F487851

General Info

Members Datasets Scaffolds Average Seq Length
999 361 998 252

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0000837|Ga0495668_0000837_7412_8176
Length 254
Sequence MAGIVRIDDEVITTDDFIRTLKLSGQFEGLVEQMVRDRLTARAARQAGLQLTPEQIQERADEFRRALGLHRAADTNHYLDALGVSLDEFEAWIVDGLYQEKMLAQVCSEQAVSRYFSLNSPRFDSVEVSHIVLDGEGAAREMMSVLQEEPETFAEMAREHSIDTDTRGQGGVIGKVLRGSLKGDIEARVFNARAGELLGPFPSPDGAAYEIFCVNARHPAALDPDTAAEIRRLLREEWLMARAQEHVIEACTVP

Samples

Sample ID Description Type Environment
1 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
145 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
146 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
153 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
156 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
157 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
162 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
165 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
166 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
173 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
174 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
175 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
176 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
177 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
178 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
179 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
196 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
200 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
212 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
213 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
214 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
215 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
216 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
217 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
218 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
221 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
222 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
223 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
224 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
228 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
229 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
230 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
231 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
232 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
233 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
234 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
235 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
236 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
237 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
238 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
239 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
240 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
243 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
244 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
245 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
246 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
247 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
253 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
254 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
255 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
256 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
257 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
258 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
259 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
260 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
261 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
262 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
263 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
266 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
267 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
268 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
269 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
270 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
271 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
272 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
275 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
276 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
277 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
280 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
281 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
282 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
283 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
284 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
285 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
286 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
287 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
288 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
289 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
290 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
291 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
292 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
293 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
294 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
299 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
300 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
301 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
302 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
305 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
309 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
310 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
311 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
312 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
313 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
314 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
315 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
316 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
317 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
318 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
319 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
320 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
321 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
329 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
330 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
331 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
332 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
333 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
334 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
335 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
336 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
338 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
339 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
340 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
341 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
342 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
343 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
346 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
347 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
348 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
349 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
350 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
360 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
361 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 1.2
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.21
Nodule 0.1
Rhizoplane 5.91
Rhizosphere 76.38
Stem 0
Stem Tuber 0
Unclassified 7.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000899 3300001979 Bacteria 13168
2 JGI24739J22299_10005340 3300001989 Bacteria 4892
3 JGI24735J21928_10008041 3300002067 Bacteria 3424
4 JGI24738J21930_10001023 3300002075 Bacteria 7984
5 JGI25156J39149_1000633 3300002705 Bacteria 19292
6 JGI25156J39149_1000705 3300002705 Bacteria 17848
7 JGI25156J39149_1001702 3300002705 Bacteria 8849
8 JGI25165J46597_1000853 3300003214 Bacteria 22146
9 Ga0007409J51694_1014567 3300003575 Bacteria 921
10 Ga0007409J51694_1027038 3300003575 Bacteria 2070
11 Ga0055533_1001314 3300003756 Bacteria 6751
12 Ga0055532_1000014 3300003758 Bacteria 344702
13 Ga0055525_1000028 3300003759 Bacteria 331683
14 Ga0055527_1000013 3300003760 Bacteria 347416
15 Ga0055527_1000055 3300003760 Bacteria 97952
16 Ga0055527_1007461 3300003760 Bacteria 1334
17 Ga0055535_1000011 3300003761 Bacteria 347416
18 Ga0055535_1000083 3300003761 Bacteria 104680
19 Ga0055542_1000018 3300003762 Bacteria 347416
20 Ga0055542_1001335 3300003762 Bacteria 12874
21 Ga0055529_1000017 3300003763 Bacteria 347416
22 Ga0055526_1001294 3300003771 Bacteria 17952
23 Ga0055526_1008224 3300003771 Bacteria 5244
24 Ga0055526_1010588 3300003771 Bacteria 4271
25 Ga0055526_1043602 3300003771 Bacteria 1091
26 Ga0055537_1000292 3300003773 Bacteria 35472
27 Ga0055524_1001049 3300003775 Bacteria 17036
28 Ga0055524_1019724 3300003775 Bacteria 2295
29 Ga0055536_1000462 3300003781 Bacteria 28605
30 Ga0055534_1000046 3300003784 Bacteria 98150
31 Ga0055534_1000935 3300003784 Bacteria 13072
32 Ga0055534_1001910 3300003784 Bacteria 7687
33 Ga0055528_1000226 3300003790 Bacteria 47010
34 Ga0065165_1001458 3300005262 Bacteria 25539
35 Ga0065714_10106686 3300005288 Bacteria 1544
36 Ga0068869_100082861 3300005334 Bacteria 2398
37 Ga0070666_10072573 3300005335 Bacteria 2343
38 Ga0070666_10367820 3300005335 Bacteria 1031
39 Ga0070660_100008874 3300005339 Bacteria 7049
40 Ga0070661_100006929 3300005344 Bacteria 7823
41 Ga0070661_100020072 3300005344 Bacteria 4763
42 Ga0070671_100006052 3300005355 Bacteria 9642
43 Ga0070673_100405839 3300005364 Bacteria 1219
44 Ga0070659_100002890 3300005366 Bacteria 12223
45 Ga0070659_100009715 3300005366 Bacteria 7069
46 Ga0070659_100076255 3300005366 Bacteria 2673
47 Ga0070659_100368174 3300005366 Bacteria 1208
48 Ga0070667_100020129 3300005367 Bacteria 5540
49 Ga0070667_100129145 3300005367 Bacteria 2204
50 Ga0070663_100018004 3300005455 Bacteria 4623
51 Ga0070663_100047134 3300005455 Bacteria 3053
52 Ga0070663_100067888 3300005455 Bacteria 2588
53 Ga0070663_100121486 3300005455 Bacteria 1974
54 Ga0068867_100702224 3300005459 Bacteria 893
55 Ga0070684_100095995 3300005535 Bacteria 2642
56 Ga0070665_100006580 3300005548 Bacteria 11812
57 Ga0070665_100015860 3300005548 Bacteria 7564
58 Ga0070665_100058761 3300005548 Bacteria 3855
59 Ga0070665_100143386 3300005548 Bacteria 2392
60 Ga0068855_100108136 3300005563 Bacteria 3194
61 Ga0068855_100319134 3300005563 Bacteria 1717
62 Ga0070664_100007998 3300005564 Bacteria 8543
63 Ga0070664_100014507 3300005564 Bacteria 6427
64 Ga0070664_100099806 3300005564 Bacteria 2523
65 Ga0070664_100327093 3300005564 Bacteria 1390
66 Ga0070664_100347145 3300005564 Bacteria 1349
67 Ga0068854_100594962 3300005578 Bacteria 944
68 Ga0068856_100273361 3300005614 Bacteria 1706
69 Ga0068852_100016870 3300005616 Bacteria 5711
70 Ga0068852_100215563 3300005616 Bacteria 1823
71 Ga0068852_100442187 3300005616 Bacteria 1286
72 Ga0068859_100001005 3300005617 Bacteria 28915
73 Ga0068859_100014788 3300005617 Bacteria 7840
74 Ga0068864_100082860 3300005618 Bacteria 2815
75 Ga0068861_100067529 3300005719 Bacteria 2760
76 Ga0068863_100006932 3300005841 Bacteria 11105
77 Ga0068863_100037016 3300005841 Bacteria 4646
78 Ga0068863_100044357 3300005841 Bacteria 4221
79 Ga0068858_100012281 3300005842 Bacteria 8078
80 Ga0068860_100003507 3300005843 Bacteria 16149
81 Ga0068860_100058586 3300005843 Bacteria 3661
82 Ga0068862_100041066 3300005844 Bacteria 3935
83 Ga0075365_10106808 3300006038 Bacteria 1921
84 Ga0075368_10033679 3300006042 Bacteria 1994
85 Ga0075368_10068067 3300006042 Bacteria 1434
86 Ga0075368_10078548 3300006042 Bacteria 1341
87 Ga0075363_100006342 3300006048 Bacteria 5359
88 Ga0075363_100212343 3300006048 Bacteria 1108
89 Ga0075364_10025720 3300006051 Bacteria 3749
90 Ga0075362_10025882 3300006177 Bacteria 2502
91 Ga0075362_10027729 3300006177 Bacteria 2426
92 Ga0075362_10264130 3300006177 Bacteria 849
93 Ga0075367_10009348 3300006178 Bacteria 5120
94 Ga0075367_10014135 3300006178 Bacteria 4314
95 Ga0075369_10005693 3300006186 Bacteria 4674
96 Ga0075369_10021807 3300006186 Bacteria 2637
97 Ga0075366_10001522 3300006195 Bacteria 11584
98 Ga0075366_10118078 3300006195 Bacteria 1598
99 Ga0097621_100205771 3300006237 Bacteria 1710
100 Ga0075370_10001089 3300006353 Bacteria 11320
101 Ga0075370_10001738 3300006353 Bacteria 9699
102 Ga0075370_10016598 3300006353 Bacteria 3964
103 Ga0068871_100099302 3300006358 Bacteria 2437
104 Ga0068871_100249490 3300006358 Bacteria 1546
105 Ga0068865_100028606 3300006881 Bacteria 3691
106 Ga0097620_100001005 3300006931 Bacteria 28915
107 Ga0097620_100014788 3300006931 Bacteria 7840
108 Ga0105251_10000537 3300009011 Bacteria 35741
109 Ga0105244_10038955 3300009036 Bacteria 2476
110 Ga0105250_10117335 3300009092 Bacteria 1092
111 Ga0105240_10006910 3300009093 Bacteria 16581
112 Ga0105240_10014768 3300009093 Bacteria 10648
113 Ga0105240_10031257 3300009093 Bacteria 6907
114 Ga0105240_10060249 3300009093 Bacteria 4732
115 Ga0105240_10355988 3300009093 Bacteria 1659
116 Ga0105245_10134894 3300009098 Bacteria 2319
117 Ga0105247_10025965 3300009101 Bacteria 3536
118 Ga0105241_10004372 3300009174 Bacteria 10442
119 Ga0105242_10072861 3300009176 Bacteria 2854
120 Ga0105242_10155959 3300009176 Bacteria 1994
121 Ga0105242_10178369 3300009176 Bacteria 1872
122 Ga0105248_10001355 3300009177 Bacteria 27299
123 Ga0105248_10045851 3300009177 Bacteria 4901
124 Ga0105248_10128971 3300009177 Bacteria 2853
125 Ga0105248_10167403 3300009177 Bacteria 2477
126 Ga0105237_10018129 3300009545 Bacteria 7288
127 Ga0105237_10488999 3300009545 Bacteria 1237
128 Ga0105238_10032616 3300009551 Bacteria 5300
129 Ga0105238_10354897 3300009551 Bacteria 1455
130 Ga0105238_10620251 3300009551 Bacteria 1090
131 Ga0105249_10012890 3300009553 Bacteria 7376
132 Ga0105249_10847425 3300009553 Bacteria 980
133 Ga0105239_10087316 3300010375 Bacteria 3438
134 Ga0105239_10103984 3300010375 Bacteria 3144
135 Ga0105239_10148953 3300010375 Bacteria 2611
136 Ga0105246_10311014 3300011119 Bacteria 1276
137 Ga0157369_10021832 3300013105 Bacteria 7158
138 Ga0157369_10584392 3300013105 Bacteria 1153
139 Ga0157374_10000310 3300013296 Bacteria 45228
140 Ga0157374_10079869 3300013296 Bacteria 3100
141 Ga0163162_10000873 3300013306 Bacteria 28119
142 Ga0163162_10053681 3300013306 Bacteria 4051
143 Ga0163162_10086494 3300013306 Bacteria 3213
144 Ga0163162_10480133 3300013306 Bacteria 1374
145 Ga0163162_11045007 3300013306 Bacteria 924
146 Ga0157372_10370829 3300013307 Bacteria 1668
147 Ga0157375_10005109 3300013308 Bacteria 11389
148 Ga0157375_10655388 3300013308 Bacteria 1206
149 Ga0163163_10176536 3300014325 Bacteria 2183
150 Ga0157379_10140854 3300014968 Bacteria 2174
151 Ga0157379_10235480 3300014968 Bacteria 1660
152 Ga0182006_1125525 3300015261 Bacteria 887
153 Ga0182007_10000566 3300015262 Bacteria 21735
154 Ga0183361_10003 3300016635 Bacteria 577277
155 Ga0163161_10263588 3300017792 Bacteria 1346
156 Ga0206356_10783655 3300020070 Bacteria 1003
157 Ga0209566_103550 3300025225 Bacteria 2354
158 Ga0209674_100049 3300025226 Bacteria 346969
159 Ga0209674_100051 3300025226 Bacteria 338399
160 Ga0209672_100027 3300025228 Bacteria 344500
161 Ga0209672_100040 3300025228 Bacteria 278858
162 Ga0209672_100139 3300025228 Bacteria 69191
163 Ga0209147_100035 3300025229 Bacteria 344500
164 Ga0209147_100048 3300025229 Bacteria 278858
165 Ga0209563_100011 3300025230 Bacteria 1187808
166 Ga0209563_101052 3300025230 Bacteria 7972
167 Ga0209258_100052 3300025242 Bacteria 344500
168 Ga0209258_100070 3300025242 Bacteria 278858
169 Ga0209677_102480 3300025253 Bacteria 6905
170 Ga0209148_1000064 3300025254 Bacteria 344500
171 Ga0209148_1000284 3300025254 Bacteria 77768
172 Ga0209759_1000015 3300025256 Bacteria 388724
173 Ga0209759_1000041 3300025256 Bacteria 252893
174 Ga0209759_1000252 3300025256 Bacteria 79418
175 Ga0209759_1013351 3300025256 Bacteria 2227
176 Ga0209759_1016964 3300025256 Bacteria 1813
177 Ga0209129_1015186 3300025258 Bacteria 1598
178 Ga0209233_1000073 3300025261 Bacteria 362383
179 Ga0209565_1000003 3300025263 Bacteria 1099648
180 Ga0209565_1000267 3300025263 Bacteria 54064
181 Ga0209455_1000057 3300025272 Bacteria 344500
182 Ga0209455_1000178 3300025272 Bacteria 104960
183 Ga0209673_1000003 3300025273 Bacteria 980859
184 Ga0209673_1039180 3300025273 Bacteria 1371
185 Ga0209130_1002823 3300025284 Bacteria 8079
186 Ga0209675_1000003 3300025291 Bacteria 1003982
187 Ga0209675_1000575 3300025291 Bacteria 26475
188 Ga0209675_1005135 3300025291 Bacteria 5569
189 Ga0209676_1000012 3300025292 Bacteria 841431
190 Ga0209025_1000306 3300025294 Bacteria 109280
191 Ga0209025_1000849 3300025294 Bacteria 48335
192 Ga0209025_1001305 3300025294 Bacteria 34015
193 Ga0209564_1000249 3300025295 Bacteria 115584
194 Ga0209564_1001057 3300025295 Bacteria 33550
195 Ga0209564_1001073 3300025295 Bacteria 32869
196 Ga0209564_1001165 3300025295 Bacteria 30580
197 Ga0209564_1017440 3300025295 Bacteria 2797
198 Ga0209758_1016445 3300025297 Bacteria 3757
199 Ga0209256_1000029 3300025299 Bacteria 415922
200 Ga0209256_1000059 3300025299 Bacteria 272170
201 Ga0207426_1000056 3300025302 Bacteria 373596
202 Ga0209051_1035043 3300025303 Bacteria 1873
203 Ga0207713_1000124 3300025735 Bacteria 122014
204 Ga0207710_10007152 3300025900 Bacteria 4734
205 Ga0207710_10036339 3300025900 Bacteria 2171
206 Ga0207680_10038045 3300025903 Bacteria 2783
207 Ga0207680_10178312 3300025903 Bacteria 1435
208 Ga0207647_10008949 3300025904 Bacteria 7135
209 Ga0207647_10013995 3300025904 Bacteria 5552
210 Ga0207645_10048400 3300025907 Bacteria 2715
211 Ga0207645_10115403 3300025907 Bacteria 1741
212 Ga0207645_10392006 3300025907 Bacteria 933
213 Ga0207705_10000924 3300025909 Bacteria 24006
214 Ga0207654_10001825 3300025911 Bacteria 11043
215 Ga0207654_10186501 3300025911 Bacteria 1356
216 Ga0207654_10268708 3300025911 Bacteria 1150
217 Ga0207654_10337887 3300025911 Bacteria 1034
218 Ga0207695_10028387 3300025913 Bacteria 6207
219 Ga0207695_10032306 3300025913 Bacteria 5729
220 Ga0207695_10122490 3300025913 Bacteria 2567
221 Ga0207695_10126350 3300025913 Bacteria 2519
222 Ga0207695_10128884 3300025913 Bacteria 2489
223 Ga0207671_10164066 3300025914 Bacteria 1722
224 Ga0207671_10392249 3300025914 Bacteria 1104
225 Ga0207657_10004042 3300025919 Bacteria 15582
226 Ga0207657_10012912 3300025919 Bacteria 8213
227 Ga0207657_10024708 3300025919 Bacteria 5556
228 Ga0207657_10029802 3300025919 Bacteria 4961
229 Ga0207649_10009337 3300025920 Bacteria 5367
230 Ga0207649_10062807 3300025920 Bacteria 2342
231 Ga0207687_10786785 3300025927 Bacteria 811
232 Ga0207644_10045251 3300025931 Bacteria 3130
233 Ga0207644_10153115 3300025931 Bacteria 1786
234 Ga0207690_10002125 3300025932 Bacteria 12137
235 Ga0207690_10010469 3300025932 Bacteria 5514
236 Ga0207686_10036646 3300025934 Bacteria 2954
237 Ga0207686_10113620 3300025934 Bacteria 1831
238 Ga0207686_10266957 3300025934 Bacteria 1257
239 Ga0207709_10097382 3300025935 Bacteria 1937
240 Ga0207704_10064189 3300025938 Bacteria 2293
241 Ga0207711_10019515 3300025941 Bacteria 5643
242 Ga0207711_10050936 3300025941 Bacteria 3546
243 Ga0207711_10091955 3300025941 Bacteria 2669
244 Ga0207689_10048079 3300025942 Bacteria 3519
245 Ga0207661_10183095 3300025944 Bacteria 1831
246 Ga0207679_10000419 3300025945 Bacteria 30306
247 Ga0207679_10028455 3300025945 Bacteria 3878
248 Ga0207679_10084638 3300025945 Bacteria 2434
249 Ga0207679_10377955 3300025945 Bacteria 1241
250 Ga0207667_10007331 3300025949 Bacteria 13276
251 Ga0207667_10059330 3300025949 Bacteria 4007
252 Ga0207667_10432674 3300025949 Bacteria 1338
253 Ga0207651_10342207 3300025960 Bacteria 1257
254 Ga0207712_10081148 3300025961 Bacteria 2361
255 Ga0207712_10111610 3300025961 Bacteria 2052
256 Ga0207640_10176263 3300025981 Bacteria 1598
257 Ga0207658_10145089 3300025986 Bacteria 1926
258 Ga0207658_10176156 3300025986 Bacteria 1766
259 Ga0207658_10245539 3300025986 Bacteria 1519
260 Ga0207658_10319195 3300025986 Bacteria 1344
261 Ga0207658_10697709 3300025986 Bacteria 917
262 Ga0207703_10002618 3300026035 Bacteria 15532
263 Ga0207639_10116247 3300026041 Bacteria 2189
264 Ga0207639_10312752 3300026041 Bacteria 1392
265 Ga0207678_10007448 3300026067 Bacteria 9690
266 Ga0207678_10076009 3300026067 Bacteria 2876
267 Ga0207678_10103641 3300026067 Bacteria 2428
268 Ga0207702_10825272 3300026078 Bacteria 917
269 Ga0207641_10000880 3300026088 Bacteria 31415
270 Ga0207641_10025099 3300026088 Bacteria 4913
271 Ga0207648_10123277 3300026089 Bacteria 2279
272 Ga0207676_10566164 3300026095 Bacteria 1087
273 Ga0207674_10032647 3300026116 Bacteria 5458
274 Ga0207674_10318130 3300026116 Bacteria 1506
275 Ga0209282_1000033 3300027666 Bacteria 141940
276 Ga0209813_10008652 3300027866 Bacteria 2579
277 Ga0209813_10018405 3300027866 Bacteria 1930
278 Ga0209974_10001884 3300027876 Bacteria 7660
279 Ga0268266_10000709 3300028379 Bacteria 45045
280 Ga0268266_10003171 3300028379 Bacteria 16685
281 Ga0268266_10034782 3300028379 Bacteria 4286
282 Ga0268266_10059371 3300028379 Bacteria 3295
283 Ga0268266_10116281 3300028379 Bacteria 2375
284 Ga0268265_10047171 3300028380 Bacteria 3226
285 Ga0268264_10000100 3300028381 Bacteria 227852
286 Ga0268264_10173872 3300028381 Bacteria 1950
287 Ga0307517_10162912 3300028786 Bacteria 1491
288 Ga0307515_10085151 3300028794 Bacteria 4049
289 Ga0307511_10000052 3300030521 Bacteria 96724
290 Ga0307512_10165448 3300030522 Bacteria 1283
291 Ga0307513_10046599 3300031456 Bacteria 4724
292 Ga0307513_10298653 3300031456 Bacteria 1378
293 Ga0307509_10029746 3300031507 Bacteria 6057
294 Ga0307509_10079950 3300031507 Bacteria 3382
295 Ga0307508_10067046 3300031616 Bacteria 3158
296 Ga0316576_10165766 3300031727 Bacteria 1667
297 Ga0307516_10013929 3300031730 Bacteria 8533
298 Ga0307516_10216646 3300031730 Bacteria 1626
299 Ga0316577_10018183 3300031733 Bacteria 3885
300 Ga0307412_10000010 3300031911 Bacteria 421262
301 Ga0307412_10045965 3300031911 Bacteria 2857
302 Ga0316585_10023504 3300032137 Bacteria 1902
303 Ga0307507_10034168 3300033179 Bacteria 5261
304 Ga0307507_10214904 3300033179 Bacteria 1304
305 Ga0307510_10000001 3300033180 Bacteria 1172244
306 Ga0316574_0083285 3300035398 Bacteria 2033
307 Ga0316582_0046141 3300036647 Bacteria 2746
308 Ga0316584_0002509 3300036712 Bacteria 11628
309 Ga0395899_0000019 3300037312 Bacteria 411777
310 Ga0395899_0004562 3300037312 Bacteria 10788
311 Ga0395899_0006365 3300037312 Bacteria 9143
312 Ga0395900_0000307 3300037418 Bacteria 72665
313 Ga0395900_0003711 3300037418 Bacteria 16409
314 Ga0395900_0060982 3300037418 Bacteria 3879
315 Ga0395898_0176730 3300037466 Bacteria 2040
316 Ga0395905_0000004 3300037471 Bacteria 674991
317 Ga0395905_0002221 3300037471 Bacteria 21897
318 Ga0395905_0247073 3300037471 Bacteria 1667
319 Ga0395905_0534808 3300037471 Bacteria 1073
320 Ga0395901_0035147 3300038443 Bacteria 5178
321 Ga0395901_0061437 3300038443 Bacteria 3909
322 Ga0395901_0149380 3300038443 Bacteria 2455
323 Ga0395901_0185486 3300038443 Bacteria 2182
324 Ga0439433_0043792 3300041999 Bacteria 1046
325 Ga0439448_0001081 3300042005 Bacteria 6845
326 Ga0439449_0020912 3300042007 Bacteria 2452
327 Ga0439449_0072318 3300042007 Bacteria 1271
328 Ga0439455_0000629 3300042012 Bacteria 5139
329 Ga0450892_002439 3300042130 Bacteria 1590
330 Ga0439458_0018965 3300042157 Bacteria 1580
331 Ga0439458_0020809 3300042157 Bacteria 1516
332 Ga0439460_0014209 3300042461 Bacteria 2091
333 Ga0450918_000439 3300042531 Bacteria 8897
334 Ga0466969_0053435 3300044656 Bacteria 1982
335 Ga0466972_0000239 3300044658 Bacteria 37769
336 Ga0466972_0000923 3300044658 Bacteria 14156
337 Ga0466972_0121721 3300044658 Bacteria 1230
338 Ga0466965_0000569 3300044683 Bacteria 13376
339 Ga0466965_0042031 3300044683 Bacteria 2253
340 Ga0466966_0019835 3300044684 Bacteria 4422
341 Ga0466966_0057593 3300044684 Bacteria 2456
342 Ga0466966_0105310 3300044684 Bacteria 1741
343 Ga0466961_0010484 3300044693 Bacteria 5910
344 Ga0466961_0040036 3300044693 Bacteria 3004
345 Ga0466963_0010691 3300044694 Bacteria 5569
346 Ga0466964_0002281 3300044706 Bacteria 6808
347 Ga0466964_0006746 3300044706 Bacteria 4282
348 Ga0466964_0008899 3300044706 Bacteria 3776
349 Ga0466971_0000213 3300044719 Bacteria 22471
350 Ga0466971_0087604 3300044719 Bacteria 1423
351 Ga0466968_0003486 3300044735 Bacteria 5818
352 Ga0466970_0016928 3300044765 Bacteria 3762
353 Ga0466970_0091006 3300044765 Bacteria 1655
354 Ga0466957_0000113 3300044842 Bacteria 33535
355 Ga0466957_0029523 3300044842 Bacteria 3270
356 Ga0466957_0055513 3300044842 Bacteria 2421
357 Ga0466957_0059856 3300044842 Bacteria 2335
358 Ga0466960_0135256 3300044901 Bacteria 1305
359 Ga0466960_0246184 3300044901 Bacteria 992
360 Ga0466959_0008404 3300045049 Bacteria 7296
361 Ga0466959_0035982 3300045049 Bacteria 3658
362 Ga0466959_0049560 3300045049 Bacteria 3085
363 Ga0466959_0071936 3300045049 Bacteria 2503
364 Ga0466959_0170820 3300045049 Bacteria 1525
365 Ga0466958_0020084 3300045836 Bacteria 3894
366 Ga0466958_0039156 3300045836 Bacteria 2847
367 Ga0466958_0098542 3300045836 Bacteria 1815
368 Ga0466967_0014759 3300045976 Bacteria 6103
369 Ga0466967_0027604 3300045976 Bacteria 4724
370 Ga0466967_0062513 3300045976 Bacteria 3305
371 Ga0495617_000342 3300046452 Bacteria 25837
372 Ga0495617_076074 3300046452 Bacteria 1101
373 Ga0495627_002589 3300046453 Bacteria 8551
374 Ga0495592_0003498 3300046454 Bacteria 11273
375 Ga0495592_0008815 3300046454 Bacteria 7574
376 Ga0495592_0031704 3300046454 Bacteria 3993
377 Ga0495603_0001914 3300046455 Bacteria 12279
378 Ga0495603_0007636 3300046455 Bacteria 6511
379 Ga0495603_0033035 3300046455 Bacteria 3113
380 Ga0495590_0003986 3300046457 Bacteria 5996
381 Ga0495590_0004269 3300046457 Bacteria 5776
382 Ga0495590_0011444 3300046457 Bacteria 3318
383 Ga0495590_0017870 3300046457 Bacteria 2544
384 Ga0495590_0021871 3300046457 Bacteria 2265
385 Ga0495590_0025985 3300046457 Bacteria 2057
386 Ga0495591_002404 3300046458 Bacteria 10449
387 Ga0495591_045260 3300046458 Bacteria 1228
388 Ga0495629_0000033 3300046459 Bacteria 120105
389 Ga0495629_0001020 3300046459 Bacteria 22481
390 Ga0495629_0001234 3300046459 Bacteria 20099
391 Ga0495629_0008541 3300046459 Bacteria 7540
392 Ga0495629_0012940 3300046459 Bacteria 6034
393 Ga0495638_0004343 3300046460 Bacteria 10741
394 Ga0495638_0006259 3300046460 Bacteria 8687
395 Ga0495638_0012654 3300046460 Bacteria 5772
396 Ga0495638_0199344 3300046460 Bacteria 1131
397 Ga0495641_0009288 3300046461 Bacteria 5857
398 Ga0495641_0036211 3300046461 Bacteria 2321
399 Ga0495651_0006377 3300046462 Bacteria 9028
400 Ga0495653_0000163 3300046463 Bacteria 54806
401 Ga0495653_0013007 3300046463 Bacteria 6789
402 Ga0495653_0020177 3300046463 Bacteria 5402
403 Ga0495653_0055391 3300046463 Bacteria 3026
404 Ga0495653_0137033 3300046463 Bacteria 1725
405 Ga0495653_0157037 3300046463 Bacteria 1583
406 Ga0495650_0000155 3300046471 Bacteria 155947
407 Ga0495650_0006449 3300046471 Bacteria 7304
408 Ga0495650_0022675 3300046471 Bacteria 3007
409 Ga0495650_0029157 3300046471 Bacteria 2520
410 Ga0495650_0087945 3300046471 Bacteria 1187
411 Ga0495580_0000078 3300046472 Bacteria 61461
412 Ga0495580_0001384 3300046472 Bacteria 21273
413 Ga0495580_0002738 3300046472 Bacteria 15192
414 Ga0495580_0007507 3300046472 Bacteria 8758
415 Ga0495580_0040309 3300046472 Bacteria 3336
416 Ga0495580_0117201 3300046472 Bacteria 1849
417 Ga0495582_0002137 3300046473 Bacteria 11044
418 Ga0495582_0007917 3300046473 Bacteria 5873
419 Ga0495582_0023190 3300046473 Bacteria 3394
420 Ga0495605_0002835 3300046474 Bacteria 10538
421 Ga0495605_0004615 3300046474 Bacteria 8057
422 Ga0495605_0012807 3300046474 Bacteria 4641
423 Ga0495605_0119759 3300046474 Bacteria 1194
424 Ga0495605_0159502 3300046474 Bacteria 1002
425 Ga0495639_0142702 3300046475 Bacteria 1152
426 Ga0495662_0001701 3300046476 Bacteria 10995
427 Ga0495662_0006734 3300046476 Bacteria 5722
428 Ga0495662_0010105 3300046476 Bacteria 4629
429 Ga0495664_0000125 3300046477 Bacteria 38821
430 Ga0495664_0005491 3300046477 Bacteria 6961
431 Ga0495664_0035696 3300046477 Bacteria 2928
432 Ga0495664_0047412 3300046477 Bacteria 2550
433 Ga0495584_0000078 3300046491 Bacteria 68161
434 Ga0495584_0000835 3300046491 Bacteria 20077
435 Ga0495584_0017221 3300046491 Bacteria 3682
436 Ga0495584_0022466 3300046491 Bacteria 3200
437 Ga0495584_0044129 3300046491 Bacteria 2250
438 Ga0495584_0057840 3300046491 Bacteria 1951
439 Ga0495584_0064657 3300046491 Bacteria 1839
440 Ga0495584_0091313 3300046491 Bacteria 1536
441 Ga0495584_0112278 3300046491 Bacteria 1379
442 Ga0495584_0163525 3300046491 Bacteria 1131
443 Ga0495585_0000033 3300046492 Bacteria 143282
444 Ga0495585_0000042 3300046492 Bacteria 125286
445 Ga0495585_0000083 3300046492 Bacteria 99140
446 Ga0495585_0000799 3300046492 Bacteria 27482
447 Ga0495585_0003558 3300046492 Bacteria 10457
448 Ga0495585_0010937 3300046492 Bacteria 5392
449 Ga0495585_0020483 3300046492 Bacteria 3804
450 Ga0495585_0021068 3300046492 Bacteria 3744
451 Ga0495585_0022300 3300046492 Bacteria 3635
452 Ga0495585_0040530 3300046492 Bacteria 2615
453 Ga0495585_0067225 3300046492 Bacteria 1960
454 Ga0495585_0069218 3300046492 Bacteria 1926
455 Ga0495585_0114228 3300046492 Bacteria 1433
456 Ga0495594_0050767 3300046499 Bacteria 2282
457 Ga0495596_0000221 3300046500 Bacteria 39400
458 Ga0495596_0001075 3300046500 Bacteria 16213
459 Ga0495596_0005011 3300046500 Bacteria 6337
460 Ga0495596_0006428 3300046500 Bacteria 5407
461 Ga0495596_0007677 3300046500 Bacteria 4848
462 Ga0495596_0011365 3300046500 Bacteria 3844
463 Ga0495596_0013231 3300046500 Bacteria 3507
464 Ga0495596_0028754 3300046500 Bacteria 2230
465 Ga0495596_0150081 3300046500 Bacteria 905
466 Ga0495596_0152794 3300046500 Bacteria 896
467 Ga0495607_0000412 3300046501 Bacteria 43365
468 Ga0495607_0010217 3300046501 Bacteria 6315
469 Ga0495607_0014243 3300046501 Bacteria 5185
470 Ga0495607_0051049 3300046501 Bacteria 2404
471 Ga0495607_0058149 3300046501 Bacteria 2212
472 Ga0495607_0064317 3300046501 Bacteria 2072
473 Ga0495607_0109092 3300046501 Bacteria 1470
474 Ga0495607_0115445 3300046501 Bacteria 1417
475 Ga0495583_0000045 3300046506 Bacteria 220503
476 Ga0495583_0000263 3300046506 Bacteria 86125
477 Ga0495583_0000329 3300046506 Bacteria 75158
478 Ga0495583_0002504 3300046506 Bacteria 15566
479 Ga0495583_0004038 3300046506 Bacteria 10800
480 Ga0495583_0009832 3300046506 Bacteria 5666
481 Ga0495583_0018472 3300046506 Bacteria 3669
482 Ga0495583_0043569 3300046506 Bacteria 2088
483 Ga0495583_0046636 3300046506 Bacteria 1997
484 Ga0495606_0016983 3300046507 Bacteria 5522
485 Ga0495606_0030427 3300046507 Bacteria 3772
486 Ga0495606_0037142 3300046507 Bacteria 3309
487 Ga0495606_0112318 3300046507 Bacteria 1642
488 Ga0495606_0133158 3300046507 Bacteria 1475
489 Ga0495608_0124466 3300046511 Bacteria 1652
490 Ga0495610_0000319 3300046512 Bacteria 51187
491 Ga0495610_0001240 3300046512 Bacteria 22926
492 Ga0495616_0000095 3300046513 Bacteria 74912
493 Ga0495616_0001821 3300046513 Bacteria 14447
494 Ga0495616_0002270 3300046513 Bacteria 12852
495 Ga0495616_0002596 3300046513 Bacteria 11886
496 Ga0495616_0009441 3300046513 Bacteria 5706
497 Ga0495616_0010973 3300046513 Bacteria 5215
498 Ga0495616_0013715 3300046513 Bacteria 4562
499 Ga0495616_0024567 3300046513 Bacteria 3231
500 Ga0495616_0025518 3300046513 Bacteria 3156
501 Ga0495616_0036220 3300046513 Bacteria 2547
502 Ga0495618_0000437 3300046514 Bacteria 29914
503 Ga0495618_0005908 3300046514 Bacteria 7440
504 Ga0495618_0006976 3300046514 Bacteria 6844
505 Ga0495620_0011138 3300046515 Bacteria 4707
506 Ga0495620_0065570 3300046515 Bacteria 1498
507 Ga0495628_0002735 3300046516 Bacteria 15775
508 Ga0495628_0004068 3300046516 Bacteria 13013
509 Ga0495628_0027401 3300046516 Bacteria 4636
510 Ga0495628_0031631 3300046516 Bacteria 4279
511 Ga0495628_0053730 3300046516 Bacteria 3177
512 Ga0495628_0122314 3300046516 Bacteria 1995
513 Ga0495630_0000616 3300046517 Bacteria 25805
514 Ga0495630_0007378 3300046517 Bacteria 7855
515 Ga0495630_0042282 3300046517 Bacteria 3403
516 Ga0495631_0000501 3300046518 Bacteria 26200
517 Ga0495631_0041330 3300046518 Bacteria 2040
518 Ga0495631_0097067 3300046518 Bacteria 1268
519 Ga0495631_0107480 3300046518 Bacteria 1199
520 Ga0495632_0000474 3300046519 Bacteria 38110
521 Ga0495632_0013290 3300046519 Bacteria 4705
522 Ga0495632_0039687 3300046519 Bacteria 2374
523 Ga0495632_0203678 3300046519 Bacteria 900
524 Ga0495637_0024074 3300046520 Bacteria 2756
525 Ga0495643_0000507 3300046522 Bacteria 48620
526 Ga0495643_0049393 3300046522 Bacteria 2269
527 Ga0495643_0060087 3300046522 Bacteria 2018
528 Ga0495643_0090898 3300046522 Bacteria 1574
529 Ga0495643_0201323 3300046522 Bacteria 955
530 Ga0495644_0000129 3300046523 Bacteria 36133
531 Ga0495644_0000547 3300046523 Bacteria 15876
532 Ga0495644_0007632 3300046523 Bacteria 4170
533 Ga0495644_0091051 3300046523 Bacteria 1151
534 Ga0495644_0146276 3300046523 Bacteria 903
535 Ga0495648_0000052 3300046524 Bacteria 162169
536 Ga0495648_0000613 3300046524 Bacteria 38144
537 Ga0495648_0004038 3300046524 Bacteria 12668
538 Ga0495648_0018499 3300046524 Bacteria 4928
539 Ga0495648_0019856 3300046524 Bacteria 4705
540 Ga0495648_0022982 3300046524 Bacteria 4279
541 Ga0495648_0028068 3300046524 Bacteria 3753
542 Ga0495648_0053931 3300046524 Bacteria 2432
543 Ga0495648_0055376 3300046524 Bacteria 2391
544 Ga0495648_0090244 3300046524 Bacteria 1718
545 Ga0495663_0052013 3300046525 Bacteria 1271
546 Ga0495663_0074510 3300046525 Bacteria 1085
547 Ga0495666_0000056 3300046526 Bacteria 42935
548 Ga0495666_0004051 3300046526 Bacteria 7408
549 Ga0495666_0013556 3300046526 Bacteria 4063
550 Ga0495666_0026056 3300046526 Bacteria 2885
551 Ga0495666_0026422 3300046526 Bacteria 2861
552 Ga0495642_0000280 3300046528 Bacteria 28848
553 Ga0495642_0001004 3300046528 Bacteria 13091
554 Ga0495642_0001955 3300046528 Bacteria 8677
555 Ga0495642_0010706 3300046528 Bacteria 3512
556 Ga0495642_0024555 3300046528 Bacteria 2385
557 Ga0495642_0044843 3300046528 Bacteria 1806
558 Ga0495642_0050377 3300046528 Bacteria 1712
559 Ga0495652_0003187 3300046529 Bacteria 16351
560 Ga0495652_0012065 3300046529 Bacteria 7808
561 Ga0495652_0288818 3300046529 Bacteria 1197
562 Ga0495654_0031080 3300046530 Bacteria 2712
563 Ga0495654_0075835 3300046530 Bacteria 1586
564 Ga0495665_0000980 3300046531 Bacteria 15134
565 Ga0495665_0015997 3300046531 Bacteria 4042
566 Ga0495665_0019144 3300046531 Bacteria 3680
567 Ga0495665_0058742 3300046531 Bacteria 2030
568 Ga0495640_0001085 3300046533 Bacteria 21185
569 Ga0495640_0036662 3300046533 Bacteria 3463
570 Ga0495640_0092345 3300046533 Bacteria 1996
571 Ga0495586_0000574 3300046535 Bacteria 21308
572 Ga0495586_0039585 3300046535 Bacteria 2534
573 Ga0495586_0149523 3300046535 Bacteria 1313
574 Ga0495587_0000278 3300046536 Bacteria 36650
575 Ga0495587_0010663 3300046536 Bacteria 5837
576 Ga0495587_0034067 3300046536 Bacteria 3072
577 Ga0495587_0062156 3300046536 Bacteria 2187
578 Ga0495609_0000084 3300046538 Bacteria 113497
579 Ga0495609_0000086 3300046538 Bacteria 110840
580 Ga0495609_0000523 3300046538 Bacteria 30800
581 Ga0495609_0001293 3300046538 Bacteria 17074
582 Ga0495609_0002353 3300046538 Bacteria 11670
583 Ga0495609_0016137 3300046538 Bacteria 3484
584 Ga0495609_0024913 3300046538 Bacteria 2743
585 Ga0495609_0024995 3300046538 Bacteria 2739
586 Ga0495609_0025935 3300046538 Bacteria 2685
587 Ga0495609_0055980 3300046538 Bacteria 1748
588 Ga0495609_0057638 3300046538 Bacteria 1719
589 Ga0495621_0051400 3300046539 Bacteria 1475
590 Ga0495597_0001484 3300046542 Bacteria 16780
591 Ga0495597_0003591 3300046542 Bacteria 8937
592 Ga0495597_0005881 3300046542 Bacteria 6410
593 Ga0495597_0009675 3300046542 Bacteria 4749
594 Ga0495597_0012276 3300046542 Bacteria 4134
595 Ga0495597_0024955 3300046542 Bacteria 2755
596 Ga0495597_0058540 3300046542 Bacteria 1684
597 Ga0495597_0064337 3300046542 Bacteria 1593
598 Ga0495645_0000102 3300046543 Bacteria 59126
599 Ga0495645_0005699 3300046543 Bacteria 8579
600 Ga0495622_0000096 3300046557 Bacteria 77784
601 Ga0495622_0002367 3300046557 Bacteria 9171
602 Ga0495622_0086886 3300046557 Bacteria 1438
603 Ga0495622_0179295 3300046557 Bacteria 950
604 Ga0495633_0000419 3300046558 Bacteria 44088
605 Ga0495633_0028794 3300046558 Bacteria 2704
606 Ga0495633_0034790 3300046558 Bacteria 2421
607 Ga0495633_0034969 3300046558 Bacteria 2414
608 Ga0495633_0155815 3300046558 Bacteria 1054
609 Ga0495667_0110899 3300046559 Bacteria 1772
610 Ga0495667_0162103 3300046559 Bacteria 1438
611 Ga0495656_0002760 3300046615 Bacteria 5870
612 Ga0495656_0035727 3300046615 Bacteria 2043
613 Ga0495656_0262803 3300046615 Bacteria 875
614 Ga0495656_0286902 3300046615 Bacteria 840
615 Ga0495668_0000006 3300046616 Bacteria 553404
616 Ga0495668_0000318 3300046616 Bacteria 66017
617 Ga0495668_0000837 3300046616 Bacteria 34867
618 Ga0495668_0013952 3300046616 Bacteria 4723
619 Ga0495668_0068444 3300046616 Bacteria 1953
620 Ga0495668_0192291 3300046616 Bacteria 1117
621 Ga0495634_0000734 3300046642 Bacteria 31709
622 Ga0495634_0011044 3300046642 Bacteria 6589
623 Ga0495634_0063797 3300046642 Bacteria 2444
624 Ga0495611_0001587 3300046648 Bacteria 11108
625 Ga0495611_0002984 3300046648 Bacteria 7544
626 Ga0495611_0010445 3300046648 Bacteria 3929
627 Ga0495611_0128327 3300046648 Bacteria 1183
628 Ga0495625_0013356 3300046660 Bacteria 6601
629 Ga0495625_0013643 3300046660 Bacteria 6518
630 Ga0495625_0025411 3300046660 Bacteria 4493
631 Ga0495625_0026963 3300046660 Bacteria 4332
632 Ga0495625_0031048 3300046660 Bacteria 3977
633 Ga0495625_0047410 3300046660 Bacteria 3098
634 Ga0495625_0133625 3300046660 Bacteria 1679
635 Ga0495635_0000411 3300046663 Bacteria 27211
636 Ga0495635_0001238 3300046663 Bacteria 17091
637 Ga0495635_0018560 3300046663 Bacteria 4852
638 Ga0495659_0000067 3300046664 Bacteria 46337
639 Ga0495659_0026620 3300046664 Bacteria 1989
640 Ga0495661_0000678 3300046665 Bacteria 34010
641 Ga0495661_0000724 3300046665 Bacteria 32411
642 Ga0495661_0001495 3300046665 Bacteria 19464
643 Ga0495661_0010853 3300046665 Bacteria 6196
644 Ga0495661_0015010 3300046665 Bacteria 5177
645 Ga0495661_0016574 3300046665 Bacteria 4880
646 Ga0495661_0019315 3300046665 Bacteria 4468
647 Ga0495661_0019969 3300046665 Bacteria 4382
648 Ga0495661_0042775 3300046665 Bacteria 2790
649 Ga0495661_0045273 3300046665 Bacteria 2692
650 Ga0495661_0046502 3300046665 Bacteria 2649
651 Ga0495588_0015540 3300046674 Bacteria 3665
652 Ga0495588_0048307 3300046674 Bacteria 2186
653 Ga0495588_0136021 3300046674 Bacteria 1297
654 Ga0495657_0149423 3300046675 Bacteria 1451
655 Ga0495657_0159533 3300046675 Bacteria 1396
656 Ga0495599_0000347 3300046678 Bacteria 27379
657 Ga0495599_0011345 3300046678 Bacteria 5472
658 Ga0495599_0124976 3300046678 Bacteria 1599
659 Ga0495623_0003228 3300046679 Bacteria 10768
660 Ga0495623_0004602 3300046679 Bacteria 9066
661 Ga0495623_0006337 3300046679 Bacteria 7693
662 Ga0495623_0013177 3300046679 Bacteria 5359
663 Ga0495646_0007318 3300046680 Bacteria 7013
664 Ga0495646_0024211 3300046680 Bacteria 3823
665 Ga0495646_0047086 3300046680 Bacteria 2626
666 Ga0495646_0047621 3300046680 Bacteria 2608
667 Ga0495646_0157506 3300046680 Bacteria 1259
668 Ga0495646_0235552 3300046680 Bacteria 985
669 Ga0495646_0273480 3300046680 Bacteria 899
670 Ga0495658_0015626 3300046683 Bacteria 3896
671 Ga0495669_0000289 3300046684 Bacteria 28645
672 Ga0495669_0012260 3300046684 Bacteria 3646
673 Ga0495669_0043456 3300046684 Bacteria 2000
674 Ga0495669_0068267 3300046684 Bacteria 1617
675 Ga0495669_0118201 3300046684 Bacteria 1241
676 Ga0495613_0001584 3300046689 Bacteria 17265
677 Ga0495613_0006361 3300046689 Bacteria 8829
678 Ga0495613_0144402 3300046689 Bacteria 1699
679 Ga0495624_0000076 3300046690 Bacteria 64621
680 Ga0495624_0016366 3300046690 Bacteria 4991
681 Ga0495624_0028857 3300046690 Bacteria 3621
682 Ga0495624_0036014 3300046690 Bacteria 3192
683 Ga0495624_0088732 3300046690 Bacteria 1909
684 Ga0495670_0001180 3300046691 Bacteria 12665
685 Ga0495670_0005499 3300046691 Bacteria 6218
686 Ga0495670_0016059 3300046691 Bacteria 3680
687 Ga0495670_0020349 3300046691 Bacteria 3271
688 Ga0495670_0043622 3300046691 Bacteria 2238
689 Ga0495670_0046568 3300046691 Bacteria 2166
690 Ga0495670_0048679 3300046691 Bacteria 2120
691 Ga0495670_0069041 3300046691 Bacteria 1786
692 Ga0495671_0001298 3300046692 Bacteria 17061
693 Ga0495671_0001356 3300046692 Bacteria 16594
694 Ga0495671_0005385 3300046692 Bacteria 7499
695 Ga0495671_0020495 3300046692 Bacteria 3483
696 Ga0495671_0044483 3300046692 Bacteria 2226
697 Ga0495671_0055024 3300046692 Bacteria 1971
698 Ga0495671_0094013 3300046692 Bacteria 1467
699 Ga0495671_0100391 3300046692 Bacteria 1415
700 Ga0495649_0002701 3300046694 Bacteria 12360
701 Ga0495649_0005801 3300046694 Bacteria 7776
702 Ga0495649_0009705 3300046694 Bacteria 5703
703 Ga0495649_0019321 3300046694 Bacteria 3829
704 Ga0495649_0027997 3300046694 Bacteria 3125
705 Ga0495589_0000055 3300046794 Bacteria 110887
706 Ga0495589_0000407 3300046794 Bacteria 32420
707 Ga0495589_0003986 3300046794 Bacteria 7926
708 Ga0495589_0004864 3300046794 Bacteria 7126
709 Ga0495589_0006446 3300046794 Bacteria 6189
710 Ga0495589_0010283 3300046794 Bacteria 4863
711 Ga0495589_0027454 3300046794 Bacteria 2878
712 Ga0495589_0055688 3300046794 Bacteria 1948
713 Ga0495600_0000886 3300046809 Bacteria 16020
714 Ga0495600_0001111 3300046809 Bacteria 14660
715 Ga0495600_0008504 3300046809 Bacteria 6308
716 Ga0495600_0030826 3300046809 Bacteria 3473
717 Ga0495660_0043958 3300046810 Bacteria 2460
718 Ga0495660_0093366 3300046810 Bacteria 1560
719 Ga0495581_0000420 3300047315 Bacteria 21448
720 Ga0495581_0000863 3300047315 Bacteria 16176
721 Ga0495581_0002438 3300047315 Bacteria 10510
722 Ga0495581_0002610 3300047315 Bacteria 10251
723 Ga0495604_0000500 3300047317 Bacteria 34509
724 Ga0495604_0000727 3300047317 Bacteria 27719
725 Ga0495604_0018721 3300047317 Bacteria 5545
726 Ga0495604_0057340 3300047317 Bacteria 2994
727 Ga0495604_0072703 3300047317 Bacteria 2598
728 Ga0495604_0174191 3300047317 Bacteria 1510
729 Ga0495636_0019464 3300047318 Bacteria 2729
730 Ga0495636_0033617 3300047318 Bacteria 2108
731 Ga0495636_0085937 3300047318 Bacteria 1360
732 Ga0495636_0122699 3300047318 Bacteria 1150
733 Ga0495674_0001156 3300047319 Bacteria 25428
734 Ga0495674_0001927 3300047319 Bacteria 20477
735 Ga0495674_0002849 3300047319 Bacteria 16786
736 Ga0495674_0003908 3300047319 Bacteria 14471
737 Ga0495674_0008266 3300047319 Bacteria 9925
738 Ga0495674_0056987 3300047319 Bacteria 3420
739 Ga0495674_0172083 3300047319 Bacteria 1806
740 Ga0495674_0233606 3300047319 Bacteria 1517
741 Ga0495672_0000063 3300047320 Bacteria 201893
742 Ga0495672_0005166 3300047320 Bacteria 10422
743 Ga0495672_0005304 3300047320 Bacteria 10262
744 Ga0495672_0011948 3300047320 Bacteria 6087
745 Ga0495672_0027131 3300047320 Bacteria 3644
746 Ga0495672_0028146 3300047320 Bacteria 3561
747 Ga0495672_0059826 3300047320 Bacteria 2202
748 Ga0495676_0003759 3300047321 Bacteria 13788
749 Ga0495676_0009257 3300047321 Bacteria 8975
750 Ga0495676_0105207 3300047321 Bacteria 2081
751 Ga0495680_0000564 3300047322 Bacteria 41772
752 Ga0495680_0005336 3300047322 Bacteria 12126
753 Ga0495680_0025785 3300047322 Bacteria 4860
754 Ga0495680_0094919 3300047322 Bacteria 2230
755 Ga0495680_0276161 3300047322 Bacteria 1185
756 Ga0495683_0000255 3300047323 Bacteria 47956
757 Ga0495683_0000522 3300047323 Bacteria 29379
758 Ga0495683_0001194 3300047323 Bacteria 17720
759 Ga0495683_0009216 3300047323 Bacteria 5259
760 Ga0495683_0009768 3300047323 Bacteria 5101
761 Ga0495683_0015651 3300047323 Bacteria 3942
762 Ga0495683_0019368 3300047323 Bacteria 3513
763 Ga0495683_0028028 3300047323 Bacteria 2879
764 Ga0495683_0096462 3300047323 Bacteria 1426
765 Ga0495683_0200155 3300047323 Bacteria 901
766 Ga0495687_000029 3300047443 Bacteria 293244
767 Ga0495687_000139 3300047443 Bacteria 110721
768 Ga0495687_000156 3300047443 Bacteria 103711
769 Ga0495687_000253 3300047443 Bacteria 71917
770 Ga0495687_000628 3300047443 Bacteria 40562
771 Ga0495687_000656 3300047443 Bacteria 39649
772 Ga0495687_002896 3300047443 Bacteria 13094
773 Ga0495687_009196 3300047443 Bacteria 5556
774 Ga0495687_019779 3300047443 Bacteria 3294
775 Ga0495687_071523 3300047443 Bacteria 1389
776 Ga0495675_0002809 3300047444 Bacteria 10431
777 Ga0495675_0003731 3300047444 Bacteria 9209
778 Ga0495675_0006111 3300047444 Bacteria 7369
779 Ga0495675_0047314 3300047444 Bacteria 2736
780 Ga0495677_0000147 3300047445 Bacteria 33620
781 Ga0495677_0001429 3300047445 Bacteria 9579
782 Ga0495677_0014535 3300047445 Bacteria 2865
783 Ga0495677_0044060 3300047445 Bacteria 1636
784 Ga0495677_0072535 3300047445 Bacteria 1284
785 Ga0495679_000030 3300047446 Bacteria 180083
786 Ga0495679_000860 3300047446 Bacteria 19197
787 Ga0495679_001668 3300047446 Bacteria 12348
788 Ga0495679_013966 3300047446 Bacteria 2994
789 Ga0495679_017294 3300047446 Bacteria 2584
790 Ga0495685_000228 3300047447 Bacteria 19195
791 Ga0495685_011438 3300047447 Bacteria 2993
792 Ga0495685_034202 3300047447 Bacteria 1746
793 Ga0495685_054317 3300047447 Bacteria 1356
794 Ga0495685_064622 3300047447 Bacteria 1230
795 Ga0495685_079856 3300047447 Bacteria 1090
796 Ga0495673_0000159 3300047469 Bacteria 116007
797 Ga0495673_0006642 3300047469 Bacteria 6776
798 Ga0495673_0008761 3300047469 Bacteria 5652
799 Ga0495673_0032424 3300047469 Bacteria 2436
800 Ga0495681_0024032 3300047470 Bacteria 3221
801 Ga0495681_0042758 3300047470 Bacteria 2190
802 Ga0495681_0045374 3300047470 Bacteria 2104
803 Ga0495681_0045586 3300047470 Bacteria 2097
804 Ga0495681_0059603 3300047470 Bacteria 1764
805 Ga0495681_0077346 3300047470 Bacteria 1493
806 Ga0495684_0052171 3300047471 Bacteria 3121
807 Ga0495686_0000048 3300047472 Bacteria 278044
808 Ga0495686_0002450 3300047472 Bacteria 17499
809 Ga0495686_0010615 3300047472 Bacteria 6541
810 Ga0495593_0000152 3300047673 Bacteria 34507
811 Ga0495593_0011370 3300047673 Bacteria 5113
812 Ga0495593_0024854 3300047673 Bacteria 3316
813 Ga0495593_0025362 3300047673 Bacteria 3281
814 Ga0495593_0030957 3300047673 Bacteria 2925
815 Ga0495602_0000904 3300048088 Bacteria 28662
816 Ga0495602_0006978 3300048088 Bacteria 11861
817 Ga0495602_0094369 3300048088 Bacteria 2472
818 Ga0495602_0148376 3300048088 Bacteria 1846
819 Ga0495614_0000446 3300048089 Bacteria 16986
820 Ga0495614_0002458 3300048089 Bacteria 8237
821 Ga0495614_0005850 3300048089 Bacteria 5540
822 Ga0495614_0048170 3300048089 Bacteria 1827
823 Ga0495626_0023493 3300048091 Bacteria 3036
824 Ga0495626_0049160 3300048091 Bacteria 1953
825 Ga0495626_0055052 3300048091 Bacteria 1825
826 Ga0496100_0003923 3300048903 Bacteria 7816
827 Ga0496100_0033770 3300048903 Bacteria 3203
828 Ga0496100_0063417 3300048903 Bacteria 2442
829 Ga0496100_0079671 3300048903 Bacteria 2208
830 Ga0496100_0107755 3300048903 Bacteria 1931
831 Ga0496101_0001193 3300048904 Bacteria 15522
832 Ga0496101_0031557 3300048904 Bacteria 3726
833 Ga0496101_0129164 3300048904 Bacteria 1917
834 Ga0496101_0222059 3300048904 Bacteria 1466
835 Ga0496101_0471086 3300048904 Bacteria 991
836 Ga0496102_0000082 3300048905 Bacteria 139079
837 Ga0496102_0000548 3300048905 Bacteria 40478
838 Ga0496102_0001919 3300048905 Bacteria 17896
839 Ga0496102_0004818 3300048905 Bacteria 11409
840 Ga0496102_0020777 3300048905 Bacteria 5802
841 Ga0496102_0022296 3300048905 Bacteria 5611
842 Ga0496102_0035297 3300048905 Bacteria 4500
843 Ga0496102_0261020 3300048905 Bacteria 1633
844 Ga0496102_0288143 3300048905 Bacteria 1548
845 Ga0496102_0374190 3300048905 Bacteria 1340
846 Ga0496103_0000701 3300048906 Bacteria 24789
847 Ga0496103_0047033 3300048906 Bacteria 2665
848 Ga0496103_0065817 3300048906 Bacteria 2261
849 Ga0496103_0082753 3300048906 Bacteria 2020
850 Ga0496103_0092396 3300048906 Bacteria 1910
851 Ga0496104_0012925 3300048907 Bacteria 7517
852 Ga0496104_0069023 3300048907 Bacteria 3359
853 Ga0496104_0471545 3300048907 Bacteria 1167
854 Ga0496105_0125122 3300048908 Bacteria 2119
855 Ga0496105_0175343 3300048908 Bacteria 1756
856 Ga0496106_0047489 3300048909 Bacteria 3231
857 Ga0496106_0065102 3300048909 Bacteria 2775
858 Ga0496106_0104295 3300048909 Bacteria 2202
859 Ga0496107_0043650 3300048910 Bacteria 3221
860 Ga0496107_0055430 3300048910 Bacteria 2863
861 Ga0496107_0067890 3300048910 Bacteria 2587
862 Ga0496107_0077024 3300048910 Bacteria 2429
863 Ga0496107_0114739 3300048910 Bacteria 1982
864 Ga0496108_0199491 3300048911 Bacteria 1736
865 Ga0496108_0316283 3300048911 Bacteria 1361
866 Ga0496108_0778498 3300048911 Bacteria 826
867 Ga0496109_0140653 3300048912 Bacteria 2257
868 Ga0496109_0188887 3300048912 Bacteria 1936
869 Ga0496109_0203718 3300048912 Bacteria 1860
870 Ga0496110_0226429 3300048913 Bacteria 1700
871 Ga0496110_0231164 3300048913 Bacteria 1682
872 Ga0496110_0254664 3300048913 Bacteria 1598
873 Ga0496112_0009672 3300048915 Bacteria 8700
874 Ga0496112_0218854 3300048915 Bacteria 1860
875 Ga0496112_0548199 3300048915 Bacteria 1090
876 Ga0496113_0007071 3300048916 Bacteria 7181
877 Ga0496113_0009759 3300048916 Bacteria 6310
878 Ga0496113_0010371 3300048916 Bacteria 6157
879 Ga0496113_0073169 3300048916 Bacteria 2610
880 Ga0496114_0001294 3300048917 Bacteria 18937
881 Ga0496114_0066361 3300048917 Bacteria 3025
882 Ga0496114_0831642 3300048917 Bacteria 803
883 Ga0496115_0020182 3300048918 Bacteria 5137
884 Ga0496115_0074630 3300048918 Bacteria 2754
885 Ga0496116_0002350 3300048919 Bacteria 20004
886 Ga0496116_0002865 3300048919 Bacteria 17673
887 Ga0496116_0029737 3300048919 Bacteria 3933
888 Ga0496116_0029922 3300048919 Bacteria 3918
889 Ga0496117_0000035 3300048920 Bacteria 326449
890 Ga0496117_0001097 3300048920 Bacteria 40911
891 Ga0496117_0003845 3300048920 Bacteria 17085
892 Ga0496117_0045546 3300048920 Bacteria 3166
893 Ga0496117_0105080 3300048920 Bacteria 1776
894 Ga0496118_0000054 3300048921 Bacteria 233617
895 Ga0496118_0000294 3300048921 Bacteria 86720
896 Ga0496118_0001134 3300048921 Bacteria 41095
897 Ga0496118_0002121 3300048921 Bacteria 27768
898 Ga0496118_0015333 3300048921 Bacteria 7101
899 Ga0496118_0069114 3300048921 Bacteria 2560
900 Ga0496118_0099517 3300048921 Bacteria 1970
901 Ga0496119_0004866 3300048922 Bacteria 13156
902 Ga0496119_0016988 3300048922 Bacteria 5502
903 Ga0496120_0000086 3300048923 Bacteria 154099
904 Ga0496120_0268256 3300048923 Bacteria 794
905 Ga0496121_0001036 3300048924 Bacteria 49628
906 Ga0496121_0004657 3300048924 Bacteria 18221
907 Ga0496121_0008412 3300048924 Bacteria 12149
908 Ga0496121_0016860 3300048924 Bacteria 7512
909 Ga0496121_0029589 3300048924 Bacteria 5060
910 Ga0496121_0060290 3300048924 Bacteria 3121
911 Ga0496121_0159422 3300048924 Bacteria 1652
912 Ga0496121_0287228 3300048924 Bacteria 1122
913 Ga0496122_0001513 3300048925 Bacteria 37053
914 Ga0496122_0001645 3300048925 Bacteria 34677
915 Ga0496122_0002752 3300048925 Bacteria 24277
916 Ga0496123_0000970 3300048926 Bacteria 44328
917 Ga0496123_0002204 3300048926 Bacteria 24782
918 Ga0496123_0002540 3300048926 Bacteria 22349
919 Ga0496123_0041869 3300048926 Bacteria 3169
920 Ga0496123_0082985 3300048926 Bacteria 1940
921 Ga0496124_0008360 3300048927 Bacteria 10838
922 Ga0496124_0034565 3300048927 Bacteria 4434
923 Ga0496124_0327691 3300048927 Bacteria 1093
924 Ga0496125_0001339 3300048928 Bacteria 36299
925 Ga0496125_0001458 3300048928 Bacteria 34242
926 Ga0496125_0009187 3300048928 Bacteria 10215
927 Ga0496125_0024768 3300048928 Bacteria 5511
928 Ga0496125_0230742 3300048928 Bacteria 1184
929 Ga0496126_0000423 3300048929 Bacteria 85154
930 Ga0496126_0000599 3300048929 Bacteria 68021
931 Ga0496126_0001192 3300048929 Bacteria 42374
932 Ga0496126_0042621 3300048929 Bacteria 4191
933 Ga0496126_0075933 3300048929 Bacteria 2981
934 Ga0496126_0127483 3300048929 Bacteria 2202
935 Ga0496126_0289467 3300048929 Bacteria 1355
936 Ga0496126_0456059 3300048929 Bacteria 1028
937 Ga0495678_000244 3300049459 Bacteria 61112
938 Ga0495678_003003 3300049459 Bacteria 10739
939 Ga0495678_004126 3300049459 Bacteria 8594
940 Ga0495682_0000454 3300049460 Bacteria 28314
941 Ga0495682_0000471 3300049460 Bacteria 27829
942 Ga0495682_0008504 3300049460 Bacteria 4039
943 Ga0495682_0024188 3300049460 Bacteria 2266
944 Ga0495682_0036274 3300049460 Bacteria 1816
945 Ga0495682_0061201 3300049460 Bacteria 1359
946 Ga0501033_0121854 3300049570 Bacteria 1892
947 Ga0501038_0040239 3300049574 Bacteria 4085
948 Ga0501039_0117668 3300049575 Bacteria 2081
949 Ga0501042_0094494 3300049578 Bacteria 2147
950 Ga0501043_0119612 3300049579 Bacteria 2066
951 Ga0501046_0036067 3300049580 Bacteria 3981
952 Ga0501048_0020606 3300049582 Bacteria 4832
953 Ga0501071_0077165 3300049587 Bacteria 2433
954 Ga0501075_0018994 3300049591 Bacteria 4985
955 Ga0501076_0002066 3300049592 Bacteria 13751
956 Ga0501076_0184144 3300049592 Bacteria 1703
957 Ga0501250_012839 3300049680 Bacteria 996
958 Ga0501079_0024823 3300049741 Bacteria 4598
959 Ga0501079_0324933 3300049741 Bacteria 1204
960 Ga0501080_0022265 3300049742 Bacteria 5871
961 Ga0501080_0367666 3300049742 Bacteria 1297
962 Ga0501081_0002231 3300049743 Bacteria 12191
963 Ga0501081_0234522 3300049743 Bacteria 1337
964 Ga0501083_0048451 3300049744 Bacteria 2868
965 Ga0501035_0126708 3300049822 Bacteria 2229
966 Ga0501045_0001446 3300049824 Bacteria 15787
967 nmdc:mga03683_3564_c2 3300050489 Bacteria 3545
968 nmdc:mga03n38_3188_c1 3300050490 Bacteria 5227
969 nmdc:mga00v17_76693_c1 3300050491 Bacteria 2080
970 nmdc:mga0k408_155960_c1 3300050493 Bacteria 1360
971 nmdc:mga0k408_7589_c1 3300050493 Bacteria 5792
972 nmdc:mga0k408_9829_c1 3300050493 Bacteria 5166
973 nmdc:mga04h51_18556_c1 3300050495 Bacteria 2051
974 nmdc:mga04h51_45590_c1 3300050495 Bacteria 1450
975 nmdc:mga07m45_126_c1 3300050496 Bacteria 30476
976 nmdc:mga07m45_2253_c1 3300050496 Bacteria 9005
977 nmdc:mga07m45_64228_c1 3300050496 Bacteria 2083
978 nmdc:mga05p37_204206_c1 3300050507 Bacteria 2391
979 nmdc:mga0sz30_6210_c1 3300050516 Bacteria 4427
980 Ga0500658_0002282 3300053134 Bacteria 7423
981 Ga0500559_0168950 3300053136 Bacteria 1029
982 Ga0500637_0005060 3300053178 Bacteria 6347
983 Ga0501084_0026840 3300054114 Bacteria 4810
984 Ga0587084_003872 3300059477 Bacteria 1675
985 Ga0587077_008959 3300059493 Bacteria 1505
986 Ga0587082_014547 3300059504 Bacteria 1202
987 Ga0587083_0033482 3300059505 Bacteria 1037
988 Ga0587062_005140 3300059639 Bacteria 1430
989 Ga0587067_011086 3300059640 Bacteria 1381
990 Ga0587072_013521 3300059643 Bacteria 1364
991 Ga0587075_002497 3300059644 Bacteria 1949
992 Ga0587111_0033272 3300060346 Bacteria 1064
993 Ga0501082_0010901 3300060353 Bacteria 7822
994 Ga0501082_0066431 3300060353 Bacteria 3106
995 Ga0466962_0002159 3300061719 Bacteria 9291
996 Ga0466962_0011537 3300061719 Bacteria 4256
997 Ga0466962_0048807 3300061719 Bacteria 2022
998 Ga0530510_0002613 3300061734 Bacteria 12390

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2808606418 2809147037 246
2 3300009551 Ga0105238_10620251 Ga0105238_106202512 249
3 3300001979 JGI24740J21852_10000899 JGI24740J21852_100008999 250
4 3300001989 JGI24739J22299_10005340 JGI24739J22299_100053402 250
5 3300002067 JGI24735J21928_10008041 JGI24735J21928_100080413 250
6 3300002075 JGI24738J21930_10001023 JGI24738J21930_100010232 250
7 3300002705 JGI25156J39149_1000633 JGI25156J39149_100063311 250
8 3300002705 JGI25156J39149_1000705 JGI25156J39149_100070512 250
9 3300002705 JGI25156J39149_1001702 JGI25156J39149_10017024 250
10 3300003214 JGI25165J46597_1000853 JGI25165J46597_10008537 250
11 3300003575 Ga0007409J51694_1014567 Ga0007409J51694_10145671 250
12 3300003575 Ga0007409J51694_1027038 Ga0007409J51694_10270381 250
13 3300003756 Ga0055533_1001314 Ga0055533_10013143 250
14 3300003758 Ga0055532_1000014 Ga0055532_1000014113 250
15 3300003759 Ga0055525_1000028 Ga0055525_10000288 250
16 3300003760 Ga0055527_1000013 Ga0055527_1000013226 250
17 3300003760 Ga0055527_1000055 Ga0055527_100005522 250
18 3300003760 Ga0055527_1007461 Ga0055527_10074612 250
19 3300003761 Ga0055535_1000011 Ga0055535_1000011224 250
20 3300003761 Ga0055535_1000083 Ga0055535_100008322 250
21 3300003762 Ga0055542_1000018 Ga0055542_1000018226 250
22 3300003762 Ga0055542_1001335 Ga0055542_10013358 250
23 3300003763 Ga0055529_1000017 Ga0055529_1000017115 250
24 3300003771 Ga0055526_1001294 Ga0055526_10012942 250
25 3300003771 Ga0055526_1008224 Ga0055526_10082243 250
26 3300003771 Ga0055526_1010588 Ga0055526_10105883 250
27 3300003771 Ga0055526_1043602 Ga0055526_10436022 250
28 3300003773 Ga0055537_1000292 Ga0055537_100029230 250
29 3300003775 Ga0055524_1001049 Ga0055524_100104911 250
30 3300003775 Ga0055524_1019724 Ga0055524_10197242 250
31 3300003781 Ga0055536_1000462 Ga0055536_10004629 250
32 3300003784 Ga0055534_1000046 Ga0055534_100004627 250
33 3300003784 Ga0055534_1000935 Ga0055534_10009355 250
34 3300003784 Ga0055534_1001910 Ga0055534_10019103 250
35 3300003790 Ga0055528_1000226 Ga0055528_100022627 250
36 3300005262 Ga0065165_1001458 Ga0065165_100145811 250
37 3300005288 Ga0065714_10106686 Ga0065714_101066861 250
38 3300005334 Ga0068869_100082861 Ga0068869_1000828612 250
39 3300005335 Ga0070666_10072573 Ga0070666_100725732 250
40 3300005335 Ga0070666_10367820 Ga0070666_103678201 250
41 3300005339 Ga0070660_100008874 Ga0070660_1000088742 250
42 3300005344 Ga0070661_100006929 Ga0070661_1000069291 250
43 3300005344 Ga0070661_100020072 Ga0070661_1000200723 250
44 3300005355 Ga0070671_100006052 Ga0070671_1000060523 250
45 3300005364 Ga0070673_100405839 Ga0070673_1004058392 250
46 3300005366 Ga0070659_100002890 Ga0070659_1000028902 250
47 3300005366 Ga0070659_100009715 Ga0070659_1000097153 250
48 3300005366 Ga0070659_100076255 Ga0070659_1000762552 250
49 3300005366 Ga0070659_100368174 Ga0070659_1003681742 250
50 3300005367 Ga0070667_100020129 Ga0070667_1000201292 250
51 3300005367 Ga0070667_100129145 Ga0070667_1001291452 250
52 3300005455 Ga0070663_100018004 Ga0070663_1000180042 250
53 3300005455 Ga0070663_100047134 Ga0070663_1000471343 250
54 3300005455 Ga0070663_100067888 Ga0070663_1000678882 250
55 3300005455 Ga0070663_100121486 Ga0070663_1001214862 250
56 3300005459 Ga0068867_100702224 Ga0068867_1007022241 250
57 3300005535 Ga0070684_100095995 Ga0070684_1000959953 250
58 3300005548 Ga0070665_100006580 Ga0070665_1000065809 250
59 3300005548 Ga0070665_100015860 Ga0070665_1000158603 250
60 3300005548 Ga0070665_100058761 Ga0070665_1000587612 250
61 3300005548 Ga0070665_100143386 Ga0070665_1001433862 250
62 3300005563 Ga0068855_100108136 Ga0068855_1001081362 250
63 3300005563 Ga0068855_100319134 Ga0068855_1003191342 250
64 3300005564 Ga0070664_100007998 Ga0070664_1000079986 250
65 3300005564 Ga0070664_100014507 Ga0070664_1000145072 250
66 3300005564 Ga0070664_100099806 Ga0070664_1000998062 250
67 3300005564 Ga0070664_100327093 Ga0070664_1003270932 250
68 3300005564 Ga0070664_100347145 Ga0070664_1003471452 250
69 3300005578 Ga0068854_100594962 Ga0068854_1005949621 250
70 3300005614 Ga0068856_100273361 Ga0068856_1002733612 250
71 3300005616 Ga0068852_100016870 Ga0068852_1000168702 250
72 3300005616 Ga0068852_100215563 Ga0068852_1002155631 250
73 3300005616 Ga0068852_100442187 Ga0068852_1004421872 250
74 3300005617 Ga0068859_100001005 Ga0068859_10000100514 250
75 3300005617 Ga0068859_100014788 Ga0068859_1000147883 250
76 3300005618 Ga0068864_100082860 Ga0068864_1000828601 250
77 3300005719 Ga0068861_100067529 Ga0068861_1000675292 250
78 3300005841 Ga0068863_100006932 Ga0068863_1000069323 250
79 3300005841 Ga0068863_100037016 Ga0068863_1000370163 250
80 3300005841 Ga0068863_100044357 Ga0068863_1000443572 250
81 3300005842 Ga0068858_100012281 Ga0068858_1000122815 250
82 3300005843 Ga0068860_100003507 Ga0068860_1000035075 250
83 3300005843 Ga0068860_100058586 Ga0068860_1000585862 250
84 3300005844 Ga0068862_100041066 Ga0068862_1000410662 250
85 3300006038 Ga0075365_10106808 Ga0075365_101068082 250
86 3300006042 Ga0075368_10033679 Ga0075368_100336792 250
87 3300006042 Ga0075368_10068067 Ga0075368_100680671 250
88 3300006042 Ga0075368_10078548 Ga0075368_100785482 250
89 3300006048 Ga0075363_100006342 Ga0075363_1000063423 250
90 3300006048 Ga0075363_100212343 Ga0075363_1002123432 250
91 3300006051 Ga0075364_10025720 Ga0075364_100257203 250
92 3300006177 Ga0075362_10025882 Ga0075362_100258823 250
93 3300006177 Ga0075362_10027729 Ga0075362_100277292 250
94 3300006177 Ga0075362_10264130 Ga0075362_102641301 250
95 3300006178 Ga0075367_10009348 Ga0075367_100093482 250
96 3300006178 Ga0075367_10014135 Ga0075367_100141353 250
97 3300006186 Ga0075369_10005693 Ga0075369_100056933 250
98 3300006186 Ga0075369_10021807 Ga0075369_100218072 250
99 3300006195 Ga0075366_10001522 Ga0075366_100015229 250
100 3300006195 Ga0075366_10118078 Ga0075366_101180781 250
101 3300006237 Ga0097621_100205771 Ga0097621_1002057712 250
102 3300006353 Ga0075370_10001089 Ga0075370_100010898 250
103 3300006353 Ga0075370_10001738 Ga0075370_100017383 250
104 3300006353 Ga0075370_10016598 Ga0075370_100165982 250
105 3300006358 Ga0068871_100099302 Ga0068871_1000993022 250
106 3300006358 Ga0068871_100249490 Ga0068871_1002494901 250
107 3300006881 Ga0068865_100028606 Ga0068865_1000286063 250
108 3300006931 Ga0097620_100001005 Ga0097620_10000100514 250
109 3300006931 Ga0097620_100014788 Ga0097620_1000147883 250
110 3300009011 Ga0105251_10000537 Ga0105251_1000053712 250
111 3300009036 Ga0105244_10038955 Ga0105244_100389552 250
112 3300009092 Ga0105250_10117335 Ga0105250_101173352 250
113 3300009093 Ga0105240_10006910 Ga0105240_100069109 250
114 3300009093 Ga0105240_10014768 Ga0105240_1001476812 250
115 3300009093 Ga0105240_10031257 Ga0105240_100312573 250
116 3300009093 Ga0105240_10060249 Ga0105240_100602493 250
117 3300009093 Ga0105240_10355988 Ga0105240_103559882 250
118 3300009098 Ga0105245_10134894 Ga0105245_101348942 250
119 3300009101 Ga0105247_10025965 Ga0105247_100259653 250
120 3300009174 Ga0105241_10004372 Ga0105241_100043727 250
121 3300009176 Ga0105242_10072861 Ga0105242_100728612 250
122 3300009176 Ga0105242_10155959 Ga0105242_101559592 250
123 3300009176 Ga0105242_10178369 Ga0105242_101783692 250
124 3300009177 Ga0105248_10001355 Ga0105248_1000135522 250
125 3300009177 Ga0105248_10045851 Ga0105248_100458513 250
126 3300009177 Ga0105248_10128971 Ga0105248_101289713 250
127 3300009177 Ga0105248_10167403 Ga0105248_101674032 250
128 3300009545 Ga0105237_10018129 Ga0105237_100181294 250
129 3300009545 Ga0105237_10488999 Ga0105237_104889992 250
130 3300009551 Ga0105238_10032616 Ga0105238_100326163 250
131 3300009551 Ga0105238_10354897 Ga0105238_103548972 250
132 3300009553 Ga0105249_10012890 Ga0105249_100128903 250
133 3300009553 Ga0105249_10847425 Ga0105249_108474252 250
134 3300010375 Ga0105239_10087316 Ga0105239_100873162 250
135 3300010375 Ga0105239_10103984 Ga0105239_101039842 250
136 3300010375 Ga0105239_10148953 Ga0105239_101489533 250
137 3300011119 Ga0105246_10311014 Ga0105246_103110142 250
138 3300013105 Ga0157369_10021832 Ga0157369_100218323 250
139 3300013105 Ga0157369_10584392 Ga0157369_105843922 250
140 3300013296 Ga0157374_10000310 Ga0157374_1000031010 250
141 3300013296 Ga0157374_10079869 Ga0157374_100798694 250
142 3300013306 Ga0163162_10000873 Ga0163162_100008737 250
143 3300013306 Ga0163162_10053681 Ga0163162_100536812 250
144 3300013306 Ga0163162_10086494 Ga0163162_100864943 250
145 3300013306 Ga0163162_10480133 Ga0163162_104801331 250
146 3300013306 Ga0163162_11045007 Ga0163162_110450072 250
147 3300013307 Ga0157372_10370829 Ga0157372_103708292 250
148 3300013308 Ga0157375_10005109 Ga0157375_100051092 250
149 3300013308 Ga0157375_10655388 Ga0157375_106553881 250
150 3300014325 Ga0163163_10176536 Ga0163163_101765362 250
151 3300014968 Ga0157379_10140854 Ga0157379_101408542 250
152 3300014968 Ga0157379_10235480 Ga0157379_102354802 250
153 3300015261 Ga0182006_1125525 Ga0182006_11255251 250
154 3300015262 Ga0182007_10000566 Ga0182007_100005663 250
155 3300016635 Ga0183361_10003 Ga0183361_10003360 250
156 3300017792 Ga0163161_10263588 Ga0163161_102635882 250
157 3300020070 Ga0206356_10783655 Ga0206356_107836551 250
158 3300025225 Ga0209566_103550 Ga0209566_1035502 250
159 3300025226 Ga0209674_100049 Ga0209674_10004966 250
160 3300025226 Ga0209674_100051 Ga0209674_100051125 250
161 3300025228 Ga0209672_100027 Ga0209672_100027110 250
162 3300025228 Ga0209672_100040 Ga0209672_10004022 250
163 3300025228 Ga0209672_100139 Ga0209672_10013941 250
164 3300025229 Ga0209147_100035 Ga0209147_100035110 250
165 3300025229 Ga0209147_100048 Ga0209147_10004822 250
166 3300025230 Ga0209563_100011 Ga0209563_100011302 250
167 3300025230 Ga0209563_101052 Ga0209563_1010524 250
168 3300025242 Ga0209258_100052 Ga0209258_100052209 250
169 3300025242 Ga0209258_100070 Ga0209258_10007022 250
170 3300025253 Ga0209677_102480 Ga0209677_1024802 250
171 3300025254 Ga0209148_1000064 Ga0209148_1000064209 250
172 3300025254 Ga0209148_1000284 Ga0209148_100028460 250
173 3300025256 Ga0209759_1000015 Ga0209759_1000015127 250
174 3300025256 Ga0209759_1000041 Ga0209759_1000041166 250
175 3300025256 Ga0209759_1000252 Ga0209759_100025214 250
176 3300025256 Ga0209759_1013351 Ga0209759_10133512 250
177 3300025256 Ga0209759_1016964 Ga0209759_10169642 250
178 3300025258 Ga0209129_1015186 Ga0209129_10151862 250
179 3300025261 Ga0209233_1000073 Ga0209233_1000073122 250
180 3300025263 Ga0209565_1000003 Ga0209565_1000003910 250
181 3300025263 Ga0209565_1000267 Ga0209565_10002674 250
182 3300025272 Ga0209455_1000057 Ga0209455_1000057209 250
183 3300025272 Ga0209455_1000178 Ga0209455_100017867 250
184 3300025273 Ga0209673_1000003 Ga0209673_1000003796 250
185 3300025273 Ga0209673_1039180 Ga0209673_10391802 250
186 3300025284 Ga0209130_1002823 Ga0209130_10028233 250
187 3300025291 Ga0209675_1000003 Ga0209675_1000003128 250
188 3300025291 Ga0209675_1000575 Ga0209675_10005755 250
189 3300025291 Ga0209675_1005135 Ga0209675_10051353 250
190 3300025292 Ga0209676_1000012 Ga0209676_1000012409 250
191 3300025294 Ga0209025_1000306 Ga0209025_100030651 250
192 3300025294 Ga0209025_1000849 Ga0209025_100084911 250
193 3300025294 Ga0209025_1001305 Ga0209025_10013054 250
194 3300025295 Ga0209564_1000249 Ga0209564_100024966 250
195 3300025295 Ga0209564_1001057 Ga0209564_10010574 250
196 3300025295 Ga0209564_1001073 Ga0209564_100107318 250
197 3300025295 Ga0209564_1001165 Ga0209564_10011658 250
198 3300025295 Ga0209564_1017440 Ga0209564_10174402 250
199 3300025297 Ga0209758_1016445 Ga0209758_10164453 250
200 3300025299 Ga0209256_1000029 Ga0209256_1000029297 250
201 3300025299 Ga0209256_1000059 Ga0209256_10000594 250
202 3300025302 Ga0207426_1000056 Ga0207426_1000056331 250
203 3300025303 Ga0209051_1035043 Ga0209051_10350431 250
204 3300025735 Ga0207713_1000124 Ga0207713_1000124118 250
205 3300025900 Ga0207710_10007152 Ga0207710_100071522 250
206 3300025900 Ga0207710_10036339 Ga0207710_100363392 250
207 3300025903 Ga0207680_10038045 Ga0207680_100380451 250
208 3300025903 Ga0207680_10178312 Ga0207680_101783122 250
209 3300025904 Ga0207647_10008949 Ga0207647_100089493 250
210 3300025904 Ga0207647_10013995 Ga0207647_100139953 250
211 3300025907 Ga0207645_10048400 Ga0207645_100484002 250
212 3300025907 Ga0207645_10115403 Ga0207645_101154032 250
213 3300025907 Ga0207645_10392006 Ga0207645_103920062 250
214 3300025909 Ga0207705_10000924 Ga0207705_1000092418 250
215 3300025911 Ga0207654_10001825 Ga0207654_100018257 250
216 3300025911 Ga0207654_10186501 Ga0207654_101865012 250
217 3300025911 Ga0207654_10268708 Ga0207654_102687082 250
218 3300025911 Ga0207654_10337887 Ga0207654_103378871 250
219 3300025913 Ga0207695_10028387 Ga0207695_100283873 250
220 3300025913 Ga0207695_10032306 Ga0207695_100323063 250
221 3300025913 Ga0207695_10122490 Ga0207695_101224902 250
222 3300025913 Ga0207695_10126350 Ga0207695_101263502 250
223 3300025913 Ga0207695_10128884 Ga0207695_101288842 250
224 3300025914 Ga0207671_10164066 Ga0207671_101640661 250
225 3300025914 Ga0207671_10392249 Ga0207671_103922492 250
226 3300025919 Ga0207657_10004042 Ga0207657_1000404214 250
227 3300025919 Ga0207657_10012912 Ga0207657_100129122 250
228 3300025919 Ga0207657_10024708 Ga0207657_100247083 250
229 3300025919 Ga0207657_10029802 Ga0207657_100298023 250
230 3300025920 Ga0207649_10009337 Ga0207649_100093373 250
231 3300025920 Ga0207649_10062807 Ga0207649_100628072 250
232 3300025927 Ga0207687_10786785 Ga0207687_107867851 250
233 3300025931 Ga0207644_10045251 Ga0207644_100452513 250
234 3300025931 Ga0207644_10153115 Ga0207644_101531152 250
235 3300025932 Ga0207690_10002125 Ga0207690_1000212511 250
236 3300025932 Ga0207690_10010469 Ga0207690_100104693 250
237 3300025934 Ga0207686_10036646 Ga0207686_100366463 250
238 3300025934 Ga0207686_10113620 Ga0207686_101136202 250
239 3300025934 Ga0207686_10266957 Ga0207686_102669572 250
240 3300025935 Ga0207709_10097382 Ga0207709_100973822 250
241 3300025938 Ga0207704_10064189 Ga0207704_100641893 250
242 3300025941 Ga0207711_10019515 Ga0207711_100195152 250
243 3300025941 Ga0207711_10050936 Ga0207711_100509362 250
244 3300025941 Ga0207711_10091955 Ga0207711_100919551 250
245 3300025942 Ga0207689_10048079 Ga0207689_100480792 250
246 3300025944 Ga0207661_10183095 Ga0207661_101830952 250
247 3300025945 Ga0207679_10000419 Ga0207679_100004196 250
248 3300025945 Ga0207679_10028455 Ga0207679_100284554 250
249 3300025945 Ga0207679_10084638 Ga0207679_100846382 250
250 3300025945 Ga0207679_10377955 Ga0207679_103779552 250
251 3300025949 Ga0207667_10007331 Ga0207667_100073318 250
252 3300025949 Ga0207667_10059330 Ga0207667_100593301 250
253 3300025949 Ga0207667_10432674 Ga0207667_104326742 250
254 3300025960 Ga0207651_10342207 Ga0207651_103422072 250
255 3300025961 Ga0207712_10081148 Ga0207712_100811482 250
256 3300025961 Ga0207712_10111610 Ga0207712_101116102 250
257 3300025981 Ga0207640_10176263 Ga0207640_101762632 250
258 3300025986 Ga0207658_10145089 Ga0207658_101450892 250
259 3300025986 Ga0207658_10176156 Ga0207658_101761562 250
260 3300025986 Ga0207658_10245539 Ga0207658_102455392 250
261 3300025986 Ga0207658_10319195 Ga0207658_103191952 250
262 3300025986 Ga0207658_10697709 Ga0207658_106977091 250
263 3300026035 Ga0207703_10002618 Ga0207703_100026186 250
264 3300026041 Ga0207639_10116247 Ga0207639_101162472 250
265 3300026041 Ga0207639_10312752 Ga0207639_103127521 250
266 3300026067 Ga0207678_10007448 Ga0207678_100074483 250
267 3300026067 Ga0207678_10076009 Ga0207678_100760092 250
268 3300026067 Ga0207678_10103641 Ga0207678_101036412 250
269 3300026078 Ga0207702_10825272 Ga0207702_108252721 250
270 3300026088 Ga0207641_10000880 Ga0207641_1000088020 250
271 3300026088 Ga0207641_10025099 Ga0207641_100250993 250
272 3300026089 Ga0207648_10123277 Ga0207648_101232772 250
273 3300026095 Ga0207676_10566164 Ga0207676_105661642 250
274 3300026116 Ga0207674_10032647 Ga0207674_100326476 250
275 3300026116 Ga0207674_10318130 Ga0207674_103181302 250
276 3300027666 Ga0209282_1000033 Ga0209282_1000033141 250
277 3300027866 Ga0209813_10008652 Ga0209813_100086523 250
278 3300027866 Ga0209813_10018405 Ga0209813_100184052 250
279 3300027876 Ga0209974_10001884 Ga0209974_100018843 250
280 3300028379 Ga0268266_10000709 Ga0268266_1000070912 250
281 3300028379 Ga0268266_10003171 Ga0268266_100031717 250
282 3300028379 Ga0268266_10034782 Ga0268266_100347823 250
283 3300028379 Ga0268266_10059371 Ga0268266_100593712 250
284 3300028379 Ga0268266_10116281 Ga0268266_101162812 250
285 3300028380 Ga0268265_10047171 Ga0268265_100471713 250
286 3300028381 Ga0268264_10000100 Ga0268264_1000010048 250
287 3300028381 Ga0268264_10173872 Ga0268264_101738722 250
288 3300028786 Ga0307517_10162912 Ga0307517_101629122 250
289 3300028794 Ga0307515_10085151 Ga0307515_100851512 250
290 3300030521 Ga0307511_10000052 Ga0307511_1000005275 250
291 3300030522 Ga0307512_10165448 Ga0307512_101654481 250
292 3300031456 Ga0307513_10046599 Ga0307513_100465992 250
293 3300031456 Ga0307513_10298653 Ga0307513_102986531 250
294 3300031507 Ga0307509_10029746 Ga0307509_100297463 250
295 3300031507 Ga0307509_10079950 Ga0307509_100799502 250
296 3300031616 Ga0307508_10067046 Ga0307508_100670462 250
297 3300031727 Ga0316576_10165766 Ga0316576_101657662 250
298 3300031730 Ga0307516_10013929 Ga0307516_100139293 250
299 3300031730 Ga0307516_10216646 Ga0307516_102166462 250
300 3300031733 Ga0316577_10018183 Ga0316577_100181832 250
301 3300031911 Ga0307412_10000010 Ga0307412_10000010102 250
302 3300031911 Ga0307412_10045965 Ga0307412_100459652 250
303 3300032137 Ga0316585_10023504 Ga0316585_100235042 250
304 3300033179 Ga0307507_10034168 Ga0307507_100341682 250
305 3300033179 Ga0307507_10214904 Ga0307507_102149042 250
306 3300033180 Ga0307510_10000001 Ga0307510_10000001306 250
307 3300035398 Ga0316574_0083285 Ga0316574_0083285_375_1133 250
308 3300036647 Ga0316582_0046141 Ga0316582_0046141_1623_2381 250
309 3300036712 Ga0316584_0002509 Ga0316584_0002509_9608_10366 250
310 3300037312 Ga0395899_0000019 Ga0395899_0000019_33704_34465 250
311 3300037312 Ga0395899_0004562 Ga0395899_0004562_1124_1879 250
312 3300037312 Ga0395899_0006365 Ga0395899_0006365_1681_2502 250
313 3300037418 Ga0395900_0000307 Ga0395900_0000307_65143_65964 250
314 3300037418 Ga0395900_0003711 Ga0395900_0003711_12985_13746 250
315 3300037418 Ga0395900_0060982 Ga0395900_0060982_1202_1957 250
316 3300037466 Ga0395898_0176730 Ga0395898_0176730_85_840 250
317 3300037471 Ga0395905_0000004 Ga0395905_0000004_582389_583141 250
318 3300037471 Ga0395905_0002221 Ga0395905_0002221_5978_6730 250
319 3300037471 Ga0395905_0247073 Ga0395905_0247073_746_1498 250
320 3300037471 Ga0395905_0534808 Ga0395905_0534808_111_872 250
321 3300038443 Ga0395901_0035147 Ga0395901_0035147_1564_2325 250
322 3300038443 Ga0395901_0061437 Ga0395901_0061437_1191_1946 250
323 3300038443 Ga0395901_0149380 Ga0395901_0149380_1336_2097 250
324 3300038443 Ga0395901_0185486 Ga0395901_0185486_1151_1912 250
325 3300041999 Ga0439433_0043792 Ga0439433_0043792_204_965 250
326 3300042005 Ga0439448_0001081 Ga0439448_0001081_1202_1963 250
327 3300042007 Ga0439449_0020912 Ga0439449_0020912_487_1248 250
328 3300042007 Ga0439449_0072318 Ga0439449_0072318_173_925 250
329 3300042012 Ga0439455_0000629 Ga0439455_0000629_3028_3789 250
330 3300042130 Ga0450892_002439 Ga0450892_002439_584_1336 250
331 3300042157 Ga0439458_0018965 Ga0439458_0018965_69_830 250
332 3300042157 Ga0439458_0020809 Ga0439458_0020809_453_1214 250
333 3300042461 Ga0439460_0014209 Ga0439460_0014209_247_1008 250
334 3300042531 Ga0450918_000439 Ga0450918_000439_2781_3533 250
335 3300044656 Ga0466969_0053435 Ga0466969_0053435_91_843 250
336 3300044658 Ga0466972_0000239 Ga0466972_0000239_17329_18084 250
337 3300044658 Ga0466972_0000923 Ga0466972_0000923_3980_4735 250
338 3300044658 Ga0466972_0121721 Ga0466972_0121721_299_1060 250
339 3300044683 Ga0466965_0000569 Ga0466965_0000569_8086_8841 250
340 3300044683 Ga0466965_0042031 Ga0466965_0042031_775_1527 250
341 3300044684 Ga0466966_0019835 Ga0466966_0019835_754_1506 250
342 3300044684 Ga0466966_0057593 Ga0466966_0057593_1474_2235 250
343 3300044684 Ga0466966_0105310 Ga0466966_0105310_966_1727 250
344 3300044693 Ga0466961_0010484 Ga0466961_0010484_4977_5729 250
345 3300044693 Ga0466961_0040036 Ga0466961_0040036_893_1645 250
346 3300044694 Ga0466963_0010691 Ga0466963_0010691_2088_2849 250
347 3300044706 Ga0466964_0002281 Ga0466964_0002281_5243_6004 250
348 3300044706 Ga0466964_0006746 Ga0466964_0006746_3475_4227 250
349 3300044706 Ga0466964_0008899 Ga0466964_0008899_1867_2622 250
350 3300044719 Ga0466971_0000213 Ga0466971_0000213_21242_21994 250
351 3300044719 Ga0466971_0087604 Ga0466971_0087604_470_1231 250
352 3300044735 Ga0466968_0003486 Ga0466968_0003486_3011_3766 250
353 3300044765 Ga0466970_0016928 Ga0466970_0016928_1004_1756 250
354 3300044765 Ga0466970_0091006 Ga0466970_0091006_299_1060 250
355 3300044842 Ga0466957_0000113 Ga0466957_0000113_29096_29857 250
356 3300044842 Ga0466957_0029523 Ga0466957_0029523_1206_1967 250
357 3300044842 Ga0466957_0055513 Ga0466957_0055513_1653_2405 250
358 3300044842 Ga0466957_0059856 Ga0466957_0059856_562_1323 250
359 3300044901 Ga0466960_0135256 Ga0466960_0135256_60_812 250
360 3300044901 Ga0466960_0246184 Ga0466960_0246184_113_874 250
361 3300045049 Ga0466959_0008404 Ga0466959_0008404_1963_2715 250
362 3300045049 Ga0466959_0035982 Ga0466959_0035982_757_1518 250
363 3300045049 Ga0466959_0049560 Ga0466959_0049560_478_1239 250
364 3300045049 Ga0466959_0071936 Ga0466959_0071936_709_1500 250
365 3300045049 Ga0466959_0170820 Ga0466959_0170820_747_1499 250
366 3300045836 Ga0466958_0020084 Ga0466958_0020084_1703_2494 250
367 3300045836 Ga0466958_0039156 Ga0466958_0039156_177_929 250
368 3300045836 Ga0466958_0098542 Ga0466958_0098542_949_1710 250
369 3300045976 Ga0466967_0014759 Ga0466967_0014759_104_865 250
370 3300045976 Ga0466967_0027604 Ga0466967_0027604_1152_1913 250
371 3300045976 Ga0466967_0062513 Ga0466967_0062513_2234_2995 250
372 3300046452 Ga0495617_000342 Ga0495617_000342_12725_13657 250
373 3300046452 Ga0495617_076074 Ga0495617_076074_66_827 250
374 3300046453 Ga0495627_002589 Ga0495627_002589_134_895 250
375 3300046454 Ga0495592_0003498 Ga0495592_0003498_6686_7453 250
376 3300046454 Ga0495592_0008815 Ga0495592_0008815_6666_7418 250
377 3300046454 Ga0495592_0031704 Ga0495592_0031704_1113_1865 250
378 3300046455 Ga0495603_0001914 Ga0495603_0001914_6418_7170 250
379 3300046455 Ga0495603_0007636 Ga0495603_0007636_226_978 250
380 3300046455 Ga0495603_0033035 Ga0495603_0033035_137_889 250
381 3300046457 Ga0495590_0003986 Ga0495590_0003986_3689_4441 250
382 3300046457 Ga0495590_0004269 Ga0495590_0004269_1163_1924 250
383 3300046457 Ga0495590_0011444 Ga0495590_0011444_891_1643 250
384 3300046457 Ga0495590_0017870 Ga0495590_0017870_1022_1783 250
385 3300046457 Ga0495590_0021871 Ga0495590_0021871_753_1514 250
386 3300046457 Ga0495590_0025985 Ga0495590_0025985_933_1685 250
387 3300046458 Ga0495591_002404 Ga0495591_002404_1803_2555 250
388 3300046458 Ga0495591_045260 Ga0495591_045260_241_993 250
389 3300046459 Ga0495629_0000033 Ga0495629_0000033_12399_13151 250
390 3300046459 Ga0495629_0001020 Ga0495629_0001020_13002_13754 250
391 3300046459 Ga0495629_0001234 Ga0495629_0001234_2729_3481 250
392 3300046459 Ga0495629_0008541 Ga0495629_0008541_1652_2404 250
393 3300046459 Ga0495629_0012940 Ga0495629_0012940_5212_5979 250
394 3300046460 Ga0495638_0004343 Ga0495638_0004343_5455_6216 250
395 3300046460 Ga0495638_0006259 Ga0495638_0006259_6247_6999 250
396 3300046460 Ga0495638_0012654 Ga0495638_0012654_1362_2123 250
397 3300046460 Ga0495638_0199344 Ga0495638_0199344_312_1073 250
398 3300046461 Ga0495641_0009288 Ga0495641_0009288_3464_4216 250
399 3300046461 Ga0495641_0036211 Ga0495641_0036211_324_1091 250
400 3300046462 Ga0495651_0006377 Ga0495651_0006377_6541_7293 250
401 3300046463 Ga0495653_0000163 Ga0495653_0000163_3043_3795 250
402 3300046463 Ga0495653_0013007 Ga0495653_0013007_1237_1989 250
403 3300046463 Ga0495653_0020177 Ga0495653_0020177_18_779 250
404 3300046463 Ga0495653_0055391 Ga0495653_0055391_887_1639 250
405 3300046463 Ga0495653_0137033 Ga0495653_0137033_854_1621 250
406 3300046463 Ga0495653_0157037 Ga0495653_0157037_410_1162 250
407 3300046471 Ga0495650_0000155 Ga0495650_0000155_147931_148683 250
408 3300046471 Ga0495650_0006449 Ga0495650_0006449_6231_6983 250
409 3300046471 Ga0495650_0022675 Ga0495650_0022675_172_924 250
410 3300046471 Ga0495650_0029157 Ga0495650_0029157_524_1291 250
411 3300046471 Ga0495650_0087945 Ga0495650_0087945_72_824 250
412 3300046472 Ga0495580_0000078 Ga0495580_0000078_12455_13207 250
413 3300046472 Ga0495580_0001384 Ga0495580_0001384_11994_12746 250
414 3300046472 Ga0495580_0002738 Ga0495580_0002738_5284_6036 250
415 3300046472 Ga0495580_0007507 Ga0495580_0007507_6149_6901 250
416 3300046472 Ga0495580_0040309 Ga0495580_0040309_1087_1839 250
417 3300046472 Ga0495580_0117201 Ga0495580_0117201_128_880 250
418 3300046473 Ga0495582_0002137 Ga0495582_0002137_10124_10876 250
419 3300046473 Ga0495582_0007917 Ga0495582_0007917_1397_2164 250
420 3300046473 Ga0495582_0023190 Ga0495582_0023190_69_821 250
421 3300046474 Ga0495605_0002835 Ga0495605_0002835_1076_1828 250
422 3300046474 Ga0495605_0004615 Ga0495605_0004615_6158_6910 250
423 3300046474 Ga0495605_0012807 Ga0495605_0012807_2523_3275 250
424 3300046474 Ga0495605_0119759 Ga0495605_0119759_392_1153 250
425 3300046474 Ga0495605_0159502 Ga0495605_0159502_54_806 250
426 3300046475 Ga0495639_0142702 Ga0495639_0142702_299_1060 250
427 3300046476 Ga0495662_0001701 Ga0495662_0001701_7564_8316 250
428 3300046476 Ga0495662_0006734 Ga0495662_0006734_2412_3164 250
429 3300046476 Ga0495662_0010105 Ga0495662_0010105_632_1384 250
430 3300046477 Ga0495664_0000125 Ga0495664_0000125_29342_30094 250
431 3300046477 Ga0495664_0005491 Ga0495664_0005491_5030_5815 250
432 3300046477 Ga0495664_0035696 Ga0495664_0035696_796_1563 250
433 3300046477 Ga0495664_0047412 Ga0495664_0047412_1245_1997 250
434 3300046491 Ga0495584_0000078 Ga0495584_0000078_4575_5336 250
435 3300046491 Ga0495584_0000835 Ga0495584_0000835_10625_11398 250
436 3300046491 Ga0495584_0017221 Ga0495584_0017221_826_1587 250
437 3300046491 Ga0495584_0022466 Ga0495584_0022466_658_1419 250
438 3300046491 Ga0495584_0044129 Ga0495584_0044129_852_1613 250
439 3300046491 Ga0495584_0057840 Ga0495584_0057840_309_1061 250
440 3300046491 Ga0495584_0064657 Ga0495584_0064657_648_1409 250
441 3300046491 Ga0495584_0091313 Ga0495584_0091313_602_1363 250
442 3300046491 Ga0495584_0112278 Ga0495584_0112278_134_895 250
443 3300046491 Ga0495584_0163525 Ga0495584_0163525_237_998 250
444 3300046492 Ga0495585_0000033 Ga0495585_0000033_37656_38417 250
445 3300046492 Ga0495585_0000042 Ga0495585_0000042_27333_28265 250
446 3300046492 Ga0495585_0000083 Ga0495585_0000083_18433_19194 250
447 3300046492 Ga0495585_0000799 Ga0495585_0000799_9527_10300 250
448 3300046492 Ga0495585_0003558 Ga0495585_0003558_7997_8758 250
449 3300046492 Ga0495585_0010937 Ga0495585_0010937_3504_4265 250
450 3300046492 Ga0495585_0020483 Ga0495585_0020483_2829_3590 250
451 3300046492 Ga0495585_0021068 Ga0495585_0021068_2483_3244 250
452 3300046492 Ga0495585_0022300 Ga0495585_0022300_456_1217 250
453 3300046492 Ga0495585_0040530 Ga0495585_0040530_56_808 250
454 3300046492 Ga0495585_0067225 Ga0495585_0067225_621_1382 250
455 3300046492 Ga0495585_0069218 Ga0495585_0069218_92_853 250
456 3300046492 Ga0495585_0114228 Ga0495585_0114228_322_1083 250
457 3300046499 Ga0495594_0050767 Ga0495594_0050767_126_878 250
458 3300046500 Ga0495596_0000221 Ga0495596_0000221_28960_29721 250
459 3300046500 Ga0495596_0001075 Ga0495596_0001075_14370_15122 250
460 3300046500 Ga0495596_0005011 Ga0495596_0005011_4349_5101 250
461 3300046500 Ga0495596_0006428 Ga0495596_0006428_1732_2493 250
462 3300046500 Ga0495596_0007677 Ga0495596_0007677_277_1038 250
463 3300046500 Ga0495596_0011365 Ga0495596_0011365_644_1396 250
464 3300046500 Ga0495596_0013231 Ga0495596_0013231_1000_1773 250
465 3300046500 Ga0495596_0028754 Ga0495596_0028754_721_1482 250
466 3300046500 Ga0495596_0150081 Ga0495596_0150081_30_797 250
467 3300046500 Ga0495596_0152794 Ga0495596_0152794_35_787 250
468 3300046501 Ga0495607_0000412 Ga0495607_0000412_29838_30659 250
469 3300046501 Ga0495607_0010217 Ga0495607_0010217_4413_5174 250
470 3300046501 Ga0495607_0014243 Ga0495607_0014243_2465_3226 250
471 3300046501 Ga0495607_0051049 Ga0495607_0051049_321_1082 250
472 3300046501 Ga0495607_0058149 Ga0495607_0058149_119_880 250
473 3300046501 Ga0495607_0064317 Ga0495607_0064317_386_1138 250
474 3300046501 Ga0495607_0109092 Ga0495607_0109092_539_1291 250
475 3300046501 Ga0495607_0115445 Ga0495607_0115445_414_1175 250
476 3300046506 Ga0495583_0000045 Ga0495583_0000045_36709_37470 250
477 3300046506 Ga0495583_0000263 Ga0495583_0000263_43939_44700 250
478 3300046506 Ga0495583_0000329 Ga0495583_0000329_64403_65164 250
479 3300046506 Ga0495583_0002504 Ga0495583_0002504_8229_8990 250
480 3300046506 Ga0495583_0004038 Ga0495583_0004038_3544_4305 250
481 3300046506 Ga0495583_0009832 Ga0495583_0009832_460_1212 250
482 3300046506 Ga0495583_0018472 Ga0495583_0018472_842_1594 250
483 3300046506 Ga0495583_0043569 Ga0495583_0043569_564_1325 250
484 3300046506 Ga0495583_0046636 Ga0495583_0046636_465_1226 250
485 3300046507 Ga0495606_0016983 Ga0495606_0016983_984_1736 250
486 3300046507 Ga0495606_0030427 Ga0495606_0030427_1012_1773 250
487 3300046507 Ga0495606_0037142 Ga0495606_0037142_646_1398 250
488 3300046507 Ga0495606_0112318 Ga0495606_0112318_235_996 250
489 3300046507 Ga0495606_0133158 Ga0495606_0133158_541_1308 250
490 3300046511 Ga0495608_0124466 Ga0495608_0124466_225_977 250
491 3300046512 Ga0495610_0000319 Ga0495610_0000319_17749_18501 250
492 3300046512 Ga0495610_0001240 Ga0495610_0001240_21176_21928 250
493 3300046513 Ga0495616_0000095 Ga0495616_0000095_47757_48518 250
494 3300046513 Ga0495616_0001821 Ga0495616_0001821_12056_12808 250
495 3300046513 Ga0495616_0002270 Ga0495616_0002270_9428_10189 250
496 3300046513 Ga0495616_0002596 Ga0495616_0002596_2733_3506 250
497 3300046513 Ga0495616_0009441 Ga0495616_0009441_128_889 250
498 3300046513 Ga0495616_0010973 Ga0495616_0010973_3796_4557 250
499 3300046513 Ga0495616_0013715 Ga0495616_0013715_1449_2270 250
500 3300046513 Ga0495616_0024567 Ga0495616_0024567_1458_2210 250
501 3300046513 Ga0495616_0025518 Ga0495616_0025518_527_1288 250
502 3300046513 Ga0495616_0036220 Ga0495616_0036220_1759_2520 250
503 3300046514 Ga0495618_0000437 Ga0495618_0000437_14219_14971 250
504 3300046514 Ga0495618_0005908 Ga0495618_0005908_843_1595 250
505 3300046514 Ga0495618_0006976 Ga0495618_0006976_3722_4489 250
506 3300046515 Ga0495620_0011138 Ga0495620_0011138_2444_3196 250
507 3300046515 Ga0495620_0065570 Ga0495620_0065570_245_1012 250
508 3300046516 Ga0495628_0002735 Ga0495628_0002735_11994_12746 250
509 3300046516 Ga0495628_0004068 Ga0495628_0004068_8871_9623 250
510 3300046516 Ga0495628_0027401 Ga0495628_0027401_2915_3667 250
511 3300046516 Ga0495628_0031631 Ga0495628_0031631_1160_1912 250
512 3300046516 Ga0495628_0053730 Ga0495628_0053730_1303_2070 250
513 3300046516 Ga0495628_0122314 Ga0495628_0122314_157_909 250
514 3300046517 Ga0495630_0000616 Ga0495630_0000616_7696_8448 250
515 3300046517 Ga0495630_0007378 Ga0495630_0007378_1173_1925 250
516 3300046517 Ga0495630_0042282 Ga0495630_0042282_1503_2255 250
517 3300046518 Ga0495631_0000501 Ga0495631_0000501_19551_20312 250
518 3300046518 Ga0495631_0041330 Ga0495631_0041330_738_1499 250
519 3300046518 Ga0495631_0097067 Ga0495631_0097067_405_1166 250
520 3300046518 Ga0495631_0107480 Ga0495631_0107480_422_1183 250
521 3300046519 Ga0495632_0000474 Ga0495632_0000474_30894_31655 250
522 3300046519 Ga0495632_0013290 Ga0495632_0013290_1206_1967 250
523 3300046519 Ga0495632_0039687 Ga0495632_0039687_1138_1890 250
524 3300046519 Ga0495632_0203678 Ga0495632_0203678_116_877 250
525 3300046520 Ga0495637_0024074 Ga0495637_0024074_787_1548 250
526 3300046522 Ga0495643_0000507 Ga0495643_0000507_4669_5430 250
527 3300046522 Ga0495643_0049393 Ga0495643_0049393_1231_2052 250
528 3300046522 Ga0495643_0060087 Ga0495643_0060087_76_837 250
529 3300046522 Ga0495643_0090898 Ga0495643_0090898_260_1021 250
530 3300046522 Ga0495643_0201323 Ga0495643_0201323_105_857 250
531 3300046523 Ga0495644_0000129 Ga0495644_0000129_9136_9897 250
532 3300046523 Ga0495644_0000547 Ga0495644_0000547_13141_13902 250
533 3300046523 Ga0495644_0007632 Ga0495644_0007632_788_1549 250
534 3300046523 Ga0495644_0091051 Ga0495644_0091051_131_892 250
535 3300046523 Ga0495644_0146276 Ga0495644_0146276_41_802 250
536 3300046524 Ga0495648_0000052 Ga0495648_0000052_27333_28265 250
537 3300046524 Ga0495648_0000613 Ga0495648_0000613_30127_30888 250
538 3300046524 Ga0495648_0004038 Ga0495648_0004038_589_1341 250
539 3300046524 Ga0495648_0018499 Ga0495648_0018499_490_1251 250
540 3300046524 Ga0495648_0019856 Ga0495648_0019856_2785_3537 250
541 3300046524 Ga0495648_0022982 Ga0495648_0022982_2851_3612 250
542 3300046524 Ga0495648_0028068 Ga0495648_0028068_1033_1785 250
543 3300046524 Ga0495648_0053931 Ga0495648_0053931_313_1074 250
544 3300046524 Ga0495648_0055376 Ga0495648_0055376_549_1301 250
545 3300046524 Ga0495648_0090244 Ga0495648_0090244_159_920 250
546 3300046525 Ga0495663_0052013 Ga0495663_0052013_328_1089 250
547 3300046525 Ga0495663_0074510 Ga0495663_0074510_187_948 250
548 3300046526 Ga0495666_0000056 Ga0495666_0000056_12806_13558 250
549 3300046526 Ga0495666_0004051 Ga0495666_0004051_5004_5756 250
550 3300046526 Ga0495666_0013556 Ga0495666_0013556_2355_3107 250
551 3300046526 Ga0495666_0026056 Ga0495666_0026056_593_1345 250
552 3300046526 Ga0495666_0026422 Ga0495666_0026422_1302_2123 250
553 3300046528 Ga0495642_0000280 Ga0495642_0000280_6666_7427 250
554 3300046528 Ga0495642_0001004 Ga0495642_0001004_5668_6420 250
555 3300046528 Ga0495642_0001955 Ga0495642_0001955_1414_2235 250
556 3300046528 Ga0495642_0010706 Ga0495642_0010706_1778_2539 250
557 3300046528 Ga0495642_0024555 Ga0495642_0024555_370_1122 250
558 3300046528 Ga0495642_0044843 Ga0495642_0044843_961_1713 250
559 3300046528 Ga0495642_0050377 Ga0495642_0050377_320_1081 250
560 3300046529 Ga0495652_0003187 Ga0495652_0003187_12570_13322 250
561 3300046529 Ga0495652_0012065 Ga0495652_0012065_6072_6839 250
562 3300046529 Ga0495652_0288818 Ga0495652_0288818_294_1046 250
563 3300046530 Ga0495654_0031080 Ga0495654_0031080_1227_1979 250
564 3300046530 Ga0495654_0075835 Ga0495654_0075835_454_1215 250
565 3300046531 Ga0495665_0000980 Ga0495665_0000980_12606_13358 250
566 3300046531 Ga0495665_0015997 Ga0495665_0015997_1746_2498 250
567 3300046531 Ga0495665_0019144 Ga0495665_0019144_1085_1837 250
568 3300046531 Ga0495665_0058742 Ga0495665_0058742_1244_1996 250
569 3300046533 Ga0495640_0001085 Ga0495640_0001085_15513_16265 250
570 3300046533 Ga0495640_0036662 Ga0495640_0036662_1397_2164 250
571 3300046533 Ga0495640_0092345 Ga0495640_0092345_658_1410 250
572 3300046535 Ga0495586_0000574 Ga0495586_0000574_7751_8503 250
573 3300046535 Ga0495586_0039585 Ga0495586_0039585_658_1425 250
574 3300046535 Ga0495586_0149523 Ga0495586_0149523_489_1274 250
575 3300046536 Ga0495587_0000278 Ga0495587_0000278_17022_17774 250
576 3300046536 Ga0495587_0010663 Ga0495587_0010663_1633_2385 250
577 3300046536 Ga0495587_0034067 Ga0495587_0034067_1236_1997 250
578 3300046536 Ga0495587_0062156 Ga0495587_0062156_859_1620 250
579 3300046538 Ga0495609_0000084 Ga0495609_0000084_106020_106781 250
580 3300046538 Ga0495609_0000086 Ga0495609_0000086_6339_7160 250
581 3300046538 Ga0495609_0000523 Ga0495609_0000523_9372_10133 250
582 3300046538 Ga0495609_0001293 Ga0495609_0001293_13835_14596 250
583 3300046538 Ga0495609_0002353 Ga0495609_0002353_9932_10684 250
584 3300046538 Ga0495609_0016137 Ga0495609_0016137_115_876 250
585 3300046538 Ga0495609_0024913 Ga0495609_0024913_1546_2307 250
586 3300046538 Ga0495609_0024995 Ga0495609_0024995_1196_1957 250
587 3300046538 Ga0495609_0025935 Ga0495609_0025935_433_1194 250
588 3300046538 Ga0495609_0055980 Ga0495609_0055980_751_1512 250
589 3300046538 Ga0495609_0057638 Ga0495609_0057638_255_1007 250
590 3300046539 Ga0495621_0051400 Ga0495621_0051400_618_1370 250
591 3300046542 Ga0495597_0001484 Ga0495597_0001484_10993_11754 250
592 3300046542 Ga0495597_0003591 Ga0495597_0003591_5408_6169 250
593 3300046542 Ga0495597_0005881 Ga0495597_0005881_2665_3426 250
594 3300046542 Ga0495597_0009675 Ga0495597_0009675_1244_2005 250
595 3300046542 Ga0495597_0012276 Ga0495597_0012276_629_1381 250
596 3300046542 Ga0495597_0024955 Ga0495597_0024955_1877_2638 250
597 3300046542 Ga0495597_0058540 Ga0495597_0058540_712_1464 250
598 3300046542 Ga0495597_0064337 Ga0495597_0064337_431_1183 250
599 3300046543 Ga0495645_0000102 Ga0495645_0000102_8566_9318 250
600 3300046543 Ga0495645_0005699 Ga0495645_0005699_5633_6424 250
601 3300046557 Ga0495622_0000096 Ga0495622_0000096_29964_30716 250
602 3300046557 Ga0495622_0002367 Ga0495622_0002367_2304_3056 250
603 3300046557 Ga0495622_0086886 Ga0495622_0086886_650_1411 250
604 3300046557 Ga0495622_0179295 Ga0495622_0179295_10_771 250
605 3300046558 Ga0495633_0000419 Ga0495633_0000419_30137_30898 250
606 3300046558 Ga0495633_0028794 Ga0495633_0028794_738_1499 250
607 3300046558 Ga0495633_0034790 Ga0495633_0034790_1504_2265 250
608 3300046558 Ga0495633_0034969 Ga0495633_0034969_1438_2199 250
609 3300046558 Ga0495633_0155815 Ga0495633_0155815_133_894 250
610 3300046559 Ga0495667_0110899 Ga0495667_0110899_886_1638 250
611 3300046559 Ga0495667_0162103 Ga0495667_0162103_420_1172 250
612 3300046615 Ga0495656_0002760 Ga0495656_0002760_2788_3549 250
613 3300046615 Ga0495656_0035727 Ga0495656_0035727_751_1512 250
614 3300046615 Ga0495656_0262803 Ga0495656_0262803_109_861 250
615 3300046615 Ga0495656_0286902 Ga0495656_0286902_59_820 250
616 3300046616 Ga0495668_0000006 Ga0495668_0000006_188975_189736 250
617 3300046616 Ga0495668_0000318 Ga0495668_0000318_31687_32448 250
618 3300046616 Ga0495668_0000837 Ga0495668_0000837_7412_8176 250
619 3300046616 Ga0495668_0013952 Ga0495668_0013952_2463_3224 250
620 3300046616 Ga0495668_0068444 Ga0495668_0068444_421_1173 250
621 3300046616 Ga0495668_0192291 Ga0495668_0192291_340_1101 250
622 3300046642 Ga0495634_0000734 Ga0495634_0000734_14492_15244 250
623 3300046642 Ga0495634_0011044 Ga0495634_0011044_3834_4601 250
624 3300046642 Ga0495634_0063797 Ga0495634_0063797_1256_2008 250
625 3300046648 Ga0495611_0001587 Ga0495611_0001587_2993_3754 250
626 3300046648 Ga0495611_0002984 Ga0495611_0002984_122_883 250
627 3300046648 Ga0495611_0010445 Ga0495611_0010445_678_1430 250
628 3300046648 Ga0495611_0128327 Ga0495611_0128327_280_1041 250
629 3300046660 Ga0495625_0013356 Ga0495625_0013356_292_1053 250
630 3300046660 Ga0495625_0013643 Ga0495625_0013643_1121_1882 250
631 3300046660 Ga0495625_0025411 Ga0495625_0025411_2010_2771 250
632 3300046660 Ga0495625_0026963 Ga0495625_0026963_722_1483 250
633 3300046660 Ga0495625_0031048 Ga0495625_0031048_2414_3175 250
634 3300046660 Ga0495625_0047410 Ga0495625_0047410_130_882 250
635 3300046660 Ga0495625_0133625 Ga0495625_0133625_11_763 250
636 3300046663 Ga0495635_0000411 Ga0495635_0000411_20401_21153 250
637 3300046663 Ga0495635_0001238 Ga0495635_0001238_14625_15377 250
638 3300046663 Ga0495635_0018560 Ga0495635_0018560_245_1012 250
639 3300046664 Ga0495659_0000067 Ga0495659_0000067_1747_2508 250
640 3300046664 Ga0495659_0026620 Ga0495659_0026620_481_1242 250
641 3300046665 Ga0495661_0000678 Ga0495661_0000678_2939_3691 250
642 3300046665 Ga0495661_0000724 Ga0495661_0000724_6339_7160 250
643 3300046665 Ga0495661_0001495 Ga0495661_0001495_6931_7692 250
644 3300046665 Ga0495661_0010853 Ga0495661_0010853_3111_3872 250
645 3300046665 Ga0495661_0015010 Ga0495661_0015010_2342_3094 250
646 3300046665 Ga0495661_0016574 Ga0495661_0016574_903_1655 250
647 3300046665 Ga0495661_0019315 Ga0495661_0019315_1238_1999 250
648 3300046665 Ga0495661_0019969 Ga0495661_0019969_1192_1953 250
649 3300046665 Ga0495661_0042775 Ga0495661_0042775_272_1033 250
650 3300046665 Ga0495661_0045273 Ga0495661_0045273_167_919 250
651 3300046665 Ga0495661_0046502 Ga0495661_0046502_1285_2046 250
652 3300046674 Ga0495588_0015540 Ga0495588_0015540_2374_3135 250
653 3300046674 Ga0495588_0048307 Ga0495588_0048307_447_1199 250
654 3300046674 Ga0495588_0136021 Ga0495588_0136021_32_784 250
655 3300046675 Ga0495657_0149423 Ga0495657_0149423_74_826 250
656 3300046675 Ga0495657_0159533 Ga0495657_0159533_29_781 250
657 3300046678 Ga0495599_0000347 Ga0495599_0000347_1906_2658 250
658 3300046678 Ga0495599_0011345 Ga0495599_0011345_23_775 250
659 3300046678 Ga0495599_0124976 Ga0495599_0124976_276_1043 250
660 3300046679 Ga0495623_0003228 Ga0495623_0003228_6988_7740 250
661 3300046679 Ga0495623_0004602 Ga0495623_0004602_1750_2502 250
662 3300046679 Ga0495623_0006337 Ga0495623_0006337_3436_4188 250
663 3300046679 Ga0495623_0013177 Ga0495623_0013177_4552_5319 250
664 3300046680 Ga0495646_0007318 Ga0495646_0007318_3943_4695 250
665 3300046680 Ga0495646_0024211 Ga0495646_0024211_2249_3016 250
666 3300046680 Ga0495646_0047086 Ga0495646_0047086_1777_2529 250
667 3300046680 Ga0495646_0047621 Ga0495646_0047621_1734_2486 250
668 3300046680 Ga0495646_0157506 Ga0495646_0157506_117_902 250
669 3300046680 Ga0495646_0235552 Ga0495646_0235552_212_964 250
670 3300046680 Ga0495646_0273480 Ga0495646_0273480_55_816 250
671 3300046683 Ga0495658_0015626 Ga0495658_0015626_402_1154 250
672 3300046684 Ga0495669_0000289 Ga0495669_0000289_21552_22313 250
673 3300046684 Ga0495669_0012260 Ga0495669_0012260_1899_2660 250
674 3300046684 Ga0495669_0043456 Ga0495669_0043456_1081_1842 250
675 3300046684 Ga0495669_0068267 Ga0495669_0068267_642_1394 250
676 3300046684 Ga0495669_0118201 Ga0495669_0118201_376_1128 250
677 3300046689 Ga0495613_0001584 Ga0495613_0001584_14737_15489 250
678 3300046689 Ga0495613_0006361 Ga0495613_0006361_608_1360 250
679 3300046689 Ga0495613_0144402 Ga0495613_0144402_619_1386 250
680 3300046690 Ga0495624_0000076 Ga0495624_0000076_12402_13154 250
681 3300046690 Ga0495624_0016366 Ga0495624_0016366_3276_4028 250
682 3300046690 Ga0495624_0028857 Ga0495624_0028857_2644_3396 250
683 3300046690 Ga0495624_0036014 Ga0495624_0036014_1678_2430 250
684 3300046690 Ga0495624_0088732 Ga0495624_0088732_573_1325 250
685 3300046691 Ga0495670_0001180 Ga0495670_0001180_9527_10288 250
686 3300046691 Ga0495670_0005499 Ga0495670_0005499_4120_4881 250
687 3300046691 Ga0495670_0016059 Ga0495670_0016059_2439_3200 250
688 3300046691 Ga0495670_0020349 Ga0495670_0020349_2328_3089 250
689 3300046691 Ga0495670_0043622 Ga0495670_0043622_1129_1890 250
690 3300046691 Ga0495670_0046568 Ga0495670_0046568_567_1319 250
691 3300046691 Ga0495670_0048679 Ga0495670_0048679_1078_1842 250
692 3300046691 Ga0495670_0069041 Ga0495670_0069041_263_1024 250
693 3300046692 Ga0495671_0001298 Ga0495671_0001298_14365_15117 250
694 3300046692 Ga0495671_0001356 Ga0495671_0001356_2375_3136 250
695 3300046692 Ga0495671_0005385 Ga0495671_0005385_6300_7052 250
696 3300046692 Ga0495671_0020495 Ga0495671_0020495_1335_2087 250
697 3300046692 Ga0495671_0044483 Ga0495671_0044483_151_903 250
698 3300046692 Ga0495671_0055024 Ga0495671_0055024_90_851 250
699 3300046692 Ga0495671_0094013 Ga0495671_0094013_693_1445 250
700 3300046692 Ga0495671_0100391 Ga0495671_0100391_15_776 250
701 3300046694 Ga0495649_0002701 Ga0495649_0002701_6958_7725 250
702 3300046694 Ga0495649_0005801 Ga0495649_0005801_2539_3291 250
703 3300046694 Ga0495649_0009705 Ga0495649_0009705_1089_1841 250
704 3300046694 Ga0495649_0019321 Ga0495649_0019321_2146_2898 250
705 3300046694 Ga0495649_0027997 Ga0495649_0027997_1657_2409 250
706 3300046794 Ga0495589_0000055 Ga0495589_0000055_103728_104549 250
707 3300046794 Ga0495589_0000407 Ga0495589_0000407_12770_13531 250
708 3300046794 Ga0495589_0003986 Ga0495589_0003986_1882_2634 250
709 3300046794 Ga0495589_0004864 Ga0495589_0004864_4834_5595 250
710 3300046794 Ga0495589_0006446 Ga0495589_0006446_4675_5427 250
711 3300046794 Ga0495589_0010283 Ga0495589_0010283_2269_3021 250
712 3300046794 Ga0495589_0027454 Ga0495589_0027454_1542_2294 250
713 3300046794 Ga0495589_0055688 Ga0495589_0055688_435_1202 250
714 3300046809 Ga0495600_0000886 Ga0495600_0000886_11512_12279 250
715 3300046809 Ga0495600_0001111 Ga0495600_0001111_5084_5836 250
716 3300046809 Ga0495600_0008504 Ga0495600_0008504_4113_4865 250
717 3300046809 Ga0495600_0030826 Ga0495600_0030826_1092_1844 250
718 3300046810 Ga0495660_0043958 Ga0495660_0043958_979_1731 250
719 3300046810 Ga0495660_0093366 Ga0495660_0093366_490_1251 250
720 3300047315 Ga0495581_0000420 Ga0495581_0000420_17132_17884 250
721 3300047315 Ga0495581_0000863 Ga0495581_0000863_1715_2467 250
722 3300047315 Ga0495581_0002438 Ga0495581_0002438_7767_8519 250
723 3300047315 Ga0495581_0002610 Ga0495581_0002610_409_1176 250
724 3300047317 Ga0495604_0000500 Ga0495604_0000500_13059_13811 250
725 3300047317 Ga0495604_0000727 Ga0495604_0000727_17228_17980 250
726 3300047317 Ga0495604_0018721 Ga0495604_0018721_261_1013 250
727 3300047317 Ga0495604_0057340 Ga0495604_0057340_1167_1988 250
728 3300047317 Ga0495604_0072703 Ga0495604_0072703_997_1749 250
729 3300047317 Ga0495604_0174191 Ga0495604_0174191_634_1395 250
730 3300047318 Ga0495636_0019464 Ga0495636_0019464_1034_1795 250
731 3300047318 Ga0495636_0033617 Ga0495636_0033617_1219_1980 250
732 3300047318 Ga0495636_0085937 Ga0495636_0085937_467_1249 250
733 3300047318 Ga0495636_0122699 Ga0495636_0122699_363_1124 250
734 3300047319 Ga0495674_0001156 Ga0495674_0001156_12683_13435 250
735 3300047319 Ga0495674_0001927 Ga0495674_0001927_2354_3106 250
736 3300047319 Ga0495674_0002849 Ga0495674_0002849_14546_15298 250
737 3300047319 Ga0495674_0003908 Ga0495674_0003908_7659_8411 250
738 3300047319 Ga0495674_0008266 Ga0495674_0008266_8162_8914 250
739 3300047319 Ga0495674_0056987 Ga0495674_0056987_1438_2205 250
740 3300047319 Ga0495674_0172083 Ga0495674_0172083_964_1716 250
741 3300047319 Ga0495674_0233606 Ga0495674_0233606_308_1060 250
742 3300047320 Ga0495672_0000063 Ga0495672_0000063_40158_40943 250
743 3300047320 Ga0495672_0005166 Ga0495672_0005166_4166_4918 250
744 3300047320 Ga0495672_0005304 Ga0495672_0005304_3108_3860 250
745 3300047320 Ga0495672_0011948 Ga0495672_0011948_3957_4718 250
746 3300047320 Ga0495672_0027131 Ga0495672_0027131_1348_2109 250
747 3300047320 Ga0495672_0028146 Ga0495672_0028146_2600_3352 250
748 3300047320 Ga0495672_0059826 Ga0495672_0059826_1036_1788 250
749 3300047321 Ga0495676_0003759 Ga0495676_0003759_12334_13086 250
750 3300047321 Ga0495676_0009257 Ga0495676_0009257_6518_7270 250
751 3300047321 Ga0495676_0105207 Ga0495676_0105207_637_1389 250
752 3300047322 Ga0495680_0000564 Ga0495680_0000564_28323_29075 250
753 3300047322 Ga0495680_0005336 Ga0495680_0005336_9925_10686 250
754 3300047322 Ga0495680_0025785 Ga0495680_0025785_2844_3596 250
755 3300047322 Ga0495680_0094919 Ga0495680_0094919_1087_1839 250
756 3300047322 Ga0495680_0276161 Ga0495680_0276161_318_1070 250
757 3300047323 Ga0495683_0000255 Ga0495683_0000255_8409_9182 250
758 3300047323 Ga0495683_0000522 Ga0495683_0000522_25440_26192 250
759 3300047323 Ga0495683_0001194 Ga0495683_0001194_4152_4919 250
760 3300047323 Ga0495683_0009216 Ga0495683_0009216_1639_2400 250
761 3300047323 Ga0495683_0009768 Ga0495683_0009768_17_784 250
762 3300047323 Ga0495683_0015651 Ga0495683_0015651_2610_3371 250
763 3300047323 Ga0495683_0019368 Ga0495683_0019368_284_1036 250
764 3300047323 Ga0495683_0028028 Ga0495683_0028028_1268_2020 250
765 3300047323 Ga0495683_0096462 Ga0495683_0096462_58_810 250
766 3300047323 Ga0495683_0200155 Ga0495683_0200155_115_876 250
767 3300047443 Ga0495687_000029 Ga0495687_000029_28660_29412 250
768 3300047443 Ga0495687_000139 Ga0495687_000139_6339_7160 250
769 3300047443 Ga0495687_000156 Ga0495687_000156_94629_95390 250
770 3300047443 Ga0495687_000253 Ga0495687_000253_24851_25612 250
771 3300047443 Ga0495687_000628 Ga0495687_000628_2550_3302 250
772 3300047443 Ga0495687_000656 Ga0495687_000656_31010_31771 250
773 3300047443 Ga0495687_002896 Ga0495687_002896_2017_2769 250
774 3300047443 Ga0495687_009196 Ga0495687_009196_1881_2633 250
775 3300047443 Ga0495687_019779 Ga0495687_019779_2027_2779 250
776 3300047443 Ga0495687_071523 Ga0495687_071523_87_854 250
777 3300047444 Ga0495675_0002809 Ga0495675_0002809_663_1430 250
778 3300047444 Ga0495675_0003731 Ga0495675_0003731_861_1613 250
779 3300047444 Ga0495675_0006111 Ga0495675_0006111_1743_2495 250
780 3300047444 Ga0495675_0047314 Ga0495675_0047314_287_1039 250
781 3300047445 Ga0495677_0000147 Ga0495677_0000147_25387_26208 250
782 3300047445 Ga0495677_0001429 Ga0495677_0001429_6940_7701 250
783 3300047445 Ga0495677_0014535 Ga0495677_0014535_940_1701 250
784 3300047445 Ga0495677_0044060 Ga0495677_0044060_194_955 250
785 3300047445 Ga0495677_0072535 Ga0495677_0072535_285_1046 250
786 3300047446 Ga0495679_000030 Ga0495679_000030_108615_109367 250
787 3300047446 Ga0495679_000860 Ga0495679_000860_6522_7283 250
788 3300047446 Ga0495679_001668 Ga0495679_001668_9820_10572 250
789 3300047446 Ga0495679_013966 Ga0495679_013966_1488_2252 250
790 3300047446 Ga0495679_017294 Ga0495679_017294_1748_2500 250
791 3300047447 Ga0495685_000228 Ga0495685_000228_16000_16761 250
792 3300047447 Ga0495685_011438 Ga0495685_011438_2025_2786 250
793 3300047447 Ga0495685_034202 Ga0495685_034202_15_776 250
794 3300047447 Ga0495685_054317 Ga0495685_054317_428_1180 250
795 3300047447 Ga0495685_064622 Ga0495685_064622_401_1153 250
796 3300047447 Ga0495685_079856 Ga0495685_079856_11_817 250
797 3300047469 Ga0495673_0000159 Ga0495673_0000159_64359_65120 250
798 3300047469 Ga0495673_0006642 Ga0495673_0006642_5099_5860 250
799 3300047469 Ga0495673_0008761 Ga0495673_0008761_3718_4479 250
800 3300047469 Ga0495673_0032424 Ga0495673_0032424_615_1367 250
801 3300047470 Ga0495681_0024032 Ga0495681_0024032_1609_2370 250
802 3300047470 Ga0495681_0042758 Ga0495681_0042758_389_1150 250
803 3300047470 Ga0495681_0045374 Ga0495681_0045374_1179_1940 250
804 3300047470 Ga0495681_0045586 Ga0495681_0045586_237_998 250
805 3300047470 Ga0495681_0059603 Ga0495681_0059603_391_1152 250
806 3300047470 Ga0495681_0077346 Ga0495681_0077346_341_1102 250
807 3300047471 Ga0495684_0052171 Ga0495684_0052171_1606_2358 250
808 3300047472 Ga0495686_0000048 Ga0495686_0000048_29999_30751 250
809 3300047472 Ga0495686_0002450 Ga0495686_0002450_4992_5753 250
810 3300047472 Ga0495686_0010615 Ga0495686_0010615_4775_5527 250
811 3300047673 Ga0495593_0000152 Ga0495593_0000152_4342_5094 250
812 3300047673 Ga0495593_0011370 Ga0495593_0011370_2705_3457 250
813 3300047673 Ga0495593_0024854 Ga0495593_0024854_1304_2056 250
814 3300047673 Ga0495593_0025362 Ga0495593_0025362_1216_1983 250
815 3300047673 Ga0495593_0030957 Ga0495593_0030957_1718_2470 250
816 3300048088 Ga0495602_0000904 Ga0495602_0000904_15228_15980 250
817 3300048088 Ga0495602_0006978 Ga0495602_0006978_7301_8053 250
818 3300048088 Ga0495602_0094369 Ga0495602_0094369_583_1350 250
819 3300048088 Ga0495602_0148376 Ga0495602_0148376_624_1391 250
820 3300048089 Ga0495614_0000446 Ga0495614_0000446_1743_2495 250
821 3300048089 Ga0495614_0002458 Ga0495614_0002458_3130_3897 250
822 3300048089 Ga0495614_0005850 Ga0495614_0005850_3039_3791 250
823 3300048089 Ga0495614_0048170 Ga0495614_0048170_173_925 250
824 3300048091 Ga0495626_0023493 Ga0495626_0023493_247_999 250
825 3300048091 Ga0495626_0049160 Ga0495626_0049160_1040_1801 250
826 3300048091 Ga0495626_0055052 Ga0495626_0055052_548_1309 250
827 3300048903 Ga0496100_0003923 Ga0496100_0003923_70_822 250
828 3300048903 Ga0496100_0033770 Ga0496100_0033770_1134_1895 250
829 3300048903 Ga0496100_0063417 Ga0496100_0063417_502_1254 250
830 3300048903 Ga0496100_0079671 Ga0496100_0079671_850_1605 250
831 3300048903 Ga0496100_0107755 Ga0496100_0107755_580_1341 250
832 3300048904 Ga0496101_0001193 Ga0496101_0001193_14530_15282 250
833 3300048904 Ga0496101_0031557 Ga0496101_0031557_1146_1898 250
834 3300048904 Ga0496101_0129164 Ga0496101_0129164_1086_1838 250
835 3300048904 Ga0496101_0222059 Ga0496101_0222059_546_1307 250
836 3300048904 Ga0496101_0471086 Ga0496101_0471086_28_789 250
837 3300048905 Ga0496102_0000082 Ga0496102_0000082_32532_33317 250
838 3300048905 Ga0496102_0000548 Ga0496102_0000548_13688_14440 250
839 3300048905 Ga0496102_0001919 Ga0496102_0001919_290_1042 250
840 3300048905 Ga0496102_0004818 Ga0496102_0004818_9646_10398 250
841 3300048905 Ga0496102_0020777 Ga0496102_0020777_2512_3264 250
842 3300048905 Ga0496102_0022296 Ga0496102_0022296_525_1331 250
843 3300048905 Ga0496102_0035297 Ga0496102_0035297_1710_2462 250
844 3300048905 Ga0496102_0261020 Ga0496102_0261020_702_1553 250
845 3300048905 Ga0496102_0288143 Ga0496102_0288143_353_1105 250
846 3300048905 Ga0496102_0374190 Ga0496102_0374190_440_1201 250
847 3300048906 Ga0496103_0000701 Ga0496103_0000701_10602_11354 250
848 3300048906 Ga0496103_0047033 Ga0496103_0047033_660_1421 250
849 3300048906 Ga0496103_0065817 Ga0496103_0065817_785_1537 250
850 3300048906 Ga0496103_0082753 Ga0496103_0082753_44_895 250
851 3300048906 Ga0496103_0092396 Ga0496103_0092396_475_1227 250
852 3300048907 Ga0496104_0012925 Ga0496104_0012925_6176_6928 250
853 3300048907 Ga0496104_0069023 Ga0496104_0069023_49_801 250
854 3300048907 Ga0496104_0471545 Ga0496104_0471545_91_843 250
855 3300048908 Ga0496105_0125122 Ga0496105_0125122_119_871 250
856 3300048908 Ga0496105_0175343 Ga0496105_0175343_241_993 250
857 3300048909 Ga0496106_0047489 Ga0496106_0047489_1034_1786 250
858 3300048909 Ga0496106_0065102 Ga0496106_0065102_1316_2068 250
859 3300048909 Ga0496106_0104295 Ga0496106_0104295_284_1036 250
860 3300048910 Ga0496107_0043650 Ga0496107_0043650_2186_2938 250
861 3300048910 Ga0496107_0055430 Ga0496107_0055430_636_1388 250
862 3300048910 Ga0496107_0067890 Ga0496107_0067890_1596_2357 250
863 3300048910 Ga0496107_0077024 Ga0496107_0077024_1361_2122 250
864 3300048910 Ga0496107_0114739 Ga0496107_0114739_655_1407 250
865 3300048911 Ga0496108_0199491 Ga0496108_0199491_873_1625 250
866 3300048911 Ga0496108_0316283 Ga0496108_0316283_116_877 250
867 3300048911 Ga0496108_0778498 Ga0496108_0778498_45_797 250
868 3300048912 Ga0496109_0140653 Ga0496109_0140653_1006_1758 250
869 3300048912 Ga0496109_0188887 Ga0496109_0188887_647_1408 250
870 3300048912 Ga0496109_0203718 Ga0496109_0203718_921_1673 250
871 3300048913 Ga0496110_0226429 Ga0496110_0226429_759_1511 250
872 3300048913 Ga0496110_0231164 Ga0496110_0231164_342_1103 250
873 3300048913 Ga0496110_0254664 Ga0496110_0254664_530_1282 250
874 3300048915 Ga0496112_0009672 Ga0496112_0009672_2459_3211 250
875 3300048915 Ga0496112_0218854 Ga0496112_0218854_203_955 250
876 3300048915 Ga0496112_0548199 Ga0496112_0548199_251_1003 250
877 3300048916 Ga0496113_0007071 Ga0496113_0007071_1272_2024 250
878 3300048916 Ga0496113_0009759 Ga0496113_0009759_3038_3799 250
879 3300048916 Ga0496113_0010371 Ga0496113_0010371_4613_5434 250
880 3300048916 Ga0496113_0073169 Ga0496113_0073169_220_972 250
881 3300048917 Ga0496114_0001294 Ga0496114_0001294_13950_14702 250
882 3300048917 Ga0496114_0066361 Ga0496114_0066361_1497_2249 250
883 3300048917 Ga0496114_0831642 Ga0496114_0831642_28_789 250
884 3300048918 Ga0496115_0020182 Ga0496115_0020182_4289_5050 250
885 3300048918 Ga0496115_0074630 Ga0496115_0074630_1611_2372 250
886 3300048919 Ga0496116_0002350 Ga0496116_0002350_17483_18235 250
887 3300048919 Ga0496116_0002865 Ga0496116_0002865_12810_13562 250
888 3300048919 Ga0496116_0029737 Ga0496116_0029737_1861_2613 250
889 3300048919 Ga0496116_0029922 Ga0496116_0029922_1020_1772 250
890 3300048920 Ga0496117_0000035 Ga0496117_0000035_211466_212218 250
891 3300048920 Ga0496117_0001097 Ga0496117_0001097_14296_15048 250
892 3300048920 Ga0496117_0003845 Ga0496117_0003845_10106_10858 250
893 3300048920 Ga0496117_0045546 Ga0496117_0045546_1888_2640 250
894 3300048920 Ga0496117_0105080 Ga0496117_0105080_202_954 250
895 3300048921 Ga0496118_0000054 Ga0496118_0000054_10843_11595 250
896 3300048921 Ga0496118_0000294 Ga0496118_0000294_47881_48633 250
897 3300048921 Ga0496118_0001134 Ga0496118_0001134_14296_15048 250
898 3300048921 Ga0496118_0002121 Ga0496118_0002121_6348_7100 250
899 3300048921 Ga0496118_0015333 Ga0496118_0015333_1514_2266 250
900 3300048921 Ga0496118_0069114 Ga0496118_0069114_578_1330 250
901 3300048921 Ga0496118_0099517 Ga0496118_0099517_743_1495 250
902 3300048922 Ga0496119_0004866 Ga0496119_0004866_2519_3271 250
903 3300048922 Ga0496119_0016988 Ga0496119_0016988_864_1616 250
904 3300048923 Ga0496120_0000086 Ga0496120_0000086_78952_79704 250
905 3300048923 Ga0496120_0268256 Ga0496120_0268256_26_778 250
906 3300048924 Ga0496121_0001036 Ga0496121_0001036_32556_33308 250
907 3300048924 Ga0496121_0004657 Ga0496121_0004657_11345_12097 250
908 3300048924 Ga0496121_0008412 Ga0496121_0008412_2894_3700 250
909 3300048924 Ga0496121_0016860 Ga0496121_0016860_739_1491 250
910 3300048924 Ga0496121_0029589 Ga0496121_0029589_3388_4140 250
911 3300048924 Ga0496121_0060290 Ga0496121_0060290_1334_2086 250
912 3300048924 Ga0496121_0159422 Ga0496121_0159422_332_1084 250
913 3300048924 Ga0496121_0287228 Ga0496121_0287228_22_774 250
914 3300048925 Ga0496122_0001513 Ga0496122_0001513_35503_36255 250
915 3300048925 Ga0496122_0001645 Ga0496122_0001645_6800_7561 250
916 3300048925 Ga0496122_0002752 Ga0496122_0002752_18904_19725 250
917 3300048926 Ga0496123_0000970 Ga0496123_0000970_36746_37507 250
918 3300048926 Ga0496123_0002204 Ga0496123_0002204_972_1724 250
919 3300048926 Ga0496123_0002540 Ga0496123_0002540_7290_8051 250
920 3300048926 Ga0496123_0041869 Ga0496123_0041869_1489_2310 250
921 3300048926 Ga0496123_0082985 Ga0496123_0082985_16_768 250
922 3300048927 Ga0496124_0008360 Ga0496124_0008360_2398_3159 250
923 3300048927 Ga0496124_0034565 Ga0496124_0034565_2755_3507 250
924 3300048927 Ga0496124_0327691 Ga0496124_0327691_42_803 250
925 3300048928 Ga0496125_0001339 Ga0496125_0001339_6563_7324 250
926 3300048928 Ga0496125_0001458 Ga0496125_0001458_33204_33956 250
927 3300048928 Ga0496125_0009187 Ga0496125_0009187_3427_4182 250
928 3300048928 Ga0496125_0024768 Ga0496125_0024768_3114_3920 250
929 3300048928 Ga0496125_0230742 Ga0496125_0230742_221_1042 250
930 3300048929 Ga0496126_0000423 Ga0496126_0000423_76529_77281 250
931 3300048929 Ga0496126_0000599 Ga0496126_0000599_37727_38479 250
932 3300048929 Ga0496126_0001192 Ga0496126_0001192_33540_34310 250
933 3300048929 Ga0496126_0042621 Ga0496126_0042621_1554_2309 250
934 3300048929 Ga0496126_0075933 Ga0496126_0075933_907_1659 250
935 3300048929 Ga0496126_0127483 Ga0496126_0127483_678_1430 250
936 3300048929 Ga0496126_0289467 Ga0496126_0289467_28_834 250
937 3300048929 Ga0496126_0456059 Ga0496126_0456059_251_1003 250
938 3300049459 Ga0495678_000244 Ga0495678_000244_23264_24025 250
939 3300049459 Ga0495678_003003 Ga0495678_003003_6936_7697 250
940 3300049459 Ga0495678_004126 Ga0495678_004126_1454_2206 250
941 3300049460 Ga0495682_0000454 Ga0495682_0000454_6886_7647 250
942 3300049460 Ga0495682_0000471 Ga0495682_0000471_12164_12925 250
943 3300049460 Ga0495682_0008504 Ga0495682_0008504_487_1239 250
944 3300049460 Ga0495682_0024188 Ga0495682_0024188_551_1324 250
945 3300049460 Ga0495682_0036274 Ga0495682_0036274_545_1327 250
946 3300049460 Ga0495682_0061201 Ga0495682_0061201_519_1280 250
947 3300049570 Ga0501033_0121854 Ga0501033_0121854_470_1222 250
948 3300049574 Ga0501038_0040239 Ga0501038_0040239_440_1192 250
949 3300049575 Ga0501039_0117668 Ga0501039_0117668_204_956 250
950 3300049578 Ga0501042_0094494 Ga0501042_0094494_1005_1757 250
951 3300049579 Ga0501043_0119612 Ga0501043_0119612_76_828 250
952 3300049580 Ga0501046_0036067 Ga0501046_0036067_2209_2961 250
953 3300049582 Ga0501048_0020606 Ga0501048_0020606_3747_4499 250
954 3300049587 Ga0501071_0077165 Ga0501071_0077165_46_798 250
955 3300049591 Ga0501075_0018994 Ga0501075_0018994_62_814 250
956 3300049592 Ga0501076_0002066 Ga0501076_0002066_2537_3289 250
957 3300049592 Ga0501076_0184144 Ga0501076_0184144_698_1450 250
958 3300049680 Ga0501250_012839 Ga0501250_012839_197_949 250
959 3300049741 Ga0501079_0024823 Ga0501079_0024823_1799_2551 250
960 3300049741 Ga0501079_0324933 Ga0501079_0324933_291_1043 250
961 3300049742 Ga0501080_0022265 Ga0501080_0022265_19_771 250
962 3300049742 Ga0501080_0367666 Ga0501080_0367666_527_1279 250
963 3300049743 Ga0501081_0002231 Ga0501081_0002231_2572_3324 250
964 3300049743 Ga0501081_0234522 Ga0501081_0234522_489_1241 250
965 3300049744 Ga0501083_0048451 Ga0501083_0048451_612_1364 250
966 3300049822 Ga0501035_0126708 Ga0501035_0126708_262_1014 250
967 3300049824 Ga0501045_0001446 Ga0501045_0001446_5618_6370 250
968 3300050489 nmdc:mga03683_3564_c2 nmdc:mga03683_3564_c2_405_1157 250
969 3300050490 nmdc:mga03n38_3188_c1 nmdc:mga03n38_3188_c1_1366_2118 250
970 3300050491 nmdc:mga00v17_76693_c1 nmdc:mga00v17_76693_c1_1044_1796 250
971 3300050493 nmdc:mga0k408_155960_c1 nmdc:mga0k408_155960_c1_593_1345 250
972 3300050493 nmdc:mga0k408_7589_c1 nmdc:mga0k408_7589_c1_3330_4082 250
973 3300050493 nmdc:mga0k408_9829_c1 nmdc:mga0k408_9829_c1_441_1193 250
974 3300050495 nmdc:mga04h51_18556_c1 nmdc:mga04h51_18556_c1_79_831 250
975 3300050495 nmdc:mga04h51_45590_c1 nmdc:mga04h51_45590_c1_30_782 250
976 3300050496 nmdc:mga07m45_126_c1 nmdc:mga07m45_126_c1_301_1053 250
977 3300050496 nmdc:mga07m45_2253_c1 nmdc:mga07m45_2253_c1_2235_2987 250
978 3300050496 nmdc:mga07m45_64228_c1 nmdc:mga07m45_64228_c1_560_1312 250
979 3300050507 nmdc:mga05p37_204206_c1 nmdc:mga05p37_204206_c1_79_831 250
980 3300050516 nmdc:mga0sz30_6210_c1 nmdc:mga0sz30_6210_c1_829_1581 250
981 3300053134 Ga0500658_0002282 Ga0500658_0002282_5599_6351 250
982 3300053136 Ga0500559_0168950 Ga0500559_0168950_105_884 250
983 3300053178 Ga0500637_0005060 Ga0500637_0005060_5142_5894 250
984 3300054114 Ga0501084_0026840 Ga0501084_0026840_1703_2455 250
985 3300059477 Ga0587084_003872 Ga0587084_003872_142_894 250
986 3300059493 Ga0587077_008959 Ga0587077_008959_141_893 250
987 3300059504 Ga0587082_014547 Ga0587082_014547_139_891 250
988 3300059505 Ga0587083_0033482 Ga0587083_0033482_142_894 250
989 3300059639 Ga0587062_005140 Ga0587062_005140_118_870 250
990 3300059640 Ga0587067_011086 Ga0587067_011086_132_884 250
991 3300059643 Ga0587072_013521 Ga0587072_013521_135_887 250
992 3300059644 Ga0587075_002497 Ga0587075_002497_142_894 250
993 3300060346 Ga0587111_0033272 Ga0587111_0033272_144_896 250
994 3300060353 Ga0501082_0010901 Ga0501082_0010901_5657_6409 250
995 3300060353 Ga0501082_0066431 Ga0501082_0066431_1565_2317 250
996 3300061719 Ga0466962_0002159 Ga0466962_0002159_478_1230 250
997 3300061719 Ga0466962_0011537 Ga0466962_0011537_2576_3328 250
998 3300061719 Ga0466962_0048807 Ga0466962_0048807_94_855 250
999 3300061734 Ga0530510_0002613 Ga0530510_0002613_1338_2090 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00639

Rotamase

PPIC-type PPIASE domain

134

215

0.93

PF13145

Rotamase_2

PPIC-type PPIASE domain

107

231

0.87

PF13616

Rotamase_3

PPIC-type PPIASE domain

110

208

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pv2-assembly1.cif.gz_B crystallographic structure of sura first peptidyl-prolyl isomerase domain complexed with peptide nftlkfwdifrk 0.8999 125 213
6xd8-assembly2.cif.gz_B crystal structure of peptidylprolyl isomerase (prsa) fragment from bacillus anthracis 0.8809 123 217
2jzv-assembly1.cif.gz_A solution structure of s. aureus prsa-ppiase 0.8691 125 214
3gpk-assembly2.cif.gz_B crystal structure of ppic-type peptidyl-prolyl cis-trans isomerase domain at 1.55a resolution. 0.8684 120 222
6xd8-assembly2.cif.gz_B crystal structure of peptidylprolyl isomerase (prsa) fragment from bacillus anthracis 0.8638 123 217
ID Description Score Start End Superfamily
af_Q2G2S6_136_245_3.10.50.40 Alpha Beta;Roll;Chitinase A; domain 3; 0.8711 121 214 3.10.50.40
af_Q54Z53_33_124_3.10.50.40 Alpha Beta;Roll;Chitinase A; domain 3; 0.8711 125 217 3.10.50.40
2jzvA00 Alpha Beta;Roll;Chitinase A; domain 3; 0.8691 125 214 3.10.50.40
af_Q9N492_46_161_3.10.50.40 Alpha Beta;Roll;Chitinase A; domain 3; 0.8683 124 213 3.10.50.40
2pv3B02 Alpha Beta;Roll;Chitinase A; domain 3; 0.8647 125 214 3.10.50.40
ID Description Score Start End GO Terms
AF-A0A062C191-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.9416 124 217 GO:0140839
GO:0140840
AF-A0A7X8MDW1-F1-model_v4 PpiC domain-containing protein 0.9399 123 213 GO:0003755
AF-A0A2G2I671-F1-model_v4 deleted 0.9335 124 217
AF-A0A1S2WXB1-F1-model_v4 Peptidyl-prolyl cis-trans isomerase C (Parvulin) (Rotamase C) 0.9153 125 215 GO:0003755
GO:0005737
AF-G0QBA8-F1-model_v4 Parvulin-like peptidyl-prolyl isomerase 0.9098 124 217 GO:0003755

Feature Viewer

pLDDT pTM Quality
93.97 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map