005466 | Ga0070685_10000493 | Ga0070685_1000049321 | 108 |
| 36 | 3300005467 | Ga0070706_100123600 | Ga0070706_1001236002 | 108 |
| 37 | 3300005468 | Ga0070707_100301965 | Ga0070707_1003019652 | 108 |
| 38 | 3300005471 | Ga0070698_100413024 | Ga0070698_1004130242 | 108 |
| 39 | 3300005518 | Ga0070699_100607410 | Ga0070699_1006074101 | 108 |
| 40 | 3300005530 | Ga0070679_100178492 | Ga0070679_1001784923 | 108 |
| 41 | 3300005535 | Ga0070684_100125115 | Ga0070684_1001251152 | 108 |
| 42 | 3300005536 | Ga0070697_100437186 | Ga0070697_1004371862 | 108 |
| 43 | 3300005539 | Ga0068853_100368490 | Ga0068853_1003684901 | 108 |
| 44 | 3300005539 | Ga0068853_100691354 | Ga0068853_1006913542 | 108 |
| 45 | 3300005543 | Ga0070672_101736624 | Ga0070672_1017366241 | 108 |
| 46 | 3300005544 | Ga0070686_100035614 | Ga0070686_1000356142 | 108 |
| 47 | 3300005545 | Ga0070695_100088980 | Ga0070695_1000889802 | 108 |
| 48 | 3300005546 | Ga0070696_100213444 | Ga0070696_1002134442 | 108 |
| 49 | 3300005546 | Ga0070696_100667254 | Ga0070696_1006672542 | 108 |
| 50 | 3300005547 | Ga0070693_100003655 | Ga0070693_1000036552 | 108 |
| 51 | 3300005548 | Ga0070665_100016649 | Ga0070665_1000166492 | 108 |
| 52 | 3300005549 | Ga0070704_100041018 | Ga0070704_1000410183 | 108 |
| 53 | 3300005549 | Ga0070704_101341913 | Ga0070704_1013419131 | 108 |
| 54 | 3300005564 | Ga0070664_100287978 | Ga0070664_1002879782 | 108 |
| 55 | 3300005578 | Ga0068854_100136299 | Ga0068854_1001362992 | 108 |
| 56 | 3300005578 | Ga0068854_100171311 | Ga0068854_1001713112 | 108 |
| 57 | 3300005614 | Ga0068856_100053983 | Ga0068856_1000539832 | 108 |
| 58 | 3300005616 | Ga0068852_100758868 | Ga0068852_1007588682 | 108 |
| 59 | 3300005617 | Ga0068859_100213952 | Ga0068859_1002139522 | 108 |
| 60 | 3300005718 | Ga0068866_10035408 | Ga0068866_100354082 | 108 |
| 61 | 3300005834 | Ga0068851_10069711 | Ga0068851_100697112 | 108 |
| 62 | 3300005841 | Ga0068863_100078599 | Ga0068863_1000785993 | 108 |
| 63 | 3300005841 | Ga0068863_100899292 | Ga0068863_1008992922 | 108 |
| 64 | 3300005842 | Ga0068858_100014064 | Ga0068858_1000140642 | 108 |
| 65 | 3300005842 | Ga0068858_100101907 | Ga0068858_1001019071 | 108 |
| 66 | 3300006028 | Ga0070717_10139912 | Ga0070717_101399122 | 108 |
| 67 | 3300006173 | Ga0070716_100018816 | Ga0070716_1000188164 | 108 |
| 68 | 3300006175 | Ga0070712_100060850 | Ga0070712_1000608502 | 108 |
| 69 | 3300006871 | Ga0075434_100383728 | Ga0075434_1003837282 | 108 |
| 70 | 3300006881 | Ga0068865_100356371 | Ga0068865_1003563712 | 108 |
| 71 | 3300006914 | Ga0075436_100142324 | Ga0075436_1001423242 | 108 |
| 72 | 3300006931 | Ga0097620_100213932 | Ga0097620_1002139322 | 108 |
| 73 | 3300009093 | Ga0105240_10359587 | Ga0105240_103595872 | 108 |
| 74 | 3300009098 | Ga0105245_10214229 | Ga0105245_102142293 | 108 |
| 75 | 3300009101 | Ga0105247_10044989 | Ga0105247_100449892 | 108 |
| 76 | 3300009148 | Ga0105243_10375564 | Ga0105243_103755642 | 108 |
| 77 | 3300009174 | Ga0105241_10277178 | Ga0105241_102771782 | 108 |
| 78 | 3300009177 | Ga0105248_10321725 | Ga0105248_103217251 | 108 |
| 79 | 3300009545 | Ga0105237_10253444 | Ga0105237_102534443 | 108 |
| 80 | 3300009551 | Ga0105238_10076515 | Ga0105238_100765154 | 108 |
| 81 | 3300009551 | Ga0105238_10408632 | Ga0105238_104086322 | 108 |
| 82 | 3300010375 | Ga0105239_10605911 | Ga0105239_106059112 | 108 |
| 83 | 3300011119 | Ga0105246_10054492 | Ga0105246_100544922 | 108 |
| 84 | 3300013100 | Ga0157373_10432858 | Ga0157373_104328582 | 108 |
| 85 | 3300013100 | Ga0157373_10686181 | Ga0157373_106861811 | 108 |
| 86 | 3300013102 | Ga0157371_10118360 | Ga0157371_101183602 | 108 |
| 87 | 3300013104 | Ga0157370_10148122 | Ga0157370_101481223 | 108 |
| 88 | 3300013307 | Ga0157372_11934594 | Ga0157372_119345942 | 108 |
| 89 | 3300014325 | Ga0163163_10142007 | Ga0163163_101420072 | 108 |
| 90 | 3300014745 | Ga0157377_10011551 | Ga0157377_100115512 | 108 |
| 91 | 3300014968 | Ga0157379_10004770 | Ga0157379_1000477014 | 108 |
| 92 | 3300014968 | Ga0157379_10024408 | Ga0157379_100244085 | 108 |
| 93 | 3300014969 | Ga0157376_10294489 | Ga0157376_102944892 | 108 |
| 94 | 3300025245 | Ga0207425_1071545 | Ga0207425_10715451 | 108 |
| 95 | 3300005329 | Ga0070683_101092304 | Ga0070683_1010923041 | 109 |
| 96 | 3300005330 | Ga0070690_100498243 | Ga0070690_1004982432 | 109 |
| 97 | 3300005341 | Ga0070691_10595448 | Ga0070691_105954482 | 109 |
| 98 | 3300005355 | Ga0070671_100049662 | Ga0070671_1000496624 | 109 |
| 99 | 3300005364 | Ga0070673_101095480 | Ga0070673_1010954802 | 109 |
| 100 | 3300005438 | Ga0070701_10855283 | Ga0070701_108552832 | 109 |
| 101 | 3300005440 | Ga0070705_100432461 | Ga0070705_1004324613 | 109 |
| 102 | 3300005444 | Ga0070694_100011953 | Ga0070694_1000119532 | 109 |
| 103 | 3300005444 | Ga0070694_101013541 | Ga0070694_1010135412 | 109 |
| 104 | 3300005536 | Ga0070697_100260777 | Ga0070697_1002607773 | 109 |
| 105 | 3300005544 | Ga0070686_101084404 | Ga0070686_1010844041 | 109 |
| 106 | 3300005545 | Ga0070695_100126146 | Ga0070695_1001261463 | 109 |
| 107 | 3300005545 | Ga0070695_100158395 | Ga0070695_1001583953 | 109 |
| 108 | 3300005546 | Ga0070696_100010213 | Ga0070696_1000102137 | 109 |
| 109 | 3300005549 | Ga0070704_100245804 | Ga0070704_1002458044 | 109 |
| 110 | 3300005617 | Ga0068859_100374376 | Ga0068859_1003743764 | 109 |
| 111 | 3300005618 | Ga0068864_100163563 | Ga0068864_1001635633 | 109 |
| 112 | 3300005719 | Ga0068861_101120855 | Ga0068861_1011208552 | 109 |
| 113 | 3300005841 | Ga0068863_101438844 | Ga0068863_1014388442 | 109 |
| 114 | 3300005844 | Ga0068862_101420419 | Ga0068862_1014204192 | 109 |
| 115 | 3300006163 | Ga0070715_10142841 | Ga0070715_101428412 | 109 |
| 116 | 3300006353 | Ga0075370_10173473 | Ga0075370_101734732 | 109 |
| 117 | 3300006871 | Ga0075434_101557612 | Ga0075434_1015576122 | 109 |
| 118 | 3300006931 | Ga0097620_100374388 | Ga0097620_1003743884 | 109 |
| 119 | 3300007076 | Ga0075435_100057492 | Ga0075435_1000574927 | 109 |
| 120 | 3300009094 | Ga0111539_10031472 | Ga0111539_100314729 | 109 |
| 121 | 3300009094 | Ga0111539_12595239 | Ga0111539_125952391 | 109 |
| 122 | 3300010159 | Ga0099796_10487772 | Ga0099796_104877721 | 109 |
| 123 | 3300013307 | Ga0157372_10615787 | Ga0157372_106157872 | 109 |
| 124 | 3300014326 | Ga0157380_11399788 | Ga0157380_113997882 | 109 |
| 125 | 3300014968 | Ga0157379_11579548 | Ga0157379_115795482 | 109 |
| 126 | 3300014969 | Ga0157376_10260162 | Ga0157376_102601623 | 109 |
| 127 | 3300025931 | Ga0207644_10109251 | Ga0207644_101092512 | 109 |
| 128 | 3300025944 | Ga0207661_11814878 | Ga0207661_118148781 | 109 |
| 129 | 3300025960 | Ga0207651_10996878 | Ga0207651_109968782 | 109 |
| 130 | 3300026075 | Ga0207708_10416819 | Ga0207708_104168193 | 109 |
| 131 | 3300026088 | Ga0207641_11297837 | Ga0207641_112978372 | 109 |
| 132 | 3300026095 | Ga0207676_10201663 | Ga0207676_102016633 | 109 |
| 133 | 3300027907 | Ga0207428_10159956 | Ga0207428_101599563 | 109 |
| 134 | 3300031548 | Ga0307408_100053233 | Ga0307408_1000532333 | 109 |
| 135 | 3300031548 | Ga0307408_100305013 | Ga0307408_1003050131 | 109 |
| 136 | 3300031548 | Ga0307408_100314965 | Ga0307408_1003149652 | 109 |
| 137 | 3300031911 | Ga0307412_10735366 | Ga0307412_107353662 | 109 |
| 138 | 3300031911 | Ga0307412_10768831 | Ga0307412_107688312 | 109 |
| 139 | 3300032005 | Ga0307411_10619137 | Ga0307411_106191372 | 109 |
| 140 | 3300035091 | Ga0373951_0007298 | Ga0373951_0007298_722_1054 | 109 |
| 141 | 3300035114 | Ga0373939_0000031 | Ga0373939_0000031_41606_41938 | 109 |
| 142 | 3300035117 | Ga0373953_0081213 | Ga0373953_0081213_347_676 | 109 |
| 143 | 3300035121 | Ga0373960_0009104 | Ga0373960_0009104_914_1246 | 109 |
| 144 | 3300035691 | Ga0373931_0001294 | Ga0373931_0001294_6544_6876 | 109 |
| 145 | 3300036401 | Ga0373937_0026003 | Ga0373937_0026003_4226_4555 | 109 |
| 146 | 3300037068 | Ga0373925_1276151 | Ga0373925_1276151_16_345 | 109 |
| 147 | 3300045051 | Ga0451576_0294932 | Ga0451576_0294932_1078_1407 | 109 |
| 148 | 3300046454 | Ga0495592_0006561 | Ga0495592_0006561_6923_7252 | 109 |
| 149 | 3300046462 | Ga0495651_0357186 | Ga0495651_0357186_361_690 | 109 |
| 150 | 3300046463 | Ga0495653_0208192 | Ga0495653_0208192_656_985 | 109 |
| 151 | 3300046473 | Ga0495582_0616189 | Ga0495582_0616189_155_484 | 109 |
| 152 | 3300046476 | Ga0495662_0012546 | Ga0495662_0012546_3282_3611 | 109 |
| 153 | 3300046511 | Ga0495608_0012778 | Ga0495608_0012778_4420_4749 | 109 |
| 154 | 3300046516 | Ga0495628_0066117 | Ga0495628_0066117_2029_2358 | 109 |
| 155 | 3300046517 | Ga0495630_0001728 | Ga0495630_0001728_6526_6855 | 109 |
| 156 | 3300046526 | Ga0495666_0026411 | Ga0495666_0026411_2443_2772 | 109 |
| 157 | 3300046529 | Ga0495652_0067036 | Ga0495652_0067036_578_907 | 109 |
| 158 | 3300046533 | Ga0495640_0005587 | Ga0495640_0005587_8475_8804 | 109 |
| 159 | 3300046535 | Ga0495586_0011166 | Ga0495586_0011166_3392_3721 | 109 |
| 160 | 3300046536 | Ga0495587_0056143 | Ga0495587_0056143_652_981 | 109 |
| 161 | 3300046559 | Ga0495667_0047388 | Ga0495667_0047388_2145_2474 | 109 |
| 162 | 3300046642 | Ga0495634_0010834 | Ga0495634_0010834_914_1243 | 109 |
| 163 | 3300046678 | Ga0495599_0033235 | Ga0495599_0033235_242_571 | 109 |
| 164 | 3300046681 | Ga0495647_0055762 | Ga0495647_0055762_561_890 | 109 |
| 165 | 3300046683 | Ga0495658_0019833 | Ga0495658_0019833_1082_1411 | 109 |
| 166 | 3300046689 | Ga0495613_0022406 | Ga0495613_0022406_3991_4320 | 109 |
| 167 | 3300046809 | Ga0495600_0229217 | Ga0495600_0229217_308_637 | 109 |
| 168 | 3300047317 | Ga0495604_0018716 | Ga0495604_0018716_1474_1803 | 109 |
| 169 | 3300047318 | Ga0495636_0002229 | Ga0495636_0002229_1085_1414 | 109 |
| 170 | 3300047319 | Ga0495674_0069160 | Ga0495674_0069160_1502_1831 | 109 |
| 171 | 3300047322 | Ga0495680_0004705 | Ga0495680_0004705_7302_7631 | 109 |
| 172 | 3300047444 | Ga0495675_0120522 | Ga0495675_0120522_1045_1374 | 109 |
| 173 | 3300047471 | Ga0495684_0109601 | Ga0495684_0109601_102_431 | 109 |
| 174 | 3300047673 | Ga0495593_0280166 | Ga0495593_0280166_140_469 | 109 |
| 175 | 3300048928 | Ga0496125_0000313 | Ga0496125_0000313_11929_12294 | 109 |
| 176 | 3300050496 | nmdc:mga07m45_655472_c1 | nmdc:mga07m45_655472_c1_250_579 | 109 |
| 177 | 3300050508 | nmdc:mga09592_241612_c1 | nmdc:mga09592_241612_c1_33_362 | 109 |
| 178 | 3300050511 | nmdc:mga08y16_171167_c1 | nmdc:mga08y16_171167_c1_1172_1501 | 109 |
| 179 | 3300050512 | nmdc:mga0n895_422388_c1 | nmdc:mga0n895_422388_c1_350_679 | 109 |
| 180 | 3300053077 | Ga0495601_0018194 | Ga0495601_0018194_168_497 | 109 |
| 181 | 3300053085 | Ga0495619_0107214 | Ga0495619_0107214_1252_1581 | 109 |
| 182 | 3300002773 | JGI25152J39213_1003080 | JGI25152J39213_10030801 | 110 |
| 183 | 3300002774 | JGI25150J39212_1017737 | JGI25150J39212_10177372 | 110 |
| 184 | 3300003215 | JGI25153J46596_10000615 | JGI25153J46596_100006156 | 110 |
| 185 | 3300003215 | JGI25153J46596_10002602 | JGI25153J46596_100026023 | 110 |
| 186 | 3300003323 | rootH1_10011242 | rootH1_100112423 | 110 |
| 187 | 3300003771 | Ga0055526_1001543 | Ga0055526_100154310 | 110 |
| 188 | 3300003791 | Ga0055530_10069192 | Ga0055530_100691921 | 110 |
| 189 | 3300003794 | Ga0055531_10000002 | Ga0055531_10000002198 | 110 |
| 190 | 3300005262 | Ga0065165_1002659 | Ga0065165_100265913 | 110 |
| 191 | 3300005327 | Ga0070658_10300320 | Ga0070658_103003202 | 110 |
| 192 | 3300005328 | Ga0070676_11583033 | Ga0070676_115830331 | 110 |
| 193 | 3300005336 | Ga0070680_100007136 | Ga0070680_1000071367 | 110 |
| 194 | 3300005438 | Ga0070701_10131369 | Ga0070701_101313692 | 110 |
| 195 | 3300005458 | Ga0070681_10045717 | Ga0070681_100457173 | 110 |
| 196 | 3300005459 | Ga0068867_100000004 | Ga0068867_10000000410 | 110 |
| 197 | 3300005530 | Ga0070679_100005395 | Ga0070679_1000053958 | 110 |
| 198 | 3300005543 | Ga0070672_101096915 | Ga0070672_1010969151 | 110 |
| 199 | 3300005547 | Ga0070693_100940888 | Ga0070693_1009408882 | 110 |
| 200 | 3300005614 | Ga0068856_100148032 | Ga0068856_1001480323 | 110 |
| 201 | 3300005614 | Ga0068856_100280219 | Ga0068856_1002802193 | 110 |
| 202 | 3300005718 | Ga0068866_10590868 | Ga0068866_105908682 | 110 |
| 203 | 3300006048 | Ga0075363_100051673 | Ga0075363_1000516733 | 110 |
| 204 | 3300006048 | Ga0075363_100086718 | Ga0075363_1000867183 | 110 |
| 205 | 3300006177 | Ga0075362_10001615 | Ga0075362_100016152 | 110 |
| 206 | 3300006178 | Ga0075367_10024391 | Ga0075367_100243914 | 110 |
| 207 | 3300006186 | Ga0075369_10375818 | Ga0075369_103758182 | 110 |
| 208 | 3300006195 | Ga0075366_10013944 | Ga0075366_100139445 | 110 |
| 209 | 3300006195 | Ga0075366_10051655 | Ga0075366_100516553 | 110 |
| 210 | 3300006195 | Ga0075366_10060953 | Ga0075366_100609534 | 110 |
| 211 | 3300006237 | Ga0097621_101744881 | Ga0097621_1017448811 | 110 |
| 212 | 3300006353 | Ga0075370_10006405 | Ga0075370_100064054 | 110 |
| 213 | 3300006353 | Ga0075370_10022199 | Ga0075370_100221994 | 110 |
| 214 | 3300006846 | Ga0075430_100119499 | Ga0075430_1001194993 | 110 |
| 215 | 3300006881 | Ga0068865_100255028 | Ga0068865_1002550282 | 110 |
| 216 | 3300009147 | Ga0114129_11064411 | Ga0114129_110644112 | 110 |
| 217 | 3300009148 | Ga0105243_10020827 | Ga0105243_100208275 | 110 |
| 218 | 3300009176 | Ga0105242_12025665 | Ga0105242_120256651 | 110 |
| 219 | 3300013296 | Ga0157374_10227604 | Ga0157374_102276042 | 110 |
| 220 | 3300013297 | Ga0157378_11072788 | Ga0157378_110727882 | 110 |
| 221 | 3300014745 | Ga0157377_10000010 | Ga0157377_1000001074 | 110 |
| 222 | 3300021361 | Ga0213872_10000034 | Ga0213872_1000003493 | 110 |
| 223 | 3300025245 | Ga0207425_1000807 | Ga0207425_10008071 | 110 |
| 224 | 3300025258 | Ga0209129_1000038 | Ga0209129_100003886 | 110 |
| 225 | 3300025273 | Ga0209673_1017657 | Ga0209673_10176573 | 110 |
| 226 | 3300025295 | Ga0209564_1000129 | Ga0209564_1000129101 | 110 |
| 227 | 3300025297 | Ga0209758_1000177 | Ga0209758_100017787 | 110 |
| 228 | 3300025297 | Ga0209758_1000197 | Ga0209758_1000197101 | 110 |
| 229 | 3300025298 | Ga0209050_1001630 | Ga0209050_100163021 | 110 |
| 230 | 3300025298 | Ga0209050_1002016 | Ga0209050_10020163 | 110 |
| 231 | 3300025299 | Ga0209256_1026046 | Ga0209256_10260461 | 110 |
| 232 | 3300025299 | Ga0209256_1044894 | Ga0209256_10448942 | 110 |
| 233 | 3300025303 | Ga0209051_1003663 | Ga0209051_100366311 | 110 |
| 234 | 3300025303 | Ga0209051_1011255 | Ga0209051_10112553 | 110 |
| 235 | 3300025304 | Ga0209257_1000049 | Ga0209257_1000049234 | 110 |
| 236 | 3300025304 | Ga0209257_1015569 | Ga0209257_10155692 | 110 |
| 237 | 3300025909 | Ga0207705_10616837 | Ga0207705_106168372 | 110 |
| 238 | 3300025912 | Ga0207707_10031988 | Ga0207707_100319883 | 110 |
| 239 | 3300025917 | Ga0207660_10004466 | Ga0207660_100044662 | 110 |
| 240 | 3300025918 | Ga0207662_10515370 | Ga0207662_105153702 | 110 |
| 241 | 3300025921 | Ga0207652_10013046 | Ga0207652_100130464 | 110 |
| 242 | 3300025926 | Ga0207659_10282424 | Ga0207659_102824242 | 110 |
| 243 | 3300025935 | Ga0207709_10004574 | Ga0207709_100045747 | 110 |
| 244 | 3300025938 | Ga0207704_10321742 | Ga0207704_103217422 | 110 |
| 245 | 3300026078 | Ga0207702_10301584 | Ga0207702_103015842 | 110 |
| 246 | 3300026089 | Ga0207648_10000002 | Ga0207648_1000000210 | 110 |
| 247 | 3300026116 | Ga0207674_10427372 | Ga0207674_104273723 | 110 |
| 248 | 3300026118 | Ga0207675_101137454 | Ga0207675_1011374542 | 110 |
| 249 | 3300028786 | Ga0307517_10153995 | Ga0307517_101539952 | 110 |
| 250 | 3300028794 | Ga0307515_10000873 | Ga0307515_1000087344 | 110 |
| 251 | 3300031548 | Ga0307408_100133327 | Ga0307408_1001333272 | 110 |
| 252 | 3300031731 | Ga0307405_10126957 | Ga0307405_101269572 | 110 |
| 253 | 3300031911 | Ga0307412_10046588 | Ga0307412_100465883 | 110 |
| 254 | 3300032002 | Ga0307416_100056724 | Ga0307416_1000567245 | 110 |
| 255 | 3300032004 | Ga0307414_10048754 | Ga0307414_100487544 | 110 |
| 256 | 3300032004 | Ga0307414_10563759 | Ga0307414_105637592 | 110 |
| 257 | 3300032005 | Ga0307411_10000112 | Ga0307411_100001125 | 110 |
| 258 | 3300032005 | Ga0307411_11520526 | Ga0307411_115205262 | 110 |
| 259 | 3300035172 | Ga0373955_0522590 | Ga0373955_0522590_54_386 | 110 |
| 260 | 3300037471 | Ga0395905_0002410 | Ga0395905_0002410_10097_10432 | 110 |
| 261 | 3300037471 | Ga0395905_0279462 | Ga0395905_0279462_254_586 | 110 |
| 262 | 3300037471 | Ga0395905_0858837 | Ga0395905_0858837_103_435 | 110 |
| 263 | 3300039447 | Ga0436361_0436689 | Ga0436361_0436689_10703_11038 | 110 |
| 264 | 3300041404 | Ga0439436_0000149 | Ga0439436_0000149_9991_10323 | 110 |
| 265 | 3300041406 | Ga0439439_0003522 | Ga0439439_0003522_1910_2242 | 110 |
| 266 | 3300041406 | Ga0439439_0012659 | Ga0439439_0012659_109_441 | 110 |
| 267 | 3300041407 | Ga0439447_008609 | Ga0439447_008609_2399_2731 | 110 |
| 268 | 3300041407 | Ga0439447_071367 | Ga0439447_071367_146_478 | 110 |
| 269 | 3300041410 | Ga0439461_0008282 | Ga0439461_0008282_1251_1583 | 110 |
| 270 | 3300041410 | Ga0439461_0037843 | Ga0439461_0037843_58_390 | 110 |
| 271 | 3300041410 | Ga0439461_0063307 | Ga0439461_0063307_225_560 | 110 |
| 272 | 3300041411 | Ga0439466_0003514 | Ga0439466_0003514_565_897 | 110 |
| 273 | 3300041411 | Ga0439466_0014241 | Ga0439466_0014241_1310_1642 | 110 |
| 274 | 3300041413 | Ga0439465_0013878 | Ga0439465_0013878_178_510 | 110 |
| 275 | 3300041441 | Ga0451787_469218 | Ga0451787_469218_196_528 | 110 |
| 276 | 3300041443 | Ga0451789_1004478 | Ga0451789_1004478_1698_2030 | 110 |
| 277 | 3300041451 | Ga0451791_1774605 | Ga0451791_1774605_230_562 | 110 |
| 278 | 3300041456 | Ga0451795_0417844 | Ga0451795_0417844_3127_3459 | 110 |
| 279 | 3300041458 | Ga0451798_0109225 | Ga0451798_0109225_233_565 | 110 |
| 280 | 3300041459 | Ga0451800_1257440 | Ga0451800_1257440_686_1018 | 110 |
| 281 | 3300041460 | Ga0451802_0491871 | Ga0451802_0491871_812_1144 | 110 |
| 282 | 3300041463 | Ga0451804_0920644 | Ga0451804_0920644_795_1127 | 110 |
| 283 | 3300041463 | Ga0451804_1039343 | Ga0451804_1039343_75_407 | 110 |
| 284 | 3300041498 | Ga0451841_1424262 | Ga0451841_1424262_15_347 | 110 |
| 285 | 3300041507 | Ga0451851_0873834 | Ga0451851_0873834_582_914 | 110 |
| 286 | 3300041512 | Ga0451853_2123395 | Ga0451853_2123395_117_449 | 110 |
| 287 | 3300041997 | Ga0439431_0005212 | Ga0439431_0005212_999_1331 | 110 |
| 288 | 3300041997 | Ga0439431_0022000 | Ga0439431_0022000_754_1086 | 110 |
| 289 | 3300041999 | Ga0439433_0000311 | Ga0439433_0000311_4324_4656 | 110 |
| 290 | 3300041999 | Ga0439433_0005036 | Ga0439433_0005036_1400_1732 | 110 |
| 291 | 3300042000 | Ga0439437_000343 | Ga0439437_000343_2379_2714 | 110 |
| 292 | 3300042002 | Ga0439442_001752 | Ga0439442_001752_2046_2378 | 110 |
| 293 | 3300042004 | Ga0439445_0088537 | Ga0439445_0088537_212_544 | 110 |
| 294 | 3300042006 | Ga0439432_000358 | Ga0439432_000358_6595_6927 | 110 |
| 295 | 3300042006 | Ga0439432_011446 | Ga0439432_011446_946_1278 | 110 |
| 296 | 3300042007 | Ga0439449_0000747 | Ga0439449_0000747_3401_3733 | 110 |
| 297 | 3300042007 | Ga0439449_0002278 | Ga0439449_0002278_152_484 | 110 |
| 298 | 3300042007 | Ga0439449_0003803 | Ga0439449_0003803_1380_1712 | 110 |
| 299 | 3300042010 | Ga0439452_001926 | Ga0439452_001926_3989_4321 | 110 |
| 300 | 3300042010 | Ga0439452_023649 | Ga0439452_023649_346_678 | 110 |
| 301 | 3300042014 | Ga0439457_008390 | Ga0439457_008390_1249_1581 | 110 |
| 302 | 3300042014 | Ga0439457_058945 | Ga0439457_058945_207_539 | 110 |
| 303 | 3300042015 | Ga0439462_0026016 | Ga0439462_0026016_1066_1398 | 110 |
| 304 | 3300042015 | Ga0439462_0064016 | Ga0439462_0064016_603_935 | 110 |
| 305 | 3300042115 | Ga0450911_025166 | Ga0450911_025166_410_742 | 110 |
| 306 | 3300042120 | Ga0450917_000047 | Ga0450917_000047_3867_4202 | 110 |
| 307 | 3300042125 | Ga0450923_005313 | Ga0450923_005313_1034_1366 | 110 |
| 308 | 3300042126 | Ga0450888_000072 | Ga0450888_000072_2095_2430 | 110 |
| 309 | 3300042127 | Ga0450890_002329 | Ga0450890_002329_1982_2317 | 110 |
| 310 | 3300042128 | Ga0450897_010218 | Ga0450897_010218_314_646 | 110 |
| 311 | 3300042129 | Ga0450891_000672 | Ga0450891_000672_1703_2038 | 110 |
| 312 | 3300042130 | Ga0450892_001742 | Ga0450892_001742_312_647 | 110 |
| 313 | 3300042131 | Ga0450894_006623 | Ga0450894_006623_101_433 | 110 |
| 314 | 3300042133 | Ga0450896_007651 | Ga0450896_007651_530_862 | 110 |
| 315 | 3300042135 | Ga0450899_002990 | Ga0450899_002990_1091_1423 | 110 |
| 316 | 3300042138 | Ga0450903_008057 | Ga0450903_008057_323_658 | 110 |
| 317 | 3300042139 | Ga0450904_018185 | Ga0450904_018185_295_630 | 110 |
| 318 | 3300042144 | Ga0450889_000337 | Ga0450889_000337_4780_5115 | 110 |
| 319 | 3300042145 | Ga0450906_020888 | Ga0450906_020888_234_566 | 110 |
| 320 | 3300042156 | Ga0439446_0017646 | Ga0439446_0017646_81_413 | 110 |
| 321 | 3300042156 | Ga0439446_0293705 | Ga0439446_0293705_49_381 | 110 |
| 322 | 3300042184 | Ga0450908_057455 | Ga0450908_057455_49_381 | 110 |
| 323 | 3300042184 | Ga0450908_079923 | Ga0450908_079923_128_460 | 110 |
| 324 | 3300042185 | Ga0450909_003136 | Ga0450909_003136_891_1223 | 110 |
| 325 | 3300042435 | Ga0439434_0000586 | Ga0439434_0000586_6326_6658 | 110 |
| 326 | 3300042435 | Ga0439434_0017599 | Ga0439434_0017599_783_1115 | 110 |
| 327 | 3300042435 | Ga0439434_0239228 | Ga0439434_0239228_124_495 | 110 |
| 328 | 3300042531 | Ga0450918_060621 | Ga0450918_060621_106_438 | 110 |
| 329 | 3300042532 | Ga0450893_0001474 | Ga0450893_0001474_1147_1482 | 110 |
| 330 | 3300042532 | Ga0450893_0003843 | Ga0450893_0003843_242_574 | 110 |
| 331 | 3300044683 | Ga0466965_0086013 | Ga0466965_0086013_709_1041 | 110 |
| 332 | 3300044684 | Ga0466966_0008651 | Ga0466966_0008651_4386_4724 | 110 |
| 333 | 3300044693 | Ga0466961_0099070 | Ga0466961_0099070_440_778 | 110 |
| 334 | 3300044765 | Ga0466970_0008735 | Ga0466970_0008735_2019_2357 | 110 |
| 335 | 3300044901 | Ga0466960_0087446 | Ga0466960_0087446_500_832 | 110 |
| 336 | 3300045049 | Ga0466959_0488788 | Ga0466959_0488788_241_579 | 110 |
| 337 | 3300046455 | Ga0495603_0598063 | Ga0495603_0598063_274_606 | 110 |
| 338 | 3300046459 | Ga0495629_0265655 | Ga0495629_0265655_612_944 | 110 |
| 339 | 3300046460 | Ga0495638_0172203 | Ga0495638_0172203_257_589 | 110 |
| 340 | 3300046473 | Ga0495582_0737772 | Ga0495582_0737772_63_395 | 110 |
| 341 | 3300046475 | Ga0495639_0598279 | Ga0495639_0598279_32_364 | 110 |
| 342 | 3300046476 | Ga0495662_0052122 | Ga0495662_0052122_1017_1349 | 110 |
| 343 | 3300046511 | Ga0495608_0628951 | Ga0495608_0628951_247_579 | 110 |
| 344 | 3300046514 | Ga0495618_0727316 | Ga0495618_0727316_85_417 | 110 |
| 345 | 3300046515 | Ga0495620_0144253 | Ga0495620_0144253_443_775 | 110 |
| 346 | 3300046516 | Ga0495628_0164618 | Ga0495628_0164618_886_1218 | 110 |
| 347 | 3300046517 | Ga0495630_0038696 | Ga0495630_0038696_1063_1395 | 110 |
| 348 | 3300046526 | Ga0495666_0496798 | Ga0495666_0496798_103_435 | 110 |
| 349 | 3300046533 | Ga0495640_0012886 | Ga0495640_0012886_3874_4206 | 110 |
| 350 | 3300046642 | Ga0495634_0123338 | Ga0495634_0123338_463_795 | 110 |
| 351 | 3300046683 | Ga0495658_0526725 | Ga0495658_0526725_259_591 | 110 |
| 352 | 3300047315 | Ga0495581_0279300 | Ga0495581_0279300_285_617 | 110 |
| 353 | 3300047317 | Ga0495604_0236559 | Ga0495604_0236559_330_662 | 110 |
| 354 | 3300047322 | Ga0495680_0605395 | Ga0495680_0605395_117_449 | 110 |
| 355 | 3300047673 | Ga0495593_0182545 | Ga0495593_0182545_287_619 | 110 |
| 356 | 3300049653 | Ga0501206_010989 | Ga0501206_010989_162_494 | 110 |
| 357 | 3300049665 | Ga0501227_002679 | Ga0501227_002679_947_1282 | 110 |
| 358 | 3300049674 | Ga0501242_076279 | Ga0501242_076279_34_369 | 110 |
| 359 | 3300049764 | Ga0501267_000121 | Ga0501267_000121_285_620 | 110 |
| 360 | 3300050490 | nmdc:mga03n38_146736_c1 | nmdc:mga03n38_146736_c1_333_665 | 110 |
| 361 | 3300050490 | nmdc:mga03n38_30849_c1 | nmdc:mga03n38_30849_c1_694_1026 | 110 |
| 362 | 3300050491 | nmdc:mga00v17_111671_c1 | nmdc:mga00v17_111671_c1_729_1061 | 110 |
| 363 | 3300050493 | nmdc:mga0k408_28362_c1 | nmdc:mga0k408_28362_c1_748_1080 | 110 |
| 364 | 3300050493 | nmdc:mga0k408_288994_c1 | nmdc:mga0k408_288994_c1_465_797 | 110 |
| 365 | 3300050493 | nmdc:mga0k408_7671_c1 | nmdc:mga0k408_7671_c1_3224_3556 | 110 |
| 366 | 3300050494 | nmdc:mga06z11_44682_c1 | nmdc:mga06z11_44682_c1_1770_2102 | 110 |
| 367 | 3300050496 | nmdc:mga07m45_3282_c1 | nmdc:mga07m45_3282_c1_2929_3261 | 110 |
| 368 | 3300050496 | nmdc:mga07m45_7161_c1 | nmdc:mga07m45_7161_c1_4027_4359 | 110 |
| 369 | 3300053078 | Ga0495612_0112261 | Ga0495612_0112261_702_1034 | 110 |
| 370 | 3300053086 | Ga0500578_0000342 | Ga0500578_0000342_38092_38424 | 110 |
| 371 | 3300053090 | Ga0500646_0037799 | Ga0500646_0037799_36_368 | 110 |
| 372 | 3300053093 | Ga0500651_0053252 | Ga0500651_0053252_633_965 | 110 |
| 373 | 3300053093 | Ga0500651_0079073 | Ga0500651_0079073_691_1023 | 110 |
| 374 | 3300053098 | Ga0500650_0271161 | Ga0500650_0271161_14_346 | 110 |
| 375 | 3300053109 | Ga0500569_006616 | Ga0500569_006616_1718_2050 | 110 |
| 376 | 3300053127 | Ga0500623_075565 | Ga0500623_075565_881_1213 | 110 |
| 377 | 3300053129 | Ga0500628_003123 | Ga0500628_003123_810_1142 | 110 |
| 378 | 3300053129 | Ga0500628_184997 | Ga0500628_184997_217_549 | 110 |
| 379 | 3300053130 | Ga0500642_0001586 | Ga0500642_0001586_4215_4547 | 110 |
| 380 | 3300053131 | Ga0500652_005414 | Ga0500652_005414_377_709 | 110 |
| 381 | 3300053142 | Ga0500577_0039092 | Ga0500577_0039092_608_940 | 110 |
| 382 | 3300053151 | Ga0500604_0013131 | Ga0500604_0013131_466_798 | 110 |
| 383 | 3300053151 | Ga0500604_0193398 | Ga0500604_0193398_213_545 | 110 |
| 384 | 3300053156 | Ga0500622_0000091 | Ga0500622_0000091_43229_43561 | 110 |
| 385 | 3300053156 | Ga0500622_0152603 | Ga0500622_0152603_224_556 | 110 |
| 386 | 3300053158 | Ga0500627_0202947 | Ga0500627_0202947_115_447 | 110 |
| 387 | 3300053161 | Ga0500634_0048186 | Ga0500634_0048186_1063_1395 | 110 |
| 388 | 3300053726 | Ga0500584_081850 | Ga0500584_081850_675_1007 | 110 |
| 389 | 3300003371 | JGI26145J50221_1038583 | JGI26145J50221_10385831 | 111 |
| 390 | 3300005339 | Ga0070660_100912575 | Ga0070660_1009125751 | 111 |
| 391 | 3300005366 | Ga0070659_100263208 | Ga0070659_1002632082 | 111 |
| 392 | 3300005406 | Ga0070703_10447299 | Ga0070703_104472991 | 111 |
| 393 | 3300005458 | Ga0070681_10102497 | Ga0070681_101024972 | 111 |
| 394 | 3300005530 | Ga0070679_100829050 | Ga0070679_1008290501 | 111 |
| 395 | 3300005535 | Ga0070684_100793668 | Ga0070684_1007936681 | 111 |
| 396 | 3300005539 | Ga0068853_100006975 | Ga0068853_1000069756 | 111 |
| 397 | 3300005563 | Ga0068855_100030561 | Ga0068855_1000305616 | 111 |
| 398 | 3300005563 | Ga0068855_100033363 | Ga0068855_1000333633 | 111 |
| 399 | 3300005577 | Ga0068857_100664668 | Ga0068857_1006646682 | 111 |
| 400 | 3300005843 | Ga0068860_101018895 | Ga0068860_1010188952 | 111 |
| 401 | 3300006038 | Ga0075365_10001590 | Ga0075365_1000159010 | 111 |
| 402 | 3300006038 | Ga0075365_10510754 | Ga0075365_105107542 | 111 |
| 403 | 3300006042 | Ga0075368_10073404 | Ga0075368_100734043 | 111 |
| 404 | 3300006048 | Ga0075363_100066441 | Ga0075363_1000664412 | 111 |
| 405 | 3300006177 | Ga0075362_10038873 | Ga0075362_100388732 | 111 |
| 406 | 3300006178 | Ga0075367_10021159 | Ga0075367_100211592 | 111 |
| 407 | 3300006195 | Ga0075366_10042728 | Ga0075366_100427281 | 111 |
| 408 | 3300006237 | Ga0097621_100725900 | Ga0097621_1007259002 | 111 |
| 409 | 3300006358 | Ga0068871_101358398 | Ga0068871_1013583981 | 111 |
| 410 | 3300006880 | Ga0075429_101772563 | Ga0075429_1017725631 | 111 |
| 411 | 3300009174 | Ga0105241_10051833 | Ga0105241_100518332 | 111 |
| 412 | 3300009545 | Ga0105237_10018195 | Ga0105237_100181953 | 111 |
| 413 | 3300010375 | Ga0105239_10034914 | Ga0105239_100349145 | 111 |
| 414 | 3300013105 | Ga0157369_10352269 | Ga0157369_103522692 | 111 |
| 415 | 3300013306 | Ga0163162_10920246 | Ga0163162_109202462 | 111 |
| 416 | 3300025911 | Ga0207654_10184614 | Ga0207654_101846142 | 111 |
| 417 | 3300025912 | Ga0207707_10032477 | Ga0207707_100324773 | 111 |
| 418 | 3300025914 | Ga0207671_10017616 | Ga0207671_100176163 | 111 |
| 419 | 3300025921 | Ga0207652_10067476 | Ga0207652_100674763 | 111 |
| 420 | 3300025924 | Ga0207694_10196753 | Ga0207694_101967532 | 111 |
| 421 | 3300025949 | Ga0207667_10033716 | Ga0207667_100337163 | 111 |
| 422 | 3300025949 | Ga0207667_10086275 | Ga0207667_100862754 | 111 |
| 423 | 3300026041 | Ga0207639_10100380 | Ga0207639_101003801 | 111 |
| 424 | 3300026089 | Ga0207648_11564530 | Ga0207648_115645302 | 111 |
| 425 | 3300026116 | Ga0207674_10047774 | Ga0207674_100477744 | 111 |
| 426 | 3300027876 | Ga0209974_10007325 | Ga0209974_100073254 | 111 |
| 427 | 3300028381 | Ga0268264_11401834 | Ga0268264_114018341 | 111 |
| 428 | 3300041460 | Ga0451802_1483943 | Ga0451802_1483943_342_677 | 111 |
| 429 | 3300041486 | Ga0451807_0588167 | Ga0451807_0588167_229_564 | 111 |
| 430 | 3300044706 | Ga0466964_0026898 | Ga0466964_0026898_385_723 | 111 |
| 431 | 3300045051 | Ga0451576_0876413 | Ga0451576_0876413_488_826 | 111 |
| 432 | 3300046462 | Ga0495651_0184789 | Ga0495651_0184789_334_669 | 111 |
| 433 | 3300046473 | Ga0495582_0732550 | Ga0495582_0732550_169_504 | 111 |
| 434 | 3300046514 | Ga0495618_0737504 | Ga0495618_0737504_220_555 | 111 |
| 435 | 3300046529 | Ga0495652_0737678 | Ga0495652_0737678_276_611 | 111 |
| 436 | 3300049569 | Ga0501032_0024130 | Ga0501032_0024130_487_822 | 111 |
| 437 | 3300049579 | Ga0501043_0000024 | Ga0501043_0000024_44154_44489 | 111 |
| 438 | 3300049580 | Ga0501046_0000173 | Ga0501046_0000173_44154_44489 | 111 |
| 439 | 3300049581 | Ga0501047_0000051 | Ga0501047_0000051_109793_110128 | 111 |
| 440 | 3300049582 | Ga0501048_0004089 | Ga0501048_0004089_8808_9143 | 111 |
| 441 | 3300049823 | Ga0501044_0825540 | Ga0501044_0825540_451_786 | 111 |
| 442 | 3300049824 | Ga0501045_0019498 | Ga0501045_0019498_2558_2893 | 111 |
| 443 | 3300050489 | nmdc:mga03683_39851_c1 | nmdc:mga03683_39851_c1_186_521 | 111 |
| 444 | 3300050489 | nmdc:mga03683_697026_c1 | nmdc:mga03683_697026_c1_110_451 | 111 |
| 445 | 3300050489 | nmdc:mga03683_91934_c1 | nmdc:mga03683_91934_c1_54_389 | 111 |
| 446 | 3300050492 | nmdc:mga0yw44_233681_c1 | nmdc:mga0yw44_233681_c1_748_1089 | 111 |
| 447 | 3300050492 | nmdc:mga0yw44_398016_c1 | nmdc:mga0yw44_398016_c1_485_820 | 111 |
| 448 | 3300050493 | nmdc:mga0k408_23096_c1 | nmdc:mga0k408_23096_c1_1112_1447 | 111 |
| 449 | 3300050493 | nmdc:mga0k408_442217_c1 | nmdc:mga0k408_442217_c1_298_633 | 111 |
| 450 | 3300050495 | nmdc:mga04h51_107551_c1 | nmdc:mga04h51_107551_c1_636_971 | 111 |
| 451 | 3300050496 | nmdc:mga07m45_45272_c1 | nmdc:mga07m45_45272_c1_1355_1690 | 111 |
| 452 | 3300050508 | nmdc:mga09592_384058_c1 | nmdc:mga09592_384058_c1_184_519 | 111 |
| 453 | 3300053102 | Ga0500554_131828 | Ga0500554_131828_315_650 | 111 |
| 454 | 3300053154 | Ga0500619_000041 | Ga0500619_000041_15134_15469 | 111 |
| 455 | iso_pu_bacteria | 2643221654 | 2644305386 | 111 |
| 456 | 3300003316 | rootH1_10008100 | rootH1_1000810010 | 112 |
| 457 | 3300003322 | rootL2_10013911 | rootL2_1001391113 | 112 |
| 458 | 3300005328 | Ga0070676_10004760 | Ga0070676_100047604 | 112 |
| 459 | 3300005329 | Ga0070683_100436994 | Ga0070683_1004369942 | 112 |
| 460 | 3300005331 | Ga0070670_100011885 | Ga0070670_1000118856 | 112 |
| 461 | 3300005333 | Ga0070677_10207347 | Ga0070677_102073472 | 112 |
| 462 | 3300005336 | Ga0070680_101539448 | Ga0070680_1015394481 | 112 |
| 463 | 3300005338 | Ga0068868_100439542 | Ga0068868_1004395422 | 112 |
| 464 | 3300005354 | Ga0070675_100300637 | Ga0070675_1003006372 | 112 |
| 465 | 3300005364 | Ga0070673_100950018 | Ga0070673_1009500182 | 112 |
| 466 | 3300005365 | Ga0070688_101031075 | Ga0070688_1010310751 | 112 |
| 467 | 3300005366 | Ga0070659_100139439 | Ga0070659_1001394392 | 112 |
| 468 | 3300005367 | Ga0070667_100000705 | Ga0070667_10000070522 | 112 |
| 469 | 3300005367 | Ga0070667_100020055 | Ga0070667_1000200552 | 112 |
| 470 | 3300005367 | Ga0070667_100449237 | Ga0070667_1004492372 | 112 |
| 471 | 3300005367 | Ga0070667_100579539 | Ga0070667_1005795392 | 112 |
| 472 | 3300005457 | Ga0070662_100285042 | Ga0070662_1002850421 | 112 |
| 473 | 3300005457 | Ga0070662_100502238 | Ga0070662_1005022382 | 112 |
| 474 | 3300005459 | Ga0068867_100009546 | Ga0068867_1000095462 | 112 |
| 475 | 3300005459 | Ga0068867_101366914 | Ga0068867_1013669142 | 112 |
| 476 | 3300005518 | Ga0070699_101414407 | Ga0070699_1014144072 | 112 |
| 477 | 3300005530 | Ga0070679_100654899 | Ga0070679_1006548992 | 112 |
| 478 | 3300005543 | Ga0070672_100022475 | Ga0070672_1000224756 | 112 |
| 479 | 3300005564 | Ga0070664_100092663 | Ga0070664_1000926633 | 112 |
| 480 | 3300005577 | Ga0068857_100031528 | Ga0068857_1000315287 | 112 |
| 481 | 3300005578 | Ga0068854_100327336 | Ga0068854_1003273362 | 112 |
| 482 | 3300005578 | Ga0068854_101034175 | Ga0068854_1010341752 | 112 |
| 483 | 3300005616 | Ga0068852_101332712 | Ga0068852_1013327122 | 112 |
| 484 | 3300005840 | Ga0068870_10351895 | Ga0068870_103518952 | 112 |
| 485 | 3300005840 | Ga0068870_10756597 | Ga0068870_107565972 | 112 |
| 486 | 3300006048 | Ga0075363_100053330 | Ga0075363_1000533302 | 112 |
| 487 | 3300006048 | Ga0075363_100529467 | Ga0075363_1005294672 | 112 |
| 488 | 3300006051 | Ga0075364_10168316 | Ga0075364_101683163 | 112 |
| 489 | 3300006051 | Ga0075364_10239523 | Ga0075364_102395233 | 112 |
| 490 | 3300006058 | Ga0075432_10216211 | Ga0075432_102162112 | 112 |
| 491 | 3300006177 | Ga0075362_10490156 | Ga0075362_104901561 | 112 |
| 492 | 3300006186 | Ga0075369_10499793 | Ga0075369_104997932 | 112 |
| 493 | 3300006195 | Ga0075366_10003855 | Ga0075366_100038554 | 112 |
| 494 | 3300006195 | Ga0075366_10482727 | Ga0075366_104827272 | 112 |
| 495 | 3300006195 | Ga0075366_10543742 | Ga0075366_105437422 | 112 |
| 496 | 3300006195 | Ga0075366_10569553 | Ga0075366_105695532 | 112 |
| 497 | 3300006353 | Ga0075370_10046000 | Ga0075370_100460002 | 112 |
| 498 | 3300006353 | Ga0075370_10326090 | Ga0075370_103260902 | 112 |
| 499 | 3300006353 | Ga0075370_10374263 | Ga0075370_103742632 | 112 |
| 500 | 3300006881 | Ga0068865_100249670 | Ga0068865_1002496702 | 112 |
| 501 | 3300006881 | Ga0068865_100593326 | Ga0068865_1005933262 | 112 |
| 502 | 3300009098 | Ga0105245_10537259 | Ga0105245_105372592 | 112 |
| 503 | 3300009148 | Ga0105243_10248770 | Ga0105243_102487703 | 112 |
| 504 | 3300009148 | Ga0105243_10303204 | Ga0105243_103032042 | 112 |
| 505 | 3300009545 | Ga0105237_10152202 | Ga0105237_101522021 | 112 |
| 506 | 3300009545 | Ga0105237_10307107 | Ga0105237_103071073 | 112 |
| 507 | 3300009553 | Ga0105249_10481359 | Ga0105249_104813593 | 112 |
| 508 | 3300010375 | Ga0105239_10492590 | Ga0105239_104925902 | 112 |
| 509 | 3300010375 | Ga0105239_10495806 | Ga0105239_104958062 | 112 |
| 510 | 3300013104 | Ga0157370_10102175 | Ga0157370_101021754 | 112 |
| 511 | 3300013308 | Ga0157375_10453168 | Ga0157375_104531682 | 112 |
| 512 | 3300014325 | Ga0163163_10259377 | Ga0163163_102593771 | 112 |
| 513 | 3300014968 | Ga0157379_10504571 | Ga0157379_105045713 | 112 |
| 514 | 3300014968 | Ga0157379_11201137 | Ga0157379_112011372 | 112 |
| 515 | 3300014969 | Ga0157376_11208231 | Ga0157376_112082311 | 112 |
| 516 | 3300025893 | Ga0207682_10058677 | Ga0207682_100586772 | 112 |
| 517 | 3300025900 | Ga0207710_10181729 | Ga0207710_101817292 | 112 |
| 518 | 3300025907 | Ga0207645_10000870 | Ga0207645_1000087018 | 112 |
| 519 | 3300025907 | Ga0207645_10168255 | Ga0207645_101682553 | 112 |
| 520 | 3300025908 | Ga0207643_10062086 | Ga0207643_100620862 | 112 |
| 521 | 3300025912 | Ga0207707_11231887 | Ga0207707_112318872 | 112 |
| 522 | 3300025921 | Ga0207652_10671784 | Ga0207652_106717842 | 112 |
| 523 | 3300025921 | Ga0207652_10873248 | Ga0207652_108732482 | 112 |
| 524 | 3300025925 | Ga0207650_10009880 | Ga0207650_100098807 | 112 |
| 525 | 3300025926 | Ga0207659_10547711 | Ga0207659_105477112 | 112 |
| 526 | 3300025927 | Ga0207687_10240542 | Ga0207687_102405422 | 112 |
| 527 | 3300025927 | Ga0207687_10315089 | Ga0207687_103150892 | 112 |
| 528 | 3300025933 | Ga0207706_10013502 | Ga0207706_100135024 | 112 |
| 529 | 3300025935 | Ga0207709_10159618 | Ga0207709_101596183 | 112 |
| 530 | 3300025937 | Ga0207669_10252024 | Ga0207669_102520243 | 112 |
| 531 | 3300025938 | Ga0207704_10470665 | Ga0207704_104706652 | 112 |
| 532 | 3300025940 | Ga0207691_10017845 | Ga0207691_100178457 | 112 |
| 533 | 3300025942 | Ga0207689_10151885 | Ga0207689_101518853 | 112 |
| 534 | 3300025944 | Ga0207661_11785985 | Ga0207661_117859852 | 112 |
| 535 | 3300025945 | Ga0207679_10421429 | Ga0207679_104214292 | 112 |
| 536 | 3300025960 | Ga0207651_10323459 | Ga0207651_103234592 | 112 |
| 537 | 3300025960 | Ga0207651_10899738 | Ga0207651_108997382 | 112 |
| 538 | 3300025961 | Ga0207712_10321904 | Ga0207712_103219043 | 112 |
| 539 | 3300025972 | Ga0207668_10536402 | Ga0207668_105364021 | 112 |
| 540 | 3300025981 | Ga0207640_10861141 | Ga0207640_108611412 | 112 |
| 541 | 3300025986 | Ga0207658_10002288 | Ga0207658_1000228810 | 112 |
| 542 | 3300025986 | Ga0207658_10068991 | Ga0207658_100689911 | 112 |
| 543 | 3300025986 | Ga0207658_10803205 | Ga0207658_108032052 | 112 |
| 544 | 3300025986 | Ga0207658_11018975 | Ga0207658_110189752 | 112 |
| 545 | 3300026023 | Ga0207677_10111697 | Ga0207677_101116973 | 112 |
| 546 | 3300026041 | Ga0207639_11629304 | Ga0207639_116293041 | 112 |
| 547 | 3300026089 | Ga0207648_10022364 | Ga0207648_100223646 | 112 |
| 548 | 3300026116 | Ga0207674_10009884 | Ga0207674_100098846 | 112 |
| 549 | 3300028786 | Ga0307517_10008069 | Ga0307517_100080695 | 112 |
| 550 | 3300028786 | Ga0307517_10087798 | Ga0307517_100877982 | 112 |
| 551 | 3300028786 | Ga0307517_10457924 | Ga0307517_104579241 | 112 |
| 552 | 3300028794 | Ga0307515_10239345 | Ga0307515_102393452 | 112 |
| 553 | 3300029957 | Ga0265324_10224448 | Ga0265324_102244481 | 112 |
| 554 | 3300030522 | Ga0307512_10066557 | Ga0307512_100665574 | 112 |
| 555 | 3300031456 | Ga0307513_10032823 | Ga0307513_100328234 | 112 |
| 556 | 3300031456 | Ga0307513_10074607 | Ga0307513_100746075 | 112 |
| 557 | 3300031456 | Ga0307513_10434627 | Ga0307513_104346272 | 112 |
| 558 | 3300031507 | Ga0307509_10052253 | Ga0307509_100522535 | 112 |
| 559 | 3300031507 | Ga0307509_10240890 | Ga0307509_102408903 | 112 |
| 560 | 3300031507 | Ga0307509_10297731 | Ga0307509_102977313 | 112 |
| 561 | 3300031507 | Ga0307509_10705268 | Ga0307509_107052681 | 112 |
| 562 | 3300031616 | Ga0307508_10000222 | Ga0307508_100002227 | 112 |
| 563 | 3300031616 | Ga0307508_10016751 | Ga0307508_100167517 | 112 |
| 564 | 3300031616 | Ga0307508_10026831 | Ga0307508_100268316 | 112 |
| 565 | 3300031616 | Ga0307508_10058972 | Ga0307508_100589723 | 112 |
| 566 | 3300031616 | Ga0307508_10114356 | Ga0307508_101143564 | 112 |
| 567 | 3300031616 | Ga0307508_10453277 | Ga0307508_104532772 | 112 |
| 568 | 3300031730 | Ga0307516_10000662 | Ga0307516_1000066221 | 112 |
| 569 | 3300031730 | Ga0307516_10111433 | Ga0307516_101114331 | 112 |
| 570 | 3300031730 | Ga0307516_10371420 | Ga0307516_103714202 | 112 |
| 571 | 3300033179 | Ga0307507_10231018 | Ga0307507_102310183 | 112 |
| 572 | 3300033179 | Ga0307507_10292572 | Ga0307507_102925722 | 112 |
| 573 | 3300033179 | Ga0307507_10516061 | Ga0307507_105160612 | 112 |
| 574 | 3300033180 | Ga0307510_10178973 | Ga0307510_101789733 | 112 |
| 575 | 3300035695 | Ga0373927_0559429 | Ga0373927_0559429_70_423 | 112 |
| 576 | 3300037068 | Ga0373925_0189829 | Ga0373925_0189829_736_1089 | 112 |
| 577 | 3300041443 | Ga0451789_0443499 | Ga0451789_0443499_107_445 | 112 |
| 578 | 3300041509 | Ga0451843_1553242 | Ga0451843_1553242_97_435 | 112 |
| 579 | 3300046457 | Ga0495590_0066222 | Ga0495590_0066222_839_1177 | 112 |
| 580 | 3300046457 | Ga0495590_0124979 | Ga0495590_0124979_572_910 | 112 |
| 581 | 3300046461 | Ga0495641_0264922 | Ga0495641_0264922_347_685 | 112 |
| 582 | 3300046474 | Ga0495605_0073081 | Ga0495605_0073081_1082_1420 | 112 |
| 583 | 3300046491 | Ga0495584_0429976 | Ga0495584_0429976_133_471 | 112 |
| 584 | 3300046512 | Ga0495610_0136617 | Ga0495610_0136617_49_387 | 112 |
| 585 | 3300046513 | Ga0495616_0197204 | Ga0495616_0197204_312_650 | 112 |
| 586 | 3300046515 | Ga0495620_0204779 | Ga0495620_0204779_380_718 | 112 |
| 587 | 3300046518 | Ga0495631_0138775 | Ga0495631_0138775_153_491 | 112 |
| 588 | 3300046519 | Ga0495632_0017543 | Ga0495632_0017543_910_1248 | 112 |
| 589 | 3300046519 | Ga0495632_0076186 | Ga0495632_0076186_627_965 | 112 |
| 590 | 3300046524 | Ga0495648_0204432 | Ga0495648_0204432_175_513 | 112 |
| 591 | 3300046526 | Ga0495666_0061797 | Ga0495666_0061797_1159_1497 | 112 |
| 592 | 3300046528 | Ga0495642_0266434 | Ga0495642_0266434_99_437 | 112 |
| 593 | 3300046539 | Ga0495621_0055952 | Ga0495621_0055952_62_403 | 112 |
| 594 | 3300046542 | Ga0495597_0049821 | Ga0495597_0049821_736_1074 | 112 |
| 595 | 3300046542 | Ga0495597_0074206 | Ga0495597_0074206_601_939 | 112 |
| 596 | 3300046557 | Ga0495622_0458416 | Ga0495622_0458416_107_445 | 112 |
| 597 | 3300046615 | Ga0495656_0002670 | Ga0495656_0002670_4130_4471 | 112 |
| 598 | 3300046616 | Ga0495668_0210643 | Ga0495668_0210643_473_811 | 112 |
| 599 | 3300046616 | Ga0495668_0762803 | Ga0495668_0762803_93_431 | 112 |
| 600 | 3300046660 | Ga0495625_0036918 | Ga0495625_0036918_2550_2888 | 112 |
| 601 | 3300046660 | Ga0495625_0069555 | Ga0495625_0069555_93_431 | 112 |
| 602 | 3300046683 | Ga0495658_0415223 | Ga0495658_0415223_135_473 | 112 |
| 603 | 3300046691 | Ga0495670_0132057 | Ga0495670_0132057_568_909 | 112 |
| 604 | 3300046694 | Ga0495649_0008009 | Ga0495649_0008009_789_1127 | 112 |
| 605 | 3300046694 | Ga0495649_0162861 | Ga0495649_0162861_80_418 | 112 |
| 606 | 3300046794 | Ga0495589_0255838 | Ga0495589_0255838_141_479 | 112 |
| 607 | 3300047323 | Ga0495683_0199671 | Ga0495683_0199671_354_692 | 112 |
| 608 | 3300047443 | Ga0495687_000330 | Ga0495687_000330_8474_8812 | 112 |
| 609 | 3300047443 | Ga0495687_010458 | Ga0495687_010458_1125_1463 | 112 |
| 610 | 3300047443 | Ga0495687_015164 | Ga0495687_015164_1125_1463 | 112 |
| 611 | 3300047469 | Ga0495673_0312798 | Ga0495673_0312798_135_473 | 112 |
| 612 | 3300047472 | Ga0495686_0162084 | Ga0495686_0162084_792_1136 | 112 |
| 613 | 3300048090 | Ga0495615_0011601 | Ga0495615_0011601_401_742 | 112 |
| 614 | 3300048091 | Ga0495626_0056643 | Ga0495626_0056643_461_799 | 112 |
| 615 | 3300048903 | Ga0496100_0279692 | Ga0496100_0279692_586_924 | 112 |
| 616 | 3300048909 | Ga0496106_0294609 | Ga0496106_0294609_660_1004 | 112 |
| 617 | 3300048917 | Ga0496114_0250949 | Ga0496114_0250949_570_908 | 112 |
| 618 | 3300048924 | Ga0496121_0100190 | Ga0496121_0100190_1699_2037 | 112 |
| 619 | 3300049460 | Ga0495682_0132834 | Ga0495682_0132834_212_550 | 112 |
| 620 | 3300049577 | Ga0501041_0824026 | Ga0501041_0824026_89_427 | 112 |
| 621 | 3300049578 | Ga0501042_0945943 | Ga0501042_0945943_185_523 | 112 |
| 622 | 3300049588 | Ga0501072_1100069 | Ga0501072_1100069_222_560 | 112 |
| 623 | 3300049591 | Ga0501075_0612134 | Ga0501075_0612134_362_700 | 112 |
| 624 | 3300049593 | Ga0501077_0183595 | Ga0501077_0183595_661_999 | 112 |
| 625 | 3300049741 | Ga0501079_0278594 | Ga0501079_0278594_665_1003 | 112 |
| 626 | 3300049743 | Ga0501081_1113446 | Ga0501081_1113446_77_415 | 112 |
| 627 | 3300050489 | nmdc:mga03683_202345_c1 | nmdc:mga03683_202345_c1_108_446 | 112 |
| 628 | 3300050489 | nmdc:mga03683_399431_c1 | nmdc:mga03683_399431_c1_177_515 | 112 |
| 629 | 3300050490 | nmdc:mga03n38_882484_c1 | nmdc:mga03n38_882484_c1_99_437 | 112 |
| 630 | 3300050491 | nmdc:mga00v17_12372_c1 | nmdc:mga00v17_12372_c1_471_809 | 112 |
| 631 | 3300050493 | nmdc:mga0k408_1110_c1 | nmdc:mga0k408_1110_c1_4547_4885 | 112 |
| 632 | 3300050493 | nmdc:mga0k408_204254_c1 | nmdc:mga0k408_204254_c1_526_864 | 112 |
| 633 | 3300050493 | nmdc:mga0k408_337776_c1 | nmdc:mga0k408_337776_c1_107_445 | 112 |
| 634 | 3300050493 | nmdc:mga0k408_42338_c1 | nmdc:mga0k408_42338_c1_753_1091 | 112 |
| 635 | 3300050494 | nmdc:mga06z11_182458_c1 | nmdc:mga06z11_182458_c1_558_896 | 112 |
| 636 | 3300050496 | nmdc:mga07m45_130733_c1 | nmdc:mga07m45_130733_c1_725_1063 | 112 |
| 637 | 3300050496 | nmdc:mga07m45_14548_c1 | nmdc:mga07m45_14548_c1_102_440 | 112 |
| 638 | 3300050496 | nmdc:mga07m45_311732_c1 | nmdc:mga07m45_311732_c1_418_756 | 112 |
| 639 | 3300050496 | nmdc:mga07m45_7700_c1 | nmdc:mga07m45_7700_c1_3345_3683 | 112 |
| 640 | 3300050496 | nmdc:mga07m45_94756_c1 | nmdc:mga07m45_94756_c1_975_1313 | 112 |
| 641 | 3300050511 | nmdc:mga08y16_649380_c1 | nmdc:mga08y16_649380_c1_633_992 | 112 |
| 642 | 3300050516 | nmdc:mga0sz30_245089_c1 | nmdc:mga0sz30_245089_c1_52_390 | 112 |
| 643 | 3300050516 | nmdc:mga0sz30_535499_c1 | nmdc:mga0sz30_535499_c1_48_386 | 112 |
| 644 | 3300053086 | Ga0500578_0041368 | Ga0500578_0041368_541_885 | 112 |
| 645 | 3300053092 | Ga0500583_0075468 | Ga0500583_0075468_1240_1578 | 112 |
| 646 | 3300053092 | Ga0500583_0347107 | Ga0500583_0347107_141_479 | 112 |
| 647 | 3300053134 | Ga0500658_0015723 | Ga0500658_0015723_1288_1626 | 112 |
| 648 | 3300053154 | Ga0500619_100300 | Ga0500619_100300_172_510 | 112 |
| 649 | 3300053155 | Ga0500620_111999 | Ga0500620_111999_572_910 | 112 |
| 650 | 3300053722 | Ga0500649_158335 | Ga0500649_158335_265_603 | 112 |
| 651 | 3300053730 | Ga0500645_002331 | Ga0500645_002331_8155_8499 | 112 |
| 652 | 3300054114 | Ga0501084_0421593 | Ga0501084_0421593_298_636 | 112 |
| 653 | 3300006195 | Ga0075366_10457705 | Ga0075366_104577051 | 113 |
| 654 | 3300009148 | Ga0105243_10175926 | Ga0105243_101759262 | 113 |
| 655 | 3300020081 | Ga0206354_11215456 | Ga0206354_112154562 | 113 |
| 656 | 3300025298 | Ga0209050_1013067 | Ga0209050_10130676 | 113 |
| 657 | 3300031731 | Ga0307405_10018973 | Ga0307405_100189733 | 113 |
| 658 | 3300031901 | Ga0307406_10136632 | Ga0307406_101366322 | 113 |
| 659 | 3300031911 | Ga0307412_10017084 | Ga0307412_100170845 | 113 |
| 660 | 3300031995 | Ga0307409_100004643 | Ga0307409_1000046439 | 113 |
| 661 | 3300032002 | Ga0307416_100018756 | Ga0307416_1000187564 | 113 |
| 662 | 3300032004 | Ga0307414_11108514 | Ga0307414_111085142 | 113 |
| 663 | 3300032005 | Ga0307411_10021299 | Ga0307411_100212993 | 113 |
| 664 | 3300032126 | Ga0307415_100001031 | Ga0307415_10000103110 | 113 |
| 665 | 3300035113 | Ga0373936_0337503 | Ga0373936_0337503_298_639 | 113 |
| 666 | 3300046452 | Ga0495617_268891 | Ga0495617_268891_62_403 | 113 |
| 667 | 3300046455 | Ga0495603_0207942 | Ga0495603_0207942_529_870 | 113 |
| 668 | 3300046459 | Ga0495629_0001758 | Ga0495629_0001758_1368_1709 | 113 |
| 669 | 3300046471 | Ga0495650_0002383 | Ga0495650_0002383_674_1015 | 113 |
| 670 | 3300046473 | Ga0495582_0089087 | Ga0495582_0089087_479_820 | 113 |
| 671 | 3300046517 | Ga0495630_0266826 | Ga0495630_0266826_748_1089 | 113 |
| 672 | 3300046524 | Ga0495648_0249714 | Ga0495648_0249714_34_375 | 113 |
| 673 | 3300046526 | Ga0495666_0333748 | Ga0495666_0333748_129_470 | 113 |
| 674 | 3300046528 | Ga0495642_0040146 | Ga0495642_0040146_493_834 | 113 |
| 675 | 3300046529 | Ga0495652_0188341 | Ga0495652_0188341_1192_1533 | 113 |
| 676 | 3300046530 | Ga0495654_0059525 | Ga0495654_0059525_630_971 | 113 |
| 677 | 3300046535 | Ga0495586_0063428 | Ga0495586_0063428_171_512 | 113 |
| 678 | 3300046536 | Ga0495587_0448019 | Ga0495587_0448019_147_488 | 113 |
| 679 | 3300046543 | Ga0495645_0000309 | Ga0495645_0000309_6623_6964 | 113 |
| 680 | 3300046675 | Ga0495657_0415615 | Ga0495657_0415615_72_413 | 113 |
| 681 | 3300046680 | Ga0495646_0022134 | Ga0495646_0022134_2188_2529 | 113 |
| 682 | 3300046684 | Ga0495669_0096688 | Ga0495669_0096688_28_369 | 113 |
| 683 | 3300046689 | Ga0495613_0222595 | Ga0495613_0222595_653_994 | 113 |
| 684 | 3300046794 | Ga0495589_0028340 | Ga0495589_0028340_1098_1439 | 113 |
| 685 | 3300046809 | Ga0495600_0307718 | Ga0495600_0307718_21_362 | 113 |
| 686 | 3300047315 | Ga0495581_0001544 | Ga0495581_0001544_10121_10462 | 113 |
| 687 | 3300047443 | Ga0495687_040493 | Ga0495687_040493_618_959 | 113 |
| 688 | 3300047446 | Ga0495679_037921 | Ga0495679_037921_974_1315 | 113 |
| 689 | 3300047470 | Ga0495681_0095694 | Ga0495681_0095694_443_784 | 113 |
| 690 | 3300047471 | Ga0495684_0605090 | Ga0495684_0605090_272_613 | 113 |
| 691 | 3300047673 | Ga0495593_0065478 | Ga0495593_0065478_1520_1861 | 113 |
| 692 | 3300048089 | Ga0495614_0028296 | Ga0495614_0028296_578_919 | 113 |
| 693 | 3300048903 | Ga0496100_0016608 | Ga0496100_0016608_3497_3838 | 113 |
| 694 | 3300048905 | Ga0496102_0845522 | Ga0496102_0845522_446_787 | 113 |
| 695 | 3300048907 | Ga0496104_0038949 | Ga0496104_0038949_1054_1395 | 113 |
| 696 | 3300048910 | Ga0496107_0145047 | Ga0496107_0145047_1166_1507 | 113 |
| 697 | 3300048913 | Ga0496110_1899729 | Ga0496110_1899729_26_367 | 113 |
| 698 | 3300048914 | Ga0496111_0218977 | Ga0496111_0218977_872_1213 | 113 |
| 699 | 3300048917 | Ga0496114_0023648 | Ga0496114_0023648_133_474 | 113 |
| 700 | 3300048918 | Ga0496115_0082785 | Ga0496115_0082785_1145_1486 | 113 |
| 701 | 3300048919 | Ga0496116_0039170 | Ga0496116_0039170_1096_1476 | 113 |
| 702 | 3300048926 | Ga0496123_0041868 | Ga0496123_0041868_1556_1936 | 113 |
| 703 | 3300048927 | Ga0496124_0217019 | Ga0496124_0217019_146_526 | 113 |
| 704 | 3300002070 | JGI24750J21931_1040090 | JGI24750J21931_10400902 | 114 |
| 705 | 3300005327 | Ga0070658_10745414 | Ga0070658_107454142 | 114 |
| 706 | 3300005328 | Ga0070676_10001334 | Ga0070676_100013348 | 114 |
| 707 | 3300005328 | Ga0070676_10165264 | Ga0070676_101652642 | 114 |
| 708 | 3300005331 | Ga0070670_100089787 | Ga0070670_1000897873 | 114 |
| 709 | 3300005331 | Ga0070670_100263957 | Ga0070670_1002639572 | 114 |
| 710 | 3300005331 | Ga0070670_100441463 | Ga0070670_1004414632 | 114 |
| 711 | 3300005333 | Ga0070677_10018563 | Ga0070677_100185631 | 114 |
| 712 | 3300005333 | Ga0070677_10131923 | Ga0070677_101319232 | 114 |
| 713 | 3300005333 | Ga0070677_10568647 | Ga0070677_105686471 | 114 |
| 714 | 3300005334 | Ga0068869_100003785 | Ga0068869_1000037852 | 114 |
| 715 | 3300005335 | Ga0070666_10634855 | Ga0070666_106348552 | 114 |
| 716 | 3300005338 | Ga0068868_100118748 | Ga0068868_1001187482 | 114 |
| 717 | 3300005338 | Ga0068868_100324736 | Ga0068868_1003247361 | 114 |
| 718 | 3300005338 | Ga0068868_100671126 | Ga0068868_1006711262 | 114 |
| 719 | 3300005339 | Ga0070660_100726075 | Ga0070660_1007260752 | 114 |
| 720 | 3300005340 | Ga0070689_100749998 | Ga0070689_1007499982 | 114 |
| 721 | 3300005341 | Ga0070691_10642534 | Ga0070691_106425342 | 114 |
| 722 | 3300005343 | Ga0070687_100121829 | Ga0070687_1001218292 | 114 |
| 723 | 3300005343 | Ga0070687_100273690 | Ga0070687_1002736902 | 114 |
| 724 | 3300005344 | Ga0070661_101023945 | Ga0070661_1010239452 | 114 |
| 725 | 3300005347 | Ga0070668_100007743 | Ga0070668_1000077431 | 114 |
| 726 | 3300005353 | Ga0070669_100002211 | Ga0070669_1000022118 | 114 |
| 727 | 3300005353 | Ga0070669_100456890 | Ga0070669_1004568902 | 114 |
| 728 | 3300005354 | Ga0070675_100035230 | Ga0070675_1000352302 | 114 |
| 729 | 3300005355 | Ga0070671_100000437 | Ga0070671_10000043719 | 114 |
| 730 | 3300005355 | Ga0070671_100240851 | Ga0070671_1002408512 | 114 |
| 731 | 3300005355 | Ga0070671_100400910 | Ga0070671_1004009102 | 114 |
| 732 | 3300005355 | Ga0070671_100491052 | Ga0070671_1004910522 | 114 |
| 733 | 3300005356 | Ga0070674_100000965 | Ga0070674_10000096510 | 114 |
| 734 | 3300005364 | Ga0070673_100085514 | Ga0070673_1000855142 | 114 |
| 735 | 3300005364 | Ga0070673_100296467 | Ga0070673_1002964672 | 114 |
| 736 | 3300005366 | Ga0070659_101490159 | Ga0070659_1014901592 | 114 |
| 737 | 3300005367 | Ga0070667_100002738 | Ga0070667_10000273810 | 114 |
| 738 | 3300005367 | Ga0070667_100335409 | Ga0070667_1003354092 | 114 |
| 739 | 3300005367 | Ga0070667_100815655 | Ga0070667_1008156552 | 114 |
| 740 | 3300005455 | Ga0070663_101375257 | Ga0070663_1013752571 | 114 |
| 741 | 3300005456 | Ga0070678_100079120 | Ga0070678_1000791202 | 114 |
| 742 | 3300005456 | Ga0070678_100258411 | Ga0070678_1002584112 | 114 |
| 743 | 3300005457 | Ga0070662_100004128 | Ga0070662_1000041283 | 114 |
| 744 | 3300005457 | Ga0070662_100023060 | Ga0070662_1000230603 | 114 |
| 745 | 3300005457 | Ga0070662_100042390 | Ga0070662_1000423904 | 114 |
| 746 | 3300005457 | Ga0070662_100813573 | Ga0070662_1008135732 | 114 |
| 747 | 3300005459 | Ga0068867_100003930 | Ga0068867_1000039308 | 114 |
| 748 | 3300005459 | Ga0068867_100094233 | Ga0068867_1000942332 | 114 |
| 749 | 3300005466 | Ga0070685_10183216 | Ga0070685_101832162 | 114 |
| 750 | 3300005539 | Ga0068853_100063148 | Ga0068853_1000631483 | 114 |
| 751 | 3300005543 | Ga0070672_100003309 | Ga0070672_1000033099 | 114 |
| 752 | 3300005543 | Ga0070672_100043274 | Ga0070672_1000432743 | 114 |
| 753 | 3300005543 | Ga0070672_100082357 | Ga0070672_1000823572 | 114 |
| 754 | 3300005543 | Ga0070672_100100170 | Ga0070672_1001001703 | 114 |
| 755 | 3300005543 | Ga0070672_100105091 | Ga0070672_1001050912 | 114 |
| 756 | 3300005543 | Ga0070672_100161485 | Ga0070672_1001614852 | 114 |
| 757 | 3300005544 | Ga0070686_100024368 | Ga0070686_1000243682 | 114 |
| 758 | 3300005547 | Ga0070693_101125818 | Ga0070693_1011258182 | 114 |
| 759 | 3300005548 | Ga0070665_100350143 | Ga0070665_1003501432 | 114 |
| 760 | 3300005564 | Ga0070664_100930323 | Ga0070664_1009303232 | 114 |
| 761 | 3300005578 | Ga0068854_100028980 | Ga0068854_1000289803 | 114 |
| 762 | 3300005578 | Ga0068854_100098256 | Ga0068854_1000982563 | 114 |
| 763 | 3300005578 | Ga0068854_100521527 | Ga0068854_1005215272 | 114 |
| 764 | 3300005614 | Ga0068856_100496054 | Ga0068856_1004960542 | 114 |
| 765 | 3300005614 | Ga0068856_102671395 | Ga0068856_1026713952 | 114 |
| 766 | 3300005615 | Ga0070702_100158131 | Ga0070702_1001581312 | 114 |
| 767 | 3300005616 | Ga0068852_100007596 | Ga0068852_1000075963 | 114 |
| 768 | 3300005616 | Ga0068852_100137191 | Ga0068852_1001371912 | 114 |
| 769 | 3300005616 | Ga0068852_100156509 | Ga0068852_1001565092 | 114 |
| 770 | 3300005616 | Ga0068852_100291591 | Ga0068852_1002915912 | 114 |
| 771 | 3300005616 | Ga0068852_100555599 | Ga0068852_1005555992 | 114 |
| 772 | 3300005616 | Ga0068852_101297695 | Ga0068852_1012976952 | 114 |
| 773 | 3300005617 | Ga0068859_100191302 | Ga0068859_1001913022 | 114 |
| 774 | 3300005618 | Ga0068864_100013261 | Ga0068864_1000132613 | 114 |
| 775 | 3300005618 | Ga0068864_100087455 | Ga0068864_1000874552 | 114 |
| 776 | 3300005618 | Ga0068864_100176707 | Ga0068864_1001767072 | 114 |
| 777 | 3300005718 | Ga0068866_10171605 | Ga0068866_101716052 | 114 |
| 778 | 3300005719 | Ga0068861_100002811 | Ga0068861_1000028115 | 114 |
| 779 | 3300005834 | Ga0068851_10145064 | Ga0068851_101450642 | 114 |
| 780 | 3300005840 | Ga0068870_10178917 | Ga0068870_101789172 | 114 |
| 781 | 3300005840 | Ga0068870_10476397 | Ga0068870_104763972 | 114 |
| 782 | 3300005841 | Ga0068863_100004699 | Ga0068863_10000469910 | 114 |
| 783 | 3300005841 | Ga0068863_100233429 | Ga0068863_1002334292 | 114 |
| 784 | 3300005841 | Ga0068863_101127117 | Ga0068863_1011271172 | 114 |
| 785 | 3300005842 | Ga0068858_100010462 | Ga0068858_1000104627 | 114 |
| 786 | 3300005843 | Ga0068860_100005300 | Ga0068860_1000053007 | 114 |
| 787 | 3300005843 | Ga0068860_100129897 | Ga0068860_1001298972 | 114 |
| 788 | 3300006178 | Ga0075367_10952134 | Ga0075367_109521341 | 114 |
| 789 | 3300006195 | Ga0075366_10039097 | Ga0075366_100390972 | 114 |
| 790 | 3300006237 | Ga0097621_100029731 | Ga0097621_1000297312 | 114 |
| 791 | 3300006237 | Ga0097621_100204014 | Ga0097621_1002040142 | 114 |
| 792 | 3300006358 | Ga0068871_100192218 | Ga0068871_1001922182 | 114 |
| 793 | 3300006881 | Ga0068865_100002020 | Ga0068865_1000020208 | 114 |
| 794 | 3300006881 | Ga0068865_101321388 | Ga0068865_1013213881 | 114 |
| 795 | 3300006931 | Ga0097620_100191296 | Ga0097620_1001912962 | 114 |
| 796 | 3300009148 | Ga0105243_10056139 | Ga0105243_100561393 | 114 |
| 797 | 3300009176 | Ga0105242_10040381 | Ga0105242_100403813 | 114 |
| 798 | 3300009176 | Ga0105242_10435979 | Ga0105242_104359792 | 114 |
| 799 | 3300009177 | Ga0105248_10030887 | Ga0105248_100308875 | 114 |
| 800 | 3300009177 | Ga0105248_10065141 | Ga0105248_100651415 | 114 |
| 801 | 3300009177 | Ga0105248_10137185 | Ga0105248_101371852 | 114 |
| 802 | 3300009177 | Ga0105248_10173538 | Ga0105248_101735382 | 114 |
| 803 | 3300009177 | Ga0105248_11460021 | Ga0105248_114600212 | 114 |
| 804 | 3300012506 | Ga0157324_1029955 | Ga0157324_10299552 | 114 |
| 805 | 3300013104 | Ga0157370_10308010 | Ga0157370_103080102 | 114 |
| 806 | 3300013105 | Ga0157369_10505965 | Ga0157369_105059652 | 114 |
| 807 | 3300013296 | Ga0157374_10035585 | Ga0157374_100355853 | 114 |
| 808 | 3300013296 | Ga0157374_10078384 | Ga0157374_100783842 | 114 |
| 809 | 3300013296 | Ga0157374_10296005 | Ga0157374_102960052 | 114 |
| 810 | 3300013297 | Ga0157378_10190217 | Ga0157378_101902171 | 114 |
| 811 | 3300013297 | Ga0157378_12753114 | Ga0157378_127531142 | 114 |
| 812 | 3300013306 | Ga0163162_10004467 | Ga0163162_100044678 | 114 |
| 813 | 3300013306 | Ga0163162_11058169 | Ga0163162_110581692 | 114 |
| 814 | 3300013306 | Ga0163162_11179515 | Ga0163162_111795152 | 114 |
| 815 | 3300013308 | Ga0157375_10001941 | Ga0157375_1000194120 | 114 |
| 816 | 3300013308 | Ga0157375_10003497 | Ga0157375_100034978 | 114 |
| 817 | 3300014325 | Ga0163163_12388977 | Ga0163163_123889772 | 114 |
| 818 | 3300014325 | Ga0163163_13186746 | Ga0163163_131867462 | 114 |
| 819 | 3300014326 | Ga0157380_10001564 | Ga0157380_1000156415 | 114 |
| 820 | 3300014326 | Ga0157380_10531573 | Ga0157380_105315732 | 114 |
| 821 | 3300014745 | Ga0157377_11288283 | Ga0157377_112882832 | 114 |
| 822 | 3300014968 | Ga0157379_10010571 | Ga0157379_100105718 | 114 |
| 823 | 3300014968 | Ga0157379_10047949 | Ga0157379_100479495 | 114 |
| 824 | 3300014968 | Ga0157379_10999508 | Ga0157379_109995082 | 114 |
| 825 | 3300014969 | Ga0157376_11074029 | Ga0157376_110740292 | 114 |
| 826 | 3300017792 | Ga0163161_10145390 | Ga0163161_101453901 | 114 |
| 827 | 3300025315 | Ga0207697_10036312 | Ga0207697_100363121 | 114 |
| 828 | 3300025315 | Ga0207697_10110271 | Ga0207697_101102712 | 114 |
| 829 | 3300025321 | Ga0207656_10091976 | Ga0207656_100919762 | 114 |
| 830 | 3300025893 | Ga0207682_10013198 | Ga0207682_100131982 | 114 |
| 831 | 3300025893 | Ga0207682_10024588 | Ga0207682_100245882 | 114 |
| 832 | 3300025893 | Ga0207682_10130831 | Ga0207682_101308312 | 114 |
| 833 | 3300025899 | Ga0207642_10001813 | Ga0207642_100018133 | 114 |
| 834 | 3300025903 | Ga0207680_10004093 | Ga0207680_100040932 | 114 |
| 835 | 3300025903 | Ga0207680_10771515 | Ga0207680_107715152 | 114 |
| 836 | 3300025906 | Ga0207699_10790676 | Ga0207699_107906762 | 114 |
| 837 | 3300025907 | Ga0207645_10002088 | Ga0207645_100020889 | 114 |
| 838 | 3300025908 | Ga0207643_10029590 | Ga0207643_100295904 | 114 |
| 839 | 3300025918 | Ga0207662_10338305 | Ga0207662_103383052 | 114 |
| 840 | 3300025918 | Ga0207662_10575494 | Ga0207662_105754942 | 114 |
| 841 | 3300025919 | Ga0207657_10113522 | Ga0207657_101135222 | 114 |
| 842 | 3300025919 | Ga0207657_10177437 | Ga0207657_101774372 | 114 |
| 843 | 3300025920 | Ga0207649_10046929 | Ga0207649_100469293 | 114 |
| 844 | 3300025923 | Ga0207681_10000967 | Ga0207681_1000096711 | 114 |
| 845 | 3300025923 | Ga0207681_10830657 | Ga0207681_108306572 | 114 |
| 846 | 3300025925 | Ga0207650_10014689 | Ga0207650_100146894 | 114 |
| 847 | 3300025925 | Ga0207650_10554415 | Ga0207650_105544152 | 114 |
| 848 | 3300025925 | Ga0207650_10777031 | Ga0207650_107770312 | 114 |
| 849 | 3300025926 | Ga0207659_10383587 | Ga0207659_103835872 | 114 |
| 850 | 3300025926 | Ga0207659_10578344 | Ga0207659_105783441 | 114 |
| 851 | 3300025926 | Ga0207659_10824796 | Ga0207659_108247962 | 114 |
| 852 | 3300025927 | Ga0207687_10900063 | Ga0207687_109000632 | 114 |
| 853 | 3300025931 | Ga0207644_10000278 | Ga0207644_1000027834 | 114 |
| 854 | 3300025931 | Ga0207644_10022498 | Ga0207644_100224984 | 114 |
| 855 | 3300025931 | Ga0207644_10710444 | Ga0207644_107104441 | 114 |
| 856 | 3300025932 | Ga0207690_10270139 | Ga0207690_102701392 | 114 |
| 857 | 3300025933 | Ga0207706_10011095 | Ga0207706_100110952 | 114 |
| 858 | 3300025933 | Ga0207706_10038294 | Ga0207706_100382944 | 114 |
| 859 | 3300025933 | Ga0207706_10224079 | Ga0207706_102240792 | 114 |
| 860 | 3300025933 | Ga0207706_10384106 | Ga0207706_103841062 | 114 |
| 861 | 3300025934 | Ga0207686_10019438 | Ga0207686_100194382 | 114 |
| 862 | 3300025935 | Ga0207709_10092825 | Ga0207709_100928252 | 114 |
| 863 | 3300025936 | Ga0207670_11424459 | Ga0207670_114244592 | 114 |
| 864 | 3300025937 | Ga0207669_10002687 | Ga0207669_100026872 | 114 |
| 865 | 3300025937 | Ga0207669_10109216 | Ga0207669_101092162 | 114 |
| 866 | 3300025940 | Ga0207691_10006361 | Ga0207691_100063614 | 114 |
| 867 | 3300025940 | Ga0207691_10041139 | Ga0207691_100411396 | 114 |
| 868 | 3300025940 | Ga0207691_10062163 | Ga0207691_100621632 | 114 |
| 869 | 3300025940 | Ga0207691_10106912 | Ga0207691_101069122 | 114 |
| 870 | 3300025940 | Ga0207691_10714400 | Ga0207691_107144001 | 114 |
| 871 | 3300025941 | Ga0207711_10019406 | Ga0207711_100194066 | 114 |
| 872 | 3300025941 | Ga0207711_10038028 | Ga0207711_100380285 | 114 |
| 873 | 3300025941 | Ga0207711_10055496 | Ga0207711_100554962 | 114 |
| 874 | 3300025941 | Ga0207711_10100159 | Ga0207711_101001593 | 114 |
| 875 | 3300025941 | Ga0207711_10895220 | Ga0207711_108952202 | 114 |
| 876 | 3300025942 | Ga0207689_10008584 | Ga0207689_1000858410 | 114 |
| 877 | 3300025945 | Ga0207679_10428307 | Ga0207679_104283072 | 114 |
| 878 | 3300025960 | Ga0207651_10270837 | Ga0207651_102708372 | 114 |
| 879 | 3300025961 | Ga0207712_10449324 | Ga0207712_104493242 | 114 |
| 880 | 3300025972 | Ga0207668_10047628 | Ga0207668_100476283 | 114 |
| 881 | 3300025981 | Ga0207640_11553041 | Ga0207640_115530412 | 114 |
| 882 | 3300025986 | Ga0207658_10002231 | Ga0207658_1000223110 | 114 |
| 883 | 3300026023 | Ga0207677_10087009 | Ga0207677_100870092 | 114 |
| 884 | 3300026023 | Ga0207677_10593827 | Ga0207677_105938271 | 114 |
| 885 | 3300026023 | Ga0207677_11509366 | Ga0207677_115093662 | 114 |
| 886 | 3300026023 | Ga0207677_11992603 | Ga0207677_119926031 | 114 |
| 887 | 3300026035 | Ga0207703_10012466 | Ga0207703_100124662 | 114 |
| 888 | 3300026041 | Ga0207639_11239149 | Ga0207639_112391491 | 114 |
| 889 | 3300026075 | Ga0207708_10091222 | Ga0207708_100912223 | 114 |
| 890 | 3300026075 | Ga0207708_10422056 | Ga0207708_104220562 | 114 |
| 891 | 3300026078 | Ga0207702_10097785 | Ga0207702_100977853 | 114 |
| 892 | 3300026088 | Ga0207641_10006486 | Ga0207641_100064868 | 114 |
| 893 | 3300026088 | Ga0207641_10157257 | Ga0207641_101572572 | 114 |
| 894 | 3300026089 | Ga0207648_10003517 | Ga0207648_1000351710 | 114 |
| 895 | 3300026089 | Ga0207648_10943619 | Ga0207648_109436192 | 114 |
| 896 | 3300026095 | Ga0207676_10027632 | Ga0207676_100276323 | 114 |
| 897 | 3300026095 | Ga0207676_10129451 | Ga0207676_101294512 | 114 |
| 898 | 3300026095 | Ga0207676_11515846 | Ga0207676_115158462 | 114 |
| 899 | 3300026118 | Ga0207675_100001416 | Ga0207675_10000141617 | 114 |
| 900 | 3300026121 | Ga0207683_10009129 | Ga0207683_100091292 | 114 |
| 901 | 3300026121 | Ga0207683_10016135 | Ga0207683_100161352 | 114 |
| 902 | 3300026121 | Ga0207683_10105127 | Ga0207683_101051273 | 114 |
| 903 | 3300026121 | Ga0207683_10545982 | Ga0207683_105459822 | 114 |
| 904 | 3300026121 | Ga0207683_10798456 | Ga0207683_107984562 | 114 |
| 905 | 3300026121 | Ga0207683_10937691 | Ga0207683_109376912 | 114 |
| 906 | 3300026142 | Ga0207698_10127571 | Ga0207698_101275712 | 114 |
| 907 | 3300026142 | Ga0207698_10441685 | Ga0207698_104416852 | 114 |
| 908 | 3300027360 | Ga0209969_1002240 | Ga0209969_10022404 | 114 |
| 909 | 3300027364 | Ga0209967_1004872 | Ga0209967_10048723 | 114 |
| 910 | 3300027378 | Ga0209981_1003673 | Ga0209981_10036732 | 114 |
| 911 | 3300027395 | Ga0209996_1019517 | Ga0209996_10195172 | 114 |
| 912 | 3300027462 | Ga0210000_1001764 | Ga0210000_10017644 | 114 |
| 913 | 3300027471 | Ga0209995_1002050 | Ga0209995_10020504 | 114 |
| 914 | 3300027526 | Ga0209968_1003838 | Ga0209968_10038382 | 114 |
| 915 | 3300027543 | Ga0209999_1001732 | Ga0209999_10017323 | 114 |
| 916 | 3300027614 | Ga0209970_1022078 | Ga0209970_10220782 | 114 |
| 917 | 3300027665 | Ga0209983_1036827 | Ga0209983_10368272 | 114 |
| 918 | 3300027682 | Ga0209971_1021982 | Ga0209971_10219822 | 114 |
| 919 | 3300027695 | Ga0209966_1045950 | Ga0209966_10459502 | 114 |
| 920 | 3300028380 | Ga0268265_10007737 | Ga0268265_100077378 | 114 |
| 921 | 3300028381 | Ga0268264_10004913 | Ga0268264_100049139 | 114 |
| 922 | 3300028381 | Ga0268264_10099285 | Ga0268264_100992852 | 114 |
| 923 | 3300028794 | Ga0307515_10000179 | Ga0307515_1000017962 | 114 |
| 924 | 3300028794 | Ga0307515_10000586 | Ga0307515_1000058653 | 114 |
| 925 | 3300028794 | Ga0307515_10236777 | Ga0307515_102367772 | 114 |
| 926 | 3300031456 | Ga0307513_10236611 | Ga0307513_102366112 | 114 |
| 927 | 3300031456 | Ga0307513_10962798 | Ga0307513_109627981 | 114 |
| 928 | 3300031616 | Ga0307508_10000122 | Ga0307508_100001228 | 114 |
| 929 | 3300031649 | Ga0307514_10272910 | Ga0307514_102729102 | 114 |
| 930 | 3300031730 | Ga0307516_10029866 | Ga0307516_100298662 | 114 |
| 931 | 3300033179 | Ga0307507_10069984 | Ga0307507_100699845 | 114 |
| 932 | 3300035111 | Ga0373923_0071975 | Ga0373923_0071975_282_626 | 114 |
| 933 | 3300035116 | Ga0373945_0008025 | Ga0373945_0008025_1249_1593 | 114 |
| 934 | 3300035170 | Ga0373943_0173390 | Ga0373943_0173390_441_785 | 114 |
| 935 | 3300035172 | Ga0373955_0112668 | Ga0373955_0112668_420_764 | 114 |
| 936 | 3300035695 | Ga0373927_0261288 | Ga0373927_0261288_471_815 | 114 |
| 937 | 3300035724 | Ga0373933_0295583 | Ga0373933_0295583_120_464 | 114 |
| 938 | 3300035725 | Ga0373947_0020189 | Ga0373947_0020189_692_1036 | 114 |
| 939 | 3300036401 | Ga0373937_0081817 | Ga0373937_0081817_391_735 | 114 |
| 940 | 3300037068 | Ga0373925_0033167 | Ga0373925_0033167_2137_2481 | 114 |
| 941 | 3300037068 | Ga0373925_0806431 | Ga0373925_0806431_336_680 | 114 |
| 942 | 3300039437 | Ga0436365_1108553 | Ga0436365_1108553_460_804 | 114 |
| 943 | 3300041456 | Ga0451795_0723237 | Ga0451795_0723237_1443_1838 | 114 |
| 944 | 3300041459 | Ga0451800_0129709 | Ga0451800_0129709_19_363 | 114 |
| 945 | 3300041459 | Ga0451800_1183513 | Ga0451800_1183513_42_386 | 114 |
| 946 | 3300041460 | Ga0451802_0213386 | Ga0451802_0213386_181_576 | 114 |
| 947 | 3300041460 | Ga0451802_0459691 | Ga0451802_0459691_730_1074 | 114 |
| 948 | 3300041491 | Ga0451833_0412951 | Ga0451833_0412951_276_671 | 114 |
| 949 | 3300041492 | Ga0451835_0304909 | Ga0451835_0304909_80_424 | 114 |
| 950 | 3300041496 | Ga0451839_0471582 | Ga0451839_0471582_257_601 | 114 |
| 951 | 3300041496 | Ga0451839_1533245 | Ga0451839_1533245_215_622 | 114 |
| 952 | 3300041505 | Ga0451849_0264779 | Ga0451849_0264779_162_506 | 114 |
| 953 | 3300041505 | Ga0451849_1033926 | Ga0451849_1033926_306_701 | 114 |
| 954 | 3300041509 | Ga0451843_0009642 | Ga0451843_0009642_1339_1734 | 114 |
| 955 | 3300041512 | Ga0451853_2066207 | Ga0451853_2066207_703_1098 | 114 |
| 956 | 3300046459 | Ga0495629_0221240 | Ga0495629_0221240_338_682 | 114 |
| 957 | 3300046472 | Ga0495580_0070354 | Ga0495580_0070354_725_1069 | 114 |
| 958 | 3300046472 | Ga0495580_0360701 | Ga0495580_0360701_205_549 | 114 |
| 959 | 3300046473 | Ga0495582_0277524 | Ga0495582_0277524_578_922 | 114 |
| 960 | 3300046512 | Ga0495610_0012246 | Ga0495610_0012246_3058_3453 | 114 |
| 961 | 3300046515 | Ga0495620_0368431 | Ga0495620_0368431_47_454 | 114 |
| 962 | 3300046517 | Ga0495630_0694475 | Ga0495630_0694475_180_539 | 114 |
| 963 | 3300046519 | Ga0495632_0099632 | Ga0495632_0099632_66_473 | 114 |
| 964 | 3300046522 | Ga0495643_0041054 | Ga0495643_0041054_615_1022 | 114 |
| 965 | 3300046537 | Ga0495598_0038050 | Ga0495598_0038050_604_948 | 114 |
| 966 | 3300046539 | Ga0495621_0128326 | Ga0495621_0128326_564_908 | 114 |
| 967 | 3300046539 | Ga0495621_0478782 | Ga0495621_0478782_149_493 | 114 |
| 968 | 3300046543 | Ga0495645_0088941 | Ga0495645_0088941_394_738 | 114 |
| 969 | 3300046558 | Ga0495633_0293281 | Ga0495633_0293281_322_666 | 114 |
| 970 | 3300046615 | Ga0495656_0094696 | Ga0495656_0094696_68_412 | 114 |
| 971 | 3300046642 | Ga0495634_0612452 | Ga0495634_0612452_46_390 | 114 |
| 972 | 3300046679 | Ga0495623_0327390 | Ga0495623_0327390_130_474 | 114 |
| 973 | 3300046681 | Ga0495647_0012321 | Ga0495647_0012321_1570_1914 | 114 |
| 974 | 3300046681 | Ga0495647_0374932 | Ga0495647_0374932_75_419 | 114 |
| 975 | 3300046683 | Ga0495658_0039204 | Ga0495658_0039204_1029_1373 | 114 |
| 976 | 3300046683 | Ga0495658_0063173 | Ga0495658_0063173_1774_2118 | 114 |
| 977 | 3300046683 | Ga0495658_0441988 | Ga0495658_0441988_391_735 | 114 |
| 978 | 3300046689 | Ga0495613_0161628 | Ga0495613_0161628_258_602 | 114 |
| 979 | 3300046691 | Ga0495670_0188188 | Ga0495670_0188188_265_609 | 114 |
| 980 | 3300047444 | Ga0495675_0403243 | Ga0495675_0403243_36_380 | 114 |
| 981 | 3300047470 | Ga0495681_0291429 | Ga0495681_0291429_16_360 | 114 |
| 982 | 3300047472 | Ga0495686_0201281 | Ga0495686_0201281_26_433 | 114 |
| 983 | 3300048904 | Ga0496101_0190107 | Ga0496101_0190107_1133_1543 | 114 |
| 984 | 3300048907 | Ga0496104_0734914 | Ga0496104_0734914_146_490 | 114 |
| 985 | 3300048910 | Ga0496107_0790580 | Ga0496107_0790580_305_649 | 114 |
| 986 | 3300048911 | Ga0496108_0040663 | Ga0496108_0040663_2883_3227 | 114 |
| 987 | 3300048911 | Ga0496108_1660631 | Ga0496108_1660631_156_500 | 114 |
| 988 | 3300048912 | Ga0496109_0389761 | Ga0496109_0389761_234_578 | 114 |
| 989 | 3300048913 | Ga0496110_0389172 | Ga0496110_0389172_792_1136 | 114 |
| 990 | 3300048914 | Ga0496111_0947198 | Ga0496111_0947198_209_553 | 114 |
| 991 | 3300048917 | Ga0496114_0067421 | Ga0496114_0067421_2255_2599 | 114 |
| 992 | 3300050493 | nmdc:mga0k408_241823_c1 | nmdc:mga0k408_241823_c1_56_463 | 114 |
| 993 | 3300050496 | nmdc:mga07m45_52835_c1 | nmdc:mga07m45_52835_c1_674_1069 | 114 |
| 994 | 3300050511 | nmdc:mga08y16_1106325_c1 | nmdc:mga08y16_1106325_c1_391_735 | 114 |
| 995 | 3300053078 | Ga0495612_0190400 | Ga0495612_0190400_545_889 | 114 |
| 996 | 3300053085 | Ga0495619_0052855 | Ga0495619_0052855_950_1294 | 114 |
| 997 | 3300053088 | Ga0500644_0220452 | Ga0500644_0220452_357_752 | 114 |
| 998 | 3300053126 | Ga0500621_223356 | Ga0500621_223356_216_611 | 114 |
| 999 | 3300053139 | Ga0500568_0090637 | Ga0500568_0090637_11_505 | 114 |
| 1000 | 3300053739 | Ga0500587_002054 | Ga0500587_002054_190_585 | 114 |
| 1001 | iso_pu_bacteria | 2585428062 | 2587756806 | 114 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lzd-assembly1.cif.gz_B | crystal structure of dph2 from pyrococcus horikoshii with 4fe-4s cluster | 0.7429 | 91 | 114 |
| 4lwo-assembly2.cif.gz_G | crystal structure of prmt6 | 0.3873 | 10 | 36 |
| 6s77-assembly1.cif.gz_A | crystal structure of carm1 n265y mutant in complex with inhibitor aa183 | 0.3752 | 10 | 38 |
| 5lv3-assembly1.cif.gz_D | crystal structure of mouse carm1 in complex with ligand lh1561br | 0.3747 | 10 | 38 |
| 7mi5-assembly1.cif.gz_F | asymmetrical pam-non pam prespacer bound cas4/cas1/cas2 complex | 0.3698 | 13 | 86 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3lzcA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Diphthamide synthesis DPH1/DPH2 domain 1 | 0.7314 | 91 | 114 | 3.40.50.11840 |
| af_Q9FHS4_48_158_3.40.1440.10 | Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease | 0.6248 | 8 | 106 | 3.40.1440.10 |
| af_A4I1H7_2_94_3.40.1440.10 | Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease | 0.58 | 10 | 97 | 3.40.1440.10 |
| af_Q9P7M3_4_108_3.40.1440.10 | Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease | 0.5623 | 11 | 98 | 3.40.1440.10 |
| af_Q9FHS4_48_158_3.40.1440.10 | Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease | 0.4713 | 8 | 106 | 3.40.1440.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A246JET8-F1-model_v4 | GIY-YIG domain-containing protein | 0.9968 | 16 | 114 |
|
| AF-A0A536Y8U5-F1-model_v4 | GIY-YIG nuclease family protein | 0.9933 | 11 | 114 |
|
| AF-A0A520B9W0-F1-model_v4 | GIY-YIG nuclease family protein | 0.9928 | 19 | 114 |
|
| AF-F5Y6F3-F1-model_v4 | GIY-YIG domain-containing protein | 0.9907 | 41 | 114 |
|
| AF-A0A848VHQ4-F1-model_v4 | GIY-YIG domain-containing protein | 0.9856 | 10 | 114 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar