F487851
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 999 | 361 | 998 | 252 |
Family's Representative Sequence
| Representative Sequence | 3300046616|Ga0495668_0000837|Ga0495668_0000837_7412_8176 |
| Length | 254 |
| Sequence | MAGIVRIDDEVITTDDFIRTLKLSGQFEGLVEQMVRDRLTARAARQAGLQLTPEQIQERADEFRRALGLHRAADTNHYLDALGVSLDEFEAWIVDGLYQEKMLAQVCSEQAVSRYFSLNSPRFDSVEVSHIVLDGEGAAREMMSVLQEEPETFAEMAREHSIDTDTRGQGGVIGKVLRGSLKGDIEARVFNARAGELLGPFPSPDGAAYEIFCVNARHPAALDPDTAAEIRRLLREEWLMARAQEHVIEACTVP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 49 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 50 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 51 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 52 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 53 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 54 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 55 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 83 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 84 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 85 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 96 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 145 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 151 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 152 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 153 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 154 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 155 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 156 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 157 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 158 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 159 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 160 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 161 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 162 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 163 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 164 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 165 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 166 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 167 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 168 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 169 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 170 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 171 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 172 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 173 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 174 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 175 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 176 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 177 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 178 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 179 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 180 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 181 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 182 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 183 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 184 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 185 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 186 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 187 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 188 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 189 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 190 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 191 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 192 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 193 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 194 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 195 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 296 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 297 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 298 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 299 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 300 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 301 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 304 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 305 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 306 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 307 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 308 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 309 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 310 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 311 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 312 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 313 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 314 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 315 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 316 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 317 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 318 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 319 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 332 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 339 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 340 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 341 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 342 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 343 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 344 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 346 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 347 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 348 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 349 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 361 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.7 |
| Metatranscriptomes | 1.2 |
| Isolates | 0.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.21 |
| Nodule | 0.1 |
| Rhizoplane | 5.91 |
| Rhizosphere | 76.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000899 | 3300001979 | Bacteria | 13168 |
| 2 | JGI24739J22299_10005340 | 3300001989 | Bacteria | 4892 |
| 3 | JGI24735J21928_10008041 | 3300002067 | Bacteria | 3424 |
| 4 | JGI24738J21930_10001023 | 3300002075 | Bacteria | 7984 |
| 5 | JGI25156J39149_1000633 | 3300002705 | Bacteria | 19292 |
| 6 | JGI25156J39149_1000705 | 3300002705 | Bacteria | 17848 |
| 7 | JGI25156J39149_1001702 | 3300002705 | Bacteria | 8849 |
| 8 | JGI25165J46597_1000853 | 3300003214 | Bacteria | 22146 |
| 9 | Ga0007409J51694_1014567 | 3300003575 | Bacteria | 921 |
| 10 | Ga0007409J51694_1027038 | 3300003575 | Bacteria | 2070 |
| 11 | Ga0055533_1001314 | 3300003756 | Bacteria | 6751 |
| 12 | Ga0055532_1000014 | 3300003758 | Bacteria | 344702 |
| 13 | Ga0055525_1000028 | 3300003759 | Bacteria | 331683 |
| 14 | Ga0055527_1000013 | 3300003760 | Bacteria | 347416 |
| 15 | Ga0055527_1000055 | 3300003760 | Bacteria | 97952 |
| 16 | Ga0055527_1007461 | 3300003760 | Bacteria | 1334 |
| 17 | Ga0055535_1000011 | 3300003761 | Bacteria | 347416 |
| 18 | Ga0055535_1000083 | 3300003761 | Bacteria | 104680 |
| 19 | Ga0055542_1000018 | 3300003762 | Bacteria | 347416 |
| 20 | Ga0055542_1001335 | 3300003762 | Bacteria | 12874 |
| 21 | Ga0055529_1000017 | 3300003763 | Bacteria | 347416 |
| 22 | Ga0055526_1001294 | 3300003771 | Bacteria | 17952 |
| 23 | Ga0055526_1008224 | 3300003771 | Bacteria | 5244 |
| 24 | Ga0055526_1010588 | 3300003771 | Bacteria | 4271 |
| 25 | Ga0055526_1043602 | 3300003771 | Bacteria | 1091 |
| 26 | Ga0055537_1000292 | 3300003773 | Bacteria | 35472 |
| 27 | Ga0055524_1001049 | 3300003775 | Bacteria | 17036 |
| 28 | Ga0055524_1019724 | 3300003775 | Bacteria | 2295 |
| 29 | Ga0055536_1000462 | 3300003781 | Bacteria | 28605 |
| 30 | Ga0055534_1000046 | 3300003784 | Bacteria | 98150 |
| 31 | Ga0055534_1000935 | 3300003784 | Bacteria | 13072 |
| 32 | Ga0055534_1001910 | 3300003784 | Bacteria | 7687 |
| 33 | Ga0055528_1000226 | 3300003790 | Bacteria | 47010 |
| 34 | Ga0065165_1001458 | 3300005262 | Bacteria | 25539 |
| 35 | Ga0065714_10106686 | 3300005288 | Bacteria | 1544 |
| 36 | Ga0068869_100082861 | 3300005334 | Bacteria | 2398 |
| 37 | Ga0070666_10072573 | 3300005335 | Bacteria | 2343 |
| 38 | Ga0070666_10367820 | 3300005335 | Bacteria | 1031 |
| 39 | Ga0070660_100008874 | 3300005339 | Bacteria | 7049 |
| 40 | Ga0070661_100006929 | 3300005344 | Bacteria | 7823 |
| 41 | Ga0070661_100020072 | 3300005344 | Bacteria | 4763 |
| 42 | Ga0070671_100006052 | 3300005355 | Bacteria | 9642 |
| 43 | Ga0070673_100405839 | 3300005364 | Bacteria | 1219 |
| 44 | Ga0070659_100002890 | 3300005366 | Bacteria | 12223 |
| 45 | Ga0070659_100009715 | 3300005366 | Bacteria | 7069 |
| 46 | Ga0070659_100076255 | 3300005366 | Bacteria | 2673 |
| 47 | Ga0070659_100368174 | 3300005366 | Bacteria | 1208 |
| 48 | Ga0070667_100020129 | 3300005367 | Bacteria | 5540 |
| 49 | Ga0070667_100129145 | 3300005367 | Bacteria | 2204 |
| 50 | Ga0070663_100018004 | 3300005455 | Bacteria | 4623 |
| 51 | Ga0070663_100047134 | 3300005455 | Bacteria | 3053 |
| 52 | Ga0070663_100067888 | 3300005455 | Bacteria | 2588 |
| 53 | Ga0070663_100121486 | 3300005455 | Bacteria | 1974 |
| 54 | Ga0068867_100702224 | 3300005459 | Bacteria | 893 |
| 55 | Ga0070684_100095995 | 3300005535 | Bacteria | 2642 |
| 56 | Ga0070665_100006580 | 3300005548 | Bacteria | 11812 |
| 57 | Ga0070665_100015860 | 3300005548 | Bacteria | 7564 |
| 58 | Ga0070665_100058761 | 3300005548 | Bacteria | 3855 |
| 59 | Ga0070665_100143386 | 3300005548 | Bacteria | 2392 |
| 60 | Ga0068855_100108136 | 3300005563 | Bacteria | 3194 |
| 61 | Ga0068855_100319134 | 3300005563 | Bacteria | 1717 |
| 62 | Ga0070664_100007998 | 3300005564 | Bacteria | 8543 |
| 63 | Ga0070664_100014507 | 3300005564 | Bacteria | 6427 |
| 64 | Ga0070664_100099806 | 3300005564 | Bacteria | 2523 |
| 65 | Ga0070664_100327093 | 3300005564 | Bacteria | 1390 |
| 66 | Ga0070664_100347145 | 3300005564 | Bacteria | 1349 |
| 67 | Ga0068854_100594962 | 3300005578 | Bacteria | 944 |
| 68 | Ga0068856_100273361 | 3300005614 | Bacteria | 1706 |
| 69 | Ga0068852_100016870 | 3300005616 | Bacteria | 5711 |
| 70 | Ga0068852_100215563 | 3300005616 | Bacteria | 1823 |
| 71 | Ga0068852_100442187 | 3300005616 | Bacteria | 1286 |
| 72 | Ga0068859_100001005 | 3300005617 | Bacteria | 28915 |
| 73 | Ga0068859_100014788 | 3300005617 | Bacteria | 7840 |
| 74 | Ga0068864_100082860 | 3300005618 | Bacteria | 2815 |
| 75 | Ga0068861_100067529 | 3300005719 | Bacteria | 2760 |
| 76 | Ga0068863_100006932 | 3300005841 | Bacteria | 11105 |
| 77 | Ga0068863_100037016 | 3300005841 | Bacteria | 4646 |
| 78 | Ga0068863_100044357 | 3300005841 | Bacteria | 4221 |
| 79 | Ga0068858_100012281 | 3300005842 | Bacteria | 8078 |
| 80 | Ga0068860_100003507 | 3300005843 | Bacteria | 16149 |
| 81 | Ga0068860_100058586 | 3300005843 | Bacteria | 3661 |
| 82 | Ga0068862_100041066 | 3300005844 | Bacteria | 3935 |
| 83 | Ga0075365_10106808 | 3300006038 | Bacteria | 1921 |
| 84 | Ga0075368_10033679 | 3300006042 | Bacteria | 1994 |
| 85 | Ga0075368_10068067 | 3300006042 | Bacteria | 1434 |
| 86 | Ga0075368_10078548 | 3300006042 | Bacteria | 1341 |
| 87 | Ga0075363_100006342 | 3300006048 | Bacteria | 5359 |
| 88 | Ga0075363_100212343 | 3300006048 | Bacteria | 1108 |
| 89 | Ga0075364_10025720 | 3300006051 | Bacteria | 3749 |
| 90 | Ga0075362_10025882 | 3300006177 | Bacteria | 2502 |
| 91 | Ga0075362_10027729 | 3300006177 | Bacteria | 2426 |
| 92 | Ga0075362_10264130 | 3300006177 | Bacteria | 849 |
| 93 | Ga0075367_10009348 | 3300006178 | Bacteria | 5120 |
| 94 | Ga0075367_10014135 | 3300006178 | Bacteria | 4314 |
| 95 | Ga0075369_10005693 | 3300006186 | Bacteria | 4674 |
| 96 | Ga0075369_10021807 | 3300006186 | Bacteria | 2637 |
| 97 | Ga0075366_10001522 | 3300006195 | Bacteria | 11584 |
| 98 | Ga0075366_10118078 | 3300006195 | Bacteria | 1598 |
| 99 | Ga0097621_100205771 | 3300006237 | Bacteria | 1710 |
| 100 | Ga0075370_10001089 | 3300006353 | Bacteria | 11320 |
| 101 | Ga0075370_10001738 | 3300006353 | Bacteria | 9699 |
| 102 | Ga0075370_10016598 | 3300006353 | Bacteria | 3964 |
| 103 | Ga0068871_100099302 | 3300006358 | Bacteria | 2437 |
| 104 | Ga0068871_100249490 | 3300006358 | Bacteria | 1546 |
| 105 | Ga0068865_100028606 | 3300006881 | Bacteria | 3691 |
| 106 | Ga0097620_100001005 | 3300006931 | Bacteria | 28915 |
| 107 | Ga0097620_100014788 | 3300006931 | Bacteria | 7840 |
| 108 | Ga0105251_10000537 | 3300009011 | Bacteria | 35741 |
| 109 | Ga0105244_10038955 | 3300009036 | Bacteria | 2476 |
| 110 | Ga0105250_10117335 | 3300009092 | Bacteria | 1092 |
| 111 | Ga0105240_10006910 | 3300009093 | Bacteria | 16581 |
| 112 | Ga0105240_10014768 | 3300009093 | Bacteria | 10648 |
| 113 | Ga0105240_10031257 | 3300009093 | Bacteria | 6907 |
| 114 | Ga0105240_10060249 | 3300009093 | Bacteria | 4732 |
| 115 | Ga0105240_10355988 | 3300009093 | Bacteria | 1659 |
| 116 | Ga0105245_10134894 | 3300009098 | Bacteria | 2319 |
| 117 | Ga0105247_10025965 | 3300009101 | Bacteria | 3536 |
| 118 | Ga0105241_10004372 | 3300009174 | Bacteria | 10442 |
| 119 | Ga0105242_10072861 | 3300009176 | Bacteria | 2854 |
| 120 | Ga0105242_10155959 | 3300009176 | Bacteria | 1994 |
| 121 | Ga0105242_10178369 | 3300009176 | Bacteria | 1872 |
| 122 | Ga0105248_10001355 | 3300009177 | Bacteria | 27299 |
| 123 | Ga0105248_10045851 | 3300009177 | Bacteria | 4901 |
| 124 | Ga0105248_10128971 | 3300009177 | Bacteria | 2853 |
| 125 | Ga0105248_10167403 | 3300009177 | Bacteria | 2477 |
| 126 | Ga0105237_10018129 | 3300009545 | Bacteria | 7288 |
| 127 | Ga0105237_10488999 | 3300009545 | Bacteria | 1237 |
| 128 | Ga0105238_10032616 | 3300009551 | Bacteria | 5300 |
| 129 | Ga0105238_10354897 | 3300009551 | Bacteria | 1455 |
| 130 | Ga0105238_10620251 | 3300009551 | Bacteria | 1090 |
| 131 | Ga0105249_10012890 | 3300009553 | Bacteria | 7376 |
| 132 | Ga0105249_10847425 | 3300009553 | Bacteria | 980 |
| 133 | Ga0105239_10087316 | 3300010375 | Bacteria | 3438 |
| 134 | Ga0105239_10103984 | 3300010375 | Bacteria | 3144 |
| 135 | Ga0105239_10148953 | 3300010375 | Bacteria | 2611 |
| 136 | Ga0105246_10311014 | 3300011119 | Bacteria | 1276 |
| 137 | Ga0157369_10021832 | 3300013105 | Bacteria | 7158 |
| 138 | Ga0157369_10584392 | 3300013105 | Bacteria | 1153 |
| 139 | Ga0157374_10000310 | 3300013296 | Bacteria | 45228 |
| 140 | Ga0157374_10079869 | 3300013296 | Bacteria | 3100 |
| 141 | Ga0163162_10000873 | 3300013306 | Bacteria | 28119 |
| 142 | Ga0163162_10053681 | 3300013306 | Bacteria | 4051 |
| 143 | Ga0163162_10086494 | 3300013306 | Bacteria | 3213 |
| 144 | Ga0163162_10480133 | 3300013306 | Bacteria | 1374 |
| 145 | Ga0163162_11045007 | 3300013306 | Bacteria | 924 |
| 146 | Ga0157372_10370829 | 3300013307 | Bacteria | 1668 |
| 147 | Ga0157375_10005109 | 3300013308 | Bacteria | 11389 |
| 148 | Ga0157375_10655388 | 3300013308 | Bacteria | 1206 |
| 149 | Ga0163163_10176536 | 3300014325 | Bacteria | 2183 |
| 150 | Ga0157379_10140854 | 3300014968 | Bacteria | 2174 |
| 151 | Ga0157379_10235480 | 3300014968 | Bacteria | 1660 |
| 152 | Ga0182006_1125525 | 3300015261 | Bacteria | 887 |
| 153 | Ga0182007_10000566 | 3300015262 | Bacteria | 21735 |
| 154 | Ga0183361_10003 | 3300016635 | Bacteria | 577277 |
| 155 | Ga0163161_10263588 | 3300017792 | Bacteria | 1346 |
| 156 | Ga0206356_10783655 | 3300020070 | Bacteria | 1003 |
| 157 | Ga0209566_103550 | 3300025225 | Bacteria | 2354 |
| 158 | Ga0209674_100049 | 3300025226 | Bacteria | 346969 |
| 159 | Ga0209674_100051 | 3300025226 | Bacteria | 338399 |
| 160 | Ga0209672_100027 | 3300025228 | Bacteria | 344500 |
| 161 | Ga0209672_100040 | 3300025228 | Bacteria | 278858 |
| 162 | Ga0209672_100139 | 3300025228 | Bacteria | 69191 |
| 163 | Ga0209147_100035 | 3300025229 | Bacteria | 344500 |
| 164 | Ga0209147_100048 | 3300025229 | Bacteria | 278858 |
| 165 | Ga0209563_100011 | 3300025230 | Bacteria | 1187808 |
| 166 | Ga0209563_101052 | 3300025230 | Bacteria | 7972 |
| 167 | Ga0209258_100052 | 3300025242 | Bacteria | 344500 |
| 168 | Ga0209258_100070 | 3300025242 | Bacteria | 278858 |
| 169 | Ga0209677_102480 | 3300025253 | Bacteria | 6905 |
| 170 | Ga0209148_1000064 | 3300025254 | Bacteria | 344500 |
| 171 | Ga0209148_1000284 | 3300025254 | Bacteria | 77768 |
| 172 | Ga0209759_1000015 | 3300025256 | Bacteria | 388724 |
| 173 | Ga0209759_1000041 | 3300025256 | Bacteria | 252893 |
| 174 | Ga0209759_1000252 | 3300025256 | Bacteria | 79418 |
| 175 | Ga0209759_1013351 | 3300025256 | Bacteria | 2227 |
| 176 | Ga0209759_1016964 | 3300025256 | Bacteria | 1813 |
| 177 | Ga0209129_1015186 | 3300025258 | Bacteria | 1598 |
| 178 | Ga0209233_1000073 | 3300025261 | Bacteria | 362383 |
| 179 | Ga0209565_1000003 | 3300025263 | Bacteria | 1099648 |
| 180 | Ga0209565_1000267 | 3300025263 | Bacteria | 54064 |
| 181 | Ga0209455_1000057 | 3300025272 | Bacteria | 344500 |
| 182 | Ga0209455_1000178 | 3300025272 | Bacteria | 104960 |
| 183 | Ga0209673_1000003 | 3300025273 | Bacteria | 980859 |
| 184 | Ga0209673_1039180 | 3300025273 | Bacteria | 1371 |
| 185 | Ga0209130_1002823 | 3300025284 | Bacteria | 8079 |
| 186 | Ga0209675_1000003 | 3300025291 | Bacteria | 1003982 |
| 187 | Ga0209675_1000575 | 3300025291 | Bacteria | 26475 |
| 188 | Ga0209675_1005135 | 3300025291 | Bacteria | 5569 |
| 189 | Ga0209676_1000012 | 3300025292 | Bacteria | 841431 |
| 190 | Ga0209025_1000306 | 3300025294 | Bacteria | 109280 |
| 191 | Ga0209025_1000849 | 3300025294 | Bacteria | 48335 |
| 192 | Ga0209025_1001305 | 3300025294 | Bacteria | 34015 |
| 193 | Ga0209564_1000249 | 3300025295 | Bacteria | 115584 |
| 194 | Ga0209564_1001057 | 3300025295 | Bacteria | 33550 |
| 195 | Ga0209564_1001073 | 3300025295 | Bacteria | 32869 |
| 196 | Ga0209564_1001165 | 3300025295 | Bacteria | 30580 |
| 197 | Ga0209564_1017440 | 3300025295 | Bacteria | 2797 |
| 198 | Ga0209758_1016445 | 3300025297 | Bacteria | 3757 |
| 199 | Ga0209256_1000029 | 3300025299 | Bacteria | 415922 |
| 200 | Ga0209256_1000059 | 3300025299 | Bacteria | 272170 |
| 201 | Ga0207426_1000056 | 3300025302 | Bacteria | 373596 |
| 202 | Ga0209051_1035043 | 3300025303 | Bacteria | 1873 |
| 203 | Ga0207713_1000124 | 3300025735 | Bacteria | 122014 |
| 204 | Ga0207710_10007152 | 3300025900 | Bacteria | 4734 |
| 205 | Ga0207710_10036339 | 3300025900 | Bacteria | 2171 |
| 206 | Ga0207680_10038045 | 3300025903 | Bacteria | 2783 |
| 207 | Ga0207680_10178312 | 3300025903 | Bacteria | 1435 |
| 208 | Ga0207647_10008949 | 3300025904 | Bacteria | 7135 |
| 209 | Ga0207647_10013995 | 3300025904 | Bacteria | 5552 |
| 210 | Ga0207645_10048400 | 3300025907 | Bacteria | 2715 |
| 211 | Ga0207645_10115403 | 3300025907 | Bacteria | 1741 |
| 212 | Ga0207645_10392006 | 3300025907 | Bacteria | 933 |
| 213 | Ga0207705_10000924 | 3300025909 | Bacteria | 24006 |
| 214 | Ga0207654_10001825 | 3300025911 | Bacteria | 11043 |
| 215 | Ga0207654_10186501 | 3300025911 | Bacteria | 1356 |
| 216 | Ga0207654_10268708 | 3300025911 | Bacteria | 1150 |
| 217 | Ga0207654_10337887 | 3300025911 | Bacteria | 1034 |
| 218 | Ga0207695_10028387 | 3300025913 | Bacteria | 6207 |
| 219 | Ga0207695_10032306 | 3300025913 | Bacteria | 5729 |
| 220 | Ga0207695_10122490 | 3300025913 | Bacteria | 2567 |
| 221 | Ga0207695_10126350 | 3300025913 | Bacteria | 2519 |
| 222 | Ga0207695_10128884 | 3300025913 | Bacteria | 2489 |
| 223 | Ga0207671_10164066 | 3300025914 | Bacteria | 1722 |
| 224 | Ga0207671_10392249 | 3300025914 | Bacteria | 1104 |
| 225 | Ga0207657_10004042 | 3300025919 | Bacteria | 15582 |
| 226 | Ga0207657_10012912 | 3300025919 | Bacteria | 8213 |
| 227 | Ga0207657_10024708 | 3300025919 | Bacteria | 5556 |
| 228 | Ga0207657_10029802 | 3300025919 | Bacteria | 4961 |
| 229 | Ga0207649_10009337 | 3300025920 | Bacteria | 5367 |
| 230 | Ga0207649_10062807 | 3300025920 | Bacteria | 2342 |
| 231 | Ga0207687_10786785 | 3300025927 | Bacteria | 811 |
| 232 | Ga0207644_10045251 | 3300025931 | Bacteria | 3130 |
| 233 | Ga0207644_10153115 | 3300025931 | Bacteria | 1786 |
| 234 | Ga0207690_10002125 | 3300025932 | Bacteria | 12137 |
| 235 | Ga0207690_10010469 | 3300025932 | Bacteria | 5514 |
| 236 | Ga0207686_10036646 | 3300025934 | Bacteria | 2954 |
| 237 | Ga0207686_10113620 | 3300025934 | Bacteria | 1831 |
| 238 | Ga0207686_10266957 | 3300025934 | Bacteria | 1257 |
| 239 | Ga0207709_10097382 | 3300025935 | Bacteria | 1937 |
| 240 | Ga0207704_10064189 | 3300025938 | Bacteria | 2293 |
| 241 | Ga0207711_10019515 | 3300025941 | Bacteria | 5643 |
| 242 | Ga0207711_10050936 | 3300025941 | Bacteria | 3546 |
| 243 | Ga0207711_10091955 | 3300025941 | Bacteria | 2669 |
| 244 | Ga0207689_10048079 | 3300025942 | Bacteria | 3519 |
| 245 | Ga0207661_10183095 | 3300025944 | Bacteria | 1831 |
| 246 | Ga0207679_10000419 | 3300025945 | Bacteria | 30306 |
| 247 | Ga0207679_10028455 | 3300025945 | Bacteria | 3878 |
| 248 | Ga0207679_10084638 | 3300025945 | Bacteria | 2434 |
| 249 | Ga0207679_10377955 | 3300025945 | Bacteria | 1241 |
| 250 | Ga0207667_10007331 | 3300025949 | Bacteria | 13276 |
| 251 | Ga0207667_10059330 | 3300025949 | Bacteria | 4007 |
| 252 | Ga0207667_10432674 | 3300025949 | Bacteria | 1338 |
| 253 | Ga0207651_10342207 | 3300025960 | Bacteria | 1257 |
| 254 | Ga0207712_10081148 | 3300025961 | Bacteria | 2361 |
| 255 | Ga0207712_10111610 | 3300025961 | Bacteria | 2052 |
| 256 | Ga0207640_10176263 | 3300025981 | Bacteria | 1598 |
| 257 | Ga0207658_10145089 | 3300025986 | Bacteria | 1926 |
| 258 | Ga0207658_10176156 | 3300025986 | Bacteria | 1766 |
| 259 | Ga0207658_10245539 | 3300025986 | Bacteria | 1519 |
| 260 | Ga0207658_10319195 | 3300025986 | Bacteria | 1344 |
| 261 | Ga0207658_10697709 | 3300025986 | Bacteria | 917 |
| 262 | Ga0207703_10002618 | 3300026035 | Bacteria | 15532 |
| 263 | Ga0207639_10116247 | 3300026041 | Bacteria | 2189 |
| 264 | Ga0207639_10312752 | 3300026041 | Bacteria | 1392 |
| 265 | Ga0207678_10007448 | 3300026067 | Bacteria | 9690 |
| 266 | Ga0207678_10076009 | 3300026067 | Bacteria | 2876 |
| 267 | Ga0207678_10103641 | 3300026067 | Bacteria | 2428 |
| 268 | Ga0207702_10825272 | 3300026078 | Bacteria | 917 |
| 269 | Ga0207641_10000880 | 3300026088 | Bacteria | 31415 |
| 270 | Ga0207641_10025099 | 3300026088 | Bacteria | 4913 |
| 271 | Ga0207648_10123277 | 3300026089 | Bacteria | 2279 |
| 272 | Ga0207676_10566164 | 3300026095 | Bacteria | 1087 |
| 273 | Ga0207674_10032647 | 3300026116 | Bacteria | 5458 |
| 274 | Ga0207674_10318130 | 3300026116 | Bacteria | 1506 |
| 275 | Ga0209282_1000033 | 3300027666 | Bacteria | 141940 |
| 276 | Ga0209813_10008652 | 3300027866 | Bacteria | 2579 |
| 277 | Ga0209813_10018405 | 3300027866 | Bacteria | 1930 |
| 278 | Ga0209974_10001884 | 3300027876 | Bacteria | 7660 |
| 279 | Ga0268266_10000709 | 3300028379 | Bacteria | 45045 |
| 280 | Ga0268266_10003171 | 3300028379 | Bacteria | 16685 |
| 281 | Ga0268266_10034782 | 3300028379 | Bacteria | 4286 |
| 282 | Ga0268266_10059371 | 3300028379 | Bacteria | 3295 |
| 283 | Ga0268266_10116281 | 3300028379 | Bacteria | 2375 |
| 284 | Ga0268265_10047171 | 3300028380 | Bacteria | 3226 |
| 285 | Ga0268264_10000100 | 3300028381 | Bacteria | 227852 |
| 286 | Ga0268264_10173872 | 3300028381 | Bacteria | 1950 |
| 287 | Ga0307517_10162912 | 3300028786 | Bacteria | 1491 |
| 288 | Ga0307515_10085151 | 3300028794 | Bacteria | 4049 |
| 289 | Ga0307511_10000052 | 3300030521 | Bacteria | 96724 |
| 290 | Ga0307512_10165448 | 3300030522 | Bacteria | 1283 |
| 291 | Ga0307513_10046599 | 3300031456 | Bacteria | 4724 |
| 292 | Ga0307513_10298653 | 3300031456 | Bacteria | 1378 |
| 293 | Ga0307509_10029746 | 3300031507 | Bacteria | 6057 |
| 294 | Ga0307509_10079950 | 3300031507 | Bacteria | 3382 |
| 295 | Ga0307508_10067046 | 3300031616 | Bacteria | 3158 |
| 296 | Ga0316576_10165766 | 3300031727 | Bacteria | 1667 |
| 297 | Ga0307516_10013929 | 3300031730 | Bacteria | 8533 |
| 298 | Ga0307516_10216646 | 3300031730 | Bacteria | 1626 |
| 299 | Ga0316577_10018183 | 3300031733 | Bacteria | 3885 |
| 300 | Ga0307412_10000010 | 3300031911 | Bacteria | 421262 |
| 301 | Ga0307412_10045965 | 3300031911 | Bacteria | 2857 |
| 302 | Ga0316585_10023504 | 3300032137 | Bacteria | 1902 |
| 303 | Ga0307507_10034168 | 3300033179 | Bacteria | 5261 |
| 304 | Ga0307507_10214904 | 3300033179 | Bacteria | 1304 |
| 305 | Ga0307510_10000001 | 3300033180 | Bacteria | 1172244 |
| 306 | Ga0316574_0083285 | 3300035398 | Bacteria | 2033 |
| 307 | Ga0316582_0046141 | 3300036647 | Bacteria | 2746 |
| 308 | Ga0316584_0002509 | 3300036712 | Bacteria | 11628 |
| 309 | Ga0395899_0000019 | 3300037312 | Bacteria | 411777 |
| 310 | Ga0395899_0004562 | 3300037312 | Bacteria | 10788 |
| 311 | Ga0395899_0006365 | 3300037312 | Bacteria | 9143 |
| 312 | Ga0395900_0000307 | 3300037418 | Bacteria | 72665 |
| 313 | Ga0395900_0003711 | 3300037418 | Bacteria | 16409 |
| 314 | Ga0395900_0060982 | 3300037418 | Bacteria | 3879 |
| 315 | Ga0395898_0176730 | 3300037466 | Bacteria | 2040 |
| 316 | Ga0395905_0000004 | 3300037471 | Bacteria | 674991 |
| 317 | Ga0395905_0002221 | 3300037471 | Bacteria | 21897 |
| 318 | Ga0395905_0247073 | 3300037471 | Bacteria | 1667 |
| 319 | Ga0395905_0534808 | 3300037471 | Bacteria | 1073 |
| 320 | Ga0395901_0035147 | 3300038443 | Bacteria | 5178 |
| 321 | Ga0395901_0061437 | 3300038443 | Bacteria | 3909 |
| 322 | Ga0395901_0149380 | 3300038443 | Bacteria | 2455 |
| 323 | Ga0395901_0185486 | 3300038443 | Bacteria | 2182 |
| 324 | Ga0439433_0043792 | 3300041999 | Bacteria | 1046 |
| 325 | Ga0439448_0001081 | 3300042005 | Bacteria | 6845 |
| 326 | Ga0439449_0020912 | 3300042007 | Bacteria | 2452 |
| 327 | Ga0439449_0072318 | 3300042007 | Bacteria | 1271 |
| 328 | Ga0439455_0000629 | 3300042012 | Bacteria | 5139 |
| 329 | Ga0450892_002439 | 3300042130 | Bacteria | 1590 |
| 330 | Ga0439458_0018965 | 3300042157 | Bacteria | 1580 |
| 331 | Ga0439458_0020809 | 3300042157 | Bacteria | 1516 |
| 332 | Ga0439460_0014209 | 3300042461 | Bacteria | 2091 |
| 333 | Ga0450918_000439 | 3300042531 | Bacteria | 8897 |
| 334 | Ga0466969_0053435 | 3300044656 | Bacteria | 1982 |
| 335 | Ga0466972_0000239 | 3300044658 | Bacteria | 37769 |
| 336 | Ga0466972_0000923 | 3300044658 | Bacteria | 14156 |
| 337 | Ga0466972_0121721 | 3300044658 | Bacteria | 1230 |
| 338 | Ga0466965_0000569 | 3300044683 | Bacteria | 13376 |
| 339 | Ga0466965_0042031 | 3300044683 | Bacteria | 2253 |
| 340 | Ga0466966_0019835 | 3300044684 | Bacteria | 4422 |
| 341 | Ga0466966_0057593 | 3300044684 | Bacteria | 2456 |
| 342 | Ga0466966_0105310 | 3300044684 | Bacteria | 1741 |
| 343 | Ga0466961_0010484 | 3300044693 | Bacteria | 5910 |
| 344 | Ga0466961_0040036 | 3300044693 | Bacteria | 3004 |
| 345 | Ga0466963_0010691 | 3300044694 | Bacteria | 5569 |
| 346 | Ga0466964_0002281 | 3300044706 | Bacteria | 6808 |
| 347 | Ga0466964_0006746 | 3300044706 | Bacteria | 4282 |
| 348 | Ga0466964_0008899 | 3300044706 | Bacteria | 3776 |
| 349 | Ga0466971_0000213 | 3300044719 | Bacteria | 22471 |
| 350 | Ga0466971_0087604 | 3300044719 | Bacteria | 1423 |
| 351 | Ga0466968_0003486 | 3300044735 | Bacteria | 5818 |
| 352 | Ga0466970_0016928 | 3300044765 | Bacteria | 3762 |
| 353 | Ga0466970_0091006 | 3300044765 | Bacteria | 1655 |
| 354 | Ga0466957_0000113 | 3300044842 | Bacteria | 33535 |
| 355 | Ga0466957_0029523 | 3300044842 | Bacteria | 3270 |
| 356 | Ga0466957_0055513 | 3300044842 | Bacteria | 2421 |
| 357 | Ga0466957_0059856 | 3300044842 | Bacteria | 2335 |
| 358 | Ga0466960_0135256 | 3300044901 | Bacteria | 1305 |
| 359 | Ga0466960_0246184 | 3300044901 | Bacteria | 992 |
| 360 | Ga0466959_0008404 | 3300045049 | Bacteria | 7296 |
| 361 | Ga0466959_0035982 | 3300045049 | Bacteria | 3658 |
| 362 | Ga0466959_0049560 | 3300045049 | Bacteria | 3085 |
| 363 | Ga0466959_0071936 | 3300045049 | Bacteria | 2503 |
| 364 | Ga0466959_0170820 | 3300045049 | Bacteria | 1525 |
| 365 | Ga0466958_0020084 | 3300045836 | Bacteria | 3894 |
| 366 | Ga0466958_0039156 | 3300045836 | Bacteria | 2847 |
| 367 | Ga0466958_0098542 | 3300045836 | Bacteria | 1815 |
| 368 | Ga0466967_0014759 | 3300045976 | Bacteria | 6103 |
| 369 | Ga0466967_0027604 | 3300045976 | Bacteria | 4724 |
| 370 | Ga0466967_0062513 | 3300045976 | Bacteria | 3305 |
| 371 | Ga0495617_000342 | 3300046452 | Bacteria | 25837 |
| 372 | Ga0495617_076074 | 3300046452 | Bacteria | 1101 |
| 373 | Ga0495627_002589 | 3300046453 | Bacteria | 8551 |
| 374 | Ga0495592_0003498 | 3300046454 | Bacteria | 11273 |
| 375 | Ga0495592_0008815 | 3300046454 | Bacteria | 7574 |
| 376 | Ga0495592_0031704 | 3300046454 | Bacteria | 3993 |
| 377 | Ga0495603_0001914 | 3300046455 | Bacteria | 12279 |
| 378 | Ga0495603_0007636 | 3300046455 | Bacteria | 6511 |
| 379 | Ga0495603_0033035 | 3300046455 | Bacteria | 3113 |
| 380 | Ga0495590_0003986 | 3300046457 | Bacteria | 5996 |
| 381 | Ga0495590_0004269 | 3300046457 | Bacteria | 5776 |
| 382 | Ga0495590_0011444 | 3300046457 | Bacteria | 3318 |
| 383 | Ga0495590_0017870 | 3300046457 | Bacteria | 2544 |
| 384 | Ga0495590_0021871 | 3300046457 | Bacteria | 2265 |
| 385 | Ga0495590_0025985 | 3300046457 | Bacteria | 2057 |
| 386 | Ga0495591_002404 | 3300046458 | Bacteria | 10449 |
| 387 | Ga0495591_045260 | 3300046458 | Bacteria | 1228 |
| 388 | Ga0495629_0000033 | 3300046459 | Bacteria | 120105 |
| 389 | Ga0495629_0001020 | 3300046459 | Bacteria | 22481 |
| 390 | Ga0495629_0001234 | 3300046459 | Bacteria | 20099 |
| 391 | Ga0495629_0008541 | 3300046459 | Bacteria | 7540 |
| 392 | Ga0495629_0012940 | 3300046459 | Bacteria | 6034 |
| 393 | Ga0495638_0004343 | 3300046460 | Bacteria | 10741 |
| 394 | Ga0495638_0006259 | 3300046460 | Bacteria | 8687 |
| 395 | Ga0495638_0012654 | 3300046460 | Bacteria | 5772 |
| 396 | Ga0495638_0199344 | 3300046460 | Bacteria | 1131 |
| 397 | Ga0495641_0009288 | 3300046461 | Bacteria | 5857 |
| 398 | Ga0495641_0036211 | 3300046461 | Bacteria | 2321 |
| 399 | Ga0495651_0006377 | 3300046462 | Bacteria | 9028 |
| 400 | Ga0495653_0000163 | 3300046463 | Bacteria | 54806 |
| 401 | Ga0495653_0013007 | 3300046463 | Bacteria | 6789 |
| 402 | Ga0495653_0020177 | 3300046463 | Bacteria | 5402 |
| 403 | Ga0495653_0055391 | 3300046463 | Bacteria | 3026 |
| 404 | Ga0495653_0137033 | 3300046463 | Bacteria | 1725 |
| 405 | Ga0495653_0157037 | 3300046463 | Bacteria | 1583 |
| 406 | Ga0495650_0000155 | 3300046471 | Bacteria | 155947 |
| 407 | Ga0495650_0006449 | 3300046471 | Bacteria | 7304 |
| 408 | Ga0495650_0022675 | 3300046471 | Bacteria | 3007 |
| 409 | Ga0495650_0029157 | 3300046471 | Bacteria | 2520 |
| 410 | Ga0495650_0087945 | 3300046471 | Bacteria | 1187 |
| 411 | Ga0495580_0000078 | 3300046472 | Bacteria | 61461 |
| 412 | Ga0495580_0001384 | 3300046472 | Bacteria | 21273 |
| 413 | Ga0495580_0002738 | 3300046472 | Bacteria | 15192 |
| 414 | Ga0495580_0007507 | 3300046472 | Bacteria | 8758 |
| 415 | Ga0495580_0040309 | 3300046472 | Bacteria | 3336 |
| 416 | Ga0495580_0117201 | 3300046472 | Bacteria | 1849 |
| 417 | Ga0495582_0002137 | 3300046473 | Bacteria | 11044 |
| 418 | Ga0495582_0007917 | 3300046473 | Bacteria | 5873 |
| 419 | Ga0495582_0023190 | 3300046473 | Bacteria | 3394 |
| 420 | Ga0495605_0002835 | 3300046474 | Bacteria | 10538 |
| 421 | Ga0495605_0004615 | 3300046474 | Bacteria | 8057 |
| 422 | Ga0495605_0012807 | 3300046474 | Bacteria | 4641 |
| 423 | Ga0495605_0119759 | 3300046474 | Bacteria | 1194 |
| 424 | Ga0495605_0159502 | 3300046474 | Bacteria | 1002 |
| 425 | Ga0495639_0142702 | 3300046475 | Bacteria | 1152 |
| 426 | Ga0495662_0001701 | 3300046476 | Bacteria | 10995 |
| 427 | Ga0495662_0006734 | 3300046476 | Bacteria | 5722 |
| 428 | Ga0495662_0010105 | 3300046476 | Bacteria | 4629 |
| 429 | Ga0495664_0000125 | 3300046477 | Bacteria | 38821 |
| 430 | Ga0495664_0005491 | 3300046477 | Bacteria | 6961 |
| 431 | Ga0495664_0035696 | 3300046477 | Bacteria | 2928 |
| 432 | Ga0495664_0047412 | 3300046477 | Bacteria | 2550 |
| 433 | Ga0495584_0000078 | 3300046491 | Bacteria | 68161 |
| 434 | Ga0495584_0000835 | 3300046491 | Bacteria | 20077 |
| 435 | Ga0495584_0017221 | 3300046491 | Bacteria | 3682 |
| 436 | Ga0495584_0022466 | 3300046491 | Bacteria | 3200 |
| 437 | Ga0495584_0044129 | 3300046491 | Bacteria | 2250 |
| 438 | Ga0495584_0057840 | 3300046491 | Bacteria | 1951 |
| 439 | Ga0495584_0064657 | 3300046491 | Bacteria | 1839 |
| 440 | Ga0495584_0091313 | 3300046491 | Bacteria | 1536 |
| 441 | Ga0495584_0112278 | 3300046491 | Bacteria | 1379 |
| 442 | Ga0495584_0163525 | 3300046491 | Bacteria | 1131 |
| 443 | Ga0495585_0000033 | 3300046492 | Bacteria | 143282 |
| 444 | Ga0495585_0000042 | 3300046492 | Bacteria | 125286 |
| 445 | Ga0495585_0000083 | 3300046492 | Bacteria | 99140 |
| 446 | Ga0495585_0000799 | 3300046492 | Bacteria | 27482 |
| 447 | Ga0495585_0003558 | 3300046492 | Bacteria | 10457 |
| 448 | Ga0495585_0010937 | 3300046492 | Bacteria | 5392 |
| 449 | Ga0495585_0020483 | 3300046492 | Bacteria | 3804 |
| 450 | Ga0495585_0021068 | 3300046492 | Bacteria | 3744 |
| 451 | Ga0495585_0022300 | 3300046492 | Bacteria | 3635 |
| 452 | Ga0495585_0040530 | 3300046492 | Bacteria | 2615 |
| 453 | Ga0495585_0067225 | 3300046492 | Bacteria | 1960 |
| 454 | Ga0495585_0069218 | 3300046492 | Bacteria | 1926 |
| 455 | Ga0495585_0114228 | 3300046492 | Bacteria | 1433 |
| 456 | Ga0495594_0050767 | 3300046499 | Bacteria | 2282 |
| 457 | Ga0495596_0000221 | 3300046500 | Bacteria | 39400 |
| 458 | Ga0495596_0001075 | 3300046500 | Bacteria | 16213 |
| 459 | Ga0495596_0005011 | 3300046500 | Bacteria | 6337 |
| 460 | Ga0495596_0006428 | 3300046500 | Bacteria | 5407 |
| 461 | Ga0495596_0007677 | 3300046500 | Bacteria | 4848 |
| 462 | Ga0495596_0011365 | 3300046500 | Bacteria | 3844 |
| 463 | Ga0495596_0013231 | 3300046500 | Bacteria | 3507 |
| 464 | Ga0495596_0028754 | 3300046500 | Bacteria | 2230 |
| 465 | Ga0495596_0150081 | 3300046500 | Bacteria | 905 |
| 466 | Ga0495596_0152794 | 3300046500 | Bacteria | 896 |
| 467 | Ga0495607_0000412 | 3300046501 | Bacteria | 43365 |
| 468 | Ga0495607_0010217 | 3300046501 | Bacteria | 6315 |
| 469 | Ga0495607_0014243 | 3300046501 | Bacteria | 5185 |
| 470 | Ga0495607_0051049 | 3300046501 | Bacteria | 2404 |
| 471 | Ga0495607_0058149 | 3300046501 | Bacteria | 2212 |
| 472 | Ga0495607_0064317 | 3300046501 | Bacteria | 2072 |
| 473 | Ga0495607_0109092 | 3300046501 | Bacteria | 1470 |
| 474 | Ga0495607_0115445 | 3300046501 | Bacteria | 1417 |
| 475 | Ga0495583_0000045 | 3300046506 | Bacteria | 220503 |
| 476 | Ga0495583_0000263 | 3300046506 | Bacteria | 86125 |
| 477 | Ga0495583_0000329 | 3300046506 | Bacteria | 75158 |
| 478 | Ga0495583_0002504 | 3300046506 | Bacteria | 15566 |
| 479 | Ga0495583_0004038 | 3300046506 | Bacteria | 10800 |
| 480 | Ga0495583_0009832 | 3300046506 | Bacteria | 5666 |
| 481 | Ga0495583_0018472 | 3300046506 | Bacteria | 3669 |
| 482 | Ga0495583_0043569 | 3300046506 | Bacteria | 2088 |
| 483 | Ga0495583_0046636 | 3300046506 | Bacteria | 1997 |
| 484 | Ga0495606_0016983 | 3300046507 | Bacteria | 5522 |
| 485 | Ga0495606_0030427 | 3300046507 | Bacteria | 3772 |
| 486 | Ga0495606_0037142 | 3300046507 | Bacteria | 3309 |
| 487 | Ga0495606_0112318 | 3300046507 | Bacteria | 1642 |
| 488 | Ga0495606_0133158 | 3300046507 | Bacteria | 1475 |
| 489 | Ga0495608_0124466 | 3300046511 | Bacteria | 1652 |
| 490 | Ga0495610_0000319 | 3300046512 | Bacteria | 51187 |
| 491 | Ga0495610_0001240 | 3300046512 | Bacteria | 22926 |
| 492 | Ga0495616_0000095 | 3300046513 | Bacteria | 74912 |
| 493 | Ga0495616_0001821 | 3300046513 | Bacteria | 14447 |
| 494 | Ga0495616_0002270 | 3300046513 | Bacteria | 12852 |
| 495 | Ga0495616_0002596 | 3300046513 | Bacteria | 11886 |
| 496 | Ga0495616_0009441 | 3300046513 | Bacteria | 5706 |
| 497 | Ga0495616_0010973 | 3300046513 | Bacteria | 5215 |
| 498 | Ga0495616_0013715 | 3300046513 | Bacteria | 4562 |
| 499 | Ga0495616_0024567 | 3300046513 | Bacteria | 3231 |
| 500 | Ga0495616_0025518 | 3300046513 | Bacteria | 3156 |
| 501 | Ga0495616_0036220 | 3300046513 | Bacteria | 2547 |
| 502 | Ga0495618_0000437 | 3300046514 | Bacteria | 29914 |
| 503 | Ga0495618_0005908 | 3300046514 | Bacteria | 7440 |
| 504 | Ga0495618_0006976 | 3300046514 | Bacteria | 6844 |
| 505 | Ga0495620_0011138 | 3300046515 | Bacteria | 4707 |
| 506 | Ga0495620_0065570 | 3300046515 | Bacteria | 1498 |
| 507 | Ga0495628_0002735 | 3300046516 | Bacteria | 15775 |
| 508 | Ga0495628_0004068 | 3300046516 | Bacteria | 13013 |
| 509 | Ga0495628_0027401 | 3300046516 | Bacteria | 4636 |
| 510 | Ga0495628_0031631 | 3300046516 | Bacteria | 4279 |
| 511 | Ga0495628_0053730 | 3300046516 | Bacteria | 3177 |
| 512 | Ga0495628_0122314 | 3300046516 | Bacteria | 1995 |
| 513 | Ga0495630_0000616 | 3300046517 | Bacteria | 25805 |
| 514 | Ga0495630_0007378 | 3300046517 | Bacteria | 7855 |
| 515 | Ga0495630_0042282 | 3300046517 | Bacteria | 3403 |
| 516 | Ga0495631_0000501 | 3300046518 | Bacteria | 26200 |
| 517 | Ga0495631_0041330 | 3300046518 | Bacteria | 2040 |
| 518 | Ga0495631_0097067 | 3300046518 | Bacteria | 1268 |
| 519 | Ga0495631_0107480 | 3300046518 | Bacteria | 1199 |
| 520 | Ga0495632_0000474 | 3300046519 | Bacteria | 38110 |
| 521 | Ga0495632_0013290 | 3300046519 | Bacteria | 4705 |
| 522 | Ga0495632_0039687 | 3300046519 | Bacteria | 2374 |
| 523 | Ga0495632_0203678 | 3300046519 | Bacteria | 900 |
| 524 | Ga0495637_0024074 | 3300046520 | Bacteria | 2756 |
| 525 | Ga0495643_0000507 | 3300046522 | Bacteria | 48620 |
| 526 | Ga0495643_0049393 | 3300046522 | Bacteria | 2269 |
| 527 | Ga0495643_0060087 | 3300046522 | Bacteria | 2018 |
| 528 | Ga0495643_0090898 | 3300046522 | Bacteria | 1574 |
| 529 | Ga0495643_0201323 | 3300046522 | Bacteria | 955 |
| 530 | Ga0495644_0000129 | 3300046523 | Bacteria | 36133 |
| 531 | Ga0495644_0000547 | 3300046523 | Bacteria | 15876 |
| 532 | Ga0495644_0007632 | 3300046523 | Bacteria | 4170 |
| 533 | Ga0495644_0091051 | 3300046523 | Bacteria | 1151 |
| 534 | Ga0495644_0146276 | 3300046523 | Bacteria | 903 |
| 535 | Ga0495648_0000052 | 3300046524 | Bacteria | 162169 |
| 536 | Ga0495648_0000613 | 3300046524 | Bacteria | 38144 |
| 537 | Ga0495648_0004038 | 3300046524 | Bacteria | 12668 |
| 538 | Ga0495648_0018499 | 3300046524 | Bacteria | 4928 |
| 539 | Ga0495648_0019856 | 3300046524 | Bacteria | 4705 |
| 540 | Ga0495648_0022982 | 3300046524 | Bacteria | 4279 |
| 541 | Ga0495648_0028068 | 3300046524 | Bacteria | 3753 |
| 542 | Ga0495648_0053931 | 3300046524 | Bacteria | 2432 |
| 543 | Ga0495648_0055376 | 3300046524 | Bacteria | 2391 |
| 544 | Ga0495648_0090244 | 3300046524 | Bacteria | 1718 |
| 545 | Ga0495663_0052013 | 3300046525 | Bacteria | 1271 |
| 546 | Ga0495663_0074510 | 3300046525 | Bacteria | 1085 |
| 547 | Ga0495666_0000056 | 3300046526 | Bacteria | 42935 |
| 548 | Ga0495666_0004051 | 3300046526 | Bacteria | 7408 |
| 549 | Ga0495666_0013556 | 3300046526 | Bacteria | 4063 |
| 550 | Ga0495666_0026056 | 3300046526 | Bacteria | 2885 |
| 551 | Ga0495666_0026422 | 3300046526 | Bacteria | 2861 |
| 552 | Ga0495642_0000280 | 3300046528 | Bacteria | 28848 |
| 553 | Ga0495642_0001004 | 3300046528 | Bacteria | 13091 |
| 554 | Ga0495642_0001955 | 3300046528 | Bacteria | 8677 |
| 555 | Ga0495642_0010706 | 3300046528 | Bacteria | 3512 |
| 556 | Ga0495642_0024555 | 3300046528 | Bacteria | 2385 |
| 557 | Ga0495642_0044843 | 3300046528 | Bacteria | 1806 |
| 558 | Ga0495642_0050377 | 3300046528 | Bacteria | 1712 |
| 559 | Ga0495652_0003187 | 3300046529 | Bacteria | 16351 |
| 560 | Ga0495652_0012065 | 3300046529 | Bacteria | 7808 |
| 561 | Ga0495652_0288818 | 3300046529 | Bacteria | 1197 |
| 562 | Ga0495654_0031080 | 3300046530 | Bacteria | 2712 |
| 563 | Ga0495654_0075835 | 3300046530 | Bacteria | 1586 |
| 564 | Ga0495665_0000980 | 3300046531 | Bacteria | 15134 |
| 565 | Ga0495665_0015997 | 3300046531 | Bacteria | 4042 |
| 566 | Ga0495665_0019144 | 3300046531 | Bacteria | 3680 |
| 567 | Ga0495665_0058742 | 3300046531 | Bacteria | 2030 |
| 568 | Ga0495640_0001085 | 3300046533 | Bacteria | 21185 |
| 569 | Ga0495640_0036662 | 3300046533 | Bacteria | 3463 |
| 570 | Ga0495640_0092345 | 3300046533 | Bacteria | 1996 |
| 571 | Ga0495586_0000574 | 3300046535 | Bacteria | 21308 |
| 572 | Ga0495586_0039585 | 3300046535 | Bacteria | 2534 |
| 573 | Ga0495586_0149523 | 3300046535 | Bacteria | 1313 |
| 574 | Ga0495587_0000278 | 3300046536 | Bacteria | 36650 |
| 575 | Ga0495587_0010663 | 3300046536 | Bacteria | 5837 |
| 576 | Ga0495587_0034067 | 3300046536 | Bacteria | 3072 |
| 577 | Ga0495587_0062156 | 3300046536 | Bacteria | 2187 |
| 578 | Ga0495609_0000084 | 3300046538 | Bacteria | 113497 |
| 579 | Ga0495609_0000086 | 3300046538 | Bacteria | 110840 |
| 580 | Ga0495609_0000523 | 3300046538 | Bacteria | 30800 |
| 581 | Ga0495609_0001293 | 3300046538 | Bacteria | 17074 |
| 582 | Ga0495609_0002353 | 3300046538 | Bacteria | 11670 |
| 583 | Ga0495609_0016137 | 3300046538 | Bacteria | 3484 |
| 584 | Ga0495609_0024913 | 3300046538 | Bacteria | 2743 |
| 585 | Ga0495609_0024995 | 3300046538 | Bacteria | 2739 |
| 586 | Ga0495609_0025935 | 3300046538 | Bacteria | 2685 |
| 587 | Ga0495609_0055980 | 3300046538 | Bacteria | 1748 |
| 588 | Ga0495609_0057638 | 3300046538 | Bacteria | 1719 |
| 589 | Ga0495621_0051400 | 3300046539 | Bacteria | 1475 |
| 590 | Ga0495597_0001484 | 3300046542 | Bacteria | 16780 |
| 591 | Ga0495597_0003591 | 3300046542 | Bacteria | 8937 |
| 592 | Ga0495597_0005881 | 3300046542 | Bacteria | 6410 |
| 593 | Ga0495597_0009675 | 3300046542 | Bacteria | 4749 |
| 594 | Ga0495597_0012276 | 3300046542 | Bacteria | 4134 |
| 595 | Ga0495597_0024955 | 3300046542 | Bacteria | 2755 |
| 596 | Ga0495597_0058540 | 3300046542 | Bacteria | 1684 |
| 597 | Ga0495597_0064337 | 3300046542 | Bacteria | 1593 |
| 598 | Ga0495645_0000102 | 3300046543 | Bacteria | 59126 |
| 599 | Ga0495645_0005699 | 3300046543 | Bacteria | 8579 |
| 600 | Ga0495622_0000096 | 3300046557 | Bacteria | 77784 |
| 601 | Ga0495622_0002367 | 3300046557 | Bacteria | 9171 |
| 602 | Ga0495622_0086886 | 3300046557 | Bacteria | 1438 |
| 603 | Ga0495622_0179295 | 3300046557 | Bacteria | 950 |
| 604 | Ga0495633_0000419 | 3300046558 | Bacteria | 44088 |
| 605 | Ga0495633_0028794 | 3300046558 | Bacteria | 2704 |
| 606 | Ga0495633_0034790 | 3300046558 | Bacteria | 2421 |
| 607 | Ga0495633_0034969 | 3300046558 | Bacteria | 2414 |
| 608 | Ga0495633_0155815 | 3300046558 | Bacteria | 1054 |
| 609 | Ga0495667_0110899 | 3300046559 | Bacteria | 1772 |
| 610 | Ga0495667_0162103 | 3300046559 | Bacteria | 1438 |
| 611 | Ga0495656_0002760 | 3300046615 | Bacteria | 5870 |
| 612 | Ga0495656_0035727 | 3300046615 | Bacteria | 2043 |
| 613 | Ga0495656_0262803 | 3300046615 | Bacteria | 875 |
| 614 | Ga0495656_0286902 | 3300046615 | Bacteria | 840 |
| 615 | Ga0495668_0000006 | 3300046616 | Bacteria | 553404 |
| 616 | Ga0495668_0000318 | 3300046616 | Bacteria | 66017 |
| 617 | Ga0495668_0000837 | 3300046616 | Bacteria | 34867 |
| 618 | Ga0495668_0013952 | 3300046616 | Bacteria | 4723 |
| 619 | Ga0495668_0068444 | 3300046616 | Bacteria | 1953 |
| 620 | Ga0495668_0192291 | 3300046616 | Bacteria | 1117 |
| 621 | Ga0495634_0000734 | 3300046642 | Bacteria | 31709 |
| 622 | Ga0495634_0011044 | 3300046642 | Bacteria | 6589 |
| 623 | Ga0495634_0063797 | 3300046642 | Bacteria | 2444 |
| 624 | Ga0495611_0001587 | 3300046648 | Bacteria | 11108 |
| 625 | Ga0495611_0002984 | 3300046648 | Bacteria | 7544 |
| 626 | Ga0495611_0010445 | 3300046648 | Bacteria | 3929 |
| 627 | Ga0495611_0128327 | 3300046648 | Bacteria | 1183 |
| 628 | Ga0495625_0013356 | 3300046660 | Bacteria | 6601 |
| 629 | Ga0495625_0013643 | 3300046660 | Bacteria | 6518 |
| 630 | Ga0495625_0025411 | 3300046660 | Bacteria | 4493 |
| 631 | Ga0495625_0026963 | 3300046660 | Bacteria | 4332 |
| 632 | Ga0495625_0031048 | 3300046660 | Bacteria | 3977 |
| 633 | Ga0495625_0047410 | 3300046660 | Bacteria | 3098 |
| 634 | Ga0495625_0133625 | 3300046660 | Bacteria | 1679 |
| 635 | Ga0495635_0000411 | 3300046663 | Bacteria | 27211 |
| 636 | Ga0495635_0001238 | 3300046663 | Bacteria | 17091 |
| 637 | Ga0495635_0018560 | 3300046663 | Bacteria | 4852 |
| 638 | Ga0495659_0000067 | 3300046664 | Bacteria | 46337 |
| 639 | Ga0495659_0026620 | 3300046664 | Bacteria | 1989 |
| 640 | Ga0495661_0000678 | 3300046665 | Bacteria | 34010 |
| 641 | Ga0495661_0000724 | 3300046665 | Bacteria | 32411 |
| 642 | Ga0495661_0001495 | 3300046665 | Bacteria | 19464 |
| 643 | Ga0495661_0010853 | 3300046665 | Bacteria | 6196 |
| 644 | Ga0495661_0015010 | 3300046665 | Bacteria | 5177 |
| 645 | Ga0495661_0016574 | 3300046665 | Bacteria | 4880 |
| 646 | Ga0495661_0019315 | 3300046665 | Bacteria | 4468 |
| 647 | Ga0495661_0019969 | 3300046665 | Bacteria | 4382 |
| 648 | Ga0495661_0042775 | 3300046665 | Bacteria | 2790 |
| 649 | Ga0495661_0045273 | 3300046665 | Bacteria | 2692 |
| 650 | Ga0495661_0046502 | 3300046665 | Bacteria | 2649 |
| 651 | Ga0495588_0015540 | 3300046674 | Bacteria | 3665 |
| 652 | Ga0495588_0048307 | 3300046674 | Bacteria | 2186 |
| 653 | Ga0495588_0136021 | 3300046674 | Bacteria | 1297 |
| 654 | Ga0495657_0149423 | 3300046675 | Bacteria | 1451 |
| 655 | Ga0495657_0159533 | 3300046675 | Bacteria | 1396 |
| 656 | Ga0495599_0000347 | 3300046678 | Bacteria | 27379 |
| 657 | Ga0495599_0011345 | 3300046678 | Bacteria | 5472 |
| 658 | Ga0495599_0124976 | 3300046678 | Bacteria | 1599 |
| 659 | Ga0495623_0003228 | 3300046679 | Bacteria | 10768 |
| 660 | Ga0495623_0004602 | 3300046679 | Bacteria | 9066 |
| 661 | Ga0495623_0006337 | 3300046679 | Bacteria | 7693 |
| 662 | Ga0495623_0013177 | 3300046679 | Bacteria | 5359 |
| 663 | Ga0495646_0007318 | 3300046680 | Bacteria | 7013 |
| 664 | Ga0495646_0024211 | 3300046680 | Bacteria | 3823 |
| 665 | Ga0495646_0047086 | 3300046680 | Bacteria | 2626 |
| 666 | Ga0495646_0047621 | 3300046680 | Bacteria | 2608 |
| 667 | Ga0495646_0157506 | 3300046680 | Bacteria | 1259 |
| 668 | Ga0495646_0235552 | 3300046680 | Bacteria | 985 |
| 669 | Ga0495646_0273480 | 3300046680 | Bacteria | 899 |
| 670 | Ga0495658_0015626 | 3300046683 | Bacteria | 3896 |
| 671 | Ga0495669_0000289 | 3300046684 | Bacteria | 28645 |
| 672 | Ga0495669_0012260 | 3300046684 | Bacteria | 3646 |
| 673 | Ga0495669_0043456 | 3300046684 | Bacteria | 2000 |
| 674 | Ga0495669_0068267 | 3300046684 | Bacteria | 1617 |
| 675 | Ga0495669_0118201 | 3300046684 | Bacteria | 1241 |
| 676 | Ga0495613_0001584 | 3300046689 | Bacteria | 17265 |
| 677 | Ga0495613_0006361 | 3300046689 | Bacteria | 8829 |
| 678 | Ga0495613_0144402 | 3300046689 | Bacteria | 1699 |
| 679 | Ga0495624_0000076 | 3300046690 | Bacteria | 64621 |
| 680 | Ga0495624_0016366 | 3300046690 | Bacteria | 4991 |
| 681 | Ga0495624_0028857 | 3300046690 | Bacteria | 3621 |
| 682 | Ga0495624_0036014 | 3300046690 | Bacteria | 3192 |
| 683 | Ga0495624_0088732 | 3300046690 | Bacteria | 1909 |
| 684 | Ga0495670_0001180 | 3300046691 | Bacteria | 12665 |
| 685 | Ga0495670_0005499 | 3300046691 | Bacteria | 6218 |
| 686 | Ga0495670_0016059 | 3300046691 | Bacteria | 3680 |
| 687 | Ga0495670_0020349 | 3300046691 | Bacteria | 3271 |
| 688 | Ga0495670_0043622 | 3300046691 | Bacteria | 2238 |
| 689 | Ga0495670_0046568 | 3300046691 | Bacteria | 2166 |
| 690 | Ga0495670_0048679 | 3300046691 | Bacteria | 2120 |
| 691 | Ga0495670_0069041 | 3300046691 | Bacteria | 1786 |
| 692 | Ga0495671_0001298 | 3300046692 | Bacteria | 17061 |
| 693 | Ga0495671_0001356 | 3300046692 | Bacteria | 16594 |
| 694 | Ga0495671_0005385 | 3300046692 | Bacteria | 7499 |
| 695 | Ga0495671_0020495 | 3300046692 | Bacteria | 3483 |
| 696 | Ga0495671_0044483 | 3300046692 | Bacteria | 2226 |
| 697 | Ga0495671_0055024 | 3300046692 | Bacteria | 1971 |
| 698 | Ga0495671_0094013 | 3300046692 | Bacteria | 1467 |
| 699 | Ga0495671_0100391 | 3300046692 | Bacteria | 1415 |
| 700 | Ga0495649_0002701 | 3300046694 | Bacteria | 12360 |
| 701 | Ga0495649_0005801 | 3300046694 | Bacteria | 7776 |
| 702 | Ga0495649_0009705 | 3300046694 | Bacteria | 5703 |
| 703 | Ga0495649_0019321 | 3300046694 | Bacteria | 3829 |
| 704 | Ga0495649_0027997 | 3300046694 | Bacteria | 3125 |
| 705 | Ga0495589_0000055 | 3300046794 | Bacteria | 110887 |
| 706 | Ga0495589_0000407 | 3300046794 | Bacteria | 32420 |
| 707 | Ga0495589_0003986 | 3300046794 | Bacteria | 7926 |
| 708 | Ga0495589_0004864 | 3300046794 | Bacteria | 7126 |
| 709 | Ga0495589_0006446 | 3300046794 | Bacteria | 6189 |
| 710 | Ga0495589_0010283 | 3300046794 | Bacteria | 4863 |
| 711 | Ga0495589_0027454 | 3300046794 | Bacteria | 2878 |
| 712 | Ga0495589_0055688 | 3300046794 | Bacteria | 1948 |
| 713 | Ga0495600_0000886 | 3300046809 | Bacteria | 16020 |
| 714 | Ga0495600_0001111 | 3300046809 | Bacteria | 14660 |
| 715 | Ga0495600_0008504 | 3300046809 | Bacteria | 6308 |
| 716 | Ga0495600_0030826 | 3300046809 | Bacteria | 3473 |
| 717 | Ga0495660_0043958 | 3300046810 | Bacteria | 2460 |
| 718 | Ga0495660_0093366 | 3300046810 | Bacteria | 1560 |
| 719 | Ga0495581_0000420 | 3300047315 | Bacteria | 21448 |
| 720 | Ga0495581_0000863 | 3300047315 | Bacteria | 16176 |
| 721 | Ga0495581_0002438 | 3300047315 | Bacteria | 10510 |
| 722 | Ga0495581_0002610 | 3300047315 | Bacteria | 10251 |
| 723 | Ga0495604_0000500 | 3300047317 | Bacteria | 34509 |
| 724 | Ga0495604_0000727 | 3300047317 | Bacteria | 27719 |
| 725 | Ga0495604_0018721 | 3300047317 | Bacteria | 5545 |
| 726 | Ga0495604_0057340 | 3300047317 | Bacteria | 2994 |
| 727 | Ga0495604_0072703 | 3300047317 | Bacteria | 2598 |
| 728 | Ga0495604_0174191 | 3300047317 | Bacteria | 1510 |
| 729 | Ga0495636_0019464 | 3300047318 | Bacteria | 2729 |
| 730 | Ga0495636_0033617 | 3300047318 | Bacteria | 2108 |
| 731 | Ga0495636_0085937 | 3300047318 | Bacteria | 1360 |
| 732 | Ga0495636_0122699 | 3300047318 | Bacteria | 1150 |
| 733 | Ga0495674_0001156 | 3300047319 | Bacteria | 25428 |
| 734 | Ga0495674_0001927 | 3300047319 | Bacteria | 20477 |
| 735 | Ga0495674_0002849 | 3300047319 | Bacteria | 16786 |
| 736 | Ga0495674_0003908 | 3300047319 | Bacteria | 14471 |
| 737 | Ga0495674_0008266 | 3300047319 | Bacteria | 9925 |
| 738 | Ga0495674_0056987 | 3300047319 | Bacteria | 3420 |
| 739 | Ga0495674_0172083 | 3300047319 | Bacteria | 1806 |
| 740 | Ga0495674_0233606 | 3300047319 | Bacteria | 1517 |
| 741 | Ga0495672_0000063 | 3300047320 | Bacteria | 201893 |
| 742 | Ga0495672_0005166 | 3300047320 | Bacteria | 10422 |
| 743 | Ga0495672_0005304 | 3300047320 | Bacteria | 10262 |
| 744 | Ga0495672_0011948 | 3300047320 | Bacteria | 6087 |
| 745 | Ga0495672_0027131 | 3300047320 | Bacteria | 3644 |
| 746 | Ga0495672_0028146 | 3300047320 | Bacteria | 3561 |
| 747 | Ga0495672_0059826 | 3300047320 | Bacteria | 2202 |
| 748 | Ga0495676_0003759 | 3300047321 | Bacteria | 13788 |
| 749 | Ga0495676_0009257 | 3300047321 | Bacteria | 8975 |
| 750 | Ga0495676_0105207 | 3300047321 | Bacteria | 2081 |
| 751 | Ga0495680_0000564 | 3300047322 | Bacteria | 41772 |
| 752 | Ga0495680_0005336 | 3300047322 | Bacteria | 12126 |
| 753 | Ga0495680_0025785 | 3300047322 | Bacteria | 4860 |
| 754 | Ga0495680_0094919 | 3300047322 | Bacteria | 2230 |
| 755 | Ga0495680_0276161 | 3300047322 | Bacteria | 1185 |
| 756 | Ga0495683_0000255 | 3300047323 | Bacteria | 47956 |
| 757 | Ga0495683_0000522 | 3300047323 | Bacteria | 29379 |
| 758 | Ga0495683_0001194 | 3300047323 | Bacteria | 17720 |
| 759 | Ga0495683_0009216 | 3300047323 | Bacteria | 5259 |
| 760 | Ga0495683_0009768 | 3300047323 | Bacteria | 5101 |
| 761 | Ga0495683_0015651 | 3300047323 | Bacteria | 3942 |
| 762 | Ga0495683_0019368 | 3300047323 | Bacteria | 3513 |
| 763 | Ga0495683_0028028 | 3300047323 | Bacteria | 2879 |
| 764 | Ga0495683_0096462 | 3300047323 | Bacteria | 1426 |
| 765 | Ga0495683_0200155 | 3300047323 | Bacteria | 901 |
| 766 | Ga0495687_000029 | 3300047443 | Bacteria | 293244 |
| 767 | Ga0495687_000139 | 3300047443 | Bacteria | 110721 |
| 768 | Ga0495687_000156 | 3300047443 | Bacteria | 103711 |
| 769 | Ga0495687_000253 | 3300047443 | Bacteria | 71917 |
| 770 | Ga0495687_000628 | 3300047443 | Bacteria | 40562 |
| 771 | Ga0495687_000656 | 3300047443 | Bacteria | 39649 |
| 772 | Ga0495687_002896 | 3300047443 | Bacteria | 13094 |
| 773 | Ga0495687_009196 | 3300047443 | Bacteria | 5556 |
| 774 | Ga0495687_019779 | 3300047443 | Bacteria | 3294 |
| 775 | Ga0495687_071523 | 3300047443 | Bacteria | 1389 |
| 776 | Ga0495675_0002809 | 3300047444 | Bacteria | 10431 |
| 777 | Ga0495675_0003731 | 3300047444 | Bacteria | 9209 |
| 778 | Ga0495675_0006111 | 3300047444 | Bacteria | 7369 |
| 779 | Ga0495675_0047314 | 3300047444 | Bacteria | 2736 |
| 780 | Ga0495677_0000147 | 3300047445 | Bacteria | 33620 |
| 781 | Ga0495677_0001429 | 3300047445 | Bacteria | 9579 |
| 782 | Ga0495677_0014535 | 3300047445 | Bacteria | 2865 |
| 783 | Ga0495677_0044060 | 3300047445 | Bacteria | 1636 |
| 784 | Ga0495677_0072535 | 3300047445 | Bacteria | 1284 |
| 785 | Ga0495679_000030 | 3300047446 | Bacteria | 180083 |
| 786 | Ga0495679_000860 | 3300047446 | Bacteria | 19197 |
| 787 | Ga0495679_001668 | 3300047446 | Bacteria | 12348 |
| 788 | Ga0495679_013966 | 3300047446 | Bacteria | 2994 |
| 789 | Ga0495679_017294 | 3300047446 | Bacteria | 2584 |
| 790 | Ga0495685_000228 | 3300047447 | Bacteria | 19195 |
| 791 | Ga0495685_011438 | 3300047447 | Bacteria | 2993 |
| 792 | Ga0495685_034202 | 3300047447 | Bacteria | 1746 |
| 793 | Ga0495685_054317 | 3300047447 | Bacteria | 1356 |
| 794 | Ga0495685_064622 | 3300047447 | Bacteria | 1230 |
| 795 | Ga0495685_079856 | 3300047447 | Bacteria | 1090 |
| 796 | Ga0495673_0000159 | 3300047469 | Bacteria | 116007 |
| 797 | Ga0495673_0006642 | 3300047469 | Bacteria | 6776 |
| 798 | Ga0495673_0008761 | 3300047469 | Bacteria | 5652 |
| 799 | Ga0495673_0032424 | 3300047469 | Bacteria | 2436 |
| 800 | Ga0495681_0024032 | 3300047470 | Bacteria | 3221 |
| 801 | Ga0495681_0042758 | 3300047470 | Bacteria | 2190 |
| 802 | Ga0495681_0045374 | 3300047470 | Bacteria | 2104 |
| 803 | Ga0495681_0045586 | 3300047470 | Bacteria | 2097 |
| 804 | Ga0495681_0059603 | 3300047470 | Bacteria | 1764 |
| 805 | Ga0495681_0077346 | 3300047470 | Bacteria | 1493 |
| 806 | Ga0495684_0052171 | 3300047471 | Bacteria | 3121 |
| 807 | Ga0495686_0000048 | 3300047472 | Bacteria | 278044 |
| 808 | Ga0495686_0002450 | 3300047472 | Bacteria | 17499 |
| 809 | Ga0495686_0010615 | 3300047472 | Bacteria | 6541 |
| 810 | Ga0495593_0000152 | 3300047673 | Bacteria | 34507 |
| 811 | Ga0495593_0011370 | 3300047673 | Bacteria | 5113 |
| 812 | Ga0495593_0024854 | 3300047673 | Bacteria | 3316 |
| 813 | Ga0495593_0025362 | 3300047673 | Bacteria | 3281 |
| 814 | Ga0495593_0030957 | 3300047673 | Bacteria | 2925 |
| 815 | Ga0495602_0000904 | 3300048088 | Bacteria | 28662 |
| 816 | Ga0495602_0006978 | 3300048088 | Bacteria | 11861 |
| 817 | Ga0495602_0094369 | 3300048088 | Bacteria | 2472 |
| 818 | Ga0495602_0148376 | 3300048088 | Bacteria | 1846 |
| 819 | Ga0495614_0000446 | 3300048089 | Bacteria | 16986 |
| 820 | Ga0495614_0002458 | 3300048089 | Bacteria | 8237 |
| 821 | Ga0495614_0005850 | 3300048089 | Bacteria | 5540 |
| 822 | Ga0495614_0048170 | 3300048089 | Bacteria | 1827 |
| 823 | Ga0495626_0023493 | 3300048091 | Bacteria | 3036 |
| 824 | Ga0495626_0049160 | 3300048091 | Bacteria | 1953 |
| 825 | Ga0495626_0055052 | 3300048091 | Bacteria | 1825 |
| 826 | Ga0496100_0003923 | 3300048903 | Bacteria | 7816 |
| 827 | Ga0496100_0033770 | 3300048903 | Bacteria | 3203 |
| 828 | Ga0496100_0063417 | 3300048903 | Bacteria | 2442 |
| 829 | Ga0496100_0079671 | 3300048903 | Bacteria | 2208 |
| 830 | Ga0496100_0107755 | 3300048903 | Bacteria | 1931 |
| 831 | Ga0496101_0001193 | 3300048904 | Bacteria | 15522 |
| 832 | Ga0496101_0031557 | 3300048904 | Bacteria | 3726 |
| 833 | Ga0496101_0129164 | 3300048904 | Bacteria | 1917 |
| 834 | Ga0496101_0222059 | 3300048904 | Bacteria | 1466 |
| 835 | Ga0496101_0471086 | 3300048904 | Bacteria | 991 |
| 836 | Ga0496102_0000082 | 3300048905 | Bacteria | 139079 |
| 837 | Ga0496102_0000548 | 3300048905 | Bacteria | 40478 |
| 838 | Ga0496102_0001919 | 3300048905 | Bacteria | 17896 |
| 839 | Ga0496102_0004818 | 3300048905 | Bacteria | 11409 |
| 840 | Ga0496102_0020777 | 3300048905 | Bacteria | 5802 |
| 841 | Ga0496102_0022296 | 3300048905 | Bacteria | 5611 |
| 842 | Ga0496102_0035297 | 3300048905 | Bacteria | 4500 |
| 843 | Ga0496102_0261020 | 3300048905 | Bacteria | 1633 |
| 844 | Ga0496102_0288143 | 3300048905 | Bacteria | 1548 |
| 845 | Ga0496102_0374190 | 3300048905 | Bacteria | 1340 |
| 846 | Ga0496103_0000701 | 3300048906 | Bacteria | 24789 |
| 847 | Ga0496103_0047033 | 3300048906 | Bacteria | 2665 |
| 848 | Ga0496103_0065817 | 3300048906 | Bacteria | 2261 |
| 849 | Ga0496103_0082753 | 3300048906 | Bacteria | 2020 |
| 850 | Ga0496103_0092396 | 3300048906 | Bacteria | 1910 |
| 851 | Ga0496104_0012925 | 3300048907 | Bacteria | 7517 |
| 852 | Ga0496104_0069023 | 3300048907 | Bacteria | 3359 |
| 853 | Ga0496104_0471545 | 3300048907 | Bacteria | 1167 |
| 854 | Ga0496105_0125122 | 3300048908 | Bacteria | 2119 |
| 855 | Ga0496105_0175343 | 3300048908 | Bacteria | 1756 |
| 856 | Ga0496106_0047489 | 3300048909 | Bacteria | 3231 |
| 857 | Ga0496106_0065102 | 3300048909 | Bacteria | 2775 |
| 858 | Ga0496106_0104295 | 3300048909 | Bacteria | 2202 |
| 859 | Ga0496107_0043650 | 3300048910 | Bacteria | 3221 |
| 860 | Ga0496107_0055430 | 3300048910 | Bacteria | 2863 |
| 861 | Ga0496107_0067890 | 3300048910 | Bacteria | 2587 |
| 862 | Ga0496107_0077024 | 3300048910 | Bacteria | 2429 |
| 863 | Ga0496107_0114739 | 3300048910 | Bacteria | 1982 |
| 864 | Ga0496108_0199491 | 3300048911 | Bacteria | 1736 |
| 865 | Ga0496108_0316283 | 3300048911 | Bacteria | 1361 |
| 866 | Ga0496108_0778498 | 3300048911 | Bacteria | 826 |
| 867 | Ga0496109_0140653 | 3300048912 | Bacteria | 2257 |
| 868 | Ga0496109_0188887 | 3300048912 | Bacteria | 1936 |
| 869 | Ga0496109_0203718 | 3300048912 | Bacteria | 1860 |
| 870 | Ga0496110_0226429 | 3300048913 | Bacteria | 1700 |
| 871 | Ga0496110_0231164 | 3300048913 | Bacteria | 1682 |
| 872 | Ga0496110_0254664 | 3300048913 | Bacteria | 1598 |
| 873 | Ga0496112_0009672 | 3300048915 | Bacteria | 8700 |
| 874 | Ga0496112_0218854 | 3300048915 | Bacteria | 1860 |
| 875 | Ga0496112_0548199 | 3300048915 | Bacteria | 1090 |
| 876 | Ga0496113_0007071 | 3300048916 | Bacteria | 7181 |
| 877 | Ga0496113_0009759 | 3300048916 | Bacteria | 6310 |
| 878 | Ga0496113_0010371 | 3300048916 | Bacteria | 6157 |
| 879 | Ga0496113_0073169 | 3300048916 | Bacteria | 2610 |
| 880 | Ga0496114_0001294 | 3300048917 | Bacteria | 18937 |
| 881 | Ga0496114_0066361 | 3300048917 | Bacteria | 3025 |
| 882 | Ga0496114_0831642 | 3300048917 | Bacteria | 803 |
| 883 | Ga0496115_0020182 | 3300048918 | Bacteria | 5137 |
| 884 | Ga0496115_0074630 | 3300048918 | Bacteria | 2754 |
| 885 | Ga0496116_0002350 | 3300048919 | Bacteria | 20004 |
| 886 | Ga0496116_0002865 | 3300048919 | Bacteria | 17673 |
| 887 | Ga0496116_0029737 | 3300048919 | Bacteria | 3933 |
| 888 | Ga0496116_0029922 | 3300048919 | Bacteria | 3918 |
| 889 | Ga0496117_0000035 | 3300048920 | Bacteria | 326449 |
| 890 | Ga0496117_0001097 | 3300048920 | Bacteria | 40911 |
| 891 | Ga0496117_0003845 | 3300048920 | Bacteria | 17085 |
| 892 | Ga0496117_0045546 | 3300048920 | Bacteria | 3166 |
| 893 | Ga0496117_0105080 | 3300048920 | Bacteria | 1776 |
| 894 | Ga0496118_0000054 | 3300048921 | Bacteria | 233617 |
| 895 | Ga0496118_0000294 | 3300048921 | Bacteria | 86720 |
| 896 | Ga0496118_0001134 | 3300048921 | Bacteria | 41095 |
| 897 | Ga0496118_0002121 | 3300048921 | Bacteria | 27768 |
| 898 | Ga0496118_0015333 | 3300048921 | Bacteria | 7101 |
| 899 | Ga0496118_0069114 | 3300048921 | Bacteria | 2560 |
| 900 | Ga0496118_0099517 | 3300048921 | Bacteria | 1970 |
| 901 | Ga0496119_0004866 | 3300048922 | Bacteria | 13156 |
| 902 | Ga0496119_0016988 | 3300048922 | Bacteria | 5502 |
| 903 | Ga0496120_0000086 | 3300048923 | Bacteria | 154099 |
| 904 | Ga0496120_0268256 | 3300048923 | Bacteria | 794 |
| 905 | Ga0496121_0001036 | 3300048924 | Bacteria | 49628 |
| 906 | Ga0496121_0004657 | 3300048924 | Bacteria | 18221 |
| 907 | Ga0496121_0008412 | 3300048924 | Bacteria | 12149 |
| 908 | Ga0496121_0016860 | 3300048924 | Bacteria | 7512 |
| 909 | Ga0496121_0029589 | 3300048924 | Bacteria | 5060 |
| 910 | Ga0496121_0060290 | 3300048924 | Bacteria | 3121 |
| 911 | Ga0496121_0159422 | 3300048924 | Bacteria | 1652 |
| 912 | Ga0496121_0287228 | 3300048924 | Bacteria | 1122 |
| 913 | Ga0496122_0001513 | 3300048925 | Bacteria | 37053 |
| 914 | Ga0496122_0001645 | 3300048925 | Bacteria | 34677 |
| 915 | Ga0496122_0002752 | 3300048925 | Bacteria | 24277 |
| 916 | Ga0496123_0000970 | 3300048926 | Bacteria | 44328 |
| 917 | Ga0496123_0002204 | 3300048926 | Bacteria | 24782 |
| 918 | Ga0496123_0002540 | 3300048926 | Bacteria | 22349 |
| 919 | Ga0496123_0041869 | 3300048926 | Bacteria | 3169 |
| 920 | Ga0496123_0082985 | 3300048926 | Bacteria | 1940 |
| 921 | Ga0496124_0008360 | 3300048927 | Bacteria | 10838 |
| 922 | Ga0496124_0034565 | 3300048927 | Bacteria | 4434 |
| 923 | Ga0496124_0327691 | 3300048927 | Bacteria | 1093 |
| 924 | Ga0496125_0001339 | 3300048928 | Bacteria | 36299 |
| 925 | Ga0496125_0001458 | 3300048928 | Bacteria | 34242 |
| 926 | Ga0496125_0009187 | 3300048928 | Bacteria | 10215 |
| 927 | Ga0496125_0024768 | 3300048928 | Bacteria | 5511 |
| 928 | Ga0496125_0230742 | 3300048928 | Bacteria | 1184 |
| 929 | Ga0496126_0000423 | 3300048929 | Bacteria | 85154 |
| 930 | Ga0496126_0000599 | 3300048929 | Bacteria | 68021 |
| 931 | Ga0496126_0001192 | 3300048929 | Bacteria | 42374 |
| 932 | Ga0496126_0042621 | 3300048929 | Bacteria | 4191 |
| 933 | Ga0496126_0075933 | 3300048929 | Bacteria | 2981 |
| 934 | Ga0496126_0127483 | 3300048929 | Bacteria | 2202 |
| 935 | Ga0496126_0289467 | 3300048929 | Bacteria | 1355 |
| 936 | Ga0496126_0456059 | 3300048929 | Bacteria | 1028 |
| 937 | Ga0495678_000244 | 3300049459 | Bacteria | 61112 |
| 938 | Ga0495678_003003 | 3300049459 | Bacteria | 10739 |
| 939 | Ga0495678_004126 | 3300049459 | Bacteria | 8594 |
| 940 | Ga0495682_0000454 | 3300049460 | Bacteria | 28314 |
| 941 | Ga0495682_0000471 | 3300049460 | Bacteria | 27829 |
| 942 | Ga0495682_0008504 | 3300049460 | Bacteria | 4039 |
| 943 | Ga0495682_0024188 | 3300049460 | Bacteria | 2266 |
| 944 | Ga0495682_0036274 | 3300049460 | Bacteria | 1816 |
| 945 | Ga0495682_0061201 | 3300049460 | Bacteria | 1359 |
| 946 | Ga0501033_0121854 | 3300049570 | Bacteria | 1892 |
| 947 | Ga0501038_0040239 | 3300049574 | Bacteria | 4085 |
| 948 | Ga0501039_0117668 | 3300049575 | Bacteria | 2081 |
| 949 | Ga0501042_0094494 | 3300049578 | Bacteria | 2147 |
| 950 | Ga0501043_0119612 | 3300049579 | Bacteria | 2066 |
| 951 | Ga0501046_0036067 | 3300049580 | Bacteria | 3981 |
| 952 | Ga0501048_0020606 | 3300049582 | Bacteria | 4832 |
| 953 | Ga0501071_0077165 | 3300049587 | Bacteria | 2433 |
| 954 | Ga0501075_0018994 | 3300049591 | Bacteria | 4985 |
| 955 | Ga0501076_0002066 | 3300049592 | Bacteria | 13751 |
| 956 | Ga0501076_0184144 | 3300049592 | Bacteria | 1703 |
| 957 | Ga0501250_012839 | 3300049680 | Bacteria | 996 |
| 958 | Ga0501079_0024823 | 3300049741 | Bacteria | 4598 |
| 959 | Ga0501079_0324933 | 3300049741 | Bacteria | 1204 |
| 960 | Ga0501080_0022265 | 3300049742 | Bacteria | 5871 |
| 961 | Ga0501080_0367666 | 3300049742 | Bacteria | 1297 |
| 962 | Ga0501081_0002231 | 3300049743 | Bacteria | 12191 |
| 963 | Ga0501081_0234522 | 3300049743 | Bacteria | 1337 |
| 964 | Ga0501083_0048451 | 3300049744 | Bacteria | 2868 |
| 965 | Ga0501035_0126708 | 3300049822 | Bacteria | 2229 |
| 966 | Ga0501045_0001446 | 3300049824 | Bacteria | 15787 |
| 967 | nmdc:mga03683_3564_c2 | 3300050489 | Bacteria | 3545 |
| 968 | nmdc:mga03n38_3188_c1 | 3300050490 | Bacteria | 5227 |
| 969 | nmdc:mga00v17_76693_c1 | 3300050491 | Bacteria | 2080 |
| 970 | nmdc:mga0k408_155960_c1 | 3300050493 | Bacteria | 1360 |
| 971 | nmdc:mga0k408_7589_c1 | 3300050493 | Bacteria | 5792 |
| 972 | nmdc:mga0k408_9829_c1 | 3300050493 | Bacteria | 5166 |
| 973 | nmdc:mga04h51_18556_c1 | 3300050495 | Bacteria | 2051 |
| 974 | nmdc:mga04h51_45590_c1 | 3300050495 | Bacteria | 1450 |
| 975 | nmdc:mga07m45_126_c1 | 3300050496 | Bacteria | 30476 |
| 976 | nmdc:mga07m45_2253_c1 | 3300050496 | Bacteria | 9005 |
| 977 | nmdc:mga07m45_64228_c1 | 3300050496 | Bacteria | 2083 |
| 978 | nmdc:mga05p37_204206_c1 | 3300050507 | Bacteria | 2391 |
| 979 | nmdc:mga0sz30_6210_c1 | 3300050516 | Bacteria | 4427 |
| 980 | Ga0500658_0002282 | 3300053134 | Bacteria | 7423 |
| 981 | Ga0500559_0168950 | 3300053136 | Bacteria | 1029 |
| 982 | Ga0500637_0005060 | 3300053178 | Bacteria | 6347 |
| 983 | Ga0501084_0026840 | 3300054114 | Bacteria | 4810 |
| 984 | Ga0587084_003872 | 3300059477 | Bacteria | 1675 |
| 985 | Ga0587077_008959 | 3300059493 | Bacteria | 1505 |
| 986 | Ga0587082_014547 | 3300059504 | Bacteria | 1202 |
| 987 | Ga0587083_0033482 | 3300059505 | Bacteria | 1037 |
| 988 | Ga0587062_005140 | 3300059639 | Bacteria | 1430 |
| 989 | Ga0587067_011086 | 3300059640 | Bacteria | 1381 |
| 990 | Ga0587072_013521 | 3300059643 | Bacteria | 1364 |
| 991 | Ga0587075_002497 | 3300059644 | Bacteria | 1949 |
| 992 | Ga0587111_0033272 | 3300060346 | Bacteria | 1064 |
| 993 | Ga0501082_0010901 | 3300060353 | Bacteria | 7822 |
| 994 | Ga0501082_0066431 | 3300060353 | Bacteria | 3106 |
| 995 | Ga0466962_0002159 | 3300061719 | Bacteria | 9291 |
| 996 | Ga0466962_0011537 | 3300061719 | Bacteria | 4256 |
| 997 | Ga0466962_0048807 | 3300061719 | Bacteria | 2022 |
| 998 | Ga0530510_0002613 | 3300061734 | Bacteria | 12390 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2808606418 | 2809147037 | 246 |
| 2 | 3300009551 | Ga0105238_10620251 | Ga0105238_106202512 | 249 |
| 3 | 3300001979 | JGI24740J21852_10000899 | JGI24740J21852_100008999 | 250 |
| 4 | 3300001989 | JGI24739J22299_10005340 | JGI24739J22299_100053402 | 250 |
| 5 | 3300002067 | JGI24735J21928_10008041 | JGI24735J21928_100080413 | 250 |
| 6 | 3300002075 | JGI24738J21930_10001023 | JGI24738J21930_100010232 | 250 |
| 7 | 3300002705 | JGI25156J39149_1000633 | JGI25156J39149_100063311 | 250 |
| 8 | 3300002705 | JGI25156J39149_1000705 | JGI25156J39149_100070512 | 250 |
| 9 | 3300002705 | JGI25156J39149_1001702 | JGI25156J39149_10017024 | 250 |
| 10 | 3300003214 | JGI25165J46597_1000853 | JGI25165J46597_10008537 | 250 |
| 11 | 3300003575 | Ga0007409J51694_1014567 | Ga0007409J51694_10145671 | 250 |
| 12 | 3300003575 | Ga0007409J51694_1027038 | Ga0007409J51694_10270381 | 250 |
| 13 | 3300003756 | Ga0055533_1001314 | Ga0055533_10013143 | 250 |
| 14 | 3300003758 | Ga0055532_1000014 | Ga0055532_1000014113 | 250 |
| 15 | 3300003759 | Ga0055525_1000028 | Ga0055525_10000288 | 250 |
| 16 | 3300003760 | Ga0055527_1000013 | Ga0055527_1000013226 | 250 |
| 17 | 3300003760 | Ga0055527_1000055 | Ga0055527_100005522 | 250 |
| 18 | 3300003760 | Ga0055527_1007461 | Ga0055527_10074612 | 250 |
| 19 | 3300003761 | Ga0055535_1000011 | Ga0055535_1000011224 | 250 |
| 20 | 3300003761 | Ga0055535_1000083 | Ga0055535_100008322 | 250 |
| 21 | 3300003762 | Ga0055542_1000018 | Ga0055542_1000018226 | 250 |
| 22 | 3300003762 | Ga0055542_1001335 | Ga0055542_10013358 | 250 |
| 23 | 3300003763 | Ga0055529_1000017 | Ga0055529_1000017115 | 250 |
| 24 | 3300003771 | Ga0055526_1001294 | Ga0055526_10012942 | 250 |
| 25 | 3300003771 | Ga0055526_1008224 | Ga0055526_10082243 | 250 |
| 26 | 3300003771 | Ga0055526_1010588 | Ga0055526_10105883 | 250 |
| 27 | 3300003771 | Ga0055526_1043602 | Ga0055526_10436022 | 250 |
| 28 | 3300003773 | Ga0055537_1000292 | Ga0055537_100029230 | 250 |
| 29 | 3300003775 | Ga0055524_1001049 | Ga0055524_100104911 | 250 |
| 30 | 3300003775 | Ga0055524_1019724 | Ga0055524_10197242 | 250 |
| 31 | 3300003781 | Ga0055536_1000462 | Ga0055536_10004629 | 250 |
| 32 | 3300003784 | Ga0055534_1000046 | Ga0055534_100004627 | 250 |
| 33 | 3300003784 | Ga0055534_1000935 | Ga0055534_10009355 | 250 |
| 34 | 3300003784 | Ga0055534_1001910 | Ga0055534_10019103 | 250 |
| 35 | 3300003790 | Ga0055528_1000226 | Ga0055528_100022627 | 250 |
| 36 | 3300005262 | Ga0065165_1001458 | Ga0065165_100145811 | 250 |
| 37 | 3300005288 | Ga0065714_10106686 | Ga0065714_101066861 | 250 |
| 38 | 3300005334 | Ga0068869_100082861 | Ga0068869_1000828612 | 250 |
| 39 | 3300005335 | Ga0070666_10072573 | Ga0070666_100725732 | 250 |
| 40 | 3300005335 | Ga0070666_10367820 | Ga0070666_103678201 | 250 |
| 41 | 3300005339 | Ga0070660_100008874 | Ga0070660_1000088742 | 250 |
| 42 | 3300005344 | Ga0070661_100006929 | Ga0070661_1000069291 | 250 |
| 43 | 3300005344 | Ga0070661_100020072 | Ga0070661_1000200723 | 250 |
| 44 | 3300005355 | Ga0070671_100006052 | Ga0070671_1000060523 | 250 |
| 45 | 3300005364 | Ga0070673_100405839 | Ga0070673_1004058392 | 250 |
| 46 | 3300005366 | Ga0070659_100002890 | Ga0070659_1000028902 | 250 |
| 47 | 3300005366 | Ga0070659_100009715 | Ga0070659_1000097153 | 250 |
| 48 | 3300005366 | Ga0070659_100076255 | Ga0070659_1000762552 | 250 |
| 49 | 3300005366 | Ga0070659_100368174 | Ga0070659_1003681742 | 250 |
| 50 | 3300005367 | Ga0070667_100020129 | Ga0070667_1000201292 | 250 |
| 51 | 3300005367 | Ga0070667_100129145 | Ga0070667_1001291452 | 250 |
| 52 | 3300005455 | Ga0070663_100018004 | Ga0070663_1000180042 | 250 |
| 53 | 3300005455 | Ga0070663_100047134 | Ga0070663_1000471343 | 250 |
| 54 | 3300005455 | Ga0070663_100067888 | Ga0070663_1000678882 | 250 |
| 55 | 3300005455 | Ga0070663_100121486 | Ga0070663_1001214862 | 250 |
| 56 | 3300005459 | Ga0068867_100702224 | Ga0068867_1007022241 | 250 |
| 57 | 3300005535 | Ga0070684_100095995 | Ga0070684_1000959953 | 250 |
| 58 | 3300005548 | Ga0070665_100006580 | Ga0070665_1000065809 | 250 |
| 59 | 3300005548 | Ga0070665_100015860 | Ga0070665_1000158603 | 250 |
| 60 | 3300005548 | Ga0070665_100058761 | Ga0070665_1000587612 | 250 |
| 61 | 3300005548 | Ga0070665_100143386 | Ga0070665_1001433862 | 250 |
| 62 | 3300005563 | Ga0068855_100108136 | Ga0068855_1001081362 | 250 |
| 63 | 3300005563 | Ga0068855_100319134 | Ga0068855_1003191342 | 250 |
| 64 | 3300005564 | Ga0070664_100007998 | Ga0070664_1000079986 | 250 |
| 65 | 3300005564 | Ga0070664_100014507 | Ga0070664_1000145072 | 250 |
| 66 | 3300005564 | Ga0070664_100099806 | Ga0070664_1000998062 | 250 |
| 67 | 3300005564 | Ga0070664_100327093 | Ga0070664_1003270932 | 250 |
| 68 | 3300005564 | Ga0070664_100347145 | Ga0070664_1003471452 | 250 |
| 69 | 3300005578 | Ga0068854_100594962 | Ga0068854_1005949621 | 250 |
| 70 | 3300005614 | Ga0068856_100273361 | Ga0068856_1002733612 | 250 |
| 71 | 3300005616 | Ga0068852_100016870 | Ga0068852_1000168702 | 250 |
| 72 | 3300005616 | Ga0068852_100215563 | Ga0068852_1002155631 | 250 |
| 73 | 3300005616 | Ga0068852_100442187 | Ga0068852_1004421872 | 250 |
| 74 | 3300005617 | Ga0068859_100001005 | Ga0068859_10000100514 | 250 |
| 75 | 3300005617 | Ga0068859_100014788 | Ga0068859_1000147883 | 250 |
| 76 | 3300005618 | Ga0068864_100082860 | Ga0068864_1000828601 | 250 |
| 77 | 3300005719 | Ga0068861_100067529 | Ga0068861_1000675292 | 250 |
| 78 | 3300005841 | Ga0068863_100006932 | Ga0068863_1000069323 | 250 |
| 79 | 3300005841 | Ga0068863_100037016 | Ga0068863_1000370163 | 250 |
| 80 | 3300005841 | Ga0068863_100044357 | Ga0068863_1000443572 | 250 |
| 81 | 3300005842 | Ga0068858_100012281 | Ga0068858_1000122815 | 250 |
| 82 | 3300005843 | Ga0068860_100003507 | Ga0068860_1000035075 | 250 |
| 83 | 3300005843 | Ga0068860_100058586 | Ga0068860_1000585862 | 250 |
| 84 | 3300005844 | Ga0068862_100041066 | Ga0068862_1000410662 | 250 |
| 85 | 3300006038 | Ga0075365_10106808 | Ga0075365_101068082 | 250 |
| 86 | 3300006042 | Ga0075368_10033679 | Ga0075368_100336792 | 250 |
| 87 | 3300006042 | Ga0075368_10068067 | Ga0075368_100680671 | 250 |
| 88 | 3300006042 | Ga0075368_10078548 | Ga0075368_100785482 | 250 |
| 89 | 3300006048 | Ga0075363_100006342 | Ga0075363_1000063423 | 250 |
| 90 | 3300006048 | Ga0075363_100212343 | Ga0075363_1002123432 | 250 |
| 91 | 3300006051 | Ga0075364_10025720 | Ga0075364_100257203 | 250 |
| 92 | 3300006177 | Ga0075362_10025882 | Ga0075362_100258823 | 250 |
| 93 | 3300006177 | Ga0075362_10027729 | Ga0075362_100277292 | 250 |
| 94 | 3300006177 | Ga0075362_10264130 | Ga0075362_102641301 | 250 |
| 95 | 3300006178 | Ga0075367_10009348 | Ga0075367_100093482 | 250 |
| 96 | 3300006178 | Ga0075367_10014135 | Ga0075367_100141353 | 250 |
| 97 | 3300006186 | Ga0075369_10005693 | Ga0075369_100056933 | 250 |
| 98 | 3300006186 | Ga0075369_10021807 | Ga0075369_100218072 | 250 |
| 99 | 3300006195 | Ga0075366_10001522 | Ga0075366_100015229 | 250 |
| 100 | 3300006195 | Ga0075366_10118078 | Ga0075366_101180781 | 250 |
| 101 | 3300006237 | Ga0097621_100205771 | Ga0097621_1002057712 | 250 |
| 102 | 3300006353 | Ga0075370_10001089 | Ga0075370_100010898 | 250 |
| 103 | 3300006353 | Ga0075370_10001738 | Ga0075370_100017383 | 250 |
| 104 | 3300006353 | Ga0075370_10016598 | Ga0075370_100165982 | 250 |
| 105 | 3300006358 | Ga0068871_100099302 | Ga0068871_1000993022 | 250 |
| 106 | 3300006358 | Ga0068871_100249490 | Ga0068871_1002494901 | 250 |
| 107 | 3300006881 | Ga0068865_100028606 | Ga0068865_1000286063 | 250 |
| 108 | 3300006931 | Ga0097620_100001005 | Ga0097620_10000100514 | 250 |
| 109 | 3300006931 | Ga0097620_100014788 | Ga0097620_1000147883 | 250 |
| 110 | 3300009011 | Ga0105251_10000537 | Ga0105251_1000053712 | 250 |
| 111 | 3300009036 | Ga0105244_10038955 | Ga0105244_100389552 | 250 |
| 112 | 3300009092 | Ga0105250_10117335 | Ga0105250_101173352 | 250 |
| 113 | 3300009093 | Ga0105240_10006910 | Ga0105240_100069109 | 250 |
| 114 | 3300009093 | Ga0105240_10014768 | Ga0105240_1001476812 | 250 |
| 115 | 3300009093 | Ga0105240_10031257 | Ga0105240_100312573 | 250 |
| 116 | 3300009093 | Ga0105240_10060249 | Ga0105240_100602493 | 250 |
| 117 | 3300009093 | Ga0105240_10355988 | Ga0105240_103559882 | 250 |
| 118 | 3300009098 | Ga0105245_10134894 | Ga0105245_101348942 | 250 |
| 119 | 3300009101 | Ga0105247_10025965 | Ga0105247_100259653 | 250 |
| 120 | 3300009174 | Ga0105241_10004372 | Ga0105241_100043727 | 250 |
| 121 | 3300009176 | Ga0105242_10072861 | Ga0105242_100728612 | 250 |
| 122 | 3300009176 | Ga0105242_10155959 | Ga0105242_101559592 | 250 |
| 123 | 3300009176 | Ga0105242_10178369 | Ga0105242_101783692 | 250 |
| 124 | 3300009177 | Ga0105248_10001355 | Ga0105248_1000135522 | 250 |
| 125 | 3300009177 | Ga0105248_10045851 | Ga0105248_100458513 | 250 |
| 126 | 3300009177 | Ga0105248_10128971 | Ga0105248_101289713 | 250 |
| 127 | 3300009177 | Ga0105248_10167403 | Ga0105248_101674032 | 250 |
| 128 | 3300009545 | Ga0105237_10018129 | Ga0105237_100181294 | 250 |
| 129 | 3300009545 | Ga0105237_10488999 | Ga0105237_104889992 | 250 |
| 130 | 3300009551 | Ga0105238_10032616 | Ga0105238_100326163 | 250 |
| 131 | 3300009551 | Ga0105238_10354897 | Ga0105238_103548972 | 250 |
| 132 | 3300009553 | Ga0105249_10012890 | Ga0105249_100128903 | 250 |
| 133 | 3300009553 | Ga0105249_10847425 | Ga0105249_108474252 | 250 |
| 134 | 3300010375 | Ga0105239_10087316 | Ga0105239_100873162 | 250 |
| 135 | 3300010375 | Ga0105239_10103984 | Ga0105239_101039842 | 250 |
| 136 | 3300010375 | Ga0105239_10148953 | Ga0105239_101489533 | 250 |
| 137 | 3300011119 | Ga0105246_10311014 | Ga0105246_103110142 | 250 |
| 138 | 3300013105 | Ga0157369_10021832 | Ga0157369_100218323 | 250 |
| 139 | 3300013105 | Ga0157369_10584392 | Ga0157369_105843922 | 250 |
| 140 | 3300013296 | Ga0157374_10000310 | Ga0157374_1000031010 | 250 |
| 141 | 3300013296 | Ga0157374_10079869 | Ga0157374_100798694 | 250 |
| 142 | 3300013306 | Ga0163162_10000873 | Ga0163162_100008737 | 250 |
| 143 | 3300013306 | Ga0163162_10053681 | Ga0163162_100536812 | 250 |
| 144 | 3300013306 | Ga0163162_10086494 | Ga0163162_100864943 | 250 |
| 145 | 3300013306 | Ga0163162_10480133 | Ga0163162_104801331 | 250 |
| 146 | 3300013306 | Ga0163162_11045007 | Ga0163162_110450072 | 250 |
| 147 | 3300013307 | Ga0157372_10370829 | Ga0157372_103708292 | 250 |
| 148 | 3300013308 | Ga0157375_10005109 | Ga0157375_100051092 | 250 |
| 149 | 3300013308 | Ga0157375_10655388 | Ga0157375_106553881 | 250 |
| 150 | 3300014325 | Ga0163163_10176536 | Ga0163163_101765362 | 250 |
| 151 | 3300014968 | Ga0157379_10140854 | Ga0157379_101408542 | 250 |
| 152 | 3300014968 | Ga0157379_10235480 | Ga0157379_102354802 | 250 |
| 153 | 3300015261 | Ga0182006_1125525 | Ga0182006_11255251 | 250 |
| 154 | 3300015262 | Ga0182007_10000566 | Ga0182007_100005663 | 250 |
| 155 | 3300016635 | Ga0183361_10003 | Ga0183361_10003360 | 250 |
| 156 | 3300017792 | Ga0163161_10263588 | Ga0163161_102635882 | 250 |
| 157 | 3300020070 | Ga0206356_10783655 | Ga0206356_107836551 | 250 |
| 158 | 3300025225 | Ga0209566_103550 | Ga0209566_1035502 | 250 |
| 159 | 3300025226 | Ga0209674_100049 | Ga0209674_10004966 | 250 |
| 160 | 3300025226 | Ga0209674_100051 | Ga0209674_100051125 | 250 |
| 161 | 3300025228 | Ga0209672_100027 | Ga0209672_100027110 | 250 |
| 162 | 3300025228 | Ga0209672_100040 | Ga0209672_10004022 | 250 |
| 163 | 3300025228 | Ga0209672_100139 | Ga0209672_10013941 | 250 |
| 164 | 3300025229 | Ga0209147_100035 | Ga0209147_100035110 | 250 |
| 165 | 3300025229 | Ga0209147_100048 | Ga0209147_10004822 | 250 |
| 166 | 3300025230 | Ga0209563_100011 | Ga0209563_100011302 | 250 |
| 167 | 3300025230 | Ga0209563_101052 | Ga0209563_1010524 | 250 |
| 168 | 3300025242 | Ga0209258_100052 | Ga0209258_100052209 | 250 |
| 169 | 3300025242 | Ga0209258_100070 | Ga0209258_10007022 | 250 |
| 170 | 3300025253 | Ga0209677_102480 | Ga0209677_1024802 | 250 |
| 171 | 3300025254 | Ga0209148_1000064 | Ga0209148_1000064209 | 250 |
| 172 | 3300025254 | Ga0209148_1000284 | Ga0209148_100028460 | 250 |
| 173 | 3300025256 | Ga0209759_1000015 | Ga0209759_1000015127 | 250 |
| 174 | 3300025256 | Ga0209759_1000041 | Ga0209759_1000041166 | 250 |
| 175 | 3300025256 | Ga0209759_1000252 | Ga0209759_100025214 | 250 |
| 176 | 3300025256 | Ga0209759_1013351 | Ga0209759_10133512 | 250 |
| 177 | 3300025256 | Ga0209759_1016964 | Ga0209759_10169642 | 250 |
| 178 | 3300025258 | Ga0209129_1015186 | Ga0209129_10151862 | 250 |
| 179 | 3300025261 | Ga0209233_1000073 | Ga0209233_1000073122 | 250 |
| 180 | 3300025263 | Ga0209565_1000003 | Ga0209565_1000003910 | 250 |
| 181 | 3300025263 | Ga0209565_1000267 | Ga0209565_10002674 | 250 |
| 182 | 3300025272 | Ga0209455_1000057 | Ga0209455_1000057209 | 250 |
| 183 | 3300025272 | Ga0209455_1000178 | Ga0209455_100017867 | 250 |
| 184 | 3300025273 | Ga0209673_1000003 | Ga0209673_1000003796 | 250 |
| 185 | 3300025273 | Ga0209673_1039180 | Ga0209673_10391802 | 250 |
| 186 | 3300025284 | Ga0209130_1002823 | Ga0209130_10028233 | 250 |
| 187 | 3300025291 | Ga0209675_1000003 | Ga0209675_1000003128 | 250 |
| 188 | 3300025291 | Ga0209675_1000575 | Ga0209675_10005755 | 250 |
| 189 | 3300025291 | Ga0209675_1005135 | Ga0209675_10051353 | 250 |
| 190 | 3300025292 | Ga0209676_1000012 | Ga0209676_1000012409 | 250 |
| 191 | 3300025294 | Ga0209025_1000306 | Ga0209025_100030651 | 250 |
| 192 | 3300025294 | Ga0209025_1000849 | Ga0209025_100084911 | 250 |
| 193 | 3300025294 | Ga0209025_1001305 | Ga0209025_10013054 | 250 |
| 194 | 3300025295 | Ga0209564_1000249 | Ga0209564_100024966 | 250 |
| 195 | 3300025295 | Ga0209564_1001057 | Ga0209564_10010574 | 250 |
| 196 | 3300025295 | Ga0209564_1001073 | Ga0209564_100107318 | 250 |
| 197 | 3300025295 | Ga0209564_1001165 | Ga0209564_10011658 | 250 |
| 198 | 3300025295 | Ga0209564_1017440 | Ga0209564_10174402 | 250 |
| 199 | 3300025297 | Ga0209758_1016445 | Ga0209758_10164453 | 250 |
| 200 | 3300025299 | Ga0209256_1000029 | Ga0209256_1000029297 | 250 |
| 201 | 3300025299 | Ga0209256_1000059 | Ga0209256_10000594 | 250 |
| 202 | 3300025302 | Ga0207426_1000056 | Ga0207426_1000056331 | 250 |
| 203 | 3300025303 | Ga0209051_1035043 | Ga0209051_10350431 | 250 |
| 204 | 3300025735 | Ga0207713_1000124 | Ga0207713_1000124118 | 250 |
| 205 | 3300025900 | Ga0207710_10007152 | Ga0207710_100071522 | 250 |
| 206 | 3300025900 | Ga0207710_10036339 | Ga0207710_100363392 | 250 |
| 207 | 3300025903 | Ga0207680_10038045 | Ga0207680_100380451 | 250 |
| 208 | 3300025903 | Ga0207680_10178312 | Ga0207680_101783122 | 250 |
| 209 | 3300025904 | Ga0207647_10008949 | Ga0207647_100089493 | 250 |
| 210 | 3300025904 | Ga0207647_10013995 | Ga0207647_100139953 | 250 |
| 211 | 3300025907 | Ga0207645_10048400 | Ga0207645_100484002 | 250 |
| 212 | 3300025907 | Ga0207645_10115403 | Ga0207645_101154032 | 250 |
| 213 | 3300025907 | Ga0207645_10392006 | Ga0207645_103920062 | 250 |
| 214 | 3300025909 | Ga0207705_10000924 | Ga0207705_1000092418 | 250 |
| 215 | 3300025911 | Ga0207654_10001825 | Ga0207654_100018257 | 250 |
| 216 | 3300025911 | Ga0207654_10186501 | Ga0207654_101865012 | 250 |
| 217 | 3300025911 | Ga0207654_10268708 | Ga0207654_102687082 | 250 |
| 218 | 3300025911 | Ga0207654_10337887 | Ga0207654_103378871 | 250 |
| 219 | 3300025913 | Ga0207695_10028387 | Ga0207695_100283873 | 250 |
| 220 | 3300025913 | Ga0207695_10032306 | Ga0207695_100323063 | 250 |
| 221 | 3300025913 | Ga0207695_10122490 | Ga0207695_101224902 | 250 |
| 222 | 3300025913 | Ga0207695_10126350 | Ga0207695_101263502 | 250 |
| 223 | 3300025913 | Ga0207695_10128884 | Ga0207695_101288842 | 250 |
| 224 | 3300025914 | Ga0207671_10164066 | Ga0207671_101640661 | 250 |
| 225 | 3300025914 | Ga0207671_10392249 | Ga0207671_103922492 | 250 |
| 226 | 3300025919 | Ga0207657_10004042 | Ga0207657_1000404214 | 250 |
| 227 | 3300025919 | Ga0207657_10012912 | Ga0207657_100129122 | 250 |
| 228 | 3300025919 | Ga0207657_10024708 | Ga0207657_100247083 | 250 |
| 229 | 3300025919 | Ga0207657_10029802 | Ga0207657_100298023 | 250 |
| 230 | 3300025920 | Ga0207649_10009337 | Ga0207649_100093373 | 250 |
| 231 | 3300025920 | Ga0207649_10062807 | Ga0207649_100628072 | 250 |
| 232 | 3300025927 | Ga0207687_10786785 | Ga0207687_107867851 | 250 |
| 233 | 3300025931 | Ga0207644_10045251 | Ga0207644_100452513 | 250 |
| 234 | 3300025931 | Ga0207644_10153115 | Ga0207644_101531152 | 250 |
| 235 | 3300025932 | Ga0207690_10002125 | Ga0207690_1000212511 | 250 |
| 236 | 3300025932 | Ga0207690_10010469 | Ga0207690_100104693 | 250 |
| 237 | 3300025934 | Ga0207686_10036646 | Ga0207686_100366463 | 250 |
| 238 | 3300025934 | Ga0207686_10113620 | Ga0207686_101136202 | 250 |
| 239 | 3300025934 | Ga0207686_10266957 | Ga0207686_102669572 | 250 |
| 240 | 3300025935 | Ga0207709_10097382 | Ga0207709_100973822 | 250 |
| 241 | 3300025938 | Ga0207704_10064189 | Ga0207704_100641893 | 250 |
| 242 | 3300025941 | Ga0207711_10019515 | Ga0207711_100195152 | 250 |
| 243 | 3300025941 | Ga0207711_10050936 | Ga0207711_100509362 | 250 |
| 244 | 3300025941 | Ga0207711_10091955 | Ga0207711_100919551 | 250 |
| 245 | 3300025942 | Ga0207689_10048079 | Ga0207689_100480792 | 250 |
| 246 | 3300025944 | Ga0207661_10183095 | Ga0207661_101830952 | 250 |
| 247 | 3300025945 | Ga0207679_10000419 | Ga0207679_100004196 | 250 |
| 248 | 3300025945 | Ga0207679_10028455 | Ga0207679_100284554 | 250 |
| 249 | 3300025945 | Ga0207679_10084638 | Ga0207679_100846382 | 250 |
| 250 | 3300025945 | Ga0207679_10377955 | Ga0207679_103779552 | 250 |
| 251 | 3300025949 | Ga0207667_10007331 | Ga0207667_100073318 | 250 |
| 252 | 3300025949 | Ga0207667_10059330 | Ga0207667_100593301 | 250 |
| 253 | 3300025949 | Ga0207667_10432674 | Ga0207667_104326742 | 250 |
| 254 | 3300025960 | Ga0207651_10342207 | Ga0207651_103422072 | 250 |
| 255 | 3300025961 | Ga0207712_10081148 | Ga0207712_100811482 | 250 |
| 256 | 3300025961 | Ga0207712_10111610 | Ga0207712_101116102 | 250 |
| 257 | 3300025981 | Ga0207640_10176263 | Ga0207640_101762632 | 250 |
| 258 | 3300025986 | Ga0207658_10145089 | Ga0207658_101450892 | 250 |
| 259 | 3300025986 | Ga0207658_10176156 | Ga0207658_101761562 | 250 |
| 260 | 3300025986 | Ga0207658_10245539 | Ga0207658_102455392 | 250 |
| 261 | 3300025986 | Ga0207658_10319195 | Ga0207658_103191952 | 250 |
| 262 | 3300025986 | Ga0207658_10697709 | Ga0207658_106977091 | 250 |
| 263 | 3300026035 | Ga0207703_10002618 | Ga0207703_100026186 | 250 |
| 264 | 3300026041 | Ga0207639_10116247 | Ga0207639_101162472 | 250 |
| 265 | 3300026041 | Ga0207639_10312752 | Ga0207639_103127521 | 250 |
| 266 | 3300026067 | Ga0207678_10007448 | Ga0207678_100074483 | 250 |
| 267 | 3300026067 | Ga0207678_10076009 | Ga0207678_100760092 | 250 |
| 268 | 3300026067 | Ga0207678_10103641 | Ga0207678_101036412 | 250 |
| 269 | 3300026078 | Ga0207702_10825272 | Ga0207702_108252721 | 250 |
| 270 | 3300026088 | Ga0207641_10000880 | Ga0207641_1000088020 | 250 |
| 271 | 3300026088 | Ga0207641_10025099 | Ga0207641_100250993 | 250 |
| 272 | 3300026089 | Ga0207648_10123277 | Ga0207648_101232772 | 250 |
| 273 | 3300026095 | Ga0207676_10566164 | Ga0207676_105661642 | 250 |
| 274 | 3300026116 | Ga0207674_10032647 | Ga0207674_100326476 | 250 |
| 275 | 3300026116 | Ga0207674_10318130 | Ga0207674_103181302 | 250 |
| 276 | 3300027666 | Ga0209282_1000033 | Ga0209282_1000033141 | 250 |
| 277 | 3300027866 | Ga0209813_10008652 | Ga0209813_100086523 | 250 |
| 278 | 3300027866 | Ga0209813_10018405 | Ga0209813_100184052 | 250 |
| 279 | 3300027876 | Ga0209974_10001884 | Ga0209974_100018843 | 250 |
| 280 | 3300028379 | Ga0268266_10000709 | Ga0268266_1000070912 | 250 |
| 281 | 3300028379 | Ga0268266_10003171 | Ga0268266_100031717 | 250 |
| 282 | 3300028379 | Ga0268266_10034782 | Ga0268266_100347823 | 250 |
| 283 | 3300028379 | Ga0268266_10059371 | Ga0268266_100593712 | 250 |
| 284 | 3300028379 | Ga0268266_10116281 | Ga0268266_101162812 | 250 |
| 285 | 3300028380 | Ga0268265_10047171 | Ga0268265_100471713 | 250 |
| 286 | 3300028381 | Ga0268264_10000100 | Ga0268264_1000010048 | 250 |
| 287 | 3300028381 | Ga0268264_10173872 | Ga0268264_101738722 | 250 |
| 288 | 3300028786 | Ga0307517_10162912 | Ga0307517_101629122 | 250 |
| 289 | 3300028794 | Ga0307515_10085151 | Ga0307515_100851512 | 250 |
| 290 | 3300030521 | Ga0307511_10000052 | Ga0307511_1000005275 | 250 |
| 291 | 3300030522 | Ga0307512_10165448 | Ga0307512_101654481 | 250 |
| 292 | 3300031456 | Ga0307513_10046599 | Ga0307513_100465992 | 250 |
| 293 | 3300031456 | Ga0307513_10298653 | Ga0307513_102986531 | 250 |
| 294 | 3300031507 | Ga0307509_10029746 | Ga0307509_100297463 | 250 |
| 295 | 3300031507 | Ga0307509_10079950 | Ga0307509_100799502 | 250 |
| 296 | 3300031616 | Ga0307508_10067046 | Ga0307508_100670462 | 250 |
| 297 | 3300031727 | Ga0316576_10165766 | Ga0316576_101657662 | 250 |
| 298 | 3300031730 | Ga0307516_10013929 | Ga0307516_100139293 | 250 |
| 299 | 3300031730 | Ga0307516_10216646 | Ga0307516_102166462 | 250 |
| 300 | 3300031733 | Ga0316577_10018183 | Ga0316577_100181832 | 250 |
| 301 | 3300031911 | Ga0307412_10000010 | Ga0307412_10000010102 | 250 |
| 302 | 3300031911 | Ga0307412_10045965 | Ga0307412_100459652 | 250 |
| 303 | 3300032137 | Ga0316585_10023504 | Ga0316585_100235042 | 250 |
| 304 | 3300033179 | Ga0307507_10034168 | Ga0307507_100341682 | 250 |
| 305 | 3300033179 | Ga0307507_10214904 | Ga0307507_102149042 | 250 |
| 306 | 3300033180 | Ga0307510_10000001 | Ga0307510_10000001306 | 250 |
| 307 | 3300035398 | Ga0316574_0083285 | Ga0316574_0083285_375_1133 | 250 |
| 308 | 3300036647 | Ga0316582_0046141 | Ga0316582_0046141_1623_2381 | 250 |
| 309 | 3300036712 | Ga0316584_0002509 | Ga0316584_0002509_9608_10366 | 250 |
| 310 | 3300037312 | Ga0395899_0000019 | Ga0395899_0000019_33704_34465 | 250 |
| 311 | 3300037312 | Ga0395899_0004562 | Ga0395899_0004562_1124_1879 | 250 |
| 312 | 3300037312 | Ga0395899_0006365 | Ga0395899_0006365_1681_2502 | 250 |
| 313 | 3300037418 | Ga0395900_0000307 | Ga0395900_0000307_65143_65964 | 250 |
| 314 | 3300037418 | Ga0395900_0003711 | Ga0395900_0003711_12985_13746 | 250 |
| 315 | 3300037418 | Ga0395900_0060982 | Ga0395900_0060982_1202_1957 | 250 |
| 316 | 3300037466 | Ga0395898_0176730 | Ga0395898_0176730_85_840 | 250 |
| 317 | 3300037471 | Ga0395905_0000004 | Ga0395905_0000004_582389_583141 | 250 |
| 318 | 3300037471 | Ga0395905_0002221 | Ga0395905_0002221_5978_6730 | 250 |
| 319 | 3300037471 | Ga0395905_0247073 | Ga0395905_0247073_746_1498 | 250 |
| 320 | 3300037471 | Ga0395905_0534808 | Ga0395905_0534808_111_872 | 250 |
| 321 | 3300038443 | Ga0395901_0035147 | Ga0395901_0035147_1564_2325 | 250 |
| 322 | 3300038443 | Ga0395901_0061437 | Ga0395901_0061437_1191_1946 | 250 |
| 323 | 3300038443 | Ga0395901_0149380 | Ga0395901_0149380_1336_2097 | 250 |
| 324 | 3300038443 | Ga0395901_0185486 | Ga0395901_0185486_1151_1912 | 250 |
| 325 | 3300041999 | Ga0439433_0043792 | Ga0439433_0043792_204_965 | 250 |
| 326 | 3300042005 | Ga0439448_0001081 | Ga0439448_0001081_1202_1963 | 250 |
| 327 | 3300042007 | Ga0439449_0020912 | Ga0439449_0020912_487_1248 | 250 |
| 328 | 3300042007 | Ga0439449_0072318 | Ga0439449_0072318_173_925 | 250 |
| 329 | 3300042012 | Ga0439455_0000629 | Ga0439455_0000629_3028_3789 | 250 |
| 330 | 3300042130 | Ga0450892_002439 | Ga0450892_002439_584_1336 | 250 |
| 331 | 3300042157 | Ga0439458_0018965 | Ga0439458_0018965_69_830 | 250 |
| 332 | 3300042157 | Ga0439458_0020809 | Ga0439458_0020809_453_1214 | 250 |
| 333 | 3300042461 | Ga0439460_0014209 | Ga0439460_0014209_247_1008 | 250 |
| 334 | 3300042531 | Ga0450918_000439 | Ga0450918_000439_2781_3533 | 250 |
| 335 | 3300044656 | Ga0466969_0053435 | Ga0466969_0053435_91_843 | 250 |
| 336 | 3300044658 | Ga0466972_0000239 | Ga0466972_0000239_17329_18084 | 250 |
| 337 | 3300044658 | Ga0466972_0000923 | Ga0466972_0000923_3980_4735 | 250 |
| 338 | 3300044658 | Ga0466972_0121721 | Ga0466972_0121721_299_1060 | 250 |
| 339 | 3300044683 | Ga0466965_0000569 | Ga0466965_0000569_8086_8841 | 250 |
| 340 | 3300044683 | Ga0466965_0042031 | Ga0466965_0042031_775_1527 | 250 |
| 341 | 3300044684 | Ga0466966_0019835 | Ga0466966_0019835_754_1506 | 250 |
| 342 | 3300044684 | Ga0466966_0057593 | Ga0466966_0057593_1474_2235 | 250 |
| 343 | 3300044684 | Ga0466966_0105310 | Ga0466966_0105310_966_1727 | 250 |
| 344 | 3300044693 | Ga0466961_0010484 | Ga0466961_0010484_4977_5729 | 250 |
| 345 | 3300044693 | Ga0466961_0040036 | Ga0466961_0040036_893_1645 | 250 |
| 346 | 3300044694 | Ga0466963_0010691 | Ga0466963_0010691_2088_2849 | 250 |
| 347 | 3300044706 | Ga0466964_0002281 | Ga0466964_0002281_5243_6004 | 250 |
| 348 | 3300044706 | Ga0466964_0006746 | Ga0466964_0006746_3475_4227 | 250 |
| 349 | 3300044706 | Ga0466964_0008899 | Ga0466964_0008899_1867_2622 | 250 |
| 350 | 3300044719 | Ga0466971_0000213 | Ga0466971_0000213_21242_21994 | 250 |
| 351 | 3300044719 | Ga0466971_0087604 | Ga0466971_0087604_470_1231 | 250 |
| 352 | 3300044735 | Ga0466968_0003486 | Ga0466968_0003486_3011_3766 | 250 |
| 353 | 3300044765 | Ga0466970_0016928 | Ga0466970_0016928_1004_1756 | 250 |
| 354 | 3300044765 | Ga0466970_0091006 | Ga0466970_0091006_299_1060 | 250 |
| 355 | 3300044842 | Ga0466957_0000113 | Ga0466957_0000113_29096_29857 | 250 |
| 356 | 3300044842 | Ga0466957_0029523 | Ga0466957_0029523_1206_1967 | 250 |
| 357 | 3300044842 | Ga0466957_0055513 | Ga0466957_0055513_1653_2405 | 250 |
| 358 | 3300044842 | Ga0466957_0059856 | Ga0466957_0059856_562_1323 | 250 |
| 359 | 3300044901 | Ga0466960_0135256 | Ga0466960_0135256_60_812 | 250 |
| 360 | 3300044901 | Ga0466960_0246184 | Ga0466960_0246184_113_874 | 250 |
| 361 | 3300045049 | Ga0466959_0008404 | Ga0466959_0008404_1963_2715 | 250 |
| 362 | 3300045049 | Ga0466959_0035982 | Ga0466959_0035982_757_1518 | 250 |
| 363 | 3300045049 | Ga0466959_0049560 | Ga0466959_0049560_478_1239 | 250 |
| 364 | 3300045049 | Ga0466959_0071936 | Ga0466959_0071936_709_1500 | 250 |
| 365 | 3300045049 | Ga0466959_0170820 | Ga0466959_0170820_747_1499 | 250 |
| 366 | 3300045836 | Ga0466958_0020084 | Ga0466958_0020084_1703_2494 | 250 |
| 367 | 3300045836 | Ga0466958_0039156 | Ga0466958_0039156_177_929 | 250 |
| 368 | 3300045836 | Ga0466958_0098542 | Ga0466958_0098542_949_1710 | 250 |
| 369 | 3300045976 | Ga0466967_0014759 | Ga0466967_0014759_104_865 | 250 |
| 370 | 3300045976 | Ga0466967_0027604 | Ga0466967_0027604_1152_1913 | 250 |
| 371 | 3300045976 | Ga0466967_0062513 | Ga0466967_0062513_2234_2995 | 250 |
| 372 | 3300046452 | Ga0495617_000342 | Ga0495617_000342_12725_13657 | 250 |
| 373 | 3300046452 | Ga0495617_076074 | Ga0495617_076074_66_827 | 250 |
| 374 | 3300046453 | Ga0495627_002589 | Ga0495627_002589_134_895 | 250 |
| 375 | 3300046454 | Ga0495592_0003498 | Ga0495592_0003498_6686_7453 | 250 |
| 376 | 3300046454 | Ga0495592_0008815 | Ga0495592_0008815_6666_7418 | 250 |
| 377 | 3300046454 | Ga0495592_0031704 | Ga0495592_0031704_1113_1865 | 250 |
| 378 | 3300046455 | Ga0495603_0001914 | Ga0495603_0001914_6418_7170 | 250 |
| 379 | 3300046455 | Ga0495603_0007636 | Ga0495603_0007636_226_978 | 250 |
| 380 | 3300046455 | Ga0495603_0033035 | Ga0495603_0033035_137_889 | 250 |
| 381 | 3300046457 | Ga0495590_0003986 | Ga0495590_0003986_3689_4441 | 250 |
| 382 | 3300046457 | Ga0495590_0004269 | Ga0495590_0004269_1163_1924 | 250 |
| 383 | 3300046457 | Ga0495590_0011444 | Ga0495590_0011444_891_1643 | 250 |
| 384 | 3300046457 | Ga0495590_0017870 | Ga0495590_0017870_1022_1783 | 250 |
| 385 | 3300046457 | Ga0495590_0021871 | Ga0495590_0021871_753_1514 | 250 |
| 386 | 3300046457 | Ga0495590_0025985 | Ga0495590_0025985_933_1685 | 250 |
| 387 | 3300046458 | Ga0495591_002404 | Ga0495591_002404_1803_2555 | 250 |
| 388 | 3300046458 | Ga0495591_045260 | Ga0495591_045260_241_993 | 250 |
| 389 | 3300046459 | Ga0495629_0000033 | Ga0495629_0000033_12399_13151 | 250 |
| 390 | 3300046459 | Ga0495629_0001020 | Ga0495629_0001020_13002_13754 | 250 |
| 391 | 3300046459 | Ga0495629_0001234 | Ga0495629_0001234_2729_3481 | 250 |
| 392 | 3300046459 | Ga0495629_0008541 | Ga0495629_0008541_1652_2404 | 250 |
| 393 | 3300046459 | Ga0495629_0012940 | Ga0495629_0012940_5212_5979 | 250 |
| 394 | 3300046460 | Ga0495638_0004343 | Ga0495638_0004343_5455_6216 | 250 |
| 395 | 3300046460 | Ga0495638_0006259 | Ga0495638_0006259_6247_6999 | 250 |
| 396 | 3300046460 | Ga0495638_0012654 | Ga0495638_0012654_1362_2123 | 250 |
| 397 | 3300046460 | Ga0495638_0199344 | Ga0495638_0199344_312_1073 | 250 |
| 398 | 3300046461 | Ga0495641_0009288 | Ga0495641_0009288_3464_4216 | 250 |
| 399 | 3300046461 | Ga0495641_0036211 | Ga0495641_0036211_324_1091 | 250 |
| 400 | 3300046462 | Ga0495651_0006377 | Ga0495651_0006377_6541_7293 | 250 |
| 401 | 3300046463 | Ga0495653_0000163 | Ga0495653_0000163_3043_3795 | 250 |
| 402 | 3300046463 | Ga0495653_0013007 | Ga0495653_0013007_1237_1989 | 250 |
| 403 | 3300046463 | Ga0495653_0020177 | Ga0495653_0020177_18_779 | 250 |
| 404 | 3300046463 | Ga0495653_0055391 | Ga0495653_0055391_887_1639 | 250 |
| 405 | 3300046463 | Ga0495653_0137033 | Ga0495653_0137033_854_1621 | 250 |
| 406 | 3300046463 | Ga0495653_0157037 | Ga0495653_0157037_410_1162 | 250 |
| 407 | 3300046471 | Ga0495650_0000155 | Ga0495650_0000155_147931_148683 | 250 |
| 408 | 3300046471 | Ga0495650_0006449 | Ga0495650_0006449_6231_6983 | 250 |
| 409 | 3300046471 | Ga0495650_0022675 | Ga0495650_0022675_172_924 | 250 |
| 410 | 3300046471 | Ga0495650_0029157 | Ga0495650_0029157_524_1291 | 250 |
| 411 | 3300046471 | Ga0495650_0087945 | Ga0495650_0087945_72_824 | 250 |
| 412 | 3300046472 | Ga0495580_0000078 | Ga0495580_0000078_12455_13207 | 250 |
| 413 | 3300046472 | Ga0495580_0001384 | Ga0495580_0001384_11994_12746 | 250 |
| 414 | 3300046472 | Ga0495580_0002738 | Ga0495580_0002738_5284_6036 | 250 |
| 415 | 3300046472 | Ga0495580_0007507 | Ga0495580_0007507_6149_6901 | 250 |
| 416 | 3300046472 | Ga0495580_0040309 | Ga0495580_0040309_1087_1839 | 250 |
| 417 | 3300046472 | Ga0495580_0117201 | Ga0495580_0117201_128_880 | 250 |
| 418 | 3300046473 | Ga0495582_0002137 | Ga0495582_0002137_10124_10876 | 250 |
| 419 | 3300046473 | Ga0495582_0007917 | Ga0495582_0007917_1397_2164 | 250 |
| 420 | 3300046473 | Ga0495582_0023190 | Ga0495582_0023190_69_821 | 250 |
| 421 | 3300046474 | Ga0495605_0002835 | Ga0495605_0002835_1076_1828 | 250 |
| 422 | 3300046474 | Ga0495605_0004615 | Ga0495605_0004615_6158_6910 | 250 |
| 423 | 3300046474 | Ga0495605_0012807 | Ga0495605_0012807_2523_3275 | 250 |
| 424 | 3300046474 | Ga0495605_0119759 | Ga0495605_0119759_392_1153 | 250 |
| 425 | 3300046474 | Ga0495605_0159502 | Ga0495605_0159502_54_806 | 250 |
| 426 | 3300046475 | Ga0495639_0142702 | Ga0495639_0142702_299_1060 | 250 |
| 427 | 3300046476 | Ga0495662_0001701 | Ga0495662_0001701_7564_8316 | 250 |
| 428 | 3300046476 | Ga0495662_0006734 | Ga0495662_0006734_2412_3164 | 250 |
| 429 | 3300046476 | Ga0495662_0010105 | Ga0495662_0010105_632_1384 | 250 |
| 430 | 3300046477 | Ga0495664_0000125 | Ga0495664_0000125_29342_30094 | 250 |
| 431 | 3300046477 | Ga0495664_0005491 | Ga0495664_0005491_5030_5815 | 250 |
| 432 | 3300046477 | Ga0495664_0035696 | Ga0495664_0035696_796_1563 | 250 |
| 433 | 3300046477 | Ga0495664_0047412 | Ga0495664_0047412_1245_1997 | 250 |
| 434 | 3300046491 | Ga0495584_0000078 | Ga0495584_0000078_4575_5336 | 250 |
| 435 | 3300046491 | Ga0495584_0000835 | Ga0495584_0000835_10625_11398 | 250 |
| 436 | 3300046491 | Ga0495584_0017221 | Ga0495584_0017221_826_1587 | 250 |
| 437 | 3300046491 | Ga0495584_0022466 | Ga0495584_0022466_658_1419 | 250 |
| 438 | 3300046491 | Ga0495584_0044129 | Ga0495584_0044129_852_1613 | 250 |
| 439 | 3300046491 | Ga0495584_0057840 | Ga0495584_0057840_309_1061 | 250 |
| 440 | 3300046491 | Ga0495584_0064657 | Ga0495584_0064657_648_1409 | 250 |
| 441 | 3300046491 | Ga0495584_0091313 | Ga0495584_0091313_602_1363 | 250 |
| 442 | 3300046491 | Ga0495584_0112278 | Ga0495584_0112278_134_895 | 250 |
| 443 | 3300046491 | Ga0495584_0163525 | Ga0495584_0163525_237_998 | 250 |
| 444 | 3300046492 | Ga0495585_0000033 | Ga0495585_0000033_37656_38417 | 250 |
| 445 | 3300046492 | Ga0495585_0000042 | Ga0495585_0000042_27333_28265 | 250 |
| 446 | 3300046492 | Ga0495585_0000083 | Ga0495585_0000083_18433_19194 | 250 |
| 447 | 3300046492 | Ga0495585_0000799 | Ga0495585_0000799_9527_10300 | 250 |
| 448 | 3300046492 | Ga0495585_0003558 | Ga0495585_0003558_7997_8758 | 250 |
| 449 | 3300046492 | Ga0495585_0010937 | Ga0495585_0010937_3504_4265 | 250 |
| 450 | 3300046492 | Ga0495585_0020483 | Ga0495585_0020483_2829_3590 | 250 |
| 451 | 3300046492 | Ga0495585_0021068 | Ga0495585_0021068_2483_3244 | 250 |
| 452 | 3300046492 | Ga0495585_0022300 | Ga0495585_0022300_456_1217 | 250 |
| 453 | 3300046492 | Ga0495585_0040530 | Ga0495585_0040530_56_808 | 250 |
| 454 | 3300046492 | Ga0495585_0067225 | Ga0495585_0067225_621_1382 | 250 |
| 455 | 3300046492 | Ga0495585_0069218 | Ga0495585_0069218_92_853 | 250 |
| 456 | 3300046492 | Ga0495585_0114228 | Ga0495585_0114228_322_1083 | 250 |
| 457 | 3300046499 | Ga0495594_0050767 | Ga0495594_0050767_126_878 | 250 |
| 458 | 3300046500 | Ga0495596_0000221 | Ga0495596_0000221_28960_29721 | 250 |
| 459 | 3300046500 | Ga0495596_0001075 | Ga0495596_0001075_14370_15122 | 250 |
| 460 | 3300046500 | Ga0495596_0005011 | Ga0495596_0005011_4349_5101 | 250 |
| 461 | 3300046500 | Ga0495596_0006428 | Ga0495596_0006428_1732_2493 | 250 |
| 462 | 3300046500 | Ga0495596_0007677 | Ga0495596_0007677_277_1038 | 250 |
| 463 | 3300046500 | Ga0495596_0011365 | Ga0495596_0011365_644_1396 | 250 |
| 464 | 3300046500 | Ga0495596_0013231 | Ga0495596_0013231_1000_1773 | 250 |
| 465 | 3300046500 | Ga0495596_0028754 | Ga0495596_0028754_721_1482 | 250 |
| 466 | 3300046500 | Ga0495596_0150081 | Ga0495596_0150081_30_797 | 250 |
| 467 | 3300046500 | Ga0495596_0152794 | Ga0495596_0152794_35_787 | 250 |
| 468 | 3300046501 | Ga0495607_0000412 | Ga0495607_0000412_29838_30659 | 250 |
| 469 | 3300046501 | Ga0495607_0010217 | Ga0495607_0010217_4413_5174 | 250 |
| 470 | 3300046501 | Ga0495607_0014243 | Ga0495607_0014243_2465_3226 | 250 |
| 471 | 3300046501 | Ga0495607_0051049 | Ga0495607_0051049_321_1082 | 250 |
| 472 | 3300046501 | Ga0495607_0058149 | Ga0495607_0058149_119_880 | 250 |
| 473 | 3300046501 | Ga0495607_0064317 | Ga0495607_0064317_386_1138 | 250 |
| 474 | 3300046501 | Ga0495607_0109092 | Ga0495607_0109092_539_1291 | 250 |
| 475 | 3300046501 | Ga0495607_0115445 | Ga0495607_0115445_414_1175 | 250 |
| 476 | 3300046506 | Ga0495583_0000045 | Ga0495583_0000045_36709_37470 | 250 |
| 477 | 3300046506 | Ga0495583_0000263 | Ga0495583_0000263_43939_44700 | 250 |
| 478 | 3300046506 | Ga0495583_0000329 | Ga0495583_0000329_64403_65164 | 250 |
| 479 | 3300046506 | Ga0495583_0002504 | Ga0495583_0002504_8229_8990 | 250 |
| 480 | 3300046506 | Ga0495583_0004038 | Ga0495583_0004038_3544_4305 | 250 |
| 481 | 3300046506 | Ga0495583_0009832 | Ga0495583_0009832_460_1212 | 250 |
| 482 | 3300046506 | Ga0495583_0018472 | Ga0495583_0018472_842_1594 | 250 |
| 483 | 3300046506 | Ga0495583_0043569 | Ga0495583_0043569_564_1325 | 250 |
| 484 | 3300046506 | Ga0495583_0046636 | Ga0495583_0046636_465_1226 | 250 |
| 485 | 3300046507 | Ga0495606_0016983 | Ga0495606_0016983_984_1736 | 250 |
| 486 | 3300046507 | Ga0495606_0030427 | Ga0495606_0030427_1012_1773 | 250 |
| 487 | 3300046507 | Ga0495606_0037142 | Ga0495606_0037142_646_1398 | 250 |
| 488 | 3300046507 | Ga0495606_0112318 | Ga0495606_0112318_235_996 | 250 |
| 489 | 3300046507 | Ga0495606_0133158 | Ga0495606_0133158_541_1308 | 250 |
| 490 | 3300046511 | Ga0495608_0124466 | Ga0495608_0124466_225_977 | 250 |
| 491 | 3300046512 | Ga0495610_0000319 | Ga0495610_0000319_17749_18501 | 250 |
| 492 | 3300046512 | Ga0495610_0001240 | Ga0495610_0001240_21176_21928 | 250 |
| 493 | 3300046513 | Ga0495616_0000095 | Ga0495616_0000095_47757_48518 | 250 |
| 494 | 3300046513 | Ga0495616_0001821 | Ga0495616_0001821_12056_12808 | 250 |
| 495 | 3300046513 | Ga0495616_0002270 | Ga0495616_0002270_9428_10189 | 250 |
| 496 | 3300046513 | Ga0495616_0002596 | Ga0495616_0002596_2733_3506 | 250 |
| 497 | 3300046513 | Ga0495616_0009441 | Ga0495616_0009441_128_889 | 250 |
| 498 | 3300046513 | Ga0495616_0010973 | Ga0495616_0010973_3796_4557 | 250 |
| 499 | 3300046513 | Ga0495616_0013715 | Ga0495616_0013715_1449_2270 | 250 |
| 500 | 3300046513 | Ga0495616_0024567 | Ga0495616_0024567_1458_2210 | 250 |
| 501 | 3300046513 | Ga0495616_0025518 | Ga0495616_0025518_527_1288 | 250 |
| 502 | 3300046513 | Ga0495616_0036220 | Ga0495616_0036220_1759_2520 | 250 |
| 503 | 3300046514 | Ga0495618_0000437 | Ga0495618_0000437_14219_14971 | 250 |
| 504 | 3300046514 | Ga0495618_0005908 | Ga0495618_0005908_843_1595 | 250 |
| 505 | 3300046514 | Ga0495618_0006976 | Ga0495618_0006976_3722_4489 | 250 |
| 506 | 3300046515 | Ga0495620_0011138 | Ga0495620_0011138_2444_3196 | 250 |
| 507 | 3300046515 | Ga0495620_0065570 | Ga0495620_0065570_245_1012 | 250 |
| 508 | 3300046516 | Ga0495628_0002735 | Ga0495628_0002735_11994_12746 | 250 |
| 509 | 3300046516 | Ga0495628_0004068 | Ga0495628_0004068_8871_9623 | 250 |
| 510 | 3300046516 | Ga0495628_0027401 | Ga0495628_0027401_2915_3667 | 250 |
| 511 | 3300046516 | Ga0495628_0031631 | Ga0495628_0031631_1160_1912 | 250 |
| 512 | 3300046516 | Ga0495628_0053730 | Ga0495628_0053730_1303_2070 | 250 |
| 513 | 3300046516 | Ga0495628_0122314 | Ga0495628_0122314_157_909 | 250 |
| 514 | 3300046517 | Ga0495630_0000616 | Ga0495630_0000616_7696_8448 | 250 |
| 515 | 3300046517 | Ga0495630_0007378 | Ga0495630_0007378_1173_1925 | 250 |
| 516 | 3300046517 | Ga0495630_0042282 | Ga0495630_0042282_1503_2255 | 250 |
| 517 | 3300046518 | Ga0495631_0000501 | Ga0495631_0000501_19551_20312 | 250 |
| 518 | 3300046518 | Ga0495631_0041330 | Ga0495631_0041330_738_1499 | 250 |
| 519 | 3300046518 | Ga0495631_0097067 | Ga0495631_0097067_405_1166 | 250 |
| 520 | 3300046518 | Ga0495631_0107480 | Ga0495631_0107480_422_1183 | 250 |
| 521 | 3300046519 | Ga0495632_0000474 | Ga0495632_0000474_30894_31655 | 250 |
| 522 | 3300046519 | Ga0495632_0013290 | Ga0495632_0013290_1206_1967 | 250 |
| 523 | 3300046519 | Ga0495632_0039687 | Ga0495632_0039687_1138_1890 | 250 |
| 524 | 3300046519 | Ga0495632_0203678 | Ga0495632_0203678_116_877 | 250 |
| 525 | 3300046520 | Ga0495637_0024074 | Ga0495637_0024074_787_1548 | 250 |
| 526 | 3300046522 | Ga0495643_0000507 | Ga0495643_0000507_4669_5430 | 250 |
| 527 | 3300046522 | Ga0495643_0049393 | Ga0495643_0049393_1231_2052 | 250 |
| 528 | 3300046522 | Ga0495643_0060087 | Ga0495643_0060087_76_837 | 250 |
| 529 | 3300046522 | Ga0495643_0090898 | Ga0495643_0090898_260_1021 | 250 |
| 530 | 3300046522 | Ga0495643_0201323 | Ga0495643_0201323_105_857 | 250 |
| 531 | 3300046523 | Ga0495644_0000129 | Ga0495644_0000129_9136_9897 | 250 |
| 532 | 3300046523 | Ga0495644_0000547 | Ga0495644_0000547_13141_13902 | 250 |
| 533 | 3300046523 | Ga0495644_0007632 | Ga0495644_0007632_788_1549 | 250 |
| 534 | 3300046523 | Ga0495644_0091051 | Ga0495644_0091051_131_892 | 250 |
| 535 | 3300046523 | Ga0495644_0146276 | Ga0495644_0146276_41_802 | 250 |
| 536 | 3300046524 | Ga0495648_0000052 | Ga0495648_0000052_27333_28265 | 250 |
| 537 | 3300046524 | Ga0495648_0000613 | Ga0495648_0000613_30127_30888 | 250 |
| 538 | 3300046524 | Ga0495648_0004038 | Ga0495648_0004038_589_1341 | 250 |
| 539 | 3300046524 | Ga0495648_0018499 | Ga0495648_0018499_490_1251 | 250 |
| 540 | 3300046524 | Ga0495648_0019856 | Ga0495648_0019856_2785_3537 | 250 |
| 541 | 3300046524 | Ga0495648_0022982 | Ga0495648_0022982_2851_3612 | 250 |
| 542 | 3300046524 | Ga0495648_0028068 | Ga0495648_0028068_1033_1785 | 250 |
| 543 | 3300046524 | Ga0495648_0053931 | Ga0495648_0053931_313_1074 | 250 |
| 544 | 3300046524 | Ga0495648_0055376 | Ga0495648_0055376_549_1301 | 250 |
| 545 | 3300046524 | Ga0495648_0090244 | Ga0495648_0090244_159_920 | 250 |
| 546 | 3300046525 | Ga0495663_0052013 | Ga0495663_0052013_328_1089 | 250 |
| 547 | 3300046525 | Ga0495663_0074510 | Ga0495663_0074510_187_948 | 250 |
| 548 | 3300046526 | Ga0495666_0000056 | Ga0495666_0000056_12806_13558 | 250 |
| 549 | 3300046526 | Ga0495666_0004051 | Ga0495666_0004051_5004_5756 | 250 |
| 550 | 3300046526 | Ga0495666_0013556 | Ga0495666_0013556_2355_3107 | 250 |
| 551 | 3300046526 | Ga0495666_0026056 | Ga0495666_0026056_593_1345 | 250 |
| 552 | 3300046526 | Ga0495666_0026422 | Ga0495666_0026422_1302_2123 | 250 |
| 553 | 3300046528 | Ga0495642_0000280 | Ga0495642_0000280_6666_7427 | 250 |
| 554 | 3300046528 | Ga0495642_0001004 | Ga0495642_0001004_5668_6420 | 250 |
| 555 | 3300046528 | Ga0495642_0001955 | Ga0495642_0001955_1414_2235 | 250 |
| 556 | 3300046528 | Ga0495642_0010706 | Ga0495642_0010706_1778_2539 | 250 |
| 557 | 3300046528 | Ga0495642_0024555 | Ga0495642_0024555_370_1122 | 250 |
| 558 | 3300046528 | Ga0495642_0044843 | Ga0495642_0044843_961_1713 | 250 |
| 559 | 3300046528 | Ga0495642_0050377 | Ga0495642_0050377_320_1081 | 250 |
| 560 | 3300046529 | Ga0495652_0003187 | Ga0495652_0003187_12570_13322 | 250 |
| 561 | 3300046529 | Ga0495652_0012065 | Ga0495652_0012065_6072_6839 | 250 |
| 562 | 3300046529 | Ga0495652_0288818 | Ga0495652_0288818_294_1046 | 250 |
| 563 | 3300046530 | Ga0495654_0031080 | Ga0495654_0031080_1227_1979 | 250 |
| 564 | 3300046530 | Ga0495654_0075835 | Ga0495654_0075835_454_1215 | 250 |
| 565 | 3300046531 | Ga0495665_0000980 | Ga0495665_0000980_12606_13358 | 250 |
| 566 | 3300046531 | Ga0495665_0015997 | Ga0495665_0015997_1746_2498 | 250 |
| 567 | 3300046531 | Ga0495665_0019144 | Ga0495665_0019144_1085_1837 | 250 |
| 568 | 3300046531 | Ga0495665_0058742 | Ga0495665_0058742_1244_1996 | 250 |
| 569 | 3300046533 | Ga0495640_0001085 | Ga0495640_0001085_15513_16265 | 250 |
| 570 | 3300046533 | Ga0495640_0036662 | Ga0495640_0036662_1397_2164 | 250 |
| 571 | 3300046533 | Ga0495640_0092345 | Ga0495640_0092345_658_1410 | 250 |
| 572 | 3300046535 | Ga0495586_0000574 | Ga0495586_0000574_7751_8503 | 250 |
| 573 | 3300046535 | Ga0495586_0039585 | Ga0495586_0039585_658_1425 | 250 |
| 574 | 3300046535 | Ga0495586_0149523 | Ga0495586_0149523_489_1274 | 250 |
| 575 | 3300046536 | Ga0495587_0000278 | Ga0495587_0000278_17022_17774 | 250 |
| 576 | 3300046536 | Ga0495587_0010663 | Ga0495587_0010663_1633_2385 | 250 |
| 577 | 3300046536 | Ga0495587_0034067 | Ga0495587_0034067_1236_1997 | 250 |
| 578 | 3300046536 | Ga0495587_0062156 | Ga0495587_0062156_859_1620 | 250 |
| 579 | 3300046538 | Ga0495609_0000084 | Ga0495609_0000084_106020_106781 | 250 |
| 580 | 3300046538 | Ga0495609_0000086 | Ga0495609_0000086_6339_7160 | 250 |
| 581 | 3300046538 | Ga0495609_0000523 | Ga0495609_0000523_9372_10133 | 250 |
| 582 | 3300046538 | Ga0495609_0001293 | Ga0495609_0001293_13835_14596 | 250 |
| 583 | 3300046538 | Ga0495609_0002353 | Ga0495609_0002353_9932_10684 | 250 |
| 584 | 3300046538 | Ga0495609_0016137 | Ga0495609_0016137_115_876 | 250 |
| 585 | 3300046538 | Ga0495609_0024913 | Ga0495609_0024913_1546_2307 | 250 |
| 586 | 3300046538 | Ga0495609_0024995 | Ga0495609_0024995_1196_1957 | 250 |
| 587 | 3300046538 | Ga0495609_0025935 | Ga0495609_0025935_433_1194 | 250 |
| 588 | 3300046538 | Ga0495609_0055980 | Ga0495609_0055980_751_1512 | 250 |
| 589 | 3300046538 | Ga0495609_0057638 | Ga0495609_0057638_255_1007 | 250 |
| 590 | 3300046539 | Ga0495621_0051400 | Ga0495621_0051400_618_1370 | 250 |
| 591 | 3300046542 | Ga0495597_0001484 | Ga0495597_0001484_10993_11754 | 250 |
| 592 | 3300046542 | Ga0495597_0003591 | Ga0495597_0003591_5408_6169 | 250 |
| 593 | 3300046542 | Ga0495597_0005881 | Ga0495597_0005881_2665_3426 | 250 |
| 594 | 3300046542 | Ga0495597_0009675 | Ga0495597_0009675_1244_2005 | 250 |
| 595 | 3300046542 | Ga0495597_0012276 | Ga0495597_0012276_629_1381 | 250 |
| 596 | 3300046542 | Ga0495597_0024955 | Ga0495597_0024955_1877_2638 | 250 |
| 597 | 3300046542 | Ga0495597_0058540 | Ga0495597_0058540_712_1464 | 250 |
| 598 | 3300046542 | Ga0495597_0064337 | Ga0495597_0064337_431_1183 | 250 |
| 599 | 3300046543 | Ga0495645_0000102 | Ga0495645_0000102_8566_9318 | 250 |
| 600 | 3300046543 | Ga0495645_0005699 | Ga0495645_0005699_5633_6424 | 250 |
| 601 | 3300046557 | Ga0495622_0000096 | Ga0495622_0000096_29964_30716 | 250 |
| 602 | 3300046557 | Ga0495622_0002367 | Ga0495622_0002367_2304_3056 | 250 |
| 603 | 3300046557 | Ga0495622_0086886 | Ga0495622_0086886_650_1411 | 250 |
| 604 | 3300046557 | Ga0495622_0179295 | Ga0495622_0179295_10_771 | 250 |
| 605 | 3300046558 | Ga0495633_0000419 | Ga0495633_0000419_30137_30898 | 250 |
| 606 | 3300046558 | Ga0495633_0028794 | Ga0495633_0028794_738_1499 | 250 |
| 607 | 3300046558 | Ga0495633_0034790 | Ga0495633_0034790_1504_2265 | 250 |
| 608 | 3300046558 | Ga0495633_0034969 | Ga0495633_0034969_1438_2199 | 250 |
| 609 | 3300046558 | Ga0495633_0155815 | Ga0495633_0155815_133_894 | 250 |
| 610 | 3300046559 | Ga0495667_0110899 | Ga0495667_0110899_886_1638 | 250 |
| 611 | 3300046559 | Ga0495667_0162103 | Ga0495667_0162103_420_1172 | 250 |
| 612 | 3300046615 | Ga0495656_0002760 | Ga0495656_0002760_2788_3549 | 250 |
| 613 | 3300046615 | Ga0495656_0035727 | Ga0495656_0035727_751_1512 | 250 |
| 614 | 3300046615 | Ga0495656_0262803 | Ga0495656_0262803_109_861 | 250 |
| 615 | 3300046615 | Ga0495656_0286902 | Ga0495656_0286902_59_820 | 250 |
| 616 | 3300046616 | Ga0495668_0000006 | Ga0495668_0000006_188975_189736 | 250 |
| 617 | 3300046616 | Ga0495668_0000318 | Ga0495668_0000318_31687_32448 | 250 |
| 618 | 3300046616 | Ga0495668_0000837 | Ga0495668_0000837_7412_8176 | 250 |
| 619 | 3300046616 | Ga0495668_0013952 | Ga0495668_0013952_2463_3224 | 250 |
| 620 | 3300046616 | Ga0495668_0068444 | Ga0495668_0068444_421_1173 | 250 |
| 621 | 3300046616 | Ga0495668_0192291 | Ga0495668_0192291_340_1101 | 250 |
| 622 | 3300046642 | Ga0495634_0000734 | Ga0495634_0000734_14492_15244 | 250 |
| 623 | 3300046642 | Ga0495634_0011044 | Ga0495634_0011044_3834_4601 | 250 |
| 624 | 3300046642 | Ga0495634_0063797 | Ga0495634_0063797_1256_2008 | 250 |
| 625 | 3300046648 | Ga0495611_0001587 | Ga0495611_0001587_2993_3754 | 250 |
| 626 | 3300046648 | Ga0495611_0002984 | Ga0495611_0002984_122_883 | 250 |
| 627 | 3300046648 | Ga0495611_0010445 | Ga0495611_0010445_678_1430 | 250 |
| 628 | 3300046648 | Ga0495611_0128327 | Ga0495611_0128327_280_1041 | 250 |
| 629 | 3300046660 | Ga0495625_0013356 | Ga0495625_0013356_292_1053 | 250 |
| 630 | 3300046660 | Ga0495625_0013643 | Ga0495625_0013643_1121_1882 | 250 |
| 631 | 3300046660 | Ga0495625_0025411 | Ga0495625_0025411_2010_2771 | 250 |
| 632 | 3300046660 | Ga0495625_0026963 | Ga0495625_0026963_722_1483 | 250 |
| 633 | 3300046660 | Ga0495625_0031048 | Ga0495625_0031048_2414_3175 | 250 |
| 634 | 3300046660 | Ga0495625_0047410 | Ga0495625_0047410_130_882 | 250 |
| 635 | 3300046660 | Ga0495625_0133625 | Ga0495625_0133625_11_763 | 250 |
| 636 | 3300046663 | Ga0495635_0000411 | Ga0495635_0000411_20401_21153 | 250 |
| 637 | 3300046663 | Ga0495635_0001238 | Ga0495635_0001238_14625_15377 | 250 |
| 638 | 3300046663 | Ga0495635_0018560 | Ga0495635_0018560_245_1012 | 250 |
| 639 | 3300046664 | Ga0495659_0000067 | Ga0495659_0000067_1747_2508 | 250 |
| 640 | 3300046664 | Ga0495659_0026620 | Ga0495659_0026620_481_1242 | 250 |
| 641 | 3300046665 | Ga0495661_0000678 | Ga0495661_0000678_2939_3691 | 250 |
| 642 | 3300046665 | Ga0495661_0000724 | Ga0495661_0000724_6339_7160 | 250 |
| 643 | 3300046665 | Ga0495661_0001495 | Ga0495661_0001495_6931_7692 | 250 |
| 644 | 3300046665 | Ga0495661_0010853 | Ga0495661_0010853_3111_3872 | 250 |
| 645 | 3300046665 | Ga0495661_0015010 | Ga0495661_0015010_2342_3094 | 250 |
| 646 | 3300046665 | Ga0495661_0016574 | Ga0495661_0016574_903_1655 | 250 |
| 647 | 3300046665 | Ga0495661_0019315 | Ga0495661_0019315_1238_1999 | 250 |
| 648 | 3300046665 | Ga0495661_0019969 | Ga0495661_0019969_1192_1953 | 250 |
| 649 | 3300046665 | Ga0495661_0042775 | Ga0495661_0042775_272_1033 | 250 |
| 650 | 3300046665 | Ga0495661_0045273 | Ga0495661_0045273_167_919 | 250 |
| 651 | 3300046665 | Ga0495661_0046502 | Ga0495661_0046502_1285_2046 | 250 |
| 652 | 3300046674 | Ga0495588_0015540 | Ga0495588_0015540_2374_3135 | 250 |
| 653 | 3300046674 | Ga0495588_0048307 | Ga0495588_0048307_447_1199 | 250 |
| 654 | 3300046674 | Ga0495588_0136021 | Ga0495588_0136021_32_784 | 250 |
| 655 | 3300046675 | Ga0495657_0149423 | Ga0495657_0149423_74_826 | 250 |
| 656 | 3300046675 | Ga0495657_0159533 | Ga0495657_0159533_29_781 | 250 |
| 657 | 3300046678 | Ga0495599_0000347 | Ga0495599_0000347_1906_2658 | 250 |
| 658 | 3300046678 | Ga0495599_0011345 | Ga0495599_0011345_23_775 | 250 |
| 659 | 3300046678 | Ga0495599_0124976 | Ga0495599_0124976_276_1043 | 250 |
| 660 | 3300046679 | Ga0495623_0003228 | Ga0495623_0003228_6988_7740 | 250 |
| 661 | 3300046679 | Ga0495623_0004602 | Ga0495623_0004602_1750_2502 | 250 |
| 662 | 3300046679 | Ga0495623_0006337 | Ga0495623_0006337_3436_4188 | 250 |
| 663 | 3300046679 | Ga0495623_0013177 | Ga0495623_0013177_4552_5319 | 250 |
| 664 | 3300046680 | Ga0495646_0007318 | Ga0495646_0007318_3943_4695 | 250 |
| 665 | 3300046680 | Ga0495646_0024211 | Ga0495646_0024211_2249_3016 | 250 |
| 666 | 3300046680 | Ga0495646_0047086 | Ga0495646_0047086_1777_2529 | 250 |
| 667 | 3300046680 | Ga0495646_0047621 | Ga0495646_0047621_1734_2486 | 250 |
| 668 | 3300046680 | Ga0495646_0157506 | Ga0495646_0157506_117_902 | 250 |
| 669 | 3300046680 | Ga0495646_0235552 | Ga0495646_0235552_212_964 | 250 |
| 670 | 3300046680 | Ga0495646_0273480 | Ga0495646_0273480_55_816 | 250 |
| 671 | 3300046683 | Ga0495658_0015626 | Ga0495658_0015626_402_1154 | 250 |
| 672 | 3300046684 | Ga0495669_0000289 | Ga0495669_0000289_21552_22313 | 250 |
| 673 | 3300046684 | Ga0495669_0012260 | Ga0495669_0012260_1899_2660 | 250 |
| 674 | 3300046684 | Ga0495669_0043456 | Ga0495669_0043456_1081_1842 | 250 |
| 675 | 3300046684 | Ga0495669_0068267 | Ga0495669_0068267_642_1394 | 250 |
| 676 | 3300046684 | Ga0495669_0118201 | Ga0495669_0118201_376_1128 | 250 |
| 677 | 3300046689 | Ga0495613_0001584 | Ga0495613_0001584_14737_15489 | 250 |
| 678 | 3300046689 | Ga0495613_0006361 | Ga0495613_0006361_608_1360 | 250 |
| 679 | 3300046689 | Ga0495613_0144402 | Ga0495613_0144402_619_1386 | 250 |
| 680 | 3300046690 | Ga0495624_0000076 | Ga0495624_0000076_12402_13154 | 250 |
| 681 | 3300046690 | Ga0495624_0016366 | Ga0495624_0016366_3276_4028 | 250 |
| 682 | 3300046690 | Ga0495624_0028857 | Ga0495624_0028857_2644_3396 | 250 |
| 683 | 3300046690 | Ga0495624_0036014 | Ga0495624_0036014_1678_2430 | 250 |
| 684 | 3300046690 | Ga0495624_0088732 | Ga0495624_0088732_573_1325 | 250 |
| 685 | 3300046691 | Ga0495670_0001180 | Ga0495670_0001180_9527_10288 | 250 |
| 686 | 3300046691 | Ga0495670_0005499 | Ga0495670_0005499_4120_4881 | 250 |
| 687 | 3300046691 | Ga0495670_0016059 | Ga0495670_0016059_2439_3200 | 250 |
| 688 | 3300046691 | Ga0495670_0020349 | Ga0495670_0020349_2328_3089 | 250 |
| 689 | 3300046691 | Ga0495670_0043622 | Ga0495670_0043622_1129_1890 | 250 |
| 690 | 3300046691 | Ga0495670_0046568 | Ga0495670_0046568_567_1319 | 250 |
| 691 | 3300046691 | Ga0495670_0048679 | Ga0495670_0048679_1078_1842 | 250 |
| 692 | 3300046691 | Ga0495670_0069041 | Ga0495670_0069041_263_1024 | 250 |
| 693 | 3300046692 | Ga0495671_0001298 | Ga0495671_0001298_14365_15117 | 250 |
| 694 | 3300046692 | Ga0495671_0001356 | Ga0495671_0001356_2375_3136 | 250 |
| 695 | 3300046692 | Ga0495671_0005385 | Ga0495671_0005385_6300_7052 | 250 |
| 696 | 3300046692 | Ga0495671_0020495 | Ga0495671_0020495_1335_2087 | 250 |
| 697 | 3300046692 | Ga0495671_0044483 | Ga0495671_0044483_151_903 | 250 |
| 698 | 3300046692 | Ga0495671_0055024 | Ga0495671_0055024_90_851 | 250 |
| 699 | 3300046692 | Ga0495671_0094013 | Ga0495671_0094013_693_1445 | 250 |
| 700 | 3300046692 | Ga0495671_0100391 | Ga0495671_0100391_15_776 | 250 |
| 701 | 3300046694 | Ga0495649_0002701 | Ga0495649_0002701_6958_7725 | 250 |
| 702 | 3300046694 | Ga0495649_0005801 | Ga0495649_0005801_2539_3291 | 250 |
| 703 | 3300046694 | Ga0495649_0009705 | Ga0495649_0009705_1089_1841 | 250 |
| 704 | 3300046694 | Ga0495649_0019321 | Ga0495649_0019321_2146_2898 | 250 |
| 705 | 3300046694 | Ga0495649_0027997 | Ga0495649_0027997_1657_2409 | 250 |
| 706 | 3300046794 | Ga0495589_0000055 | Ga0495589_0000055_103728_104549 | 250 |
| 707 | 3300046794 | Ga0495589_0000407 | Ga0495589_0000407_12770_13531 | 250 |
| 708 | 3300046794 | Ga0495589_0003986 | Ga0495589_0003986_1882_2634 | 250 |
| 709 | 3300046794 | Ga0495589_0004864 | Ga0495589_0004864_4834_5595 | 250 |
| 710 | 3300046794 | Ga0495589_0006446 | Ga0495589_0006446_4675_5427 | 250 |
| 711 | 3300046794 | Ga0495589_0010283 | Ga0495589_0010283_2269_3021 | 250 |
| 712 | 3300046794 | Ga0495589_0027454 | Ga0495589_0027454_1542_2294 | 250 |
| 713 | 3300046794 | Ga0495589_0055688 | Ga0495589_0055688_435_1202 | 250 |
| 714 | 3300046809 | Ga0495600_0000886 | Ga0495600_0000886_11512_12279 | 250 |
| 715 | 3300046809 | Ga0495600_0001111 | Ga0495600_0001111_5084_5836 | 250 |
| 716 | 3300046809 | Ga0495600_0008504 | Ga0495600_0008504_4113_4865 | 250 |
| 717 | 3300046809 | Ga0495600_0030826 | Ga0495600_0030826_1092_1844 | 250 |
| 718 | 3300046810 | Ga0495660_0043958 | Ga0495660_0043958_979_1731 | 250 |
| 719 | 3300046810 | Ga0495660_0093366 | Ga0495660_0093366_490_1251 | 250 |
| 720 | 3300047315 | Ga0495581_0000420 | Ga0495581_0000420_17132_17884 | 250 |
| 721 | 3300047315 | Ga0495581_0000863 | Ga0495581_0000863_1715_2467 | 250 |
| 722 | 3300047315 | Ga0495581_0002438 | Ga0495581_0002438_7767_8519 | 250 |
| 723 | 3300047315 | Ga0495581_0002610 | Ga0495581_0002610_409_1176 | 250 |
| 724 | 3300047317 | Ga0495604_0000500 | Ga0495604_0000500_13059_13811 | 250 |
| 725 | 3300047317 | Ga0495604_0000727 | Ga0495604_0000727_17228_17980 | 250 |
| 726 | 3300047317 | Ga0495604_0018721 | Ga0495604_0018721_261_1013 | 250 |
| 727 | 3300047317 | Ga0495604_0057340 | Ga0495604_0057340_1167_1988 | 250 |
| 728 | 3300047317 | Ga0495604_0072703 | Ga0495604_0072703_997_1749 | 250 |
| 729 | 3300047317 | Ga0495604_0174191 | Ga0495604_0174191_634_1395 | 250 |
| 730 | 3300047318 | Ga0495636_0019464 | Ga0495636_0019464_1034_1795 | 250 |
| 731 | 3300047318 | Ga0495636_0033617 | Ga0495636_0033617_1219_1980 | 250 |
| 732 | 3300047318 | Ga0495636_0085937 | Ga0495636_0085937_467_1249 | 250 |
| 733 | 3300047318 | Ga0495636_0122699 | Ga0495636_0122699_363_1124 | 250 |
| 734 | 3300047319 | Ga0495674_0001156 | Ga0495674_0001156_12683_13435 | 250 |
| 735 | 3300047319 | Ga0495674_0001927 | Ga0495674_0001927_2354_3106 | 250 |
| 736 | 3300047319 | Ga0495674_0002849 | Ga0495674_0002849_14546_15298 | 250 |
| 737 | 3300047319 | Ga0495674_0003908 | Ga0495674_0003908_7659_8411 | 250 |
| 738 | 3300047319 | Ga0495674_0008266 | Ga0495674_0008266_8162_8914 | 250 |
| 739 | 3300047319 | Ga0495674_0056987 | Ga0495674_0056987_1438_2205 | 250 |
| 740 | 3300047319 | Ga0495674_0172083 | Ga0495674_0172083_964_1716 | 250 |
| 741 | 3300047319 | Ga0495674_0233606 | Ga0495674_0233606_308_1060 | 250 |
| 742 | 3300047320 | Ga0495672_0000063 | Ga0495672_0000063_40158_40943 | 250 |
| 743 | 3300047320 | Ga0495672_0005166 | Ga0495672_0005166_4166_4918 | 250 |
| 744 | 3300047320 | Ga0495672_0005304 | Ga0495672_0005304_3108_3860 | 250 |
| 745 | 3300047320 | Ga0495672_0011948 | Ga0495672_0011948_3957_4718 | 250 |
| 746 | 3300047320 | Ga0495672_0027131 | Ga0495672_0027131_1348_2109 | 250 |
| 747 | 3300047320 | Ga0495672_0028146 | Ga0495672_0028146_2600_3352 | 250 |
| 748 | 3300047320 | Ga0495672_0059826 | Ga0495672_0059826_1036_1788 | 250 |
| 749 | 3300047321 | Ga0495676_0003759 | Ga0495676_0003759_12334_13086 | 250 |
| 750 | 3300047321 | Ga0495676_0009257 | Ga0495676_0009257_6518_7270 | 250 |
| 751 | 3300047321 | Ga0495676_0105207 | Ga0495676_0105207_637_1389 | 250 |
| 752 | 3300047322 | Ga0495680_0000564 | Ga0495680_0000564_28323_29075 | 250 |
| 753 | 3300047322 | Ga0495680_0005336 | Ga0495680_0005336_9925_10686 | 250 |
| 754 | 3300047322 | Ga0495680_0025785 | Ga0495680_0025785_2844_3596 | 250 |
| 755 | 3300047322 | Ga0495680_0094919 | Ga0495680_0094919_1087_1839 | 250 |
| 756 | 3300047322 | Ga0495680_0276161 | Ga0495680_0276161_318_1070 | 250 |
| 757 | 3300047323 | Ga0495683_0000255 | Ga0495683_0000255_8409_9182 | 250 |
| 758 | 3300047323 | Ga0495683_0000522 | Ga0495683_0000522_25440_26192 | 250 |
| 759 | 3300047323 | Ga0495683_0001194 | Ga0495683_0001194_4152_4919 | 250 |
| 760 | 3300047323 | Ga0495683_0009216 | Ga0495683_0009216_1639_2400 | 250 |
| 761 | 3300047323 | Ga0495683_0009768 | Ga0495683_0009768_17_784 | 250 |
| 762 | 3300047323 | Ga0495683_0015651 | Ga0495683_0015651_2610_3371 | 250 |
| 763 | 3300047323 | Ga0495683_0019368 | Ga0495683_0019368_284_1036 | 250 |
| 764 | 3300047323 | Ga0495683_0028028 | Ga0495683_0028028_1268_2020 | 250 |
| 765 | 3300047323 | Ga0495683_0096462 | Ga0495683_0096462_58_810 | 250 |
| 766 | 3300047323 | Ga0495683_0200155 | Ga0495683_0200155_115_876 | 250 |
| 767 | 3300047443 | Ga0495687_000029 | Ga0495687_000029_28660_29412 | 250 |
| 768 | 3300047443 | Ga0495687_000139 | Ga0495687_000139_6339_7160 | 250 |
| 769 | 3300047443 | Ga0495687_000156 | Ga0495687_000156_94629_95390 | 250 |
| 770 | 3300047443 | Ga0495687_000253 | Ga0495687_000253_24851_25612 | 250 |
| 771 | 3300047443 | Ga0495687_000628 | Ga0495687_000628_2550_3302 | 250 |
| 772 | 3300047443 | Ga0495687_000656 | Ga0495687_000656_31010_31771 | 250 |
| 773 | 3300047443 | Ga0495687_002896 | Ga0495687_002896_2017_2769 | 250 |
| 774 | 3300047443 | Ga0495687_009196 | Ga0495687_009196_1881_2633 | 250 |
| 775 | 3300047443 | Ga0495687_019779 | Ga0495687_019779_2027_2779 | 250 |
| 776 | 3300047443 | Ga0495687_071523 | Ga0495687_071523_87_854 | 250 |
| 777 | 3300047444 | Ga0495675_0002809 | Ga0495675_0002809_663_1430 | 250 |
| 778 | 3300047444 | Ga0495675_0003731 | Ga0495675_0003731_861_1613 | 250 |
| 779 | 3300047444 | Ga0495675_0006111 | Ga0495675_0006111_1743_2495 | 250 |
| 780 | 3300047444 | Ga0495675_0047314 | Ga0495675_0047314_287_1039 | 250 |
| 781 | 3300047445 | Ga0495677_0000147 | Ga0495677_0000147_25387_26208 | 250 |
| 782 | 3300047445 | Ga0495677_0001429 | Ga0495677_0001429_6940_7701 | 250 |
| 783 | 3300047445 | Ga0495677_0014535 | Ga0495677_0014535_940_1701 | 250 |
| 784 | 3300047445 | Ga0495677_0044060 | Ga0495677_0044060_194_955 | 250 |
| 785 | 3300047445 | Ga0495677_0072535 | Ga0495677_0072535_285_1046 | 250 |
| 786 | 3300047446 | Ga0495679_000030 | Ga0495679_000030_108615_109367 | 250 |
| 787 | 3300047446 | Ga0495679_000860 | Ga0495679_000860_6522_7283 | 250 |
| 788 | 3300047446 | Ga0495679_001668 | Ga0495679_001668_9820_10572 | 250 |
| 789 | 3300047446 | Ga0495679_013966 | Ga0495679_013966_1488_2252 | 250 |
| 790 | 3300047446 | Ga0495679_017294 | Ga0495679_017294_1748_2500 | 250 |
| 791 | 3300047447 | Ga0495685_000228 | Ga0495685_000228_16000_16761 | 250 |
| 792 | 3300047447 | Ga0495685_011438 | Ga0495685_011438_2025_2786 | 250 |
| 793 | 3300047447 | Ga0495685_034202 | Ga0495685_034202_15_776 | 250 |
| 794 | 3300047447 | Ga0495685_054317 | Ga0495685_054317_428_1180 | 250 |
| 795 | 3300047447 | Ga0495685_064622 | Ga0495685_064622_401_1153 | 250 |
| 796 | 3300047447 | Ga0495685_079856 | Ga0495685_079856_11_817 | 250 |
| 797 | 3300047469 | Ga0495673_0000159 | Ga0495673_0000159_64359_65120 | 250 |
| 798 | 3300047469 | Ga0495673_0006642 | Ga0495673_0006642_5099_5860 | 250 |
| 799 | 3300047469 | Ga0495673_0008761 | Ga0495673_0008761_3718_4479 | 250 |
| 800 | 3300047469 | Ga0495673_0032424 | Ga0495673_0032424_615_1367 | 250 |
| 801 | 3300047470 | Ga0495681_0024032 | Ga0495681_0024032_1609_2370 | 250 |
| 802 | 3300047470 | Ga0495681_0042758 | Ga0495681_0042758_389_1150 | 250 |
| 803 | 3300047470 | Ga0495681_0045374 | Ga0495681_0045374_1179_1940 | 250 |
| 804 | 3300047470 | Ga0495681_0045586 | Ga0495681_0045586_237_998 | 250 |
| 805 | 3300047470 | Ga0495681_0059603 | Ga0495681_0059603_391_1152 | 250 |
| 806 | 3300047470 | Ga0495681_0077346 | Ga0495681_0077346_341_1102 | 250 |
| 807 | 3300047471 | Ga0495684_0052171 | Ga0495684_0052171_1606_2358 | 250 |
| 808 | 3300047472 | Ga0495686_0000048 | Ga0495686_0000048_29999_30751 | 250 |
| 809 | 3300047472 | Ga0495686_0002450 | Ga0495686_0002450_4992_5753 | 250 |
| 810 | 3300047472 | Ga0495686_0010615 | Ga0495686_0010615_4775_5527 | 250 |
| 811 | 3300047673 | Ga0495593_0000152 | Ga0495593_0000152_4342_5094 | 250 |
| 812 | 3300047673 | Ga0495593_0011370 | Ga0495593_0011370_2705_3457 | 250 |
| 813 | 3300047673 | Ga0495593_0024854 | Ga0495593_0024854_1304_2056 | 250 |
| 814 | 3300047673 | Ga0495593_0025362 | Ga0495593_0025362_1216_1983 | 250 |
| 815 | 3300047673 | Ga0495593_0030957 | Ga0495593_0030957_1718_2470 | 250 |
| 816 | 3300048088 | Ga0495602_0000904 | Ga0495602_0000904_15228_15980 | 250 |
| 817 | 3300048088 | Ga0495602_0006978 | Ga0495602_0006978_7301_8053 | 250 |
| 818 | 3300048088 | Ga0495602_0094369 | Ga0495602_0094369_583_1350 | 250 |
| 819 | 3300048088 | Ga0495602_0148376 | Ga0495602_0148376_624_1391 | 250 |
| 820 | 3300048089 | Ga0495614_0000446 | Ga0495614_0000446_1743_2495 | 250 |
| 821 | 3300048089 | Ga0495614_0002458 | Ga0495614_0002458_3130_3897 | 250 |
| 822 | 3300048089 | Ga0495614_0005850 | Ga0495614_0005850_3039_3791 | 250 |
| 823 | 3300048089 | Ga0495614_0048170 | Ga0495614_0048170_173_925 | 250 |
| 824 | 3300048091 | Ga0495626_0023493 | Ga0495626_0023493_247_999 | 250 |
| 825 | 3300048091 | Ga0495626_0049160 | Ga0495626_0049160_1040_1801 | 250 |
| 826 | 3300048091 | Ga0495626_0055052 | Ga0495626_0055052_548_1309 | 250 |
| 827 | 3300048903 | Ga0496100_0003923 | Ga0496100_0003923_70_822 | 250 |
| 828 | 3300048903 | Ga0496100_0033770 | Ga0496100_0033770_1134_1895 | 250 |
| 829 | 3300048903 | Ga0496100_0063417 | Ga0496100_0063417_502_1254 | 250 |
| 830 | 3300048903 | Ga0496100_0079671 | Ga0496100_0079671_850_1605 | 250 |
| 831 | 3300048903 | Ga0496100_0107755 | Ga0496100_0107755_580_1341 | 250 |
| 832 | 3300048904 | Ga0496101_0001193 | Ga0496101_0001193_14530_15282 | 250 |
| 833 | 3300048904 | Ga0496101_0031557 | Ga0496101_0031557_1146_1898 | 250 |
| 834 | 3300048904 | Ga0496101_0129164 | Ga0496101_0129164_1086_1838 | 250 |
| 835 | 3300048904 | Ga0496101_0222059 | Ga0496101_0222059_546_1307 | 250 |
| 836 | 3300048904 | Ga0496101_0471086 | Ga0496101_0471086_28_789 | 250 |
| 837 | 3300048905 | Ga0496102_0000082 | Ga0496102_0000082_32532_33317 | 250 |
| 838 | 3300048905 | Ga0496102_0000548 | Ga0496102_0000548_13688_14440 | 250 |
| 839 | 3300048905 | Ga0496102_0001919 | Ga0496102_0001919_290_1042 | 250 |
| 840 | 3300048905 | Ga0496102_0004818 | Ga0496102_0004818_9646_10398 | 250 |
| 841 | 3300048905 | Ga0496102_0020777 | Ga0496102_0020777_2512_3264 | 250 |
| 842 | 3300048905 | Ga0496102_0022296 | Ga0496102_0022296_525_1331 | 250 |
| 843 | 3300048905 | Ga0496102_0035297 | Ga0496102_0035297_1710_2462 | 250 |
| 844 | 3300048905 | Ga0496102_0261020 | Ga0496102_0261020_702_1553 | 250 |
| 845 | 3300048905 | Ga0496102_0288143 | Ga0496102_0288143_353_1105 | 250 |
| 846 | 3300048905 | Ga0496102_0374190 | Ga0496102_0374190_440_1201 | 250 |
| 847 | 3300048906 | Ga0496103_0000701 | Ga0496103_0000701_10602_11354 | 250 |
| 848 | 3300048906 | Ga0496103_0047033 | Ga0496103_0047033_660_1421 | 250 |
| 849 | 3300048906 | Ga0496103_0065817 | Ga0496103_0065817_785_1537 | 250 |
| 850 | 3300048906 | Ga0496103_0082753 | Ga0496103_0082753_44_895 | 250 |
| 851 | 3300048906 | Ga0496103_0092396 | Ga0496103_0092396_475_1227 | 250 |
| 852 | 3300048907 | Ga0496104_0012925 | Ga0496104_0012925_6176_6928 | 250 |
| 853 | 3300048907 | Ga0496104_0069023 | Ga0496104_0069023_49_801 | 250 |
| 854 | 3300048907 | Ga0496104_0471545 | Ga0496104_0471545_91_843 | 250 |
| 855 | 3300048908 | Ga0496105_0125122 | Ga0496105_0125122_119_871 | 250 |
| 856 | 3300048908 | Ga0496105_0175343 | Ga0496105_0175343_241_993 | 250 |
| 857 | 3300048909 | Ga0496106_0047489 | Ga0496106_0047489_1034_1786 | 250 |
| 858 | 3300048909 | Ga0496106_0065102 | Ga0496106_0065102_1316_2068 | 250 |
| 859 | 3300048909 | Ga0496106_0104295 | Ga0496106_0104295_284_1036 | 250 |
| 860 | 3300048910 | Ga0496107_0043650 | Ga0496107_0043650_2186_2938 | 250 |
| 861 | 3300048910 | Ga0496107_0055430 | Ga0496107_0055430_636_1388 | 250 |
| 862 | 3300048910 | Ga0496107_0067890 | Ga0496107_0067890_1596_2357 | 250 |
| 863 | 3300048910 | Ga0496107_0077024 | Ga0496107_0077024_1361_2122 | 250 |
| 864 | 3300048910 | Ga0496107_0114739 | Ga0496107_0114739_655_1407 | 250 |
| 865 | 3300048911 | Ga0496108_0199491 | Ga0496108_0199491_873_1625 | 250 |
| 866 | 3300048911 | Ga0496108_0316283 | Ga0496108_0316283_116_877 | 250 |
| 867 | 3300048911 | Ga0496108_0778498 | Ga0496108_0778498_45_797 | 250 |
| 868 | 3300048912 | Ga0496109_0140653 | Ga0496109_0140653_1006_1758 | 250 |
| 869 | 3300048912 | Ga0496109_0188887 | Ga0496109_0188887_647_1408 | 250 |
| 870 | 3300048912 | Ga0496109_0203718 | Ga0496109_0203718_921_1673 | 250 |
| 871 | 3300048913 | Ga0496110_0226429 | Ga0496110_0226429_759_1511 | 250 |
| 872 | 3300048913 | Ga0496110_0231164 | Ga0496110_0231164_342_1103 | 250 |
| 873 | 3300048913 | Ga0496110_0254664 | Ga0496110_0254664_530_1282 | 250 |
| 874 | 3300048915 | Ga0496112_0009672 | Ga0496112_0009672_2459_3211 | 250 |
| 875 | 3300048915 | Ga0496112_0218854 | Ga0496112_0218854_203_955 | 250 |
| 876 | 3300048915 | Ga0496112_0548199 | Ga0496112_0548199_251_1003 | 250 |
| 877 | 3300048916 | Ga0496113_0007071 | Ga0496113_0007071_1272_2024 | 250 |
| 878 | 3300048916 | Ga0496113_0009759 | Ga0496113_0009759_3038_3799 | 250 |
| 879 | 3300048916 | Ga0496113_0010371 | Ga0496113_0010371_4613_5434 | 250 |
| 880 | 3300048916 | Ga0496113_0073169 | Ga0496113_0073169_220_972 | 250 |
| 881 | 3300048917 | Ga0496114_0001294 | Ga0496114_0001294_13950_14702 | 250 |
| 882 | 3300048917 | Ga0496114_0066361 | Ga0496114_0066361_1497_2249 | 250 |
| 883 | 3300048917 | Ga0496114_0831642 | Ga0496114_0831642_28_789 | 250 |
| 884 | 3300048918 | Ga0496115_0020182 | Ga0496115_0020182_4289_5050 | 250 |
| 885 | 3300048918 | Ga0496115_0074630 | Ga0496115_0074630_1611_2372 | 250 |
| 886 | 3300048919 | Ga0496116_0002350 | Ga0496116_0002350_17483_18235 | 250 |
| 887 | 3300048919 | Ga0496116_0002865 | Ga0496116_0002865_12810_13562 | 250 |
| 888 | 3300048919 | Ga0496116_0029737 | Ga0496116_0029737_1861_2613 | 250 |
| 889 | 3300048919 | Ga0496116_0029922 | Ga0496116_0029922_1020_1772 | 250 |
| 890 | 3300048920 | Ga0496117_0000035 | Ga0496117_0000035_211466_212218 | 250 |
| 891 | 3300048920 | Ga0496117_0001097 | Ga0496117_0001097_14296_15048 | 250 |
| 892 | 3300048920 | Ga0496117_0003845 | Ga0496117_0003845_10106_10858 | 250 |
| 893 | 3300048920 | Ga0496117_0045546 | Ga0496117_0045546_1888_2640 | 250 |
| 894 | 3300048920 | Ga0496117_0105080 | Ga0496117_0105080_202_954 | 250 |
| 895 | 3300048921 | Ga0496118_0000054 | Ga0496118_0000054_10843_11595 | 250 |
| 896 | 3300048921 | Ga0496118_0000294 | Ga0496118_0000294_47881_48633 | 250 |
| 897 | 3300048921 | Ga0496118_0001134 | Ga0496118_0001134_14296_15048 | 250 |
| 898 | 3300048921 | Ga0496118_0002121 | Ga0496118_0002121_6348_7100 | 250 |
| 899 | 3300048921 | Ga0496118_0015333 | Ga0496118_0015333_1514_2266 | 250 |
| 900 | 3300048921 | Ga0496118_0069114 | Ga0496118_0069114_578_1330 | 250 |
| 901 | 3300048921 | Ga0496118_0099517 | Ga0496118_0099517_743_1495 | 250 |
| 902 | 3300048922 | Ga0496119_0004866 | Ga0496119_0004866_2519_3271 | 250 |
| 903 | 3300048922 | Ga0496119_0016988 | Ga0496119_0016988_864_1616 | 250 |
| 904 | 3300048923 | Ga0496120_0000086 | Ga0496120_0000086_78952_79704 | 250 |
| 905 | 3300048923 | Ga0496120_0268256 | Ga0496120_0268256_26_778 | 250 |
| 906 | 3300048924 | Ga0496121_0001036 | Ga0496121_0001036_32556_33308 | 250 |
| 907 | 3300048924 | Ga0496121_0004657 | Ga0496121_0004657_11345_12097 | 250 |
| 908 | 3300048924 | Ga0496121_0008412 | Ga0496121_0008412_2894_3700 | 250 |
| 909 | 3300048924 | Ga0496121_0016860 | Ga0496121_0016860_739_1491 | 250 |
| 910 | 3300048924 | Ga0496121_0029589 | Ga0496121_0029589_3388_4140 | 250 |
| 911 | 3300048924 | Ga0496121_0060290 | Ga0496121_0060290_1334_2086 | 250 |
| 912 | 3300048924 | Ga0496121_0159422 | Ga0496121_0159422_332_1084 | 250 |
| 913 | 3300048924 | Ga0496121_0287228 | Ga0496121_0287228_22_774 | 250 |
| 914 | 3300048925 | Ga0496122_0001513 | Ga0496122_0001513_35503_36255 | 250 |
| 915 | 3300048925 | Ga0496122_0001645 | Ga0496122_0001645_6800_7561 | 250 |
| 916 | 3300048925 | Ga0496122_0002752 | Ga0496122_0002752_18904_19725 | 250 |
| 917 | 3300048926 | Ga0496123_0000970 | Ga0496123_0000970_36746_37507 | 250 |
| 918 | 3300048926 | Ga0496123_0002204 | Ga0496123_0002204_972_1724 | 250 |
| 919 | 3300048926 | Ga0496123_0002540 | Ga0496123_0002540_7290_8051 | 250 |
| 920 | 3300048926 | Ga0496123_0041869 | Ga0496123_0041869_1489_2310 | 250 |
| 921 | 3300048926 | Ga0496123_0082985 | Ga0496123_0082985_16_768 | 250 |
| 922 | 3300048927 | Ga0496124_0008360 | Ga0496124_0008360_2398_3159 | 250 |
| 923 | 3300048927 | Ga0496124_0034565 | Ga0496124_0034565_2755_3507 | 250 |
| 924 | 3300048927 | Ga0496124_0327691 | Ga0496124_0327691_42_803 | 250 |
| 925 | 3300048928 | Ga0496125_0001339 | Ga0496125_0001339_6563_7324 | 250 |
| 926 | 3300048928 | Ga0496125_0001458 | Ga0496125_0001458_33204_33956 | 250 |
| 927 | 3300048928 | Ga0496125_0009187 | Ga0496125_0009187_3427_4182 | 250 |
| 928 | 3300048928 | Ga0496125_0024768 | Ga0496125_0024768_3114_3920 | 250 |
| 929 | 3300048928 | Ga0496125_0230742 | Ga0496125_0230742_221_1042 | 250 |
| 930 | 3300048929 | Ga0496126_0000423 | Ga0496126_0000423_76529_77281 | 250 |
| 931 | 3300048929 | Ga0496126_0000599 | Ga0496126_0000599_37727_38479 | 250 |
| 932 | 3300048929 | Ga0496126_0001192 | Ga0496126_0001192_33540_34310 | 250 |
| 933 | 3300048929 | Ga0496126_0042621 | Ga0496126_0042621_1554_2309 | 250 |
| 934 | 3300048929 | Ga0496126_0075933 | Ga0496126_0075933_907_1659 | 250 |
| 935 | 3300048929 | Ga0496126_0127483 | Ga0496126_0127483_678_1430 | 250 |
| 936 | 3300048929 | Ga0496126_0289467 | Ga0496126_0289467_28_834 | 250 |
| 937 | 3300048929 | Ga0496126_0456059 | Ga0496126_0456059_251_1003 | 250 |
| 938 | 3300049459 | Ga0495678_000244 | Ga0495678_000244_23264_24025 | 250 |
| 939 | 3300049459 | Ga0495678_003003 | Ga0495678_003003_6936_7697 | 250 |
| 940 | 3300049459 | Ga0495678_004126 | Ga0495678_004126_1454_2206 | 250 |
| 941 | 3300049460 | Ga0495682_0000454 | Ga0495682_0000454_6886_7647 | 250 |
| 942 | 3300049460 | Ga0495682_0000471 | Ga0495682_0000471_12164_12925 | 250 |
| 943 | 3300049460 | Ga0495682_0008504 | Ga0495682_0008504_487_1239 | 250 |
| 944 | 3300049460 | Ga0495682_0024188 | Ga0495682_0024188_551_1324 | 250 |
| 945 | 3300049460 | Ga0495682_0036274 | Ga0495682_0036274_545_1327 | 250 |
| 946 | 3300049460 | Ga0495682_0061201 | Ga0495682_0061201_519_1280 | 250 |
| 947 | 3300049570 | Ga0501033_0121854 | Ga0501033_0121854_470_1222 | 250 |
| 948 | 3300049574 | Ga0501038_0040239 | Ga0501038_0040239_440_1192 | 250 |
| 949 | 3300049575 | Ga0501039_0117668 | Ga0501039_0117668_204_956 | 250 |
| 950 | 3300049578 | Ga0501042_0094494 | Ga0501042_0094494_1005_1757 | 250 |
| 951 | 3300049579 | Ga0501043_0119612 | Ga0501043_0119612_76_828 | 250 |
| 952 | 3300049580 | Ga0501046_0036067 | Ga0501046_0036067_2209_2961 | 250 |
| 953 | 3300049582 | Ga0501048_0020606 | Ga0501048_0020606_3747_4499 | 250 |
| 954 | 3300049587 | Ga0501071_0077165 | Ga0501071_0077165_46_798 | 250 |
| 955 | 3300049591 | Ga0501075_0018994 | Ga0501075_0018994_62_814 | 250 |
| 956 | 3300049592 | Ga0501076_0002066 | Ga0501076_0002066_2537_3289 | 250 |
| 957 | 3300049592 | Ga0501076_0184144 | Ga0501076_0184144_698_1450 | 250 |
| 958 | 3300049680 | Ga0501250_012839 | Ga0501250_012839_197_949 | 250 |
| 959 | 3300049741 | Ga0501079_0024823 | Ga0501079_0024823_1799_2551 | 250 |
| 960 | 3300049741 | Ga0501079_0324933 | Ga0501079_0324933_291_1043 | 250 |
| 961 | 3300049742 | Ga0501080_0022265 | Ga0501080_0022265_19_771 | 250 |
| 962 | 3300049742 | Ga0501080_0367666 | Ga0501080_0367666_527_1279 | 250 |
| 963 | 3300049743 | Ga0501081_0002231 | Ga0501081_0002231_2572_3324 | 250 |
| 964 | 3300049743 | Ga0501081_0234522 | Ga0501081_0234522_489_1241 | 250 |
| 965 | 3300049744 | Ga0501083_0048451 | Ga0501083_0048451_612_1364 | 250 |
| 966 | 3300049822 | Ga0501035_0126708 | Ga0501035_0126708_262_1014 | 250 |
| 967 | 3300049824 | Ga0501045_0001446 | Ga0501045_0001446_5618_6370 | 250 |
| 968 | 3300050489 | nmdc:mga03683_3564_c2 | nmdc:mga03683_3564_c2_405_1157 | 250 |
| 969 | 3300050490 | nmdc:mga03n38_3188_c1 | nmdc:mga03n38_3188_c1_1366_2118 | 250 |
| 970 | 3300050491 | nmdc:mga00v17_76693_c1 | nmdc:mga00v17_76693_c1_1044_1796 | 250 |
| 971 | 3300050493 | nmdc:mga0k408_155960_c1 | nmdc:mga0k408_155960_c1_593_1345 | 250 |
| 972 | 3300050493 | nmdc:mga0k408_7589_c1 | nmdc:mga0k408_7589_c1_3330_4082 | 250 |
| 973 | 3300050493 | nmdc:mga0k408_9829_c1 | nmdc:mga0k408_9829_c1_441_1193 | 250 |
| 974 | 3300050495 | nmdc:mga04h51_18556_c1 | nmdc:mga04h51_18556_c1_79_831 | 250 |
| 975 | 3300050495 | nmdc:mga04h51_45590_c1 | nmdc:mga04h51_45590_c1_30_782 | 250 |
| 976 | 3300050496 | nmdc:mga07m45_126_c1 | nmdc:mga07m45_126_c1_301_1053 | 250 |
| 977 | 3300050496 | nmdc:mga07m45_2253_c1 | nmdc:mga07m45_2253_c1_2235_2987 | 250 |
| 978 | 3300050496 | nmdc:mga07m45_64228_c1 | nmdc:mga07m45_64228_c1_560_1312 | 250 |
| 979 | 3300050507 | nmdc:mga05p37_204206_c1 | nmdc:mga05p37_204206_c1_79_831 | 250 |
| 980 | 3300050516 | nmdc:mga0sz30_6210_c1 | nmdc:mga0sz30_6210_c1_829_1581 | 250 |
| 981 | 3300053134 | Ga0500658_0002282 | Ga0500658_0002282_5599_6351 | 250 |
| 982 | 3300053136 | Ga0500559_0168950 | Ga0500559_0168950_105_884 | 250 |
| 983 | 3300053178 | Ga0500637_0005060 | Ga0500637_0005060_5142_5894 | 250 |
| 984 | 3300054114 | Ga0501084_0026840 | Ga0501084_0026840_1703_2455 | 250 |
| 985 | 3300059477 | Ga0587084_003872 | Ga0587084_003872_142_894 | 250 |
| 986 | 3300059493 | Ga0587077_008959 | Ga0587077_008959_141_893 | 250 |
| 987 | 3300059504 | Ga0587082_014547 | Ga0587082_014547_139_891 | 250 |
| 988 | 3300059505 | Ga0587083_0033482 | Ga0587083_0033482_142_894 | 250 |
| 989 | 3300059639 | Ga0587062_005140 | Ga0587062_005140_118_870 | 250 |
| 990 | 3300059640 | Ga0587067_011086 | Ga0587067_011086_132_884 | 250 |
| 991 | 3300059643 | Ga0587072_013521 | Ga0587072_013521_135_887 | 250 |
| 992 | 3300059644 | Ga0587075_002497 | Ga0587075_002497_142_894 | 250 |
| 993 | 3300060346 | Ga0587111_0033272 | Ga0587111_0033272_144_896 | 250 |
| 994 | 3300060353 | Ga0501082_0010901 | Ga0501082_0010901_5657_6409 | 250 |
| 995 | 3300060353 | Ga0501082_0066431 | Ga0501082_0066431_1565_2317 | 250 |
| 996 | 3300061719 | Ga0466962_0002159 | Ga0466962_0002159_478_1230 | 250 |
| 997 | 3300061719 | Ga0466962_0011537 | Ga0466962_0011537_2576_3328 | 250 |
| 998 | 3300061719 | Ga0466962_0048807 | Ga0466962_0048807_94_855 | 250 |
| 999 | 3300061734 | Ga0530510_0002613 | Ga0530510_0002613_1338_2090 | 250 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pv2-assembly1.cif.gz_B | crystallographic structure of sura first peptidyl-prolyl isomerase domain complexed with peptide nftlkfwdifrk | 0.8999 | 125 | 213 |
| 6xd8-assembly2.cif.gz_B | crystal structure of peptidylprolyl isomerase (prsa) fragment from bacillus anthracis | 0.8809 | 123 | 217 |
| 2jzv-assembly1.cif.gz_A | solution structure of s. aureus prsa-ppiase | 0.8691 | 125 | 214 |
| 3gpk-assembly2.cif.gz_B | crystal structure of ppic-type peptidyl-prolyl cis-trans isomerase domain at 1.55a resolution. | 0.8684 | 120 | 222 |
| 6xd8-assembly2.cif.gz_B | crystal structure of peptidylprolyl isomerase (prsa) fragment from bacillus anthracis | 0.8638 | 123 | 217 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G2S6_136_245_3.10.50.40 | Alpha Beta;Roll;Chitinase A; domain 3; | 0.8711 | 121 | 214 | 3.10.50.40 |
| af_Q54Z53_33_124_3.10.50.40 | Alpha Beta;Roll;Chitinase A; domain 3; | 0.8711 | 125 | 217 | 3.10.50.40 |
| 2jzvA00 | Alpha Beta;Roll;Chitinase A; domain 3; | 0.8691 | 125 | 214 | 3.10.50.40 |
| af_Q9N492_46_161_3.10.50.40 | Alpha Beta;Roll;Chitinase A; domain 3; | 0.8683 | 124 | 213 | 3.10.50.40 |
| 2pv3B02 | Alpha Beta;Roll;Chitinase A; domain 3; | 0.8647 | 125 | 214 | 3.10.50.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A062C191-F1-model_v4 | peptidylprolyl isomerase (EC 5.2.1.8) | 0.9416 | 124 | 217 |
GO:0140839
GO:0140840 |
| AF-A0A7X8MDW1-F1-model_v4 | PpiC domain-containing protein | 0.9399 | 123 | 213 |
GO:0003755
|
| AF-A0A2G2I671-F1-model_v4 | deleted | 0.9335 | 124 | 217 |
|
| AF-A0A1S2WXB1-F1-model_v4 | Peptidyl-prolyl cis-trans isomerase C (Parvulin) (Rotamase C) | 0.9153 | 125 | 215 |
GO:0003755
GO:0005737 |
| AF-G0QBA8-F1-model_v4 | Parvulin-like peptidyl-prolyl isomerase | 0.9098 | 124 | 217 |
GO:0003755
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar