F487848

General Info

Members Datasets Scaffolds Average Seq Length
999 400 1998 113

Family's Representative Sequence

Representative Sequence 3300042438|Ga0439459_0050755|Ga0439459_0050755_241_666
Length 133
Sequence MIRIDALWLCTQPQDMPRLMMMPHERQTNGFLEALNGRAGADRLLAVVVNTVGQAQAHHGWLFANARATRIKLLVHDGFGVWCATRRLHSGSFAWTSAPAGASALQLTAQQFEALVVGLPWQRLPELQVIGRA

Samples

Sample ID Description Type Environment
1 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
12 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
103 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
120 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
121 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
192 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
193 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
194 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
200 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
201 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
206 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
207 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
208 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
209 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
210 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
211 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
212 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
213 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
214 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
215 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
216 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
217 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
218 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
219 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
220 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
221 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
222 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
228 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
229 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
230 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
231 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
232 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
233 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
234 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
235 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
236 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
237 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
238 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
239 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
240 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
241 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
242 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
243 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
244 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
245 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
246 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
247 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
248 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
249 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
250 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
251 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
252 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
253 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
254 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
255 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
256 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
257 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
258 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
259 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
260 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
261 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
262 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
263 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
264 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
265 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
266 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
267 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
268 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
269 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
270 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
271 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
272 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
273 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
274 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
275 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
276 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
277 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
278 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
279 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
280 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
281 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
282 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
283 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
284 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
285 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
286 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
287 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
288 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
289 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
290 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
291 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
292 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
293 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
294 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
295 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
296 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
297 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
298 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
299 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
300 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
301 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
302 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
303 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
304 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
305 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
306 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
307 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
308 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
309 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
310 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
311 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
312 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
313 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
314 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
315 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
316 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
317 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
318 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
319 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
320 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
321 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
322 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
323 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
324 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
325 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
326 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
327 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
328 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
329 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
330 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
331 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
332 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
333 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
334 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
335 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
336 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
337 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
338 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
339 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
340 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
341 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
342 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
343 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
344 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
345 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
346 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
347 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
348 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
349 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
350 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
351 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
352 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
353 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
354 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
355 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
356 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
357 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
359 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
360 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
361 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
364 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
365 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
366 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
367 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
368 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
369 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
370 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
371 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
372 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
373 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
374 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
375 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
376 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
377 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
378 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
379 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
380 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
381 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
382 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
383 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
384 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
385 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
386 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
387 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
388 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
389 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
390 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
391 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
392 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
393 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
394 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
395 2643221609 Acidovorax sp. Root217 Isolate Unclassified
396 2738541277 Variovorax sp. GV051 Isolate Unclassified
397 2738541307 Variovorax sp. GV008 Isolate Unclassified
398 2738543019 Variovorax sp. GV040 Isolate Unclassified
399 2818991446 Variovorax sp. 1180 Isolate Unclassified
400 2928070936 Variovorax gossypii 1167 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.81
Nodule 0
Rhizoplane 3.9
Rhizosphere 82.28
Stem 0
Stem Tuber 0
Unclassified 1.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439459_0050755 3300042438 Bacteria 910
2 JGI24746J21847_1008557 3300001977 Bacteria 1541
3 JGI24746J21847_1016033 3300001977 Bacteria 1074
4 JGI24747J21853_1002566 3300001978 Bacteria 1495
5 JGI24740J21852_10022439 3300001979 Bacteria 2173
6 JGI24740J21852_10026796 3300001979 Bacteria 1926
7 JGI24743J22301_10010853 3300001991 Bacteria 1631
8 JGI24735J21928_10003492 3300002067 Bacteria 5353
9 JGI24735J21928_10006917 3300002067 Bacteria 3714
10 JGI24735J21928_10013752 3300002067 Unclassified 2538
11 JGI24735J21928_10049156 3300002067 Bacteria 1219
12 JGI24745J21846_1007335 3300002073 Bacteria 1233
13 JGI24738J21930_10037536 3300002075 Bacteria 985
14 JGI24738J21930_10047938 3300002075 Unclassified 870
15 JGI24738J21930_10058704 3300002075 Bacteria 789
16 JGI24749J21850_1002272 3300002076 Bacteria 2704
17 JGI24744J21845_10000546 3300002077 Bacteria 6763
18 JGI24744J21845_10002063 3300002077 Bacteria 4071
19 JGI24744J21845_10012863 3300002077 Bacteria 1691
20 JGI24744J21845_10014587 3300002077 Bacteria 1576
21 JGI24744J21845_10015111 3300002077 Bacteria 1545
22 JGI24035J26624_1024462 3300002126 Bacteria 645
23 JGI24033J26618_1001024 3300002155 Bacteria 2702
24 JGI24033J26618_1023458 3300002155 Bacteria 802
25 JGI24033J26618_1041460 3300002155 Bacteria 643
26 JGI24034J26672_10006509 3300002239 Bacteria 1685
27 JGI24034J26672_10006646 3300002239 Bacteria 1670
28 JGI24742J22300_10003701 3300002244 Bacteria 2483
29 JGI24742J22300_10058459 3300002244 Bacteria 706
30 JGI25152J39213_1021668 3300002773 Bacteria 1123
31 rootH1_10022611 3300003316 Bacteria 17424
32 Ga0055540_1007059 3300003792 Bacteria 4319
33 Ga0065712_10088924 3300005290 Bacteria 2495
34 Ga0065712_10151304 3300005290 Bacteria 1367
35 Ga0065715_10104929 3300005293 Bacteria 2926
36 Ga0065715_10106561 3300005293 Bacteria 2822
37 Ga0065715_10113579 3300005293 Bacteria 2483
38 Ga0065707_10544037 3300005295 Bacteria 726
39 Ga0070658_10647369 3300005327 Bacteria 917
40 Ga0070658_10976318 3300005327 Bacteria 737
41 Ga0070676_10033783 3300005328 Bacteria 2934
42 Ga0070676_10039378 3300005328 Bacteria 2733
43 Ga0070676_10062913 3300005328 Bacteria 2209
44 Ga0070676_10086074 3300005328 Bacteria 1916
45 Ga0070676_10117958 3300005328 Bacteria 1662
46 Ga0070690_100055561 3300005330 Bacteria 2536
47 Ga0070690_100079351 3300005330 Bacteria 2146
48 Ga0070670_100034722 3300005331 Bacteria 4340
49 Ga0070670_100077375 3300005331 Bacteria 2858
50 Ga0070670_100125395 3300005331 Bacteria 2216
51 Ga0070670_100141414 3300005331 Bacteria 2081
52 Ga0070670_100651065 3300005331 Bacteria 945
53 Ga0070677_10021084 3300005333 Bacteria 2386
54 Ga0070677_10022003 3300005333 Bacteria 2343
55 Ga0070677_10133016 3300005333 Bacteria 1138
56 Ga0070677_10512445 3300005333 Bacteria 652
57 Ga0070677_10757933 3300005333 Bacteria 551
58 Ga0068869_100054891 3300005334 Bacteria 2902
59 Ga0068869_100069693 3300005334 Bacteria 2600
60 Ga0068869_100254044 3300005334 Bacteria 1405
61 Ga0068869_100461470 3300005334 Bacteria 1054
62 Ga0068869_100959533 3300005334 Bacteria 743
63 Ga0068869_101173928 3300005334 Bacteria 674
64 Ga0070666_10032492 3300005335 Bacteria 3447
65 Ga0070666_10070455 3300005335 Bacteria 2379
66 Ga0070666_10136874 3300005335 Bacteria 1704
67 Ga0068868_100059339 3300005338 Bacteria 3026
68 Ga0068868_100085704 3300005338 Bacteria 2531
69 Ga0068868_100103601 3300005338 Bacteria 2305
70 Ga0068868_100326371 3300005338 Bacteria 1309
71 Ga0068868_100330066 3300005338 Bacteria 1302
72 Ga0068868_100356036 3300005338 Bacteria 1255
73 Ga0068868_100445740 3300005338 Bacteria 1125
74 Ga0070689_100009091 3300005340 Bacteria 7034
75 Ga0070689_100681910 3300005340 Bacteria 896
76 Ga0070687_100022395 3300005343 Bacteria 2987
77 Ga0070661_100019361 3300005344 Bacteria 4852
78 Ga0070661_100053826 3300005344 Bacteria 2947
79 Ga0070661_100170282 3300005344 Bacteria 1653
80 Ga0070661_100261095 3300005344 Bacteria 1339
81 Ga0070661_100684613 3300005344 Bacteria 834
82 Ga0070692_10132732 3300005345 Bacteria 1401
83 Ga0070692_10210756 3300005345 Bacteria 1143
84 Ga0070668_100075099 3300005347 Bacteria 2638
85 Ga0070668_100089721 3300005347 Bacteria 2421
86 Ga0070668_100179790 3300005347 Bacteria 1727
87 Ga0070668_100445735 3300005347 Bacteria 1112
88 Ga0070668_100735894 3300005347 Bacteria 872
89 Ga0070669_100046424 3300005353 Bacteria 3167
90 Ga0070669_100057796 3300005353 Bacteria 2847
91 Ga0070669_100111464 3300005353 Bacteria 2077
92 Ga0070669_100382129 3300005353 Bacteria 1149
93 Ga0070669_100724857 3300005353 Bacteria 841
94 Ga0070669_100896952 3300005353 Bacteria 757
95 Ga0070675_100048175 3300005354 Bacteria 3493
96 Ga0070675_100106540 3300005354 Bacteria 2366
97 Ga0070675_100247721 3300005354 Bacteria 1558
98 Ga0070675_100552497 3300005354 Bacteria 1041
99 Ga0070675_100755770 3300005354 Bacteria 887
100 Ga0070675_100936947 3300005354 Bacteria 794
101 Ga0070675_101277700 3300005354 Bacteria 676
102 Ga0070675_101759537 3300005354 Bacteria 572
103 Ga0070675_101964082 3300005354 Bacteria 539
104 Ga0070671_100060170 3300005355 Bacteria 3162
105 Ga0070671_100107518 3300005355 Bacteria 2342
106 Ga0070671_100152400 3300005355 Bacteria 1952
107 Ga0070671_100210192 3300005355 Bacteria 1650
108 Ga0070671_100221147 3300005355 Bacteria 1606
109 Ga0070671_100240284 3300005355 Bacteria 1537
110 Ga0070671_100594705 3300005355 Bacteria 956
111 Ga0070674_100023873 3300005356 Bacteria 3965
112 Ga0070674_100056264 3300005356 Bacteria 2727
113 Ga0070674_100158446 3300005356 Bacteria 1715
114 Ga0070674_100178518 3300005356 Bacteria 1624
115 Ga0070674_100195778 3300005356 Bacteria 1557
116 Ga0070674_100227292 3300005356 Bacteria 1455
117 Ga0070674_100296687 3300005356 Bacteria 1287
118 Ga0070674_100384458 3300005356 Bacteria 1143
119 Ga0070674_100505010 3300005356 Bacteria 1008
120 Ga0070673_100024340 3300005364 Bacteria 4438
121 Ga0070673_100056697 3300005364 Bacteria 3092
122 Ga0070673_100287705 3300005364 Bacteria 1443
123 Ga0070673_100320159 3300005364 Bacteria 1370
124 Ga0070673_100489219 3300005364 Bacteria 1111
125 Ga0070673_100724347 3300005364 Bacteria 915
126 Ga0070688_100004924 3300005365 Bacteria 6988
127 Ga0070688_100204317 3300005365 Bacteria 1384
128 Ga0070688_100563490 3300005365 Bacteria 868
129 Ga0070688_100991018 3300005365 Bacteria 667
130 Ga0070659_100088147 3300005366 Bacteria 2485
131 Ga0070659_100332309 3300005366 Bacteria 1272
132 Ga0070667_100059120 3300005367 Bacteria 3242
133 Ga0070667_100074581 3300005367 Bacteria 2894
134 Ga0070667_100262581 3300005367 Bacteria 1546
135 Ga0070667_100353245 3300005367 Bacteria 1331
136 Ga0070667_100556175 3300005367 Bacteria 1055
137 Ga0070667_100603537 3300005367 Bacteria 1011
138 Ga0070701_10025016 3300005438 Bacteria 2894
139 Ga0070705_100226274 3300005440 Bacteria 1298
140 Ga0070700_100037965 3300005441 Bacteria 2932
141 Ga0070708_100061511 3300005445 Bacteria 3354
142 Ga0070708_100141970 3300005445 Bacteria 2228
143 Ga0070663_100068888 3300005455 Bacteria 2569
144 Ga0070663_100079432 3300005455 Bacteria 2407
145 Ga0070663_100964894 3300005455 Bacteria 739
146 Ga0070678_100043176 3300005456 Bacteria 3209
147 Ga0070678_100072390 3300005456 Bacteria 2583
148 Ga0070678_100081206 3300005456 Bacteria 2457
149 Ga0070678_100081397 3300005456 Bacteria 2455
150 Ga0070678_100093330 3300005456 Bacteria 2314
151 Ga0070678_100192564 3300005456 Bacteria 1677
152 Ga0070678_100663371 3300005456 Bacteria 937
153 Ga0070678_100886021 3300005456 Bacteria 815
154 Ga0070678_100955688 3300005456 Bacteria 786
155 Ga0070678_101062681 3300005456 Bacteria 746
156 Ga0070678_101423332 3300005456 Bacteria 648
157 Ga0070662_100031707 3300005457 Bacteria 3711
158 Ga0070662_100058310 3300005457 Bacteria 2809
159 Ga0070662_100771126 3300005457 Bacteria 816
160 Ga0070662_101283459 3300005457 Bacteria 630
161 Ga0070662_101666024 3300005457 Bacteria 551
162 Ga0068867_100049623 3300005459 Bacteria 3090
163 Ga0068867_100058808 3300005459 Bacteria 2848
164 Ga0068867_100066318 3300005459 Bacteria 2688
165 Ga0068867_100169343 3300005459 Bacteria 1729
166 Ga0068867_100224160 3300005459 Bacteria 1516
167 Ga0068867_100556904 3300005459 Bacteria 994
168 Ga0070685_10033337 3300005466 Bacteria 2892
169 Ga0070685_10041936 3300005466 Bacteria 2609
170 Ga0070685_10625959 3300005466 Bacteria 777
171 Ga0070685_10722232 3300005466 Bacteria 728
172 Ga0070685_11333569 3300005466 Bacteria 549
173 Ga0070706_100364227 3300005467 Bacteria 1347
174 Ga0070706_100369182 3300005467 Bacteria 1337
175 Ga0070706_100670600 3300005467 Bacteria 962
176 Ga0070706_101448786 3300005467 Bacteria 628
177 Ga0070707_100609582 3300005468 Bacteria 1054
178 Ga0070707_100774711 3300005468 Bacteria 923
179 Ga0070699_100082485 3300005518 Bacteria 2803
180 Ga0070699_100463848 3300005518 Bacteria 1149
181 Ga0068853_100278700 3300005539 Bacteria 1541
182 Ga0068853_100289399 3300005539 Bacteria 1512
183 Ga0068853_100383984 3300005539 Bacteria 1312
184 Ga0068853_100806648 3300005539 Bacteria 899
185 Ga0070672_100038632 3300005543 Bacteria 3649
186 Ga0070672_100045720 3300005543 Bacteria 3388
187 Ga0070672_100058561 3300005543 Bacteria 3028
188 Ga0070672_100113509 3300005543 Bacteria 2211
189 Ga0070672_100160944 3300005543 Bacteria 1862
190 Ga0070672_100177777 3300005543 Bacteria 1772
191 Ga0070672_100400845 3300005543 Bacteria 1176
192 Ga0070672_100555183 3300005543 Bacteria 997
193 Ga0070686_100042827 3300005544 Bacteria 2837
194 Ga0070686_100087590 3300005544 Bacteria 2076
195 Ga0070665_100112058 3300005548 Bacteria 2731
196 Ga0070665_100569826 3300005548 Bacteria 1145
197 Ga0070665_100619873 3300005548 Bacteria 1095
198 Ga0070665_102295270 3300005548 Bacteria 543
199 Ga0070664_100000608 3300005564 Bacteria 27424
200 Ga0070664_100076310 3300005564 Bacteria 2879
201 Ga0070664_100096961 3300005564 Bacteria 2559
202 Ga0070664_100119106 3300005564 Bacteria 2310
203 Ga0070664_101259914 3300005564 Bacteria 698
204 Ga0068857_100100240 3300005577 Bacteria 2598
205 Ga0068857_100987200 3300005577 Bacteria 810
206 Ga0068854_100029807 3300005578 Bacteria 3781
207 Ga0068854_100162481 3300005578 Bacteria 1731
208 Ga0068854_100190790 3300005578 Bacteria 1606
209 Ga0068854_100287299 3300005578 Bacteria 1326
210 Ga0068854_100858295 3300005578 Bacteria 795
211 Ga0068856_100034558 3300005614 Bacteria 4951
212 Ga0070702_100052280 3300005615 Bacteria 2342
213 Ga0070702_100137130 3300005615 Bacteria 1554
214 Ga0070702_100491913 3300005615 Bacteria 899
215 Ga0068852_100142797 3300005616 Bacteria 2217
216 Ga0068852_100185813 3300005616 Bacteria 1957
217 Ga0068852_100236838 3300005616 Bacteria 1742
218 Ga0068852_100945665 3300005616 Bacteria 880
219 Ga0068852_101025284 3300005616 Bacteria 844
220 Ga0068852_101262161 3300005616 Bacteria 760
221 Ga0068852_102669683 3300005616 Bacteria 519
222 Ga0068859_100087807 3300005617 Bacteria 3158
223 Ga0068859_100242914 3300005617 Bacteria 1890
224 Ga0068859_102829297 3300005617 Bacteria 532
225 Ga0068864_100058907 3300005618 Bacteria 3321
226 Ga0068864_100068131 3300005618 Bacteria 3091
227 Ga0068864_100088389 3300005618 Bacteria 2729
228 Ga0068864_100201411 3300005618 Bacteria 1829
229 Ga0068864_100270659 3300005618 Bacteria 1583
230 Ga0068864_100478821 3300005618 Bacteria 1194
231 Ga0068864_100671174 3300005618 Bacteria 1010
232 Ga0068864_100799958 3300005618 Bacteria 926
233 Ga0068864_102098850 3300005618 Bacteria 571
234 Ga0068866_10049806 3300005718 Bacteria 2125
235 Ga0068866_10103166 3300005718 Bacteria 1577
236 Ga0068861_100085732 3300005719 Bacteria 2474
237 Ga0068861_100098008 3300005719 Bacteria 2326
238 Ga0068861_100410158 3300005719 Bacteria 1205
239 Ga0068861_102657728 3300005719 Bacteria 505
240 Ga0068851_10028989 3300005834 Bacteria 2737
241 Ga0068851_10303365 3300005834 Bacteria 919
242 Ga0068870_10014940 3300005840 Bacteria 3676
243 Ga0068870_10049677 3300005840 Bacteria 2213
244 Ga0068870_10644844 3300005840 Bacteria 725
245 Ga0068870_10851015 3300005840 Bacteria 641
246 Ga0068870_10917697 3300005840 Bacteria 620
247 Ga0068863_100083478 3300005841 Bacteria 3027
248 Ga0068863_100208702 3300005841 Bacteria 1880
249 Ga0068863_100405798 3300005841 Bacteria 1333
250 Ga0068863_100887403 3300005841 Bacteria 891
251 Ga0068863_100968357 3300005841 Bacteria 853
252 Ga0068863_101768379 3300005841 Bacteria 628
253 Ga0068858_100292203 3300005842 Bacteria 1554
254 Ga0068858_100517159 3300005842 Bacteria 1154
255 Ga0068858_101706526 3300005842 Bacteria 622
256 Ga0068860_100029987 3300005843 Bacteria 5231
257 Ga0068860_100109164 3300005843 Bacteria 2644
258 Ga0068860_100430435 3300005843 Bacteria 1309
259 Ga0068860_100455719 3300005843 Bacteria 1272
260 Ga0068860_101144354 3300005843 Bacteria 798
261 Ga0068860_102380544 3300005843 Bacteria 550
262 Ga0068862_100088607 3300005844 Bacteria 2692
263 Ga0068862_101933037 3300005844 Bacteria 600
264 Ga0075364_10182496 3300006051 Bacteria 1420
265 Ga0075432_10351928 3300006058 Bacteria 624
266 Ga0070715_10734022 3300006163 Bacteria 593
267 Ga0075367_10319038 3300006178 Bacteria 979
268 Ga0075369_10433486 3300006186 Bacteria 621
269 Ga0075366_10021874 3300006195 Bacteria 3718
270 Ga0075366_10030294 3300006195 Bacteria 3181
271 Ga0075366_10063795 3300006195 Bacteria 2190
272 Ga0075366_10173767 3300006195 Bacteria 1307
273 Ga0075366_10276264 3300006195 Bacteria 1026
274 Ga0075366_11024531 3300006195 Bacteria 515
275 Ga0097621_100063706 3300006237 Bacteria 3030
276 Ga0097621_100074313 3300006237 Bacteria 2815
277 Ga0097621_100275915 3300006237 Bacteria 1478
278 Ga0097621_100384690 3300006237 Bacteria 1254
279 Ga0097621_100390296 3300006237 Bacteria 1245
280 Ga0097621_100399275 3300006237 Bacteria 1230
281 Ga0075370_10024278 3300006353 Bacteria 3347
282 Ga0075370_10099412 3300006353 Bacteria 1683
283 Ga0075370_10390674 3300006353 Bacteria 834
284 Ga0068871_100162511 3300006358 Bacteria 1910
285 Ga0068871_100191629 3300006358 Bacteria 1761
286 Ga0068871_100337878 3300006358 Bacteria 1329
287 Ga0068871_100630725 3300006358 Bacteria 977
288 Ga0075428_101997405 3300006844 Bacteria 601
289 Ga0075433_11191588 3300006852 Bacteria 661
290 Ga0068865_100105259 3300006881 Bacteria 2072
291 Ga0068865_100188375 3300006881 Bacteria 1593
292 Ga0068865_101320729 3300006881 Bacteria 642
293 Ga0068865_101667913 3300006881 Bacteria 574
294 Ga0097620_100087800 3300006931 Bacteria 3158
295 Ga0097620_100242922 3300006931 Bacteria 1890
296 Ga0097620_102828313 3300006931 Bacteria 532
297 Ga0099794_10608982 3300007265 Bacteria 579
298 Ga0105240_10616762 3300009093 Bacteria 1193
299 Ga0111539_10569237 3300009094 Bacteria 1319
300 Ga0111539_10619707 3300009094 Bacteria 1260
301 Ga0111539_10827597 3300009094 Bacteria 1077
302 Ga0111539_10886874 3300009094 Bacteria 1037
303 Ga0111539_10950063 3300009094 Bacteria 999
304 Ga0105245_10060483 3300009098 Bacteria 3411
305 Ga0105245_10367143 3300009098 Bacteria 1430
306 Ga0105247_10121409 3300009101 Bacteria 1693
307 Ga0114129_11458820 3300009147 Bacteria 842
308 Ga0105243_10035190 3300009148 Bacteria 3882
309 Ga0105243_10069182 3300009148 Bacteria 2847
310 Ga0105243_10084060 3300009148 Bacteria 2606
311 Ga0105243_11160511 3300009148 Bacteria 784
312 Ga0105241_12182432 3300009174 Bacteria 549
313 Ga0105242_10067616 3300009176 Bacteria 2955
314 Ga0105242_10072268 3300009176 Bacteria 2865
315 Ga0105242_10113848 3300009176 Bacteria 2310
316 Ga0105242_10218946 3300009176 Bacteria 1700
317 Ga0105242_12182762 3300009176 Bacteria 599
318 Ga0105248_10004858 3300009177 Bacteria 14884
319 Ga0105248_10161902 3300009177 Bacteria 2524
320 Ga0105248_10255587 3300009177 Bacteria 1972
321 Ga0105248_10400166 3300009177 Bacteria 1546
322 Ga0105248_10483514 3300009177 Bacteria 1396
323 Ga0105248_10581750 3300009177 Bacteria 1263
324 Ga0105248_10835244 3300009177 Bacteria 1040
325 Ga0105237_10165742 3300009545 Bacteria 2209
326 Ga0105238_10915313 3300009551 Bacteria 896
327 Ga0105238_11260070 3300009551 Bacteria 765
328 Ga0105249_10092922 3300009553 Bacteria 2825
329 Ga0105249_10209836 3300009553 Bacteria 1911
330 Ga0105249_10248471 3300009553 Bacteria 1762
331 Ga0105249_10312910 3300009553 Bacteria 1579
332 Ga0105249_10629059 3300009553 Bacteria 1130
333 Ga0105239_10098568 3300010375 Bacteria 3231
334 Ga0105239_10226021 3300010375 Bacteria 2100
335 Ga0105239_11350460 3300010375 Bacteria 822
336 Ga0105246_10043453 3300011119 Bacteria 3049
337 Ga0105246_10086834 3300011119 Bacteria 2244
338 Ga0105246_10419786 3300011119 Bacteria 1116
339 Ga0105246_10733668 3300011119 Bacteria 869
340 Ga0105246_11177053 3300011119 Bacteria 704
341 Ga0105246_11417017 3300011119 Bacteria 649
342 Ga0157329_1025237 3300012491 Bacteria 585
343 Ga0157324_1004541 3300012506 Bacteria 965
344 Ga0157373_10015300 3300013100 Bacteria 5609
345 Ga0157373_10221664 3300013100 Bacteria 1334
346 Ga0157373_10324704 3300013100 Bacteria 1095
347 Ga0157369_10001966 3300013105 Bacteria 24777
348 Ga0157374_10054519 3300013296 Bacteria 3729
349 Ga0157374_10070856 3300013296 Bacteria 3286
350 Ga0157374_10105947 3300013296 Bacteria 2701
351 Ga0157374_10120808 3300013296 Bacteria 2528
352 Ga0157374_10173954 3300013296 Bacteria 2101
353 Ga0157374_10381121 3300013296 Bacteria 1405
354 Ga0157374_10563095 3300013296 Bacteria 1148
355 Ga0157374_10888715 3300013296 Bacteria 908
356 Ga0157374_11242107 3300013296 Bacteria 767
357 Ga0157378_10050171 3300013297 Bacteria 3713
358 Ga0157378_10061843 3300013297 Bacteria 3343
359 Ga0157378_10104953 3300013297 Bacteria 2583
360 Ga0157378_10130748 3300013297 Bacteria 2324
361 Ga0157378_10599801 3300013297 Bacteria 1112
362 Ga0157378_10755969 3300013297 Bacteria 995
363 Ga0157378_12691935 3300013297 Unclassified 550
364 Ga0163162_10100056 3300013306 Bacteria 2990
365 Ga0163162_10118736 3300013306 Bacteria 2747
366 Ga0163162_10128551 3300013306 Bacteria 2641
367 Ga0163162_10147703 3300013306 Bacteria 2468
368 Ga0163162_10148963 3300013306 Bacteria 2457
369 Ga0163162_10699993 3300013306 Bacteria 1135
370 Ga0163162_11031378 3300013306 Unclassified 931
371 Ga0157375_10032141 3300013308 Bacteria 4974
372 Ga0157375_10045915 3300013308 Bacteria 4254
373 Ga0157375_10098581 3300013308 Bacteria 3000
374 Ga0157375_10150529 3300013308 Bacteria 2462
375 Ga0157375_10265116 3300013308 Bacteria 1879
376 Ga0157375_11050687 3300013308 Bacteria 952
377 Ga0157375_11139157 3300013308 Bacteria 914
378 Ga0157375_11454801 3300013308 Bacteria 808
379 Ga0157375_11780567 3300013308 Bacteria 730
380 Ga0163163_10099470 3300014325 Bacteria 2930
381 Ga0163163_10572113 3300014325 Bacteria 1193
382 Ga0163163_10637967 3300014325 Bacteria 1129
383 Ga0163163_11290074 3300014325 Bacteria 792
384 Ga0157380_10182027 3300014326 Bacteria 1847
385 Ga0157380_10489324 3300014326 Bacteria 1192
386 Ga0157380_10607391 3300014326 Bacteria 1083
387 Ga0157380_10882288 3300014326 Bacteria 919
388 Ga0157380_11340043 3300014326 Bacteria 764
389 Ga0157380_12103408 3300014326 Bacteria 627
390 Ga0157377_10025068 3300014745 Bacteria 3178
391 Ga0157377_10032370 3300014745 Bacteria 2847
392 Ga0157377_10257414 3300014745 Bacteria 1134
393 Ga0157377_10361655 3300014745 Bacteria 977
394 Ga0157377_10695170 3300014745 Bacteria 738
395 Ga0157379_10238466 3300014968 Bacteria 1649
396 Ga0157379_10307350 3300014968 Bacteria 1446
397 Ga0157379_10628827 3300014968 Bacteria 1004
398 Ga0157379_10791449 3300014968 Bacteria 895
399 Ga0157379_11217245 3300014968 Bacteria 725
400 Ga0157379_12083366 3300014968 Bacteria 562
401 Ga0157376_10009211 3300014969 Bacteria 7162
402 Ga0157376_10067884 3300014969 Bacteria 3017
403 Ga0157376_10071977 3300014969 Bacteria 2939
404 Ga0157376_10419604 3300014969 Bacteria 1298
405 Ga0157376_10626635 3300014969 Bacteria 1073
406 Ga0157376_10664279 3300014969 Bacteria 1044
407 Ga0157376_10665944 3300014969 Bacteria 1043
408 Ga0157376_10854361 3300014969 Bacteria 925
409 Ga0182007_10269138 3300015262 Bacteria 617
410 Ga0163161_10074617 3300017792 Bacteria 2487
411 Ga0163161_10139056 3300017792 Bacteria 1838
412 Ga0163161_10832945 3300017792 Bacteria 777
413 Ga0213872_10229734 3300021361 Bacteria 787
414 Ga0213876_10332027 3300021384 Bacteria 808
415 Ga0207425_1000926 3300025245 Bacteria 13967
416 Ga0209129_1000776 3300025258 Bacteria 20242
417 Ga0209565_1000504 3300025263 Bacteria 28431
418 Ga0207666_1011965 3300025271 Bacteria 1204
419 Ga0209673_1001382 3300025273 Bacteria 23815
420 Ga0209675_1000615 3300025291 Bacteria 25527
421 Ga0209025_1001649 3300025294 Bacteria 27534
422 Ga0209025_1039618 3300025294 Bacteria 2052
423 Ga0209758_1001416 3300025297 Bacteria 28400
424 Ga0209050_1045940 3300025298 Bacteria 1152
425 Ga0207426_1028434 3300025302 Bacteria 1853
426 Ga0209051_1011651 3300025303 Bacteria 4321
427 Ga0207697_10015671 3300025315 Bacteria 3129
428 Ga0207697_10068764 3300025315 Bacteria 1482
429 Ga0207697_10236487 3300025315 Bacteria 807
430 Ga0207656_10009116 3300025321 Bacteria 3679
431 Ga0207656_10050934 3300025321 Bacteria 1789
432 Ga0207656_10525113 3300025321 Bacteria 602
433 Ga0207682_10007094 3300025893 Bacteria 4487
434 Ga0207682_10020394 3300025893 Bacteria 2603
435 Ga0207682_10032166 3300025893 Bacteria 2108
436 Ga0207642_10014304 3300025899 Bacteria 2924
437 Ga0207642_10120442 3300025899 Bacteria 1352
438 Ga0207710_10039768 3300025900 Bacteria 2082
439 Ga0207688_10059588 3300025901 Bacteria 2150
440 Ga0207688_10550387 3300025901 Bacteria 725
441 Ga0207688_10738888 3300025901 Bacteria 623
442 Ga0207680_10042790 3300025903 Bacteria 2652
443 Ga0207680_10231929 3300025903 Bacteria 1269
444 Ga0207680_10989561 3300025903 Bacteria 602
445 Ga0207685_10416524 3300025905 Bacteria 692
446 Ga0207645_10024006 3300025907 Bacteria 3958
447 Ga0207645_10036857 3300025907 Bacteria 3140
448 Ga0207645_10049280 3300025907 Bacteria 2689
449 Ga0207645_10094609 3300025907 Bacteria 1923
450 Ga0207643_10022049 3300025908 Bacteria 3504
451 Ga0207643_10038007 3300025908 Bacteria 2703
452 Ga0207643_10069003 3300025908 Bacteria 2031
453 Ga0207643_10293772 3300025908 Bacteria 1010
454 Ga0207705_10246376 3300025909 Bacteria 1362
455 Ga0207705_10384122 3300025909 Bacteria 1085
456 Ga0207684_10292089 3300025910 Bacteria 1405
457 Ga0207684_10378162 3300025910 Bacteria 1218
458 Ga0207695_10650506 3300025913 Bacteria 935
459 Ga0207671_10389630 3300025914 Bacteria 1107
460 Ga0207662_10027480 3300025918 Bacteria 3283
461 Ga0207662_10048655 3300025918 Bacteria 2512
462 Ga0207662_10151688 3300025918 Bacteria 1474
463 Ga0207657_10351768 3300025919 Bacteria 1162
464 Ga0207657_10448391 3300025919 Bacteria 1013
465 Ga0207649_10042122 3300025920 Bacteria 2783
466 Ga0207649_10043787 3300025920 Bacteria 2739
467 Ga0207649_10182935 3300025920 Bacteria 1468
468 Ga0207646_10520945 3300025922 Bacteria 1070
469 Ga0207646_11178402 3300025922 Bacteria 672
470 Ga0207681_10058536 3300025923 Bacteria 2638
471 Ga0207681_10060204 3300025923 Bacteria 2605
472 Ga0207681_10407852 3300025923 Bacteria 1099
473 Ga0207681_10724204 3300025923 Bacteria 828
474 Ga0207694_10318671 3300025924 Bacteria 1283
475 Ga0207650_10039198 3300025925 Bacteria 3462
476 Ga0207650_10076420 3300025925 Bacteria 2530
477 Ga0207650_10156923 3300025925 Bacteria 1800
478 Ga0207650_10340688 3300025925 Bacteria 1231
479 Ga0207650_10597136 3300025925 Bacteria 928
480 Ga0207650_10650573 3300025925 Bacteria 889
481 Ga0207650_11135122 3300025925 Bacteria 665
482 Ga0207659_10039197 3300025926 Bacteria 3302
483 Ga0207659_10062289 3300025926 Bacteria 2692
484 Ga0207659_10064741 3300025926 Bacteria 2647
485 Ga0207659_10074484 3300025926 Bacteria 2488
486 Ga0207659_10114391 3300025926 Bacteria 2057
487 Ga0207659_10614830 3300025926 Bacteria 927
488 Ga0207659_11564648 3300025926 Bacteria 563
489 Ga0207687_10063790 3300025927 Bacteria 2610
490 Ga0207687_10107317 3300025927 Bacteria 2066
491 Ga0207687_10418214 3300025927 Bacteria 1106
492 Ga0207644_10061521 3300025931 Bacteria 2719
493 Ga0207644_10123525 3300025931 Bacteria 1973
494 Ga0207644_10150119 3300025931 Bacteria 1802
495 Ga0207644_10406741 3300025931 Bacteria 1113
496 Ga0207644_10539468 3300025931 Bacteria 965
497 Ga0207644_10805822 3300025931 Bacteria 785
498 Ga0207644_11081180 3300025931 Bacteria 674
499 Ga0207644_11590836 3300025931 Bacteria 548
500 Ga0207690_10558588 3300025932 Bacteria 931
501 Ga0207706_10030508 3300025933 Bacteria 4809
502 Ga0207706_10079062 3300025933 Bacteria 2892
503 Ga0207706_10083381 3300025933 Bacteria 2810
504 Ga0207706_10620160 3300025933 Bacteria 928
505 Ga0207706_10636007 3300025933 Bacteria 915
506 Ga0207706_11399828 3300025933 Bacteria 574
507 Ga0207686_10039080 3300025934 Bacteria 2877
508 Ga0207686_10058549 3300025934 Bacteria 2429
509 Ga0207686_11708408 3300025934 Bacteria 520
510 Ga0207709_10001297 3300025935 Bacteria 17815
511 Ga0207709_10043641 3300025935 Bacteria 2704
512 Ga0207709_10047422 3300025935 Bacteria 2612
513 Ga0207709_11134645 3300025935 Bacteria 643
514 Ga0207670_10056632 3300025936 Bacteria 2655
515 Ga0207669_10011933 3300025937 Bacteria 4251
516 Ga0207669_10038862 3300025937 Bacteria 2744
517 Ga0207669_10046658 3300025937 Bacteria 2561
518 Ga0207669_10067305 3300025937 Bacteria 2231
519 Ga0207669_10181162 3300025937 Bacteria 1510
520 Ga0207669_10333479 3300025937 Bacteria 1165
521 Ga0207669_11560305 3300025937 Bacteria 563
522 Ga0207704_10087065 3300025938 Bacteria 2039
523 Ga0207704_10211713 3300025938 Bacteria 1427
524 Ga0207691_10040029 3300025940 Bacteria 4333
525 Ga0207691_10063010 3300025940 Bacteria 3363
526 Ga0207691_10077354 3300025940 Bacteria 2998
527 Ga0207691_10105908 3300025940 Bacteria 2505
528 Ga0207691_10106314 3300025940 Bacteria 2500
529 Ga0207691_10413937 3300025940 Bacteria 1149
530 Ga0207691_10502002 3300025940 Bacteria 1030
531 Ga0207711_10013735 3300025941 Bacteria 6724
532 Ga0207711_10093791 3300025941 Bacteria 2644
533 Ga0207711_10110110 3300025941 Bacteria 2448
534 Ga0207689_10049132 3300025942 Bacteria 3481
535 Ga0207689_10055430 3300025942 Bacteria 3262
536 Ga0207689_10073327 3300025942 Bacteria 2812
537 Ga0207689_10315990 3300025942 Bacteria 1296
538 Ga0207689_10326866 3300025942 Bacteria 1273
539 Ga0207679_10000396 3300025945 Bacteria 31334
540 Ga0207679_10040847 3300025945 Bacteria 3323
541 Ga0207679_10329541 3300025945 Bacteria 1324
542 Ga0207679_10355725 3300025945 Bacteria 1277
543 Ga0207679_10625077 3300025945 Bacteria 972
544 Ga0207679_11456326 3300025945 Bacteria 628
545 Ga0207651_10016652 3300025960 Bacteria 4314
546 Ga0207651_10065040 3300025960 Bacteria 2555
547 Ga0207651_10114291 3300025960 Bacteria 2033
548 Ga0207651_10617112 3300025960 Bacteria 949
549 Ga0207651_10706541 3300025960 Bacteria 888
550 Ga0207651_10855538 3300025960 Bacteria 808
551 Ga0207712_10087705 3300025961 Bacteria 2283
552 Ga0207712_10383753 3300025961 Bacteria 1177
553 Ga0207712_11166413 3300025961 Bacteria 687
554 Ga0207712_11313085 3300025961 Bacteria 647
555 Ga0207668_10050249 3300025972 Bacteria 2872
556 Ga0207668_10055436 3300025972 Bacteria 2755
557 Ga0207640_10053606 3300025981 Bacteria 2633
558 Ga0207640_10151703 3300025981 Bacteria 1703
559 Ga0207640_10246140 3300025981 Bacteria 1385
560 Ga0207640_10727500 3300025981 Bacteria 853
561 Ga0207658_10063758 3300025986 Bacteria 2762
562 Ga0207658_10111608 3300025986 Bacteria 2162
563 Ga0207658_10343741 3300025986 Bacteria 1297
564 Ga0207658_10405921 3300025986 Bacteria 1198
565 Ga0207658_10581742 3300025986 Bacteria 1004
566 Ga0207677_10001022 3300026023 Bacteria 15412
567 Ga0207677_10042099 3300026023 Bacteria 3026
568 Ga0207677_10112778 3300026023 Bacteria 2028
569 Ga0207677_10182480 3300026023 Bacteria 1652
570 Ga0207677_10442469 3300026023 Bacteria 1112
571 Ga0207703_10070133 3300026035 Bacteria 2892
572 Ga0207639_10250788 3300026041 Bacteria 1543
573 Ga0207639_10289937 3300026041 Bacteria 1443
574 Ga0207639_11174350 3300026041 Bacteria 720
575 Ga0207678_10033815 3300026067 Bacteria 4453
576 Ga0207678_10426556 3300026067 Bacteria 1150
577 Ga0207708_10047563 3300026075 Bacteria 3265
578 Ga0207708_10417008 3300026075 Bacteria 1113
579 Ga0207708_10570256 3300026075 Bacteria 956
580 Ga0207702_10019663 3300026078 Bacteria 5590
581 Ga0207641_10002464 3300026088 Bacteria 17101
582 Ga0207641_10052783 3300026088 Bacteria 3444
583 Ga0207641_10208255 3300026088 Bacteria 1807
584 Ga0207641_10391387 3300026088 Bacteria 1333
585 Ga0207641_11151988 3300026088 Bacteria 774
586 Ga0207648_10053063 3300026089 Bacteria 3545
587 Ga0207648_10080227 3300026089 Bacteria 2847
588 Ga0207648_10093474 3300026089 Bacteria 2630
589 Ga0207648_10099291 3300026089 Bacteria 2549
590 Ga0207648_10106451 3300026089 Bacteria 2461
591 Ga0207648_10109563 3300026089 Bacteria 2424
592 Ga0207648_10143460 3300026089 Bacteria 2106
593 Ga0207648_10192390 3300026089 Bacteria 1808
594 Ga0207648_10545639 3300026089 Bacteria 1064
595 Ga0207648_10934914 3300026089 Bacteria 811
596 Ga0207648_11892747 3300026089 Bacteria 558
597 Ga0207676_10003641 3300026095 Bacteria 10902
598 Ga0207676_10046325 3300026095 Bacteria 3364
599 Ga0207676_10130206 3300026095 Bacteria 2138
600 Ga0207676_10771192 3300026095 Bacteria 936
601 Ga0207676_10962783 3300026095 Bacteria 839
602 Ga0207676_11902761 3300026095 Bacteria 594
603 Ga0207674_10058073 3300026116 Bacteria 3922
604 Ga0207674_10116483 3300026116 Bacteria 2643
605 Ga0207675_100071847 3300026118 Bacteria 3235
606 Ga0207675_100082492 3300026118 Bacteria 3015
607 Ga0207675_100692505 3300026118 Bacteria 1027
608 Ga0207675_101430581 3300026118 Bacteria 712
609 Ga0207683_10037384 3300026121 Bacteria 4227
610 Ga0207683_10088278 3300026121 Bacteria 2759
611 Ga0207683_10091033 3300026121 Bacteria 2717
612 Ga0207683_10091067 3300026121 Bacteria 2716
613 Ga0207683_10092732 3300026121 Bacteria 2691
614 Ga0207683_10108165 3300026121 Bacteria 2488
615 Ga0207683_10310334 3300026121 Bacteria 1444
616 Ga0207683_10476393 3300026121 Bacteria 1152
617 Ga0207683_10488481 3300026121 Bacteria 1137
618 Ga0207683_10785741 3300026121 Bacteria 883
619 Ga0207683_10832979 3300026121 Bacteria 856
620 Ga0207683_10978171 3300026121 Bacteria 786
621 Ga0207683_10999182 3300026121 Bacteria 777
622 Ga0207683_11063956 3300026121 Bacteria 751
623 Ga0207698_10105481 3300026142 Bacteria 2348
624 Ga0207698_10216124 3300026142 Bacteria 1729
625 Ga0207698_10232424 3300026142 Bacteria 1675
626 Ga0207698_10239255 3300026142 Bacteria 1653
627 Ga0207698_10917957 3300026142 Bacteria 883
628 Ga0207698_11157743 3300026142 Bacteria 787
629 Ga0207698_12224058 3300026142 Unclassified 561
630 Ga0209970_1084206 3300027614 Bacteria 599
631 Ga0209974_10206645 3300027876 Bacteria 727
632 Ga0207428_10330499 3300027907 Bacteria 1124
633 Ga0207428_10678392 3300027907 Bacteria 738
634 Ga0268266_10064123 3300028379 Bacteria 3173
635 Ga0268266_10544643 3300028379 Bacteria 1111
636 Ga0268266_11934383 3300028379 Bacteria 564
637 Ga0268266_12365495 3300028379 Bacteria 502
638 Ga0268265_10074435 3300028380 Bacteria 2656
639 Ga0268265_10137595 3300028380 Bacteria 2040
640 Ga0268265_10271221 3300028380 Bacteria 1513
641 Ga0268264_10021919 3300028381 Bacteria 5214
642 Ga0268264_10085176 3300028381 Bacteria 2712
643 Ga0268264_10259215 3300028381 Bacteria 1619
644 Ga0268264_10885871 3300028381 Bacteria 895
645 Ga0307517_10039878 3300028786 Bacteria 5139
646 Ga0307517_10135433 3300028786 Bacteria 1754
647 Ga0307515_10000048 3300028794 Bacteria 288111
648 Ga0307515_10000187 3300028794 Bacteria 151904
649 Ga0307515_10000354 3300028794 Bacteria 112621
650 Ga0307515_10031147 3300028794 Bacteria 8906
651 Ga0307515_10034493 3300028794 Bacteria 8279
652 Ga0307515_10111736 3300028794 Bacteria 3185
653 Ga0307515_10130888 3300028794 Bacteria 2765
654 Ga0307515_10143620 3300028794 Bacteria 2543
655 Ga0307515_10144441 3300028794 Bacteria 2529
656 Ga0307515_10144781 3300028794 Bacteria 2524
657 Ga0307515_10372388 3300028794 Bacteria 1064
658 Ga0307515_10562429 3300028794 Bacteria 750
659 Ga0307515_10568345 3300028794 Unclassified 744
660 Ga0265324_10016708 3300029957 Bacteria 2674
661 Ga0307511_10062707 3300030521 Bacteria 2817
662 Ga0307512_10072827 3300030522 Bacteria 2537
663 Ga0307512_10116001 3300030522 Bacteria 1741
664 Ga0307512_10141805 3300030522 Bacteria 1468
665 Ga0265327_10006575 3300031251 Bacteria 9242
666 Ga0265316_10051553 3300031344 Bacteria 3232
667 Ga0307513_10082094 3300031456 Bacteria 3319
668 Ga0307513_10090109 3300031456 Bacteria 3129
669 Ga0307513_10168038 3300031456 Bacteria 2075
670 Ga0307513_10314961 3300031456 Bacteria 1325
671 Ga0307513_10578174 3300031456 Bacteria 834
672 Ga0307513_10768453 3300031456 Bacteria 669
673 Ga0307509_10119727 3300031507 Bacteria 2613
674 Ga0307509_10127126 3300031507 Bacteria 2512
675 Ga0307509_10176668 3300031507 Bacteria 2007
676 Ga0307509_10247785 3300031507 Bacteria 1567
677 Ga0307509_10376125 3300031507 Bacteria 1135
678 Ga0307509_10420664 3300031507 Bacteria 1037
679 Ga0307509_10509228 3300031507 Bacteria 887
680 Ga0307509_10589643 3300031507 Bacteria 785
681 Ga0307509_10736952 3300031507 Bacteria 651
682 Ga0307509_11000616 3300031507 Bacteria 503
683 Ga0307408_100035027 3300031548 Bacteria 3520
684 Ga0307408_100342431 3300031548 Bacteria 1266
685 Ga0307408_100606510 3300031548 Bacteria 973
686 Ga0307508_10011522 3300031616 Bacteria 8079
687 Ga0307508_10057555 3300031616 Bacteria 3440
688 Ga0307508_10884575 3300031616 Bacteria 518
689 Ga0307514_10074170 3300031649 Bacteria 2540
690 Ga0307516_10402391 3300031730 Bacteria 1028
691 Ga0307405_10087861 3300031731 Bacteria 2050
692 Ga0307518_10059139 3300031838 Bacteria 2783
693 Ga0307412_10158344 3300031911 Bacteria 1679
694 Ga0307412_10464934 3300031911 Bacteria 1045
695 Ga0307412_10552596 3300031911 Bacteria 967
696 Ga0307507_10086362 3300033179 Bacteria 2721
697 Ga0307510_10025675 3300033180 Bacteria 6789
698 Ga0373930_0142526 3300034816 Bacteria 596
699 Ga0373948_0080709 3300034817 Bacteria 742
700 Ga0373950_0001176 3300034818 Bacteria 3365
701 Ga0373950_0036539 3300034818 Bacteria 927
702 Ga0373958_0011104 3300034819 Bacteria 1515
703 Ga0373959_0000855 3300034820 Bacteria 5159
704 Ga0373959_0002144 3300034820 Bacteria 3144
705 Ga0373959_0006382 3300034820 Bacteria 1956
706 Ga0373938_0004251 3300034957 Bacteria 2382
707 Ga0373940_0051012 3300035088 Bacteria 1162
708 Ga0373949_0009529 3300035090 Bacteria 2126
709 Ga0373951_0044867 3300035091 Bacteria 1074
710 Ga0373952_0238360 3300035092 Bacteria 546
711 Ga0373932_0004130 3300035112 Bacteria 3450
712 Ga0373939_0000765 3300035114 Bacteria 7930
713 Ga0373945_0215570 3300035116 Bacteria 801
714 Ga0373960_0002710 3300035121 Bacteria 4004
715 Ga0373960_0203754 3300035121 Unclassified 700
716 Ga0373961_0002554 3300035241 Bacteria 4689
717 Ga0373962_0018343 3300035242 Bacteria 1820
718 Ga0373931_0000220 3300035691 Bacteria 24301
719 Ga0373927_0623117 3300035695 Bacteria 713
720 Ga0373925_0158147 3300037068 Bacteria 1783
721 Ga0373925_0945184 3300037068 Bacteria 710
722 Ga0395905_0031696 3300037471 Bacteria 4973
723 Ga0395905_0096594 3300037471 Bacteria 2774
724 Ga0395905_0167568 3300037471 Bacteria 2064
725 Ga0395905_1560861 3300037471 Unclassified 565
726 Ga0436365_0074840 3300039437 Bacteria 1570
727 Ga0436365_1780463 3300039437 Bacteria 1335
728 Ga0436361_0513912 3300039447 Bacteria 1629
729 Ga0436361_0948675 3300039447 Bacteria 5275
730 Ga0436363_0803522 3300039450 Bacteria 518
731 Ga0439436_0011007 3300041404 Bacteria 2751
732 Ga0439436_0022873 3300041404 Bacteria 1851
733 Ga0439436_0056068 3300041404 Bacteria 1107
734 Ga0439438_023213 3300041405 Bacteria 1713
735 Ga0439438_053906 3300041405 Bacteria 1017
736 Ga0439439_0088153 3300041406 Unclassified 845
737 Ga0439461_0004317 3300041410 Bacteria 2371
738 Ga0439461_0025944 3300041410 Bacteria 1193
739 Ga0439466_0072591 3300041411 Bacteria 1094
740 Ga0439466_0158768 3300041411 Bacteria 692
741 Ga0439465_0280041 3300041413 Bacteria 621
742 Ga0451789_0035194 3300041443 Bacteria 1044
743 Ga0451789_0983965 3300041443 Bacteria 854
744 Ga0451793_0721010 3300041452 Bacteria 822
745 Ga0451797_0593584 3300041453 Bacteria 838
746 Ga0451798_1050243 3300041458 Bacteria 1860
747 Ga0451802_0207361 3300041460 Bacteria 1193
748 Ga0451804_1068077 3300041463 Bacteria 852
749 Ga0451833_0889723 3300041491 Bacteria 1047
750 Ga0451835_1034774 3300041492 Bacteria 565
751 Ga0451837_1138718 3300041494 Bacteria 1035
752 Ga0451841_0856228 3300041498 Bacteria 640
753 Ga0451847_0005316 3300041503 Bacteria 765
754 Ga0451849_1221059 3300041505 Bacteria 1024
755 Ga0451849_1295352 3300041505 Bacteria 631
756 Ga0451843_0583165 3300041509 Bacteria 1403
757 Ga0451855_0372937 3300041511 Bacteria 729
758 Ga0451853_0685318 3300041512 Bacteria 783
759 Ga0451853_1184622 3300041512 Bacteria 1706
760 Ga0451853_1789136 3300041512 Bacteria 720
761 Ga0439431_0009410 3300041997 Bacteria 2207
762 Ga0439431_0014832 3300041997 Bacteria 1809
763 Ga0439431_0018651 3300041997 Bacteria 1643
764 Ga0439433_0019958 3300041999 Bacteria 1495
765 Ga0439437_001649 3300042000 Bacteria 2360
766 Ga0439437_007018 3300042000 Bacteria 1254
767 Ga0439442_002632 3300042002 Bacteria 3523
768 Ga0439445_0059132 3300042004 Bacteria 1045
769 Ga0439445_0079295 3300042004 Bacteria 916
770 Ga0439448_0056094 3300042005 Bacteria 1296
771 Ga0439432_119905 3300042006 Bacteria 779
772 Ga0439449_0003396 3300042007 Bacteria 6202
773 Ga0439449_0022194 3300042007 Bacteria 2375
774 Ga0439449_0147619 3300042007 Bacteria 877
775 Ga0439450_002449 3300042008 Bacteria 2919
776 Ga0439457_006496 3300042014 Bacteria 2863
777 Ga0439457_098147 3300042014 Unclassified 681
778 Ga0439457_101229 3300042014 Bacteria 672
779 Ga0439462_0016954 3300042015 Bacteria 1886
780 Ga0439462_0164472 3300042015 Unclassified 626
781 Ga0450911_000146 3300042115 Bacteria 28932
782 Ga0450913_005318 3300042117 Bacteria 914
783 Ga0450914_007038 3300042118 Bacteria 1005
784 Ga0450919_011767 3300042121 Bacteria 994
785 Ga0450923_070691 3300042125 Bacteria 773
786 Ga0450892_017223 3300042130 Bacteria 685
787 Ga0450896_011401 3300042133 Bacteria 1251
788 Ga0450896_023391 3300042133 Bacteria 913
789 Ga0450898_001281 3300042134 Bacteria 3270
790 Ga0450898_007798 3300042134 Bacteria 1674
791 Ga0450899_003972 3300042135 Bacteria 1583
792 Ga0450905_001092 3300042142 Bacteria 3407
793 Ga0450889_002823 3300042144 Bacteria 1718
794 Ga0439446_0033900 3300042156 Bacteria 1484
795 Ga0439458_0003779 3300042157 Bacteria 3504
796 Ga0450908_111839 3300042184 Bacteria 505
797 Ga0450909_048766 3300042185 Bacteria 659
798 Ga0439434_0008144 3300042435 Bacteria 3072
799 Ga0439444_0001387 3300042437 Bacteria 3125
800 Ga0439464_0001930 3300042439 Bacteria 5011
801 Ga0439460_0005930 3300042461 Bacteria 3012
802 Ga0450918_003611 3300042531 Bacteria 2864
803 Ga0451577_1813348 3300042876 Bacteria 535
804 Ga0439440_0004451 3300042993 Bacteria 2751
805 Ga0466961_0016694 3300044693 Bacteria 4720
806 Ga0466961_0055980 3300044693 Bacteria 2513
807 Ga0466964_0711452 3300044706 Unclassified 561
808 Ga0466964_0829781 3300044706 Bacteria 524
809 Ga0466971_0166235 3300044719 Bacteria 1034
810 Ga0466957_0506843 3300044842 Bacteria 837
811 Ga0466957_0853949 3300044842 Unclassified 649
812 Ga0466960_0464550 3300044901 Bacteria 737
813 Ga0451576_0183338 3300045051 Bacteria 2185
814 Ga0451576_0547639 3300045051 Bacteria 1215
815 Ga0451576_1792059 3300045051 Bacteria 635
816 Ga0451576_1844840 3300045051 Bacteria 624
817 Ga0466958_0351034 3300045836 Bacteria 949
818 Ga0495592_0026238 3300046454 Bacteria 4418
819 Ga0495592_0041014 3300046454 Bacteria 3470
820 Ga0495592_0086135 3300046454 Bacteria 2263
821 Ga0495603_0485794 3300046455 Bacteria 707
822 Ga0495590_0346673 3300046457 Bacteria 564
823 Ga0495591_108715 3300046458 Bacteria 682
824 Ga0495638_0145522 3300046460 Bacteria 1379
825 Ga0495650_0006341 3300046471 Bacteria 7393
826 Ga0495650_0035902 3300046471 Bacteria 2176
827 Ga0495650_0169285 3300046471 Bacteria 774
828 Ga0495650_0323592 3300046471 Bacteria 513
829 Ga0495639_0008551 3300046475 Bacteria 4390
830 Ga0495596_0051291 3300046500 Bacteria 1616
831 Ga0495606_0208930 3300046507 Bacteria 1107
832 Ga0495606_0568564 3300046507 Bacteria 561
833 Ga0495608_0048925 3300046511 Bacteria 2808
834 Ga0495610_0048050 3300046512 Bacteria 2096
835 Ga0495616_0029331 3300046513 Bacteria 2906
836 Ga0495618_0015068 3300046514 Bacteria 4716
837 Ga0495618_0118377 3300046514 Bacteria 1696
838 Ga0495618_0159301 3300046514 Bacteria 1439
839 Ga0495620_0022401 3300046515 Bacteria 3042
840 Ga0495628_0185528 3300046516 Bacteria 1572
841 Ga0495628_0406179 3300046516 Unclassified 994
842 Ga0495628_1171840 3300046516 Bacteria 522
843 Ga0495630_1059650 3300046517 Bacteria 615
844 Ga0495631_0056543 3300046518 Bacteria 1708
845 Ga0495632_0024364 3300046519 Bacteria 3215
846 Ga0495632_0243080 3300046519 Bacteria 809
847 Ga0495643_0043034 3300046522 Bacteria 2459
848 Ga0495643_0063705 3300046522 Bacteria 1949
849 Ga0495643_0075288 3300046522 Bacteria 1766
850 Ga0495643_0201040 3300046522 Bacteria 956
851 Ga0495648_0079658 3300046524 Bacteria 1869
852 Ga0495663_0070035 3300046525 Bacteria 1115
853 Ga0495642_0425487 3300046528 Bacteria 586
854 Ga0495654_0079330 3300046530 Bacteria 1542
855 Ga0495654_0155770 3300046530 Bacteria 1007
856 Ga0495587_0581955 3300046536 Bacteria 617
857 Ga0495598_0003043 3300046537 Bacteria 3519
858 Ga0495598_0006332 3300046537 Bacteria 2670
859 Ga0495598_0072520 3300046537 Bacteria 1087
860 Ga0495598_0108543 3300046537 Bacteria 927
861 Ga0495598_0146527 3300046537 Bacteria 821
862 Ga0495621_0021047 3300046539 Bacteria 2146
863 Ga0495621_0028201 3300046539 Bacteria 1907
864 Ga0495621_0063382 3300046539 Bacteria 1347
865 Ga0495621_0093023 3300046539 Bacteria 1138
866 Ga0495621_0099644 3300046539 Bacteria 1104
867 Ga0495621_0230239 3300046539 Bacteria 752
868 Ga0495597_0013035 3300046542 Bacteria 3991
869 Ga0495597_0305926 3300046542 Bacteria 616
870 Ga0495633_0158467 3300046558 Bacteria 1044
871 Ga0495668_0067386 3300046616 Bacteria 1969
872 Ga0495668_0095169 3300046616 Bacteria 1630
873 Ga0495668_0158172 3300046616 Bacteria 1241
874 Ga0495634_0343908 3300046642 Bacteria 894
875 Ga0495625_0042920 3300046660 Bacteria 3283
876 Ga0495625_0058366 3300046660 Bacteria 2742
877 Ga0495588_0594164 3300046674 Bacteria 580
878 Ga0495646_0334011 3300046680 Bacteria 796
879 Ga0495658_0350164 3300046683 Bacteria 939
880 Ga0495669_0024220 3300046684 Bacteria 2644
881 Ga0495613_0033204 3300046689 Bacteria 3834
882 Ga0495613_0058183 3300046689 Bacteria 2837
883 Ga0495613_0263195 3300046689 Bacteria 1201
884 Ga0495624_0746435 3300046690 Bacteria 580
885 Ga0495670_0035271 3300046691 Bacteria 2493
886 Ga0495670_0450932 3300046691 Bacteria 697
887 Ga0495660_0167675 3300046810 Bacteria 1072
888 Ga0495672_0487820 3300047320 Bacteria 550
889 Ga0495676_0879282 3300047321 Bacteria 575
890 Ga0495676_1039684 3300047321 Bacteria 522
891 Ga0495680_0066809 3300047322 Bacteria 2751
892 Ga0495687_008993 3300047443 Bacteria 5645
893 Ga0495687_009715 3300047443 Bacteria 5348
894 Ga0495681_0030098 3300047470 Bacteria 2769
895 Ga0495681_0136415 3300047470 Bacteria 1040
896 Ga0495686_0006359 3300047472 Bacteria 9063
897 Ga0495686_0039912 3300047472 Bacteria 2996
898 Ga0495602_0236558 3300048088 Bacteria 1369
899 Ga0495614_0077300 3300048089 Bacteria 1439
900 Ga0495614_0125335 3300048089 Bacteria 1134
901 Ga0495626_0020181 3300048091 Bacteria 3324
902 Ga0495626_0138550 3300048091 Bacteria 1033
903 Ga0496100_0082998 3300048903 Bacteria 2168
904 Ga0496101_0070584 3300048904 Bacteria 2558
905 Ga0496101_1002278 3300048904 Bacteria 657
906 Ga0496102_0474779 3300048905 Bacteria 1172
907 Ga0496102_0546860 3300048905 Bacteria 1081
908 Ga0496102_0676938 3300048905 Bacteria 955
909 Ga0496102_1337828 3300048905 Bacteria 635
910 Ga0496104_0213463 3300048907 Bacteria 1841
911 Ga0496105_0085233 3300048908 Bacteria 2610
912 Ga0496106_0054871 3300048909 Bacteria 3011
913 Ga0496106_1435662 3300048909 Bacteria 532
914 Ga0496107_0064362 3300048910 Bacteria 2658
915 Ga0496108_0079625 3300048911 Bacteria 2774
916 Ga0496108_0081300 3300048911 Bacteria 2745
917 Ga0496108_1298871 3300048911 Bacteria 612
918 Ga0496109_0102899 3300048912 Bacteria 2650
919 Ga0496109_0109869 3300048912 Bacteria 2563
920 Ga0496109_0216355 3300048912 Bacteria 1802
921 Ga0496109_0889982 3300048912 Bacteria 828
922 Ga0496109_1257199 3300048912 Bacteria 676
923 Ga0496110_0090024 3300048913 Bacteria 2743
924 Ga0496110_0102308 3300048913 Bacteria 2569
925 Ga0496111_0064219 3300048914 Bacteria 2663
926 Ga0496112_1286390 3300048915 Bacteria 647
927 Ga0496113_0101244 3300048916 Bacteria 2233
928 Ga0496113_0782920 3300048916 Bacteria 758
929 Ga0496113_1359612 3300048916 Bacteria 551
930 Ga0496113_1398112 3300048916 Bacteria 542
931 Ga0496114_0077799 3300048917 Bacteria 2797
932 Ga0496114_0411677 3300048917 Bacteria 1197
933 Ga0496114_0669251 3300048917 Bacteria 912
934 Ga0496114_0762747 3300048917 Bacteria 845
935 Ga0496121_0000762 3300048924 Bacteria 59172
936 Ga0496121_0126498 3300048924 Bacteria 1920
937 Ga0496125_0018914 3300048928 Bacteria 6520
938 Ga0496126_0025976 3300048929 Bacteria 5623
939 Ga0501292_025896 3300049515 Bacteria 968
940 Ga0501042_0412268 3300049578 Bacteria 979
941 Ga0501072_0307739 3300049588 Bacteria 1260
942 Ga0501253_041813 3300049683 Bacteria 926
943 Ga0501265_012261 3300049762 Bacteria 1066
944 Ga0501267_021967 3300049764 Bacteria 709
945 Ga0501044_0594496 3300049823 Bacteria 1000
946 Ga0501044_1620704 3300049823 Bacteria 512
947 nmdc:mga03n38_844681_c1 3300050490 Bacteria 535
948 nmdc:mga00v17_166472_c1 3300050491 Bacteria 1420
949 nmdc:mga0k408_123064_c1 3300050493 Bacteria 1537
950 nmdc:mga0k408_214305_c1 3300050493 Bacteria 1150
951 nmdc:mga0k408_31499_c1 3300050493 Bacteria 3028
952 nmdc:mga0k408_40114_c1 3300050493 Bacteria 2693
953 nmdc:mga0k408_412962_c1 3300050493 Bacteria 803
954 nmdc:mga0k408_4713_c1 3300050493 Bacteria 7225
955 nmdc:mga0k408_57992_c1 3300050493 Bacteria 2249
956 nmdc:mga07m45_32694_c1 3300050496 Bacteria 2885
957 nmdc:mga07m45_342908_c1 3300050496 Bacteria 868
958 nmdc:mga07m45_416291_c1 3300050496 Bacteria 780
959 nmdc:mga08y16_133945_c1 3300050511 Bacteria 2575
960 nmdc:mga0a205_948519_c1 3300050515 Bacteria 707
961 Ga0500643_014100 3300053087 Bacteria 2793
962 Ga0500644_0001461 3300053088 Bacteria 6230
963 Ga0500647_0375916 3300053091 Unclassified 583
964 Ga0500651_0063135 3300053093 Bacteria 2312
965 Ga0500651_0132763 3300053093 Bacteria 1505
966 Ga0500654_232848 3300053099 Bacteria 512
967 Ga0500554_012385 3300053102 Bacteria 2143
968 Ga0500562_086293 3300053108 Bacteria 851
969 Ga0500572_049909 3300053111 Bacteria 1243
970 Ga0500572_087864 3300053111 Bacteria 981
971 Ga0500593_106564 3300053117 Bacteria 1159
972 Ga0500594_0045728 3300053118 Bacteria 1215
973 Ga0500594_0097071 3300053118 Bacteria 902
974 Ga0500597_022505 3300053120 Bacteria 2507
975 Ga0500626_011743 3300053128 Bacteria 3727
976 Ga0500642_0211930 3300053130 Bacteria 899
977 Ga0500655_000060 3300053133 Bacteria 30372
978 Ga0500559_0003343 3300053136 Bacteria 7938
979 Ga0500559_0122587 3300053136 Bacteria 1209
980 Ga0500568_0009438 3300053139 Bacteria 4635
981 Ga0500574_000857 3300053141 Bacteria 4157
982 Ga0500590_103117 3300053148 Bacteria 1366
983 Ga0500604_0002110 3300053151 Bacteria 5469
984 Ga0500627_0056916 3300053158 Bacteria 1714
985 Ga0500627_0230879 3300053158 Bacteria 823
986 Ga0500627_0231864 3300053158 Bacteria 821
987 Ga0500634_0013930 3300053161 Bacteria 4231
988 Ga0500638_006592 3300053162 Bacteria 4770
989 Ga0500638_155808 3300053162 Bacteria 1011
990 Ga0500611_001664 3300053727 Bacteria 2506
991 Ga0500596_085989 3300053735 Bacteria 552
992 Ga0590071_046372 3300059421 Bacteria 1050
993 Ga0466962_0219895 3300061719 Bacteria 930
994 2644060912 2643221609 Bacteria 6756331
995 2738723579 2738541277 Bacteria 7458140
996 2738886241 2738541307 Bacteria 8606193
997 2739284310 2738543019 Bacteria 7459457
998 2819602868 2818991446 Bacteria 7757362
999 2928078521 2928070936 Bacteria 8062541
1000 Ga0439459_0050755
1001 JGI24746J21847_1008557
1002 JGI24746J21847_1016033
1003 JGI24747J21853_1002566
1004 JGI24740J21852_10022439
1005 JGI24740J21852_10026796
1006 JGI24743J22301_10010853
1007 JGI24735J21928_10003492
1008 JGI24735J21928_10006917
1009 JGI24735J21928_10013752
1010 JGI24735J21928_10049156
1011 JGI24745J21846_1007335
1012 JGI24738J21930_10037536
1013 JGI24738J21930_10047938
1014 JGI24738J21930_10058704
1015 JGI24749J21850_1002272
1016 JGI24744J21845_10000546
1017 JGI24744J21845_10002063
1018 JGI24744J21845_10012863
1019 JGI24744J21845_10014587
1020 JGI24744J21845_10015111
1021 JGI24035J26624_1024462
1022 JGI24033J26618_1001024
1023 JGI24033J26618_1023458
1024 JGI24033J26618_1041460
1025 JGI24034J26672_10006509
1026 JGI24034J26672_10006646
1027 JGI24742J22300_10003701
1028 JGI24742J22300_10058459
1029 JGI25152J39213_1021668
1030 rootH1_10022611
1031 Ga0055540_1007059
1032 Ga0065712_10088924
1033 Ga0065712_10151304
1034 Ga0065715_10104929
1035 Ga0065715_10106561
1036 Ga0065715_10113579
1037 Ga0065707_10544037
1038 Ga0070658_10647369
1039 Ga0070658_10976318
1040 Ga0070676_10033783
1041 Ga0070676_10039378
1042 Ga0070676_10062913
1043 Ga0070676_10086074
1044 Ga0070676_10117958
1045 Ga0070690_100055561
1046 Ga0070690_100079351
1047 Ga0070670_100034722
1048 Ga0070670_100077375
1049 Ga0070670_100125395
1050 Ga0070670_100141414
1051 Ga0070670_100651065
1052 Ga0070677_10021084
1053 Ga0070677_10022003
1054 Ga0070677_10133016
1055 Ga0070677_10512445
1056 Ga0070677_10757933
1057 Ga0068869_100054891
1058 Ga0068869_100069693
1059 Ga0068869_100254044
1060 Ga0068869_100461470
1061 Ga0068869_100959533
1062 Ga0068869_101173928
1063 Ga0070666_10032492
1064 Ga0070666_10070455
1065 Ga0070666_10136874
1066 Ga0068868_100059339
1067 Ga0068868_100085704
1068 Ga0068868_100103601
1069 Ga0068868_100326371
1070 Ga0068868_100330066
1071 Ga0068868_100356036
1072 Ga0068868_100445740
1073 Ga0070689_100009091
1074 Ga0070689_100681910
1075 Ga0070687_100022395
1076 Ga0070661_100019361
1077 Ga0070661_100053826
1078 Ga0070661_100170282
1079 Ga0070661_100261095
1080 Ga0070661_100684613
1081 Ga0070692_10132732
1082 Ga0070692_10210756
1083 Ga0070668_100075099
1084 Ga0070668_100089721
1085 Ga0070668_100179790
1086 Ga0070668_100445735
1087 Ga0070668_100735894
1088 Ga0070669_100046424
1089 Ga0070669_100057796
1090 Ga0070669_100111464
1091 Ga0070669_100382129
1092 Ga0070669_100724857
1093 Ga0070669_100896952
1094 Ga0070675_100048175
1095 Ga0070675_100106540
1096 Ga0070675_100247721
1097 Ga0070675_100552497
1098 Ga0070675_100755770
1099 Ga0070675_100936947
1100 Ga0070675_101277700
1101 Ga0070675_101759537
1102 Ga0070675_101964082
1103 Ga0070671_100060170
1104 Ga0070671_100107518
1105 Ga0070671_100152400
1106 Ga0070671_100210192
1107 Ga0070671_100221147
1108 Ga0070671_100240284
1109 Ga0070671_100594705
1110 Ga0070674_100023873
1111 Ga0070674_100056264
1112 Ga0070674_100158446
1113 Ga0070674_100178518
1114 Ga0070674_100195778
1115 Ga0070674_100227292
1116 Ga0070674_100296687
1117 Ga0070674_100384458
1118 Ga0070674_100505010
1119 Ga0070673_100024340
1120 Ga0070673_100056697
1121 Ga0070673_100287705
1122 Ga0070673_100320159
1123 Ga0070673_100489219
1124 Ga0070673_100724347
1125 Ga0070688_100004924
1126 Ga0070688_100204317
1127 Ga0070688_100563490
1128 Ga0070688_100991018
1129 Ga0070659_100088147
1130 Ga0070659_100332309
1131 Ga0070667_100059120
1132 Ga0070667_100074581
1133 Ga0070667_100262581
1134 Ga0070667_100353245
1135 Ga0070667_100556175
1136 Ga0070667_100603537
1137 Ga0070701_10025016
1138 Ga0070705_100226274
1139 Ga0070700_100037965
1140 Ga0070708_100061511
1141 Ga0070708_100141970
1142 Ga0070663_100068888
1143 Ga0070663_100079432
1144 Ga0070663_100964894
1145 Ga0070678_100043176
1146 Ga0070678_100072390
1147 Ga0070678_100081206
1148 Ga0070678_100081397
1149 Ga0070678_100093330
1150 Ga0070678_100192564
1151 Ga0070678_100663371
1152 Ga0070678_100886021
1153 Ga0070678_100955688
1154 Ga0070678_101062681
1155 Ga0070678_101423332
1156 Ga0070662_100031707
1157 Ga0070662_100058310
1158 Ga0070662_100771126
1159 Ga0070662_101283459
1160 Ga0070662_101666024
1161 Ga0068867_100049623
1162 Ga0068867_100058808
1163 Ga0068867_100066318
1164 Ga0068867_100169343
1165 Ga0068867_100224160
1166 Ga0068867_100556904
1167 Ga0070685_10033337
1168 Ga0070685_10041936
1169 Ga0070685_10625959
1170 Ga0070685_10722232
1171 Ga0070685_11333569
1172 Ga0070706_100364227
1173 Ga0070706_100369182
1174 Ga0070706_100670600
1175 Ga0070706_101448786
1176 Ga0070707_100609582
1177 Ga0070707_100774711
1178 Ga0070699_100082485
1179 Ga0070699_100463848
1180 Ga0068853_100278700
1181 Ga0068853_100289399
1182 Ga0068853_100383984
1183 Ga0068853_100806648
1184 Ga0070672_100038632
1185 Ga0070672_100045720
1186 Ga0070672_100058561
1187 Ga0070672_100113509
1188 Ga0070672_100160944
1189 Ga0070672_100177777
1190 Ga0070672_100400845
1191 Ga0070672_100555183
1192 Ga0070686_100042827
1193 Ga0070686_100087590
1194 Ga0070665_100112058
1195 Ga0070665_100569826
1196 Ga0070665_100619873
1197 Ga0070665_102295270
1198 Ga0070664_100000608
1199 Ga0070664_100076310
1200 Ga0070664_100096961
1201 Ga0070664_100119106
1202 Ga0070664_101259914
1203 Ga0068857_100100240
1204 Ga0068857_100987200
1205 Ga0068854_100029807
1206 Ga0068854_100162481
1207 Ga0068854_100190790
1208 Ga0068854_100287299
1209 Ga0068854_100858295
1210 Ga0068856_100034558
1211 Ga0070702_100052280
1212 Ga0070702_100137130
1213 Ga0070702_100491913
1214 Ga0068852_100142797
1215 Ga0068852_100185813
1216 Ga0068852_100236838
1217 Ga0068852_100945665
1218 Ga0068852_101025284
1219 Ga0068852_101262161
1220 Ga0068852_102669683
1221 Ga0068859_100087807
1222 Ga0068859_100242914
1223 Ga0068859_102829297
1224 Ga0068864_100058907
1225 Ga0068864_100068131
1226 Ga0068864_100088389
1227 Ga0068864_100201411
1228 Ga0068864_100270659
1229 Ga0068864_100478821
1230 Ga0068864_100671174
1231 Ga0068864_100799958
1232 Ga0068864_102098850
1233 Ga0068866_10049806
1234 Ga0068866_10103166
1235 Ga0068861_100085732
1236 Ga0068861_100098008
1237 Ga0068861_100410158
1238 Ga0068861_102657728
1239 Ga0068851_10028989
1240 Ga0068851_10303365
1241 Ga0068870_10014940
1242 Ga0068870_10049677
1243 Ga0068870_10644844
1244 Ga0068870_10851015
1245 Ga0068870_10917697
1246 Ga0068863_100083478
1247 Ga0068863_100208702
1248 Ga0068863_100405798
1249 Ga0068863_100887403
1250 Ga0068863_100968357
1251 Ga0068863_101768379
1252 Ga0068858_100292203
1253 Ga0068858_100517159
1254 Ga0068858_101706526
1255 Ga0068860_100029987
1256 Ga0068860_100109164
1257 Ga0068860_100430435
1258 Ga0068860_100455719
1259 Ga0068860_101144354
1260 Ga0068860_102380544
1261 Ga0068862_100088607
1262 Ga0068862_101933037
1263 Ga0075364_10182496
1264 Ga0075432_10351928
1265 Ga0070715_10734022
1266 Ga0075367_10319038
1267 Ga0075369_10433486
1268 Ga0075366_10021874
1269 Ga0075366_10030294
1270 Ga0075366_10063795
1271 Ga0075366_10173767
1272 Ga0075366_10276264
1273 Ga0075366_11024531
1274 Ga0097621_100063706
1275 Ga0097621_100074313
1276 Ga0097621_100275915
1277 Ga0097621_100384690
1278 Ga0097621_100390296
1279 Ga0097621_100399275
1280 Ga0075370_10024278
1281 Ga0075370_10099412
1282 Ga0075370_10390674
1283 Ga0068871_100162511
1284 Ga0068871_100191629
1285 Ga0068871_100337878
1286 Ga0068871_100630725
1287 Ga0075428_101997405
1288 Ga0075433_11191588
1289 Ga0068865_100105259
1290 Ga0068865_100188375
1291 Ga0068865_101320729
1292 Ga0068865_101667913
1293 Ga0097620_100087800
1294 Ga0097620_100242922
1295 Ga0097620_102828313
1296 Ga0099794_10608982
1297 Ga0105240_10616762
1298 Ga0111539_10569237
1299 Ga0111539_10619707
1300 Ga0111539_10827597
1301 Ga0111539_10886874
1302 Ga0111539_10950063
1303 Ga0105245_10060483
1304 Ga0105245_10367143
1305 Ga0105247_10121409
1306 Ga0114129_11458820
1307 Ga0105243_10035190
1308 Ga0105243_10069182
1309 Ga0105243_10084060
1310 Ga0105243_11160511
1311 Ga0105241_12182432
1312 Ga0105242_10067616
1313 Ga0105242_10072268
1314 Ga0105242_10113848
1315 Ga0105242_10218946
1316 Ga0105242_12182762
1317 Ga0105248_10004858
1318 Ga0105248_10161902
1319 Ga0105248_10255587
1320 Ga0105248_10400166
1321 Ga0105248_10483514
1322 Ga0105248_10581750
1323 Ga0105248_10835244
1324 Ga0105237_10165742
1325 Ga0105238_10915313
1326 Ga0105238_11260070
1327 Ga0105249_10092922
1328 Ga0105249_10209836
1329 Ga0105249_10248471
1330 Ga0105249_10312910
1331 Ga0105249_10629059
1332 Ga0105239_10098568
1333 Ga0105239_10226021
1334 Ga0105239_11350460
1335 Ga0105246_10043453
1336 Ga0105246_10086834
1337 Ga0105246_10419786
1338 Ga0105246_10733668
1339 Ga0105246_11177053
1340 Ga0105246_11417017
1341 Ga0157329_1025237
1342 Ga0157324_1004541
1343 Ga0157373_10015300
1344 Ga0157373_10221664
1345 Ga0157373_10324704
1346 Ga0157369_10001966
1347 Ga0157374_10054519
1348 Ga0157374_10070856
1349 Ga0157374_10105947
1350 Ga0157374_10120808
1351 Ga0157374_10173954
1352 Ga0157374_10381121
1353 Ga0157374_10563095
1354 Ga0157374_10888715
1355 Ga0157374_11242107
1356 Ga0157378_10050171
1357 Ga0157378_10061843
1358 Ga0157378_10104953
1359 Ga0157378_10130748
1360 Ga0157378_10599801
1361 Ga0157378_10755969
1362 Ga0157378_12691935
1363 Ga0163162_10100056
1364 Ga0163162_10118736
1365 Ga0163162_10128551
1366 Ga0163162_10147703
1367 Ga0163162_10148963
1368 Ga0163162_10699993
1369 Ga0163162_11031378
1370 Ga0157375_10032141
1371 Ga0157375_10045915
1372 Ga0157375_10098581
1373 Ga0157375_10150529
1374 Ga0157375_10265116
1375 Ga0157375_11050687
1376 Ga0157375_11139157
1377 Ga0157375_11454801
1378 Ga0157375_11780567
1379 Ga0163163_10099470
1380 Ga0163163_10572113
1381 Ga0163163_10637967
1382 Ga0163163_11290074
1383 Ga0157380_10182027
1384 Ga0157380_10489324
1385 Ga0157380_10607391
1386 Ga0157380_10882288
1387 Ga0157380_11340043
1388 Ga0157380_12103408
1389 Ga0157377_10025068
1390 Ga0157377_10032370
1391 Ga0157377_10257414
1392 Ga0157377_10361655
1393 Ga0157377_10695170
1394 Ga0157379_10238466
1395 Ga0157379_10307350
1396 Ga0157379_10628827
1397 Ga0157379_10791449
1398 Ga0157379_11217245
1399 Ga0157379_12083366
1400 Ga0157376_10009211
1401 Ga0157376_10067884
1402 Ga0157376_10071977
1403 Ga0157376_10419604
1404 Ga0157376_10626635
1405 Ga0157376_10664279
1406 Ga0157376_10665944
1407 Ga0157376_10854361
1408 Ga0182007_10269138
1409 Ga0163161_10074617
1410 Ga0163161_10139056
1411 Ga0163161_10832945
1412 Ga0213872_10229734
1413 Ga0213876_10332027
1414 Ga0207425_1000926
1415 Ga0209129_1000776
1416 Ga0209565_1000504
1417 Ga0207666_1011965
1418 Ga0209673_1001382
1419 Ga0209675_1000615
1420 Ga0209025_1001649
1421 Ga0209025_1039618
1422 Ga0209758_1001416
1423 Ga0209050_1045940
1424 Ga0207426_1028434
1425 Ga0209051_1011651
1426 Ga0207697_10015671
1427 Ga0207697_10068764
1428 Ga0207697_10236487
1429 Ga0207656_10009116
1430 Ga0207656_10050934
1431 Ga0207656_10525113
1432 Ga0207682_10007094
1433 Ga0207682_10020394
1434 Ga0207682_10032166
1435 Ga0207642_10014304
1436 Ga0207642_10120442
1437 Ga0207710_10039768
1438 Ga0207688_10059588
1439 Ga0207688_10550387
1440 Ga0207688_10738888
1441 Ga0207680_10042790
1442 Ga0207680_10231929
1443 Ga0207680_10989561
1444 Ga0207685_10416524
1445 Ga0207645_10024006
1446 Ga0207645_10036857
1447 Ga0207645_10049280
1448 Ga0207645_10094609
1449 Ga0207643_10022049
1450 Ga0207643_10038007
1451 Ga0207643_10069003
1452 Ga0207643_10293772
1453 Ga0207705_10246376
1454 Ga0207705_10384122
1455 Ga0207684_10292089
1456 Ga0207684_10378162
1457 Ga0207695_10650506
1458 Ga0207671_10389630
1459 Ga0207662_10027480
1460 Ga0207662_10048655
1461 Ga0207662_10151688
1462 Ga0207657_10351768
1463 Ga0207657_10448391
1464 Ga0207649_10042122
1465 Ga0207649_10043787
1466 Ga0207649_10182935
1467 Ga0207646_10520945
1468 Ga0207646_11178402
1469 Ga0207681_10058536
1470 Ga0207681_10060204
1471 Ga0207681_10407852
1472 Ga0207681_10724204
1473 Ga0207694_10318671
1474 Ga0207650_10039198
1475 Ga0207650_10076420
1476 Ga0207650_10156923
1477 Ga0207650_10340688
1478 Ga0207650_10597136
1479 Ga0207650_10650573
1480 Ga0207650_11135122
1481 Ga0207659_10039197
1482 Ga0207659_10062289
1483 Ga0207659_10064741
1484 Ga0207659_10074484
1485 Ga0207659_10114391
1486 Ga0207659_10614830
1487 Ga0207659_11564648
1488 Ga0207687_10063790
1489 Ga0207687_10107317
1490 Ga0207687_10418214
1491 Ga0207644_10061521
1492 Ga0207644_10123525
1493 Ga0207644_10150119
1494 Ga0207644_10406741
1495 Ga0207644_10539468
1496 Ga0207644_10805822
1497 Ga0207644_11081180
1498 Ga0207644_11590836
1499 Ga0207690_10558588
1500 Ga0207706_10030508
1501 Ga0207706_10079062
1502 Ga0207706_10083381
1503 Ga0207706_10620160
1504 Ga0207706_10636007
1505 Ga0207706_11399828
1506 Ga0207686_10039080
1507 Ga0207686_10058549
1508 Ga0207686_11708408
1509 Ga0207709_10001297
1510 Ga0207709_10043641
1511 Ga0207709_10047422
1512 Ga0207709_11134645
1513 Ga0207670_10056632
1514 Ga0207669_10011933
1515 Ga0207669_10038862
1516 Ga0207669_10046658
1517 Ga0207669_10067305
1518 Ga0207669_10181162
1519 Ga0207669_10333479
1520 Ga0207669_11560305
1521 Ga0207704_10087065
1522 Ga0207704_10211713
1523 Ga0207691_10040029
1524 Ga0207691_10063010
1525 Ga0207691_10077354
1526 Ga0207691_10105908
1527 Ga0207691_10106314
1528 Ga0207691_10413937
1529 Ga0207691_10502002
1530 Ga0207711_10013735
1531 Ga0207711_10093791
1532 Ga0207711_10110110
1533 Ga0207689_10049132
1534 Ga0207689_10055430
1535 Ga0207689_10073327
1536 Ga0207689_10315990
1537 Ga0207689_10326866
1538 Ga0207679_10000396
1539 Ga0207679_10040847
1540 Ga0207679_10329541
1541 Ga0207679_10355725
1542 Ga0207679_10625077
1543 Ga0207679_11456326
1544 Ga0207651_10016652
1545 Ga0207651_10065040
1546 Ga0207651_10114291
1547 Ga0207651_10617112
1548 Ga0207651_10706541
1549 Ga0207651_10855538
1550 Ga0207712_10087705
1551 Ga0207712_10383753
1552 Ga0207712_11166413
1553 Ga0207712_11313085
1554 Ga0207668_10050249
1555 Ga0207668_10055436
1556 Ga0207640_10053606
1557 Ga0207640_10151703
1558 Ga0207640_10246140
1559 Ga0207640_10727500
1560 Ga0207658_10063758
1561 Ga0207658_10111608
1562 Ga0207658_10343741
1563 Ga0207658_10405921
1564 Ga0207658_10581742
1565 Ga0207677_10001022
1566 Ga0207677_10042099
1567 Ga0207677_10112778
1568 Ga0207677_10182480
1569 Ga0207677_10442469
1570 Ga0207703_10070133
1571 Ga0207639_10250788
1572 Ga0207639_10289937
1573 Ga0207639_11174350
1574 Ga0207678_10033815
1575 Ga0207678_10426556
1576 Ga0207708_10047563
1577 Ga0207708_10417008
1578 Ga0207708_10570256
1579 Ga0207702_10019663
1580 Ga0207641_10002464
1581 Ga0207641_10052783
1582 Ga0207641_10208255
1583 Ga0207641_10391387
1584 Ga0207641_11151988
1585 Ga0207648_10053063
1586 Ga0207648_10080227
1587 Ga0207648_10093474
1588 Ga0207648_10099291
1589 Ga0207648_10106451
1590 Ga0207648_10109563
1591 Ga0207648_10143460
1592 Ga0207648_10192390
1593 Ga0207648_10545639
1594 Ga0207648_10934914
1595 Ga0207648_11892747
1596 Ga0207676_10003641
1597 Ga0207676_10046325
1598 Ga0207676_10130206
1599 Ga0207676_10771192
1600 Ga0207676_10962783
1601 Ga0207676_11902761
1602 Ga0207674_10058073
1603 Ga0207674_10116483
1604 Ga0207675_100071847
1605 Ga0207675_100082492
1606 Ga0207675_100692505
1607 Ga0207675_101430581
1608 Ga0207683_10037384
1609 Ga0207683_10088278
1610 Ga0207683_10091033
1611 Ga0207683_10091067
1612 Ga0207683_10092732
1613 Ga0207683_10108165
1614 Ga0207683_10310334
1615 Ga0207683_10476393
1616 Ga0207683_10488481
1617 Ga0207683_10785741
1618 Ga0207683_10832979
1619 Ga0207683_10978171
1620 Ga0207683_10999182
1621 Ga0207683_11063956
1622 Ga0207698_10105481
1623 Ga0207698_10216124
1624 Ga0207698_10232424
1625 Ga0207698_10239255
1626 Ga0207698_10917957
1627 Ga0207698_11157743
1628 Ga0207698_12224058
1629 Ga0209970_1084206
1630 Ga0209974_10206645
1631 Ga0207428_10330499
1632 Ga0207428_10678392
1633 Ga0268266_10064123
1634 Ga0268266_10544643
1635 Ga0268266_11934383
1636 Ga0268266_12365495
1637 Ga0268265_10074435
1638 Ga0268265_10137595
1639 Ga0268265_10271221
1640 Ga0268264_10021919
1641 Ga0268264_10085176
1642 Ga0268264_10259215
1643 Ga0268264_10885871
1644 Ga0307517_10039878
1645 Ga0307517_10135433
1646 Ga0307515_10000048
1647 Ga0307515_10000187
1648 Ga0307515_10000354
1649 Ga0307515_10031147
1650 Ga0307515_10034493
1651 Ga0307515_10111736
1652 Ga0307515_10130888
1653 Ga0307515_10143620
1654 Ga0307515_10144441
1655 Ga0307515_10144781
1656 Ga0307515_10372388
1657 Ga0307515_10562429
1658 Ga0307515_10568345
1659 Ga0265324_10016708
1660 Ga0307511_10062707
1661 Ga0307512_10072827
1662 Ga0307512_10116001
1663 Ga0307512_10141805
1664 Ga0265327_10006575
1665 Ga0265316_10051553
1666 Ga0307513_10082094
1667 Ga0307513_10090109
1668 Ga0307513_10168038
1669 Ga0307513_10314961
1670 Ga0307513_10578174
1671 Ga0307513_10768453
1672 Ga0307509_10119727
1673 Ga0307509_10127126
1674 Ga0307509_10176668
1675 Ga0307509_10247785
1676 Ga0307509_10376125
1677 Ga0307509_10420664
1678 Ga0307509_10509228
1679 Ga0307509_10589643
1680 Ga0307509_10736952
1681 Ga0307509_11000616
1682 Ga0307408_100035027
1683 Ga0307408_100342431
1684 Ga0307408_100606510
1685 Ga0307508_10011522
1686 Ga0307508_10057555
1687 Ga0307508_10884575
1688 Ga0307514_10074170
1689 Ga0307516_10402391
1690 Ga0307405_10087861
1691 Ga0307518_10059139
1692 Ga0307412_10158344
1693 Ga0307412_10464934
1694 Ga0307412_10552596
1695 Ga0307507_10086362
1696 Ga0307510_10025675
1697 Ga0373930_0142526
1698 Ga0373948_0080709
1699 Ga0373950_0001176
1700 Ga0373950_0036539
1701 Ga0373958_0011104
1702 Ga0373959_0000855
1703 Ga0373959_0002144
1704 Ga0373959_0006382
1705 Ga0373938_0004251
1706 Ga0373940_0051012
1707 Ga0373949_0009529
1708 Ga0373951_0044867
1709 Ga0373952_0238360
1710 Ga0373932_0004130
1711 Ga0373939_0000765
1712 Ga0373945_0215570
1713 Ga0373960_0002710
1714 Ga0373960_0203754
1715 Ga0373961_0002554
1716 Ga0373962_0018343
1717 Ga0373931_0000220
1718 Ga0373927_0623117
1719 Ga0373925_0158147
1720 Ga0373925_0945184
1721 Ga0395905_0031696
1722 Ga0395905_0096594
1723 Ga0395905_0167568
1724 Ga0395905_1560861
1725 Ga0436365_0074840
1726 Ga0436365_1780463
1727 Ga0436361_0513912
1728 Ga0436361_0948675
1729 Ga0436363_0803522
1730 Ga0439436_0011007
1731 Ga0439436_0022873
1732 Ga0439436_0056068
1733 Ga0439438_023213
1734 Ga0439438_053906
1735 Ga0439439_0088153
1736 Ga0439461_0004317
1737 Ga0439461_0025944
1738 Ga0439466_0072591
1739 Ga0439466_0158768
1740 Ga0439465_0280041
1741 Ga0451789_0035194
1742 Ga0451789_0983965
1743 Ga0451793_0721010
1744 Ga0451797_0593584
1745 Ga0451798_1050243
1746 Ga0451802_0207361
1747 Ga0451804_1068077
1748 Ga0451833_0889723
1749 Ga0451835_1034774
1750 Ga0451837_1138718
1751 Ga0451841_0856228
1752 Ga0451847_0005316
1753 Ga0451849_1221059
1754 Ga0451849_1295352
1755 Ga0451843_0583165
1756 Ga0451855_0372937
1757 Ga0451853_0685318
1758 Ga0451853_1184622
1759 Ga0451853_1789136
1760 Ga0439431_0009410
1761 Ga0439431_0014832
1762 Ga0439431_0018651
1763 Ga0439433_0019958
1764 Ga0439437_001649
1765 Ga0439437_007018
1766 Ga0439442_002632
1767 Ga0439445_0059132
1768 Ga0439445_0079295
1769 Ga0439448_0056094
1770 Ga0439432_119905
1771 Ga0439449_0003396
1772 Ga0439449_0022194
1773 Ga0439449_0147619
1774 Ga0439450_002449
1775 Ga0439457_006496
1776 Ga0439457_098147
1777 Ga0439457_101229
1778 Ga0439462_0016954
1779 Ga0439462_0164472
1780 Ga0450911_000146
1781 Ga0450913_005318
1782 Ga0450914_007038
1783 Ga0450919_011767
1784 Ga0450923_070691
1785 Ga0450892_017223
1786 Ga0450896_011401
1787 Ga0450896_023391
1788 Ga0450898_001281
1789 Ga0450898_007798
1790 Ga0450899_003972
1791 Ga0450905_001092
1792 Ga0450889_002823
1793 Ga0439446_0033900
1794 Ga0439458_0003779
1795 Ga0450908_111839
1796 Ga0450909_048766
1797 Ga0439434_0008144
1798 Ga0439444_0001387
1799 Ga0439464_0001930
1800 Ga0439460_0005930
1801 Ga0450918_003611
1802 Ga0451577_1813348
1803 Ga0439440_0004451
1804 Ga0466961_0016694
1805 Ga0466961_0055980
1806 Ga0466964_0711452
1807 Ga0466964_0829781
1808 Ga0466971_0166235
1809 Ga0466957_0506843
1810 Ga0466957_0853949
1811 Ga0466960_0464550
1812 Ga0451576_0183338
1813 Ga0451576_0547639
1814 Ga0451576_1792059
1815 Ga0451576_1844840
1816 Ga0466958_0351034
1817 Ga0495592_0026238
1818 Ga0495592_0041014
1819 Ga0495592_0086135
1820 Ga0495603_0485794
1821 Ga0495590_0346673
1822 Ga0495591_108715
1823 Ga0495638_0145522
1824 Ga0495650_0006341
1825 Ga0495650_0035902
1826 Ga0495650_0169285
1827 Ga0495650_0323592
1828 Ga0495639_0008551
1829 Ga0495596_0051291
1830 Ga0495606_0208930
1831 Ga0495606_0568564
1832 Ga0495608_0048925
1833 Ga0495610_0048050
1834 Ga0495616_0029331
1835 Ga0495618_0015068
1836 Ga0495618_0118377
1837 Ga0495618_0159301
1838 Ga0495620_0022401
1839 Ga0495628_0185528
1840 Ga0495628_0406179
1841 Ga0495628_1171840
1842 Ga0495630_1059650
1843 Ga0495631_0056543
1844 Ga0495632_0024364
1845 Ga0495632_0243080
1846 Ga0495643_0043034
1847 Ga0495643_0063705
1848 Ga0495643_0075288
1849 Ga0495643_0201040
1850 Ga0495648_0079658
1851 Ga0495663_0070035
1852 Ga0495642_0425487
1853 Ga0495654_0079330
1854 Ga0495654_0155770
1855 Ga0495587_0581955
1856 Ga0495598_0003043
1857 Ga0495598_0006332
1858 Ga0495598_0072520
1859 Ga0495598_0108543
1860 Ga0495598_0146527
1861 Ga0495621_0021047
1862 Ga0495621_0028201
1863 Ga0495621_0063382
1864 Ga0495621_0093023
1865 Ga0495621_0099644
1866 Ga0495621_0230239
1867 Ga0495597_0013035
1868 Ga0495597_0305926
1869 Ga0495633_0158467
1870 Ga0495668_0067386
1871 Ga0495668_0095169
1872 Ga0495668_0158172
1873 Ga0495634_0343908
1874 Ga0495625_0042920
1875 Ga0495625_0058366
1876 Ga0495588_0594164
1877 Ga0495646_0334011
1878 Ga0495658_0350164
1879 Ga0495669_0024220
1880 Ga0495613_0033204
1881 Ga0495613_0058183
1882 Ga0495613_0263195
1883 Ga0495624_0746435
1884 Ga0495670_0035271
1885 Ga0495670_0450932
1886 Ga0495660_0167675
1887 Ga0495672_0487820
1888 Ga0495676_0879282
1889 Ga0495676_1039684
1890 Ga0495680_0066809
1891 Ga0495687_008993
1892 Ga0495687_009715
1893 Ga0495681_0030098
1894 Ga0495681_0136415
1895 Ga0495686_0006359
1896 Ga0495686_0039912
1897 Ga0495602_0236558
1898 Ga0495614_0077300
1899 Ga0495614_0125335
1900 Ga0495626_0020181
1901 Ga0495626_0138550
1902 Ga0496100_0082998
1903 Ga0496101_0070584
1904 Ga0496101_1002278
1905 Ga0496102_0474779
1906 Ga0496102_0546860
1907 Ga0496102_0676938
1908 Ga0496102_1337828
1909 Ga0496104_0213463
1910 Ga0496105_0085233
1911 Ga0496106_0054871
1912 Ga0496106_1435662
1913 Ga0496107_0064362
1914 Ga0496108_0079625
1915 Ga0496108_0081300
1916 Ga0496108_1298871
1917 Ga0496109_0102899
1918 Ga0496109_0109869
1919 Ga0496109_0216355
1920 Ga0496109_0889982
1921 Ga0496109_1257199
1922 Ga0496110_0090024
1923 Ga0496110_0102308
1924 Ga0496111_0064219
1925 Ga0496112_1286390
1926 Ga0496113_0101244
1927 Ga0496113_0782920
1928 Ga0496113_1359612
1929 Ga0496113_1398112
1930 Ga0496114_0077799
1931 Ga0496114_0411677
1932 Ga0496114_0669251
1933 Ga0496114_0762747
1934 Ga0496121_0000762
1935 Ga0496121_0126498
1936 Ga0496125_0018914
1937 Ga0496126_0025976
1938 Ga0501292_025896
1939 Ga0501042_0412268
1940 Ga0501072_0307739
1941 Ga0501253_041813
1942 Ga0501265_012261
1943 Ga0501267_021967
1944 Ga0501044_0594496
1945 Ga0501044_1620704
1946 nmdc:mga03n38_844681_c1
1947 nmdc:mga00v17_166472_c1
1948 nmdc:mga0k408_123064_c1
1949 nmdc:mga0k408_214305_c1
1950 nmdc:mga0k408_31499_c1
1951 nmdc:mga0k408_40114_c1
1952 nmdc:mga0k408_412962_c1
1953 nmdc:mga0k408_4713_c1
1954 nmdc:mga0k408_57992_c1
1955 nmdc:mga07m45_32694_c1
1956 nmdc:mga07m45_342908_c1
1957 nmdc:mga07m45_416291_c1
1958 nmdc:mga08y16_133945_c1
1959 nmdc:mga0a205_948519_c1
1960 Ga0500643_014100
1961 Ga0500644_0001461
1962 Ga0500647_0375916
1963 Ga0500651_0063135
1964 Ga0500651_0132763
1965 Ga0500654_232848
1966 Ga0500554_012385
1967 Ga0500562_086293
1968 Ga0500572_049909
1969 Ga0500572_087864
1970 Ga0500593_106564
1971 Ga0500594_0045728
1972 Ga0500594_0097071
1973 Ga0500597_022505
1974 Ga0500626_011743
1975 Ga0500642_0211930
1976 Ga0500655_000060
1977 Ga0500559_0003343
1978 Ga0500559_0122587
1979 Ga0500568_0009438
1980 Ga0500574_000857
1981 Ga0500590_103117
1982 Ga0500604_0002110
1983 Ga0500627_0056916
1984 Ga0500627_0230879
1985 Ga0500627_0231864
1986 Ga0500634_0013930
1987 Ga0500638_006592
1988 Ga0500638_155808
1989 Ga0500611_001664
1990 Ga0500596_085989
1991 Ga0590071_046372
1992 Ga0466962_0219895
1993 2644060912
1994 2738723579
1995 2738886241
1996 2739284310
1997 2819602868
1998 2928078521

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05717

TnpB_IS66

IS66 Orf2 like protein

31

126

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3opm-assembly3.cif.gz_C crystal structure of human dpp4 bound to tak-294 0.801 36 66
2qo5-assembly1.cif.gz_A crystal structure of the cysteine 91 threonine mutant of zebrafish liver bile acid-binding protein complexed with cholic acid 0.8005 39 69
7aht-assembly1.cif.gz_A structure of the n-domain of the k+/h+ antiporter subunit khtt at ph 7.5 0.759 41 66
3stn-assembly1.cif.gz_A structure of human lfabp (apo-lfabp) 0.7578 39 69
3ppt-assembly1.cif.gz_A rep1-nxsq fatty acid transporter 0.757 39 69
ID Description Score Start End Superfamily
af_Q4DSL1_1_420_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8341 36 67 2.130.10.10
2qo5A00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8005 39 69 2.40.128.20
af_E9QFP6_1_93_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.789 47 70 2.60.40.10
af_Q1AMT3_1_127_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7853 39 69 2.40.128.20
af_F8Y416_51_178_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.7758 41 69 3.80.10.10
ID Description Score Start End GO Terms
AF-A0A6I1VZR1-F1-model_v4 IS66 family insertion sequence element accessory protein TnpB 0.9786 1 67
AF-A0A853GWH0-F1-model_v4 IS66 family insertion sequence element accessory protein TnpB 0.9785 1 67
AF-V8FT39-F1-model_v4 Transposase IS66 0.9747 2 65
AF-A0A7W8P7C2-F1-model_v4 Transposase 0.9741 1 68
AF-A0A7S6VMJ1-F1-model_v4 IS66 family insertion sequence element accessory protein TnpB 0.9704 1 74

Map