F487839
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 999 | 344 | 1998 | 125 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_11620055|Ga0105248_116200552 |
| Length | 124 |
| Sequence | MAKQHYSASEAAAALGISLDTLRRWDRAKRIKVTRDKSNRRVVSAREIDRLRGDGQHITARNRFRGTVTDVQVDGLMAQVELVVTEPVRIVALVTRDAVEELGLKKGMAATAIVKSTNVMVQSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 3 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 62 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 63 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 92 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 93 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 114 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 115 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 166 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 167 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 168 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 170 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 171 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 177 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 178 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 179 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 180 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 181 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 183 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 184 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 185 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 188 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 189 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 190 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 196 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 199 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 201 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 203 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 206 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 207 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 208 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 209 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 210 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 211 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 212 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 213 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 215 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 216 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 217 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 218 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 219 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 220 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 221 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 222 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 223 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 224 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 225 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 226 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 227 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 228 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 229 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 230 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 231 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 232 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 279 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 280 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 281 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 282 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 283 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 284 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 287 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 288 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 289 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 290 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 291 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 292 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 325 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 326 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 327 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 340 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 341 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 344 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.1 |
| Metatranscriptomes | 0.9 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1 |
| Nodule | 0 |
| Rhizoplane | 10.41 |
| Rhizosphere | 88.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105248_11620055 | 3300009177 | Bacteria | 733 |
| 2 | ARSoilOldRDRAFT_c018305 | 3300000044 | Bacteria | 610 |
| 3 | ARCol0yngRDRAFT_1004101 | 3300000652 | Bacteria | 1060 |
| 4 | JGI25407J50210_10010134 | 3300003373 | Bacteria | 2394 |
| 5 | JGI25407J50210_10055697 | 3300003373 | Unclassified | 997 |
| 6 | Ga0070658_10046325 | 3300005327 | Bacteria | 3519 |
| 7 | Ga0070683_100001618 | 3300005329 | Bacteria | 17420 |
| 8 | Ga0070683_100004037 | 3300005329 | Bacteria | 12016 |
| 9 | Ga0070683_100024659 | 3300005329 | Bacteria | 5391 |
| 10 | Ga0070683_100225996 | 3300005329 | Bacteria | 1779 |
| 11 | Ga0070683_100244202 | 3300005329 | Unclassified | 1708 |
| 12 | Ga0070683_100480038 | 3300005329 | Bacteria | 1187 |
| 13 | Ga0068869_101119060 | 3300005334 | Bacteria | 690 |
| 14 | Ga0070680_100014480 | 3300005336 | Bacteria | 6169 |
| 15 | Ga0070680_100038421 | 3300005336 | Bacteria | 3872 |
| 16 | Ga0070680_100045407 | 3300005336 | Bacteria | 3572 |
| 17 | Ga0070680_100228698 | 3300005336 | Unclassified | 1570 |
| 18 | Ga0070680_100543419 | 3300005336 | Bacteria | 996 |
| 19 | Ga0070680_100599236 | 3300005336 | Bacteria | 946 |
| 20 | Ga0070682_100036952 | 3300005337 | Bacteria | 2988 |
| 21 | Ga0070682_100450233 | 3300005337 | Bacteria | 986 |
| 22 | Ga0068868_100450303 | 3300005338 | Bacteria | 1120 |
| 23 | Ga0068868_101567529 | 3300005338 | Bacteria | 618 |
| 24 | Ga0068868_101613621 | 3300005338 | Unclassified | 610 |
| 25 | Ga0068868_102102625 | 3300005338 | Unclassified | 537 |
| 26 | Ga0070660_100004204 | 3300005339 | Bacteria | 9938 |
| 27 | Ga0070660_100008236 | 3300005339 | Bacteria | 7286 |
| 28 | Ga0070660_100030781 | 3300005339 | Bacteria | 4027 |
| 29 | Ga0070660_100176630 | 3300005339 | Bacteria | 1727 |
| 30 | Ga0070691_10131992 | 3300005341 | Bacteria | 1266 |
| 31 | Ga0070661_100037480 | 3300005344 | Bacteria | 3527 |
| 32 | Ga0070661_100402984 | 3300005344 | Unclassified | 1082 |
| 33 | Ga0070661_100464306 | 3300005344 | Bacteria | 1009 |
| 34 | Ga0070692_10059677 | 3300005345 | Bacteria | 2006 |
| 35 | Ga0070692_10113771 | 3300005345 | Bacteria | 1500 |
| 36 | Ga0070692_10885315 | 3300005345 | Unclassified | 616 |
| 37 | Ga0070668_101421743 | 3300005347 | Bacteria | 633 |
| 38 | Ga0070671_100088351 | 3300005355 | Bacteria | 2594 |
| 39 | Ga0070671_101454634 | 3300005355 | Bacteria | 606 |
| 40 | Ga0070673_100655696 | 3300005364 | Bacteria | 961 |
| 41 | Ga0070659_100044012 | 3300005366 | Bacteria | 3493 |
| 42 | Ga0070659_100104376 | 3300005366 | Bacteria | 2283 |
| 43 | Ga0070659_100395487 | 3300005366 | Unclassified | 1166 |
| 44 | Ga0070659_100473885 | 3300005366 | Unclassified | 1064 |
| 45 | Ga0070709_10147435 | 3300005434 | Bacteria | 1623 |
| 46 | Ga0070709_10421862 | 3300005434 | Unclassified | 1000 |
| 47 | Ga0070714_100007601 | 3300005435 | Bacteria | 8438 |
| 48 | Ga0070714_100016982 | 3300005435 | Bacteria | 5889 |
| 49 | Ga0070714_100437922 | 3300005435 | Bacteria | 1240 |
| 50 | Ga0070714_100442941 | 3300005435 | Bacteria | 1233 |
| 51 | Ga0070714_100853464 | 3300005435 | Bacteria | 883 |
| 52 | Ga0070714_102195250 | 3300005435 | Unclassified | 538 |
| 53 | Ga0070713_100001979 | 3300005436 | Bacteria | 13224 |
| 54 | Ga0070713_100142875 | 3300005436 | Bacteria | 2121 |
| 55 | Ga0070713_100175846 | 3300005436 | Bacteria | 1921 |
| 56 | Ga0070713_100210275 | 3300005436 | Unclassified | 1761 |
| 57 | Ga0070713_100933916 | 3300005436 | Bacteria | 835 |
| 58 | Ga0070713_101077840 | 3300005436 | Bacteria | 776 |
| 59 | Ga0070713_101470755 | 3300005436 | Bacteria | 661 |
| 60 | Ga0070713_101718825 | 3300005436 | Unclassified | 609 |
| 61 | Ga0070710_10001198 | 3300005437 | Bacteria | 12272 |
| 62 | Ga0070710_10022719 | 3300005437 | Bacteria | 3285 |
| 63 | Ga0070710_10080619 | 3300005437 | Bacteria | 1899 |
| 64 | Ga0070710_10534886 | 3300005437 | Unclassified | 807 |
| 65 | Ga0070710_10722536 | 3300005437 | Bacteria | 705 |
| 66 | Ga0070710_10743055 | 3300005437 | Unclassified | 696 |
| 67 | Ga0070701_10767539 | 3300005438 | Bacteria | 655 |
| 68 | Ga0070711_100016338 | 3300005439 | Bacteria | 4712 |
| 69 | Ga0070711_100016526 | 3300005439 | Bacteria | 4687 |
| 70 | Ga0070711_100027857 | 3300005439 | Bacteria | 3713 |
| 71 | Ga0070711_100053977 | 3300005439 | Bacteria | 2772 |
| 72 | Ga0070694_100080056 | 3300005444 | Bacteria | 2269 |
| 73 | Ga0070708_100771315 | 3300005445 | Bacteria | 904 |
| 74 | Ga0070663_100301716 | 3300005455 | Bacteria | 1282 |
| 75 | Ga0070663_100380750 | 3300005455 | Bacteria | 1149 |
| 76 | Ga0070663_101260541 | 3300005455 | Bacteria | 651 |
| 77 | Ga0070678_100655740 | 3300005456 | Bacteria | 942 |
| 78 | Ga0070678_101239106 | 3300005456 | Bacteria | 693 |
| 79 | Ga0070678_102341847 | 3300005456 | Unclassified | 507 |
| 80 | Ga0070662_100211703 | 3300005457 | Bacteria | 1543 |
| 81 | Ga0070681_10003984 | 3300005458 | Bacteria | 13931 |
| 82 | Ga0070681_10009371 | 3300005458 | Bacteria | 9633 |
| 83 | Ga0070681_10020410 | 3300005458 | Bacteria | 6641 |
| 84 | Ga0070681_10420534 | 3300005458 | Bacteria | 1248 |
| 85 | Ga0070681_11108094 | 3300005458 | Bacteria | 713 |
| 86 | Ga0068867_102283975 | 3300005459 | Bacteria | 514 |
| 87 | Ga0070685_10425637 | 3300005466 | Bacteria | 925 |
| 88 | Ga0070706_100249775 | 3300005467 | Bacteria | 1656 |
| 89 | Ga0070707_100000445 | 3300005468 | Bacteria | 40989 |
| 90 | Ga0070707_100318397 | 3300005468 | Unclassified | 1512 |
| 91 | Ga0070707_100365301 | 3300005468 | Bacteria | 1402 |
| 92 | Ga0070698_100324261 | 3300005471 | Bacteria | 1471 |
| 93 | Ga0070679_100011917 | 3300005530 | Bacteria | 8298 |
| 94 | Ga0070679_100014687 | 3300005530 | Bacteria | 7528 |
| 95 | Ga0070679_100026708 | 3300005530 | Bacteria | 5676 |
| 96 | Ga0070679_100032618 | 3300005530 | Bacteria | 5153 |
| 97 | Ga0070679_100093684 | 3300005530 | Bacteria | 2991 |
| 98 | Ga0070679_100405563 | 3300005530 | Bacteria | 1309 |
| 99 | Ga0070684_100020900 | 3300005535 | Bacteria | 5433 |
| 100 | Ga0070684_100040098 | 3300005535 | Bacteria | 4031 |
| 101 | Ga0070684_100046844 | 3300005535 | Bacteria | 3746 |
| 102 | Ga0070684_100137345 | 3300005535 | Bacteria | 2209 |
| 103 | Ga0070684_100803058 | 3300005535 | Bacteria | 880 |
| 104 | Ga0070684_102027899 | 3300005535 | Unclassified | 543 |
| 105 | Ga0068853_100028009 | 3300005539 | Bacteria | 4739 |
| 106 | Ga0068853_100087810 | 3300005539 | Bacteria | 2729 |
| 107 | Ga0070672_100773624 | 3300005543 | Bacteria | 844 |
| 108 | Ga0070695_100119158 | 3300005545 | Bacteria | 1803 |
| 109 | Ga0070693_100357570 | 3300005547 | Unclassified | 1001 |
| 110 | Ga0070665_100056274 | 3300005548 | Bacteria | 3944 |
| 111 | Ga0070704_100007156 | 3300005549 | Bacteria | 6628 |
| 112 | Ga0070704_100046747 | 3300005549 | Bacteria | 3021 |
| 113 | Ga0068855_100017510 | 3300005563 | Bacteria | 8616 |
| 114 | Ga0068855_100029199 | 3300005563 | Bacteria | 6595 |
| 115 | Ga0068855_100072111 | 3300005563 | Bacteria | 4015 |
| 116 | Ga0068855_100090005 | 3300005563 | Bacteria | 3542 |
| 117 | Ga0068855_100124099 | 3300005563 | Bacteria | 2954 |
| 118 | Ga0070664_100056337 | 3300005564 | Bacteria | 3340 |
| 119 | Ga0070664_100066143 | 3300005564 | Bacteria | 3086 |
| 120 | Ga0070664_100947117 | 3300005564 | Bacteria | 808 |
| 121 | Ga0068857_100077305 | 3300005577 | Bacteria | 2969 |
| 122 | Ga0068857_100082734 | 3300005577 | Bacteria | 2867 |
| 123 | Ga0068857_101087488 | 3300005577 | Bacteria | 772 |
| 124 | Ga0068854_100742018 | 3300005578 | Bacteria | 851 |
| 125 | Ga0068856_100083740 | 3300005614 | Bacteria | 3168 |
| 126 | Ga0068856_100239210 | 3300005614 | Bacteria | 1831 |
| 127 | Ga0068856_100346098 | 3300005614 | Bacteria | 1505 |
| 128 | Ga0068856_100506060 | 3300005614 | Unclassified | 1229 |
| 129 | Ga0070702_100055343 | 3300005615 | Unclassified | 2287 |
| 130 | Ga0070702_100071092 | 3300005615 | Bacteria | 2056 |
| 131 | Ga0070702_100602270 | 3300005615 | Unclassified | 824 |
| 132 | Ga0068852_100156433 | 3300005616 | Bacteria | 2124 |
| 133 | Ga0068852_100614980 | 3300005616 | Bacteria | 1092 |
| 134 | Ga0068852_100853387 | 3300005616 | Bacteria | 926 |
| 135 | Ga0068852_101814320 | 3300005616 | Unclassified | 632 |
| 136 | Ga0068859_101816869 | 3300005617 | Bacteria | 673 |
| 137 | Ga0068864_100589514 | 3300005618 | Bacteria | 1078 |
| 138 | Ga0068861_101779948 | 3300005719 | Bacteria | 611 |
| 139 | Ga0068870_11057064 | 3300005840 | Bacteria | 582 |
| 140 | Ga0068863_100654396 | 3300005841 | Unclassified | 1042 |
| 141 | Ga0068860_100685859 | 3300005843 | Bacteria | 1034 |
| 142 | Ga0068860_101612365 | 3300005843 | Bacteria | 671 |
| 143 | Ga0081455_10016553 | 3300005937 | Bacteria | 7113 |
| 144 | Ga0081538_10025660 | 3300005981 | Bacteria | 4147 |
| 145 | Ga0081540_1073518 | 3300005983 | Unclassified | 1570 |
| 146 | Ga0070717_10015481 | 3300006028 | Bacteria | 5892 |
| 147 | Ga0070717_10064315 | 3300006028 | Bacteria | 3046 |
| 148 | Ga0070717_10083763 | 3300006028 | Bacteria | 2682 |
| 149 | Ga0070717_10173225 | 3300006028 | Bacteria | 1878 |
| 150 | Ga0070717_10702232 | 3300006028 | Bacteria | 919 |
| 151 | Ga0070717_10893284 | 3300006028 | Unclassified | 809 |
| 152 | Ga0070717_11525256 | 3300006028 | Unclassified | 606 |
| 153 | Ga0075365_10336474 | 3300006038 | Bacteria | 1064 |
| 154 | Ga0075364_10056535 | 3300006051 | Bacteria | 2569 |
| 155 | Ga0075364_10076268 | 3300006051 | Bacteria | 2212 |
| 156 | Ga0075364_10165487 | 3300006051 | Unclassified | 1494 |
| 157 | Ga0075432_10002081 | 3300006058 | Bacteria | 6664 |
| 158 | Ga0070715_10000804 | 3300006163 | Bacteria | 8554 |
| 159 | Ga0070715_10026658 | 3300006163 | Bacteria | 2301 |
| 160 | Ga0070716_100001564 | 3300006173 | Bacteria | 10277 |
| 161 | Ga0070716_100033017 | 3300006173 | Bacteria | 2828 |
| 162 | Ga0070716_100846515 | 3300006173 | Unclassified | 712 |
| 163 | Ga0070716_101567659 | 3300006173 | Bacteria | 540 |
| 164 | Ga0070712_100016804 | 3300006175 | Bacteria | 4732 |
| 165 | Ga0070712_100092879 | 3300006175 | Unclassified | 2214 |
| 166 | Ga0070712_100178712 | 3300006175 | Unclassified | 1652 |
| 167 | Ga0070712_100373333 | 3300006175 | Unclassified | 1172 |
| 168 | Ga0070712_100383775 | 3300006175 | Bacteria | 1157 |
| 169 | Ga0070712_100404855 | 3300006175 | Bacteria | 1128 |
| 170 | Ga0070712_100744820 | 3300006175 | Bacteria | 838 |
| 171 | Ga0070712_100826192 | 3300006175 | Unclassified | 796 |
| 172 | Ga0097621_100999889 | 3300006237 | Bacteria | 782 |
| 173 | Ga0097621_101283954 | 3300006237 | Unclassified | 691 |
| 174 | Ga0068871_100744676 | 3300006358 | Unclassified | 900 |
| 175 | Ga0075428_100060924 | 3300006844 | Bacteria | 4132 |
| 176 | Ga0075430_100023972 | 3300006846 | Bacteria | 5196 |
| 177 | Ga0075431_100726193 | 3300006847 | Bacteria | 970 |
| 178 | Ga0075433_10022357 | 3300006852 | Bacteria | 5308 |
| 179 | Ga0075433_10323489 | 3300006852 | Bacteria | 1364 |
| 180 | Ga0075433_10332983 | 3300006852 | Bacteria | 1342 |
| 181 | Ga0075433_11538861 | 3300006852 | Unclassified | 574 |
| 182 | Ga0075434_100529904 | 3300006871 | Bacteria | 1198 |
| 183 | Ga0075434_100567574 | 3300006871 | Bacteria | 1154 |
| 184 | Ga0075434_100634759 | 3300006871 | Bacteria | 1087 |
| 185 | Ga0075434_101288477 | 3300006871 | Unclassified | 742 |
| 186 | Ga0075429_100121549 | 3300006880 | Bacteria | 2283 |
| 187 | Ga0075429_100171637 | 3300006880 | Bacteria | 1899 |
| 188 | Ga0097620_101816523 | 3300006931 | Bacteria | 673 |
| 189 | Ga0075435_100954863 | 3300007076 | Bacteria | 748 |
| 190 | Ga0105251_10162270 | 3300009011 | Bacteria | 1007 |
| 191 | Ga0105240_10080020 | 3300009093 | Bacteria | 4020 |
| 192 | Ga0105240_10115984 | 3300009093 | Bacteria | 3232 |
| 193 | Ga0105240_10341446 | 3300009093 | Bacteria | 1701 |
| 194 | Ga0111539_10012361 | 3300009094 | Bacteria | 10700 |
| 195 | Ga0111539_10878690 | 3300009094 | Bacteria | 1043 |
| 196 | Ga0105245_10010834 | 3300009098 | Bacteria | 7933 |
| 197 | Ga0105245_10072081 | 3300009098 | Bacteria | 3138 |
| 198 | Ga0105245_10072772 | 3300009098 | Bacteria | 3123 |
| 199 | Ga0105245_10171030 | 3300009098 | Bacteria | 2069 |
| 200 | Ga0105245_10541552 | 3300009098 | Bacteria | 1185 |
| 201 | Ga0105245_11092065 | 3300009098 | Unclassified | 844 |
| 202 | Ga0105245_11619371 | 3300009098 | Bacteria | 699 |
| 203 | Ga0105247_10243341 | 3300009101 | Bacteria | 1227 |
| 204 | Ga0105247_10764542 | 3300009101 | Bacteria | 734 |
| 205 | Ga0105247_11611717 | 3300009101 | Unclassified | 533 |
| 206 | Ga0114129_10012279 | 3300009147 | Bacteria | 12187 |
| 207 | Ga0105243_10047086 | 3300009148 | Bacteria | 3393 |
| 208 | Ga0105241_10756674 | 3300009174 | Unclassified | 891 |
| 209 | Ga0105241_12108453 | 3300009174 | Bacteria | 557 |
| 210 | Ga0105242_10330216 | 3300009176 | Bacteria | 1402 |
| 211 | Ga0105248_10090057 | 3300009177 | Bacteria | 3454 |
| 212 | Ga0105248_10524673 | 3300009177 | Bacteria | 1335 |
| 213 | Ga0105237_10085590 | 3300009545 | Bacteria | 3142 |
| 214 | Ga0105237_10163848 | 3300009545 | Bacteria | 2222 |
| 215 | Ga0105238_11222086 | 3300009551 | Bacteria | 776 |
| 216 | Ga0105249_10058633 | 3300009553 | Bacteria | 3529 |
| 217 | Ga0105239_10117623 | 3300010375 | Bacteria | 2950 |
| 218 | Ga0105239_10324948 | 3300010375 | Bacteria | 1735 |
| 219 | Ga0105239_10542001 | 3300010375 | Bacteria | 1325 |
| 220 | Ga0105239_11027185 | 3300010375 | Unclassified | 948 |
| 221 | Ga0105246_10061389 | 3300011119 | Bacteria | 2615 |
| 222 | Ga0105246_10194063 | 3300011119 | Bacteria | 1574 |
| 223 | Ga0105246_10674620 | 3300011119 | Unclassified | 903 |
| 224 | Ga0157337_1001970 | 3300012483 | Unclassified | 1123 |
| 225 | Ga0157345_1004708 | 3300012498 | Bacteria | 1032 |
| 226 | Ga0157338_1083782 | 3300012515 | Bacteria | 520 |
| 227 | Ga0157373_10160091 | 3300013100 | Bacteria | 1584 |
| 228 | Ga0157371_10123923 | 3300013102 | Bacteria | 1838 |
| 229 | Ga0157371_10155000 | 3300013102 | Bacteria | 1634 |
| 230 | Ga0157370_10003288 | 3300013104 | Bacteria | 19063 |
| 231 | Ga0157370_10019501 | 3300013104 | Bacteria | 6801 |
| 232 | Ga0157370_10030905 | 3300013104 | Bacteria | 5245 |
| 233 | Ga0157370_10104682 | 3300013104 | Bacteria | 2649 |
| 234 | Ga0157370_10957836 | 3300013104 | Unclassified | 776 |
| 235 | Ga0157370_11269960 | 3300013104 | Bacteria | 664 |
| 236 | Ga0157369_10001003 | 3300013105 | Bacteria | 35669 |
| 237 | Ga0157369_10037234 | 3300013105 | Bacteria | 5326 |
| 238 | Ga0157369_10235657 | 3300013105 | Unclassified | 1912 |
| 239 | Ga0157369_11322061 | 3300013105 | Unclassified | 734 |
| 240 | Ga0157369_12022822 | 3300013105 | Unclassified | 584 |
| 241 | Ga0157374_10041234 | 3300013296 | Bacteria | 4254 |
| 242 | Ga0157374_10063540 | 3300013296 | Bacteria | 3462 |
| 243 | Ga0157374_10100741 | 3300013296 | Bacteria | 2769 |
| 244 | Ga0157374_10482043 | 3300013296 | Unclassified | 1244 |
| 245 | Ga0157374_10521786 | 3300013296 | Unclassified | 1194 |
| 246 | Ga0157374_11573131 | 3300013296 | Bacteria | 681 |
| 247 | Ga0157374_12011758 | 3300013296 | Unclassified | 604 |
| 248 | Ga0157378_10304071 | 3300013297 | Bacteria | 1544 |
| 249 | Ga0163162_10094964 | 3300013306 | Unclassified | 3068 |
| 250 | Ga0163162_12463949 | 3300013306 | Unclassified | 598 |
| 251 | Ga0157372_10059549 | 3300013307 | Bacteria | 4272 |
| 252 | Ga0157372_10099027 | 3300013307 | Bacteria | 3325 |
| 253 | Ga0157372_10142077 | 3300013307 | Bacteria | 2767 |
| 254 | Ga0157372_10241533 | 3300013307 | Bacteria | 2096 |
| 255 | Ga0157372_10290217 | 3300013307 | Bacteria | 1902 |
| 256 | Ga0157372_10927414 | 3300013307 | Bacteria | 1010 |
| 257 | Ga0157372_11618537 | 3300013307 | Bacteria | 745 |
| 258 | Ga0157375_10078085 | 3300013308 | Bacteria | 3343 |
| 259 | Ga0157375_12899469 | 3300013308 | Unclassified | 573 |
| 260 | Ga0163163_10480874 | 3300014325 | Bacteria | 1303 |
| 261 | Ga0182008_10088788 | 3300014497 | Unclassified | 1523 |
| 262 | Ga0182008_10335926 | 3300014497 | Unclassified | 798 |
| 263 | Ga0157377_10024981 | 3300014745 | Bacteria | 3182 |
| 264 | Ga0157379_10882244 | 3300014968 | Unclassified | 848 |
| 265 | Ga0157376_10005638 | 3300014969 | Bacteria | 8762 |
| 266 | Ga0157376_10078509 | 3300014969 | Unclassified | 2827 |
| 267 | Ga0182007_10386320 | 3300015262 | Bacteria | 532 |
| 268 | Ga0197907_11302405 | 3300020069 | Bacteria | 1101 |
| 269 | Ga0206356_11288287 | 3300020070 | Bacteria | 2420 |
| 270 | Ga0206354_10189649 | 3300020081 | Bacteria | 1192 |
| 271 | Ga0206354_11042467 | 3300020081 | Bacteria | 1023 |
| 272 | Ga0206353_10249593 | 3300020082 | Bacteria | 1272 |
| 273 | Ga0206353_10287330 | 3300020082 | Bacteria | 3052 |
| 274 | Ga0206353_10846162 | 3300020082 | Unclassified | 971 |
| 275 | Ga0213873_10147018 | 3300021358 | Unclassified | 707 |
| 276 | Ga0213871_10033542 | 3300021441 | Bacteria | 1351 |
| 277 | Ga0224712_10041711 | 3300022467 | Unclassified | 1735 |
| 278 | Ga0224712_10118831 | 3300022467 | Unclassified | 1142 |
| 279 | Ga0207692_10012838 | 3300025898 | Bacteria | 3612 |
| 280 | Ga0207692_10041406 | 3300025898 | Bacteria | 2280 |
| 281 | Ga0207692_11062515 | 3300025898 | Unclassified | 536 |
| 282 | Ga0207688_10006115 | 3300025901 | Bacteria | 6550 |
| 283 | Ga0207685_10181639 | 3300025905 | Bacteria | 976 |
| 284 | Ga0207699_10118982 | 3300025906 | Bacteria | 1705 |
| 285 | Ga0207699_10142354 | 3300025906 | Bacteria | 1577 |
| 286 | Ga0207643_10028234 | 3300025908 | Bacteria | 3115 |
| 287 | Ga0207705_10038495 | 3300025909 | Bacteria | 3424 |
| 288 | Ga0207684_10426738 | 3300025910 | Bacteria | 1139 |
| 289 | Ga0207654_10879797 | 3300025911 | Bacteria | 649 |
| 290 | Ga0207707_10012789 | 3300025912 | Bacteria | 7301 |
| 291 | Ga0207707_10135027 | 3300025912 | Bacteria | 2157 |
| 292 | Ga0207707_10166503 | 3300025912 | Bacteria | 1926 |
| 293 | Ga0207707_10233233 | 3300025912 | Bacteria | 1601 |
| 294 | Ga0207707_10315569 | 3300025912 | Bacteria | 1350 |
| 295 | Ga0207707_10322492 | 3300025912 | Bacteria | 1333 |
| 296 | Ga0207707_10373305 | 3300025912 | Bacteria | 1227 |
| 297 | Ga0207695_10126218 | 3300025913 | Bacteria | 2520 |
| 298 | Ga0207695_11177285 | 3300025913 | Unclassified | 647 |
| 299 | Ga0207671_10072414 | 3300025914 | Bacteria | 2572 |
| 300 | Ga0207693_10001250 | 3300025915 | Bacteria | 22628 |
| 301 | Ga0207693_10004134 | 3300025915 | Bacteria | 12318 |
| 302 | Ga0207693_10194985 | 3300025915 | Unclassified | 1594 |
| 303 | Ga0207693_10268992 | 3300025915 | Bacteria | 1336 |
| 304 | Ga0207693_10279318 | 3300025915 | Unclassified | 1309 |
| 305 | Ga0207693_10403284 | 3300025915 | Bacteria | 1069 |
| 306 | Ga0207663_10008967 | 3300025916 | Bacteria | 5264 |
| 307 | Ga0207663_10161175 | 3300025916 | Unclassified | 1583 |
| 308 | Ga0207663_10167249 | 3300025916 | Bacteria | 1558 |
| 309 | Ga0207663_10329727 | 3300025916 | Unclassified | 1149 |
| 310 | Ga0207660_10017111 | 3300025917 | Bacteria | 4811 |
| 311 | Ga0207660_10050421 | 3300025917 | Bacteria | 2955 |
| 312 | Ga0207660_10185956 | 3300025917 | Unclassified | 1616 |
| 313 | Ga0207660_10460299 | 3300025917 | Bacteria | 1029 |
| 314 | Ga0207660_11655254 | 3300025917 | Unclassified | 515 |
| 315 | Ga0207657_10000184 | 3300025919 | Bacteria | 64813 |
| 316 | Ga0207657_10000683 | 3300025919 | Bacteria | 36161 |
| 317 | Ga0207657_10006110 | 3300025919 | Bacteria | 12520 |
| 318 | Ga0207657_10152363 | 3300025919 | Bacteria | 1882 |
| 319 | Ga0207657_10340037 | 3300025919 | Bacteria | 1185 |
| 320 | Ga0207649_10015676 | 3300025920 | Bacteria | 4258 |
| 321 | Ga0207649_10876424 | 3300025920 | Bacteria | 703 |
| 322 | Ga0207652_10053119 | 3300025921 | Bacteria | 3480 |
| 323 | Ga0207652_10808601 | 3300025921 | Bacteria | 832 |
| 324 | Ga0207646_10001908 | 3300025922 | Bacteria | 25106 |
| 325 | Ga0207646_10321857 | 3300025922 | Bacteria | 1397 |
| 326 | Ga0207646_10548342 | 3300025922 | Archaea | 1040 |
| 327 | Ga0207694_11630105 | 3300025924 | Bacteria | 543 |
| 328 | Ga0207659_10140453 | 3300025926 | Bacteria | 1874 |
| 329 | Ga0207687_10029370 | 3300025927 | Bacteria | 3698 |
| 330 | Ga0207687_10228865 | 3300025927 | Bacteria | 1468 |
| 331 | Ga0207687_10589850 | 3300025927 | Bacteria | 936 |
| 332 | Ga0207687_10736013 | 3300025927 | Unclassified | 839 |
| 333 | Ga0207700_10004525 | 3300025928 | Bacteria | 8212 |
| 334 | Ga0207700_10062354 | 3300025928 | Bacteria | 2831 |
| 335 | Ga0207700_10066737 | 3300025928 | Bacteria | 2751 |
| 336 | Ga0207700_10143629 | 3300025928 | Bacteria | 1964 |
| 337 | Ga0207700_10300222 | 3300025928 | Bacteria | 1387 |
| 338 | Ga0207700_11045744 | 3300025928 | Bacteria | 730 |
| 339 | Ga0207664_10015331 | 3300025929 | Bacteria | 5557 |
| 340 | Ga0207664_10083855 | 3300025929 | Unclassified | 2598 |
| 341 | Ga0207664_10097280 | 3300025929 | Bacteria | 2424 |
| 342 | Ga0207664_10151111 | 3300025929 | Bacteria | 1973 |
| 343 | Ga0207664_10346787 | 3300025929 | Unclassified | 1314 |
| 344 | Ga0207664_10765041 | 3300025929 | Unclassified | 869 |
| 345 | Ga0207644_11279576 | 3300025931 | Bacteria | 616 |
| 346 | Ga0207690_10023249 | 3300025932 | Bacteria | 3867 |
| 347 | Ga0207690_10106143 | 3300025932 | Bacteria | 2015 |
| 348 | Ga0207690_10269685 | 3300025932 | Unclassified | 1322 |
| 349 | Ga0207690_10679419 | 3300025932 | Bacteria | 845 |
| 350 | Ga0207706_10202208 | 3300025933 | Bacteria | 1742 |
| 351 | Ga0207686_10283488 | 3300025934 | Unclassified | 1224 |
| 352 | Ga0207709_11339277 | 3300025935 | Bacteria | 592 |
| 353 | Ga0207669_10784452 | 3300025937 | Bacteria | 789 |
| 354 | Ga0207665_10000620 | 3300025939 | Bacteria | 23807 |
| 355 | Ga0207665_10523521 | 3300025939 | Unclassified | 918 |
| 356 | Ga0207665_10699903 | 3300025939 | Unclassified | 797 |
| 357 | Ga0207691_10810845 | 3300025940 | Bacteria | 786 |
| 358 | Ga0207711_10251301 | 3300025941 | Bacteria | 1624 |
| 359 | Ga0207711_11356029 | 3300025941 | Bacteria | 654 |
| 360 | Ga0207689_10468641 | 3300025942 | Bacteria | 1054 |
| 361 | Ga0207661_10001205 | 3300025944 | Bacteria | 17301 |
| 362 | Ga0207661_10037224 | 3300025944 | Bacteria | 3804 |
| 363 | Ga0207661_10066652 | 3300025944 | Bacteria | 2925 |
| 364 | Ga0207661_10128752 | 3300025944 | Bacteria | 2165 |
| 365 | Ga0207661_10171014 | 3300025944 | Bacteria | 1892 |
| 366 | Ga0207661_10407436 | 3300025944 | Bacteria | 1234 |
| 367 | Ga0207661_10899324 | 3300025944 | Bacteria | 815 |
| 368 | Ga0207679_10151806 | 3300025945 | Bacteria | 1886 |
| 369 | Ga0207679_10712132 | 3300025945 | Bacteria | 911 |
| 370 | Ga0207667_10024085 | 3300025949 | Bacteria | 6693 |
| 371 | Ga0207667_10244424 | 3300025949 | Bacteria | 1836 |
| 372 | Ga0207667_10608660 | 3300025949 | Bacteria | 1101 |
| 373 | Ga0207667_11289104 | 3300025949 | Unclassified | 707 |
| 374 | Ga0207651_10353084 | 3300025960 | Bacteria | 1239 |
| 375 | Ga0207677_10421955 | 3300026023 | Bacteria | 1136 |
| 376 | Ga0207677_11016801 | 3300026023 | Bacteria | 752 |
| 377 | Ga0207677_11349274 | 3300026023 | Bacteria | 656 |
| 378 | Ga0207677_12161181 | 3300026023 | Bacteria | 518 |
| 379 | Ga0207639_10526226 | 3300026041 | Bacteria | 1083 |
| 380 | Ga0207639_11241489 | 3300026041 | Unclassified | 699 |
| 381 | Ga0207678_10250853 | 3300026067 | Bacteria | 1515 |
| 382 | Ga0207708_10016428 | 3300026075 | Bacteria | 5567 |
| 383 | Ga0207708_11156817 | 3300026075 | Bacteria | 676 |
| 384 | Ga0207702_10049373 | 3300026078 | Bacteria | 3551 |
| 385 | Ga0207702_10143391 | 3300026078 | Unclassified | 2164 |
| 386 | Ga0207702_10384910 | 3300026078 | Unclassified | 1350 |
| 387 | Ga0207702_10477538 | 3300026078 | Bacteria | 1213 |
| 388 | Ga0207702_10846275 | 3300026078 | Unclassified | 905 |
| 389 | Ga0207702_11650765 | 3300026078 | Bacteria | 634 |
| 390 | Ga0207702_11855730 | 3300026078 | Bacteria | 594 |
| 391 | Ga0207641_11509838 | 3300026088 | Unclassified | 673 |
| 392 | Ga0207674_10025286 | 3300026116 | Bacteria | 6336 |
| 393 | Ga0207674_10939236 | 3300026116 | Bacteria | 833 |
| 394 | Ga0207675_100135417 | 3300026118 | Bacteria | 2337 |
| 395 | Ga0207683_10189263 | 3300026121 | Unclassified | 1868 |
| 396 | Ga0207698_10408913 | 3300026142 | Bacteria | 1299 |
| 397 | Ga0207698_10909242 | 3300026142 | Bacteria | 888 |
| 398 | Ga0207428_10044987 | 3300027907 | Bacteria | 3559 |
| 399 | Ga0207428_10058468 | 3300027907 | Bacteria | 3060 |
| 400 | Ga0268264_10649579 | 3300028381 | Bacteria | 1044 |
| 401 | Ga0265337_1093193 | 3300028556 | Bacteria | 821 |
| 402 | Ga0265326_10038666 | 3300028558 | Bacteria | 1356 |
| 403 | Ga0265326_10145041 | 3300028558 | Bacteria | 678 |
| 404 | Ga0265319_1127463 | 3300028563 | Bacteria | 792 |
| 405 | Ga0265334_10002535 | 3300028573 | Bacteria | 8540 |
| 406 | Ga0265334_10014738 | 3300028573 | Bacteria | 3255 |
| 407 | Ga0265318_10000296 | 3300028577 | Bacteria | 40669 |
| 408 | Ga0265322_10004483 | 3300028654 | Bacteria | 4155 |
| 409 | Ga0265322_10039015 | 3300028654 | Bacteria | 1351 |
| 410 | Ga0265336_10009086 | 3300028666 | Bacteria | 3450 |
| 411 | Ga0265336_10043787 | 3300028666 | Unclassified | 1363 |
| 412 | Ga0265338_10006228 | 3300028800 | Bacteria | 15274 |
| 413 | Ga0265338_10009103 | 3300028800 | Bacteria | 11933 |
| 414 | Ga0265338_10014335 | 3300028800 | Bacteria | 8828 |
| 415 | Ga0265338_10017902 | 3300028800 | Bacteria | 7610 |
| 416 | Ga0265338_10630500 | 3300028800 | Bacteria | 744 |
| 417 | Ga0265338_10913177 | 3300028800 | Bacteria | 597 |
| 418 | Ga0265324_10010734 | 3300029957 | Bacteria | 3516 |
| 419 | Ga0265324_10050110 | 3300029957 | Bacteria | 1435 |
| 420 | Ga0265324_10096190 | 3300029957 | Bacteria | 1007 |
| 421 | Ga0265330_10001988 | 3300031235 | Bacteria | 11348 |
| 422 | Ga0265330_10095104 | 3300031235 | Bacteria | 1277 |
| 423 | Ga0265332_10033692 | 3300031238 | Unclassified | 2229 |
| 424 | Ga0265332_10171184 | 3300031238 | Bacteria | 906 |
| 425 | Ga0265328_10000451 | 3300031239 | Bacteria | 19117 |
| 426 | Ga0265328_10007616 | 3300031239 | Bacteria | 4505 |
| 427 | Ga0265320_10014605 | 3300031240 | Bacteria | 4463 |
| 428 | Ga0265325_10000309 | 3300031241 | Bacteria | 34328 |
| 429 | Ga0265325_10093910 | 3300031241 | Bacteria | 1475 |
| 430 | Ga0265329_10040426 | 3300031242 | Bacteria | 1496 |
| 431 | Ga0265329_10100504 | 3300031242 | Unclassified | 920 |
| 432 | Ga0265340_10023790 | 3300031247 | Bacteria | 3119 |
| 433 | Ga0265340_10065712 | 3300031247 | Bacteria | 1727 |
| 434 | Ga0265340_10230136 | 3300031247 | Bacteria | 829 |
| 435 | Ga0265339_10052368 | 3300031249 | Bacteria | 2223 |
| 436 | Ga0265339_10070399 | 3300031249 | Bacteria | 1865 |
| 437 | Ga0265331_10005204 | 3300031250 | Bacteria | 7895 |
| 438 | Ga0265331_10170706 | 3300031250 | Bacteria | 984 |
| 439 | Ga0265327_10003767 | 3300031251 | Bacteria | 14076 |
| 440 | Ga0265327_10005428 | 3300031251 | Bacteria | 10632 |
| 441 | Ga0265327_10061828 | 3300031251 | Unclassified | 1908 |
| 442 | Ga0265327_10232442 | 3300031251 | Bacteria | 826 |
| 443 | Ga0265316_10003341 | 3300031344 | Bacteria | 16263 |
| 444 | Ga0265316_10029734 | 3300031344 | Bacteria | 4487 |
| 445 | Ga0265316_10948189 | 3300031344 | Bacteria | 600 |
| 446 | Ga0265313_10002173 | 3300031595 | Bacteria | 17392 |
| 447 | Ga0265313_10015004 | 3300031595 | Bacteria | 4544 |
| 448 | Ga0265313_10018343 | 3300031595 | Bacteria | 3931 |
| 449 | Ga0265313_10332627 | 3300031595 | Unclassified | 605 |
| 450 | Ga0265314_10020854 | 3300031711 | Bacteria | 5053 |
| 451 | Ga0265314_10221951 | 3300031711 | Bacteria | 1102 |
| 452 | Ga0265342_10005698 | 3300031712 | Bacteria | 9417 |
| 453 | Ga0316583_10166797 | 3300032133 | Bacteria | 766 |
| 454 | Ga0373926_0030362 | 3300035083 | Bacteria | 1903 |
| 455 | Ga0373926_0088051 | 3300035083 | Unclassified | 1153 |
| 456 | Ga0373944_0097381 | 3300035089 | Bacteria | 990 |
| 457 | Ga0373951_0165470 | 3300035091 | Bacteria | 628 |
| 458 | Ga0373923_0321792 | 3300035111 | Bacteria | 734 |
| 459 | Ga0373945_0002914 | 3300035116 | Bacteria | 5376 |
| 460 | Ga0373956_0176228 | 3300035119 | Bacteria | 1010 |
| 461 | Ga0373956_0205402 | 3300035119 | Bacteria | 934 |
| 462 | Ga0373957_0110240 | 3300035120 | Unclassified | 1108 |
| 463 | Ga0373943_0002185 | 3300035170 | Bacteria | 8897 |
| 464 | Ga0373943_0019338 | 3300035170 | Bacteria | 3131 |
| 465 | Ga0373955_0192196 | 3300035172 | Bacteria | 1214 |
| 466 | Ga0373955_0285359 | 3300035172 | Unclassified | 994 |
| 467 | Ga0373955_0371248 | 3300035172 | Bacteria | 868 |
| 468 | Ga0373924_0367934 | 3300035410 | Unclassified | 641 |
| 469 | Ga0373935_0008309 | 3300035692 | Bacteria | 6210 |
| 470 | Ga0373927_0046367 | 3300035695 | Bacteria | 2812 |
| 471 | Ga0373927_0168659 | 3300035695 | Bacteria | 1435 |
| 472 | Ga0373933_0093576 | 3300035724 | Unclassified | 1858 |
| 473 | Ga0373933_0217245 | 3300035724 | Bacteria | 1226 |
| 474 | Ga0373933_0334655 | 3300035724 | Bacteria | 982 |
| 475 | Ga0373947_0001831 | 3300035725 | Bacteria | 13012 |
| 476 | Ga0373947_0053904 | 3300035725 | Bacteria | 2426 |
| 477 | Ga0373937_0000308 | 3300036401 | Bacteria | 46115 |
| 478 | Ga0373937_0329769 | 3300036401 | Unclassified | 1444 |
| 479 | Ga0373937_0514372 | 3300036401 | Bacteria | 1137 |
| 480 | Ga0373937_1618595 | 3300036401 | Unclassified | 595 |
| 481 | Ga0373925_0001399 | 3300037068 | Bacteria | 20978 |
| 482 | Ga0373925_0050755 | 3300037068 | Bacteria | 3095 |
| 483 | Ga0395899_0010575 | 3300037312 | Bacteria | 7071 |
| 484 | Ga0395899_0051456 | 3300037312 | Bacteria | 3057 |
| 485 | Ga0395900_0013234 | 3300037418 | Bacteria | 8431 |
| 486 | Ga0395900_0266899 | 3300037418 | Bacteria | 1707 |
| 487 | Ga0395900_0355050 | 3300037418 | Bacteria | 1439 |
| 488 | Ga0395900_0406093 | 3300037418 | Bacteria | 1325 |
| 489 | Ga0395900_1523480 | 3300037418 | Bacteria | 580 |
| 490 | Ga0395898_0007979 | 3300037466 | Bacteria | 11231 |
| 491 | Ga0395898_0031288 | 3300037466 | Bacteria | 5319 |
| 492 | Ga0395898_0184687 | 3300037466 | Bacteria | 1992 |
| 493 | Ga0395898_0258314 | 3300037466 | Bacteria | 1661 |
| 494 | Ga0395898_0401477 | 3300037466 | Bacteria | 1307 |
| 495 | Ga0395898_0579135 | 3300037466 | Bacteria | 1065 |
| 496 | Ga0395898_0722702 | 3300037466 | Bacteria | 937 |
| 497 | Ga0395898_1327919 | 3300037466 | Unclassified | 648 |
| 498 | Ga0395898_1465149 | 3300037466 | Bacteria | 609 |
| 499 | Ga0395905_0109123 | 3300037471 | Bacteria | 2598 |
| 500 | Ga0395905_0264488 | 3300037471 | Bacteria | 1605 |
| 501 | Ga0395905_0407358 | 3300037471 | Bacteria | 1255 |
| 502 | Ga0395905_0419329 | 3300037471 | Bacteria | 1234 |
| 503 | Ga0395905_0868975 | 3300037471 | Unclassified | 805 |
| 504 | Ga0395905_0913409 | 3300037471 | Unclassified | 781 |
| 505 | Ga0395905_1748416 | 3300037471 | Unclassified | 527 |
| 506 | Ga0395901_0085806 | 3300038443 | Bacteria | 3291 |
| 507 | Ga0395901_0107058 | 3300038443 | Bacteria | 2934 |
| 508 | Ga0395901_0155796 | 3300038443 | Bacteria | 2399 |
| 509 | Ga0395901_0315428 | 3300038443 | Bacteria | 1618 |
| 510 | Ga0395901_0568987 | 3300038443 | Bacteria | 1146 |
| 511 | Ga0395901_0607445 | 3300038443 | Unclassified | 1102 |
| 512 | Ga0395901_0810343 | 3300038443 | Bacteria | 924 |
| 513 | Ga0395901_2001383 | 3300038443 | Bacteria | 525 |
| 514 | Ga0436360_0570305 | 3300039438 | Bacteria | 2998 |
| 515 | Ga0436360_0718691 | 3300039438 | Unclassified | 798 |
| 516 | Ga0436362_0431750 | 3300039453 | Bacteria | 1986 |
| 517 | Ga0439453_0063814 | 3300041408 | Bacteria | 767 |
| 518 | Ga0451804_0842484 | 3300041463 | Unclassified | 928 |
| 519 | Ga0451855_1376915 | 3300041511 | Bacteria | 553 |
| 520 | Ga0439448_0345572 | 3300042005 | Bacteria | 530 |
| 521 | Ga0450902_083325 | 3300042137 | Bacteria | 563 |
| 522 | Ga0439458_0028399 | 3300042157 | Bacteria | 1324 |
| 523 | Ga0439460_0087264 | 3300042461 | Bacteria | 987 |
| 524 | Ga0466965_0476347 | 3300044683 | Unclassified | 698 |
| 525 | Ga0466966_0049919 | 3300044684 | Unclassified | 2663 |
| 526 | Ga0466966_0323023 | 3300044684 | Unclassified | 927 |
| 527 | Ga0466961_0005003 | 3300044693 | Bacteria | 8335 |
| 528 | Ga0466963_0000532 | 3300044694 | Bacteria | 17888 |
| 529 | Ga0466963_0001856 | 3300044694 | Bacteria | 11523 |
| 530 | Ga0466963_0007505 | 3300044694 | Bacteria | 6507 |
| 531 | Ga0466963_0007882 | 3300044694 | Bacteria | 6375 |
| 532 | Ga0466963_0059581 | 3300044694 | Bacteria | 2548 |
| 533 | Ga0466963_0065184 | 3300044694 | Bacteria | 2442 |
| 534 | Ga0466963_0090962 | 3300044694 | Bacteria | 2078 |
| 535 | Ga0466963_0271709 | 3300044694 | Bacteria | 1191 |
| 536 | Ga0466963_0351716 | 3300044694 | Bacteria | 1038 |
| 537 | Ga0466963_1111041 | 3300044694 | Bacteria | 556 |
| 538 | Ga0466964_0027586 | 3300044706 | Bacteria | 2231 |
| 539 | Ga0466964_0056934 | 3300044706 | Bacteria | 1617 |
| 540 | Ga0466964_0200818 | 3300044706 | Bacteria | 957 |
| 541 | Ga0466964_0224624 | 3300044706 | Unclassified | 913 |
| 542 | Ga0466971_0245788 | 3300044719 | Bacteria | 852 |
| 543 | Ga0466971_0714686 | 3300044719 | Unclassified | 504 |
| 544 | Ga0466968_0010627 | 3300044735 | Bacteria | 3574 |
| 545 | Ga0466968_0055011 | 3300044735 | Bacteria | 1707 |
| 546 | Ga0466968_0453167 | 3300044735 | Bacteria | 634 |
| 547 | Ga0466970_0535355 | 3300044765 | Unclassified | 676 |
| 548 | Ga0466957_0007081 | 3300044842 | Bacteria | 6341 |
| 549 | Ga0466957_0311157 | 3300044842 | Bacteria | 1060 |
| 550 | Ga0466957_1217920 | 3300044842 | Unclassified | 545 |
| 551 | Ga0466959_0011375 | 3300045049 | Bacteria | 6393 |
| 552 | Ga0466959_0021693 | 3300045049 | Bacteria | 4740 |
| 553 | Ga0451576_0115678 | 3300045051 | Bacteria | 2792 |
| 554 | Ga0451576_1693411 | 3300045051 | Unclassified | 655 |
| 555 | Ga0466958_0015042 | 3300045836 | Bacteria | 4427 |
| 556 | Ga0466958_0112001 | 3300045836 | Unclassified | 1704 |
| 557 | Ga0466958_0972209 | 3300045836 | Bacteria | 554 |
| 558 | Ga0466967_0006110 | 3300045976 | Bacteria | 8470 |
| 559 | Ga0466967_0009880 | 3300045976 | Bacteria | 7117 |
| 560 | Ga0466967_0015339 | 3300045976 | Bacteria | 6001 |
| 561 | Ga0466967_0016262 | 3300045976 | Bacteria | 5860 |
| 562 | Ga0466967_0020316 | 3300045976 | Bacteria | 5364 |
| 563 | Ga0466967_0044126 | 3300045976 | Bacteria | 3865 |
| 564 | Ga0466967_0055221 | 3300045976 | Bacteria | 3498 |
| 565 | Ga0466967_0064317 | 3300045976 | Bacteria | 3262 |
| 566 | Ga0466967_0083195 | 3300045976 | Bacteria | 2894 |
| 567 | Ga0466967_0120169 | 3300045976 | Bacteria | 2426 |
| 568 | Ga0466967_0163033 | 3300045976 | Bacteria | 2094 |
| 569 | Ga0466967_0192464 | 3300045976 | Bacteria | 1928 |
| 570 | Ga0466967_0375051 | 3300045976 | Bacteria | 1380 |
| 571 | Ga0466967_0463150 | 3300045976 | Bacteria | 1240 |
| 572 | Ga0466967_0673265 | 3300045976 | Bacteria | 1024 |
| 573 | Ga0466967_0850607 | 3300045976 | Unclassified | 906 |
| 574 | Ga0466967_1146501 | 3300045976 | Unclassified | 775 |
| 575 | Ga0466967_1163574 | 3300045976 | Unclassified | 768 |
| 576 | Ga0466967_1407735 | 3300045976 | Bacteria | 694 |
| 577 | Ga0466967_1579078 | 3300045976 | Unclassified | 653 |
| 578 | Ga0466967_1908516 | 3300045976 | Bacteria | 591 |
| 579 | Ga0466967_2488758 | 3300045976 | Bacteria | 513 |
| 580 | Ga0495592_0000410 | 3300046454 | Bacteria | 32753 |
| 581 | Ga0495592_0008108 | 3300046454 | Bacteria | 7887 |
| 582 | Ga0495592_0072952 | 3300046454 | Bacteria | 2497 |
| 583 | Ga0495592_0124333 | 3300046454 | Bacteria | 1811 |
| 584 | Ga0495592_0169769 | 3300046454 | Unclassified | 1495 |
| 585 | Ga0495592_0215774 | 3300046454 | Unclassified | 1286 |
| 586 | Ga0495603_0282350 | 3300046455 | Bacteria | 954 |
| 587 | Ga0495629_0026042 | 3300046459 | Bacteria | 4156 |
| 588 | Ga0495629_0084672 | 3300046459 | Bacteria | 2212 |
| 589 | Ga0495629_0154532 | 3300046459 | Bacteria | 1595 |
| 590 | Ga0495629_0200141 | 3300046459 | Bacteria | 1381 |
| 591 | Ga0495629_0233316 | 3300046459 | Bacteria | 1268 |
| 592 | Ga0495641_0005629 | 3300046461 | Bacteria | 8372 |
| 593 | Ga0495641_0009652 | 3300046461 | Bacteria | 5708 |
| 594 | Ga0495641_0039888 | 3300046461 | Bacteria | 2186 |
| 595 | Ga0495641_0154131 | 3300046461 | Bacteria | 1027 |
| 596 | Ga0495641_0382634 | 3300046461 | Unclassified | 638 |
| 597 | Ga0495651_0000034 | 3300046462 | Bacteria | 99213 |
| 598 | Ga0495651_0054593 | 3300046462 | Bacteria | 3072 |
| 599 | Ga0495651_0056976 | 3300046462 | Bacteria | 3001 |
| 600 | Ga0495651_0216323 | 3300046462 | Bacteria | 1329 |
| 601 | Ga0495651_0265008 | 3300046462 | Bacteria | 1167 |
| 602 | Ga0495651_0308257 | 3300046462 | Bacteria | 1060 |
| 603 | Ga0495653_0001634 | 3300046463 | Bacteria | 17597 |
| 604 | Ga0495653_0007842 | 3300046463 | Bacteria | 8742 |
| 605 | Ga0495653_0150966 | 3300046463 | Bacteria | 1623 |
| 606 | Ga0495653_0161884 | 3300046463 | Bacteria | 1553 |
| 607 | Ga0495653_0296286 | 3300046463 | Unclassified | 1056 |
| 608 | Ga0495580_0018581 | 3300046472 | Bacteria | 5174 |
| 609 | Ga0495582_0008933 | 3300046473 | Bacteria | 5530 |
| 610 | Ga0495582_0352125 | 3300046473 | Bacteria | 848 |
| 611 | Ga0495582_0483457 | 3300046473 | Unclassified | 715 |
| 612 | Ga0495639_0009322 | 3300046475 | Bacteria | 4209 |
| 613 | Ga0495639_0269909 | 3300046475 | Bacteria | 844 |
| 614 | Ga0495662_0005815 | 3300046476 | Bacteria | 6172 |
| 615 | Ga0495662_0137492 | 3300046476 | Bacteria | 1202 |
| 616 | Ga0495664_0003716 | 3300046477 | Bacteria | 8323 |
| 617 | Ga0495664_0024197 | 3300046477 | Bacteria | 3528 |
| 618 | Ga0495664_0058659 | 3300046477 | Bacteria | 2290 |
| 619 | Ga0495664_0170231 | 3300046477 | Unclassified | 1321 |
| 620 | Ga0495664_0950238 | 3300046477 | Bacteria | 501 |
| 621 | Ga0495608_0001004 | 3300046511 | Bacteria | 19861 |
| 622 | Ga0495608_0027586 | 3300046511 | Bacteria | 3863 |
| 623 | Ga0495608_0035988 | 3300046511 | Bacteria | 3334 |
| 624 | Ga0495608_0306809 | 3300046511 | Bacteria | 982 |
| 625 | Ga0495608_0664312 | 3300046511 | Unclassified | 622 |
| 626 | Ga0495608_0777675 | 3300046511 | Unclassified | 566 |
| 627 | Ga0495618_0008709 | 3300046514 | Bacteria | 6132 |
| 628 | Ga0495618_0047831 | 3300046514 | Bacteria | 2699 |
| 629 | Ga0495618_0182783 | 3300046514 | Bacteria | 1332 |
| 630 | Ga0495618_0186969 | 3300046514 | Bacteria | 1315 |
| 631 | Ga0495618_0198672 | 3300046514 | Unclassified | 1270 |
| 632 | Ga0495618_0716944 | 3300046514 | Bacteria | 587 |
| 633 | Ga0495628_0000184 | 3300046516 | Bacteria | 54832 |
| 634 | Ga0495628_0116001 | 3300046516 | Bacteria | 2057 |
| 635 | Ga0495628_0176333 | 3300046516 | Unclassified | 1619 |
| 636 | Ga0495628_0327959 | 3300046516 | Bacteria | 1128 |
| 637 | Ga0495628_0558418 | 3300046516 | Unclassified | 821 |
| 638 | Ga0495628_0782852 | 3300046516 | Bacteria | 668 |
| 639 | Ga0495628_0933321 | 3300046516 | Unclassified | 600 |
| 640 | Ga0495630_0006556 | 3300046517 | Bacteria | 8289 |
| 641 | Ga0495630_0022305 | 3300046517 | Bacteria | 4676 |
| 642 | Ga0495630_0177965 | 3300046517 | Unclassified | 1621 |
| 643 | Ga0495630_0235350 | 3300046517 | Unclassified | 1399 |
| 644 | Ga0495630_0396091 | 3300046517 | Bacteria | 1058 |
| 645 | Ga0495630_0696609 | 3300046517 | Unclassified | 777 |
| 646 | Ga0495666_0001186 | 3300046526 | Bacteria | 12548 |
| 647 | Ga0495652_0000319 | 3300046529 | Bacteria | 56845 |
| 648 | Ga0495652_0018630 | 3300046529 | Bacteria | 6186 |
| 649 | Ga0495652_0058072 | 3300046529 | Bacteria | 3278 |
| 650 | Ga0495652_0156930 | 3300046529 | Unclassified | 1771 |
| 651 | Ga0495652_0219334 | 3300046529 | Bacteria | 1430 |
| 652 | Ga0495652_0242948 | 3300046529 | Unclassified | 1338 |
| 653 | Ga0495652_0465620 | 3300046529 | Unclassified | 882 |
| 654 | Ga0495652_0774125 | 3300046529 | Bacteria | 641 |
| 655 | Ga0495665_0003752 | 3300046531 | Bacteria | 8219 |
| 656 | Ga0495640_0010802 | 3300046533 | Bacteria | 7043 |
| 657 | Ga0495640_0016364 | 3300046533 | Bacteria | 5548 |
| 658 | Ga0495640_0038013 | 3300046533 | Unclassified | 3389 |
| 659 | Ga0495640_0124729 | 3300046533 | Unclassified | 1671 |
| 660 | Ga0495640_0320714 | 3300046533 | Bacteria | 960 |
| 661 | Ga0495586_0052035 | 3300046535 | Bacteria | 2216 |
| 662 | Ga0495586_0078082 | 3300046535 | Bacteria | 1816 |
| 663 | Ga0495586_0466650 | 3300046535 | Bacteria | 728 |
| 664 | Ga0495587_0000055 | 3300046536 | Bacteria | 97024 |
| 665 | Ga0495587_0072248 | 3300046536 | Bacteria | 2006 |
| 666 | Ga0495587_0137127 | 3300046536 | Unclassified | 1397 |
| 667 | Ga0495587_0838608 | 3300046536 | Bacteria | 501 |
| 668 | Ga0495645_0000170 | 3300046543 | Bacteria | 45455 |
| 669 | Ga0495645_0075458 | 3300046543 | Bacteria | 2426 |
| 670 | Ga0495645_0262930 | 3300046543 | Unclassified | 1141 |
| 671 | Ga0495645_0503907 | 3300046543 | Unclassified | 756 |
| 672 | Ga0495667_0021039 | 3300046559 | Bacteria | 4400 |
| 673 | Ga0495667_0039955 | 3300046559 | Bacteria | 3116 |
| 674 | Ga0495667_0043555 | 3300046559 | Bacteria | 2974 |
| 675 | Ga0495667_0085805 | 3300046559 | Bacteria | 2043 |
| 676 | Ga0495667_0161893 | 3300046559 | Bacteria | 1439 |
| 677 | Ga0495667_0172395 | 3300046559 | Bacteria | 1390 |
| 678 | Ga0495667_0268327 | 3300046559 | Unclassified | 1085 |
| 679 | Ga0495667_0424684 | 3300046559 | Bacteria | 836 |
| 680 | Ga0495667_0583267 | 3300046559 | Unclassified | 697 |
| 681 | Ga0495634_0008630 | 3300046642 | Bacteria | 7563 |
| 682 | Ga0495634_0037619 | 3300046642 | Bacteria | 3305 |
| 683 | Ga0495634_0075314 | 3300046642 | Bacteria | 2216 |
| 684 | Ga0495634_0522557 | 3300046642 | Bacteria | 694 |
| 685 | Ga0495634_0716118 | 3300046642 | Unclassified | 575 |
| 686 | Ga0495635_0011475 | 3300046663 | Bacteria | 6212 |
| 687 | Ga0495635_0031624 | 3300046663 | Bacteria | 3673 |
| 688 | Ga0495635_0051587 | 3300046663 | Unclassified | 2833 |
| 689 | Ga0495635_0059979 | 3300046663 | Bacteria | 2616 |
| 690 | Ga0495635_0161873 | 3300046663 | Bacteria | 1523 |
| 691 | Ga0495635_0600135 | 3300046663 | Bacteria | 719 |
| 692 | Ga0495657_0025578 | 3300046675 | Bacteria | 4190 |
| 693 | Ga0495657_0069002 | 3300046675 | Bacteria | 2314 |
| 694 | Ga0495657_0179041 | 3300046675 | Bacteria | 1302 |
| 695 | Ga0495657_0225993 | 3300046675 | Unclassified | 1133 |
| 696 | Ga0495657_0240447 | 3300046675 | Bacteria | 1093 |
| 697 | Ga0495657_0816910 | 3300046675 | Unclassified | 532 |
| 698 | Ga0495599_0001220 | 3300046678 | Bacteria | 14572 |
| 699 | Ga0495599_0061558 | 3300046678 | Bacteria | 2345 |
| 700 | Ga0495599_0156685 | 3300046678 | Bacteria | 1409 |
| 701 | Ga0495599_0540301 | 3300046678 | Bacteria | 683 |
| 702 | Ga0495599_0613858 | 3300046678 | Bacteria | 632 |
| 703 | Ga0495599_0626045 | 3300046678 | Archaea | 625 |
| 704 | Ga0495623_0000149 | 3300046679 | Bacteria | 42958 |
| 705 | Ga0495623_0041042 | 3300046679 | Bacteria | 2953 |
| 706 | Ga0495623_0205186 | 3300046679 | Unclassified | 1131 |
| 707 | Ga0495623_0259635 | 3300046679 | Unclassified | 974 |
| 708 | Ga0495646_0010301 | 3300046680 | Bacteria | 5946 |
| 709 | Ga0495646_0079788 | 3300046680 | Bacteria | 1910 |
| 710 | Ga0495646_0097428 | 3300046680 | Bacteria | 1690 |
| 711 | Ga0495647_0001212 | 3300046681 | Bacteria | 7962 |
| 712 | Ga0495647_0463397 | 3300046681 | Bacteria | 587 |
| 713 | Ga0495658_0004111 | 3300046683 | Bacteria | 7167 |
| 714 | Ga0495658_0047705 | 3300046683 | Bacteria | 2413 |
| 715 | Ga0495658_0069176 | 3300046683 | Bacteria | 2046 |
| 716 | Ga0495658_0152406 | 3300046683 | Unclassified | 1421 |
| 717 | Ga0495658_0380134 | 3300046683 | Unclassified | 899 |
| 718 | Ga0495613_0005204 | 3300046689 | Bacteria | 9767 |
| 719 | Ga0495613_0011084 | 3300046689 | Bacteria | 6693 |
| 720 | Ga0495613_0052186 | 3300046689 | Bacteria | 3012 |
| 721 | Ga0495613_0070496 | 3300046689 | Bacteria | 2549 |
| 722 | Ga0495624_0016643 | 3300046690 | Bacteria | 4949 |
| 723 | Ga0495624_0026752 | 3300046690 | Bacteria | 3779 |
| 724 | Ga0495624_0544670 | 3300046690 | Unclassified | 693 |
| 725 | Ga0495600_0149841 | 3300046809 | Unclassified | 1511 |
| 726 | Ga0495600_0263300 | 3300046809 | Unclassified | 1095 |
| 727 | Ga0495581_0005286 | 3300047315 | Bacteria | 7468 |
| 728 | Ga0495604_0000194 | 3300047317 | Bacteria | 54877 |
| 729 | Ga0495604_0038396 | 3300047317 | Bacteria | 3767 |
| 730 | Ga0495604_0040857 | 3300047317 | Bacteria | 3640 |
| 731 | Ga0495604_0610286 | 3300047317 | Unclassified | 699 |
| 732 | Ga0495604_0694084 | 3300047317 | Bacteria | 647 |
| 733 | Ga0495674_0009278 | 3300047319 | Bacteria | 9349 |
| 734 | Ga0495674_0023647 | 3300047319 | Bacteria | 5658 |
| 735 | Ga0495674_0025046 | 3300047319 | Bacteria | 5476 |
| 736 | Ga0495674_0092528 | 3300047319 | Bacteria | 2581 |
| 737 | Ga0495674_0214047 | 3300047319 | Bacteria | 1595 |
| 738 | Ga0495674_0341898 | 3300047319 | Bacteria | 1216 |
| 739 | Ga0495674_0360492 | 3300047319 | Unclassified | 1179 |
| 740 | Ga0495674_0511381 | 3300047319 | Bacteria | 960 |
| 741 | Ga0495674_0520153 | 3300047319 | Bacteria | 950 |
| 742 | Ga0495676_0066273 | 3300047321 | Bacteria | 2799 |
| 743 | Ga0495676_0068155 | 3300047321 | Bacteria | 2750 |
| 744 | Ga0495676_0087620 | 3300047321 | Bacteria | 2339 |
| 745 | Ga0495676_0400227 | 3300047321 | Bacteria | 911 |
| 746 | Ga0495680_0017928 | 3300047322 | Bacteria | 6024 |
| 747 | Ga0495680_0028662 | 3300047322 | Bacteria | 4564 |
| 748 | Ga0495680_0034084 | 3300047322 | Bacteria | 4117 |
| 749 | Ga0495680_0036955 | 3300047322 | Bacteria | 3915 |
| 750 | Ga0495675_0000029 | 3300047444 | Bacteria | 105305 |
| 751 | Ga0495675_0202192 | 3300047444 | Bacteria | 1209 |
| 752 | Ga0495675_0263542 | 3300047444 | Bacteria | 1032 |
| 753 | Ga0495684_0008421 | 3300047471 | Bacteria | 7990 |
| 754 | Ga0495684_0019490 | 3300047471 | Bacteria | 5225 |
| 755 | Ga0495684_0028439 | 3300047471 | Bacteria | 4292 |
| 756 | Ga0495684_0052586 | 3300047471 | Bacteria | 3108 |
| 757 | Ga0495684_0073849 | 3300047471 | Bacteria | 2591 |
| 758 | Ga0495684_0142758 | 3300047471 | Unclassified | 1795 |
| 759 | Ga0495684_0183360 | 3300047471 | Unclassified | 1551 |
| 760 | Ga0495593_0000750 | 3300047673 | Bacteria | 18855 |
| 761 | Ga0495602_0000741 | 3300048088 | Bacteria | 30911 |
| 762 | Ga0495602_0061366 | 3300048088 | Bacteria | 3270 |
| 763 | Ga0495602_0087920 | 3300048088 | Bacteria | 2588 |
| 764 | Ga0495602_0201833 | 3300048088 | Bacteria | 1516 |
| 765 | Ga0495602_0283851 | 3300048088 | Bacteria | 1218 |
| 766 | Ga0495602_0392215 | 3300048088 | Bacteria | 992 |
| 767 | Ga0495602_0681216 | 3300048088 | Bacteria | 699 |
| 768 | Ga0495602_0705525 | 3300048088 | Bacteria | 684 |
| 769 | Ga0495602_0729267 | 3300048088 | Bacteria | 670 |
| 770 | Ga0495602_1145511 | 3300048088 | Bacteria | 508 |
| 771 | Ga0495614_0000802 | 3300048089 | Bacteria | 13308 |
| 772 | Ga0495614_0136064 | 3300048089 | Unclassified | 1090 |
| 773 | Ga0496100_0002026 | 3300048903 | Bacteria | 10143 |
| 774 | Ga0496100_0022421 | 3300048903 | Bacteria | 3821 |
| 775 | Ga0496100_0050060 | 3300048903 | Bacteria | 2705 |
| 776 | Ga0496100_0120248 | 3300048903 | Bacteria | 1836 |
| 777 | Ga0496100_0293833 | 3300048903 | Bacteria | 1214 |
| 778 | Ga0496100_0730144 | 3300048903 | Bacteria | 774 |
| 779 | Ga0496101_0007253 | 3300048904 | Bacteria | 7172 |
| 780 | Ga0496101_0028953 | 3300048904 | Bacteria | 3871 |
| 781 | Ga0496101_0109681 | 3300048904 | Bacteria | 2076 |
| 782 | Ga0496101_0117841 | 3300048904 | Bacteria | 2005 |
| 783 | Ga0496101_0244499 | 3300048904 | Bacteria | 1397 |
| 784 | Ga0496101_0378708 | 3300048904 | Bacteria | 1113 |
| 785 | Ga0496102_0015239 | 3300048905 | Bacteria | 6693 |
| 786 | Ga0496102_0016614 | 3300048905 | Bacteria | 6434 |
| 787 | Ga0496102_0092770 | 3300048905 | Bacteria | 2797 |
| 788 | Ga0496102_0891220 | 3300048905 | Bacteria | 811 |
| 789 | Ga0496102_0894044 | 3300048905 | Bacteria | 810 |
| 790 | Ga0496102_0927624 | 3300048905 | Bacteria | 792 |
| 791 | Ga0496102_1360852 | 3300048905 | Bacteria | 629 |
| 792 | Ga0496102_1568203 | 3300048905 | Unclassified | 577 |
| 793 | Ga0496103_0370884 | 3300048906 | Bacteria | 920 |
| 794 | Ga0496104_0003169 | 3300048907 | Bacteria | 14147 |
| 795 | Ga0496104_0007841 | 3300048907 | Bacteria | 9462 |
| 796 | Ga0496104_0035240 | 3300048907 | Bacteria | 4673 |
| 797 | Ga0496104_0051552 | 3300048907 | Bacteria | 3884 |
| 798 | Ga0496104_0167467 | 3300048907 | Bacteria | 2107 |
| 799 | Ga0496104_0299279 | 3300048907 | Bacteria | 1521 |
| 800 | Ga0496104_0395651 | 3300048907 | Unclassified | 1294 |
| 801 | Ga0496104_0593860 | 3300048907 | Unclassified | 1017 |
| 802 | Ga0496105_0013301 | 3300048908 | Bacteria | 6530 |
| 803 | Ga0496105_0018312 | 3300048908 | Bacteria | 5626 |
| 804 | Ga0496105_0024704 | 3300048908 | Bacteria | 4884 |
| 805 | Ga0496105_0048496 | 3300048908 | Bacteria | 3505 |
| 806 | Ga0496105_0063378 | 3300048908 | Bacteria | 3050 |
| 807 | Ga0496105_0096726 | 3300048908 | Bacteria | 2438 |
| 808 | Ga0496105_0116215 | 3300048908 | Bacteria | 2207 |
| 809 | Ga0496105_0289262 | 3300048908 | Bacteria | 1319 |
| 810 | Ga0496105_0699396 | 3300048908 | Bacteria | 778 |
| 811 | Ga0496106_0001209 | 3300048909 | Bacteria | 19302 |
| 812 | Ga0496106_0003352 | 3300048909 | Bacteria | 11940 |
| 813 | Ga0496106_0286909 | 3300048909 | Unclassified | 1319 |
| 814 | Ga0496106_0619780 | 3300048909 | Bacteria | 866 |
| 815 | Ga0496107_0022234 | 3300048910 | Bacteria | 4481 |
| 816 | Ga0496107_0051508 | 3300048910 | Bacteria | 2969 |
| 817 | Ga0496107_0064351 | 3300048910 | Bacteria | 2659 |
| 818 | Ga0496107_0208732 | 3300048910 | Bacteria | 1452 |
| 819 | Ga0496107_0514774 | 3300048910 | Unclassified | 887 |
| 820 | Ga0496108_0002815 | 3300048911 | Bacteria | 13953 |
| 821 | Ga0496108_0022442 | 3300048911 | Bacteria | 5188 |
| 822 | Ga0496108_0029182 | 3300048911 | Bacteria | 4567 |
| 823 | Ga0496108_0050860 | 3300048911 | Bacteria | 3471 |
| 824 | Ga0496108_0184595 | 3300048911 | Bacteria | 1806 |
| 825 | Ga0496109_0001232 | 3300048912 | Bacteria | 21266 |
| 826 | Ga0496109_0005020 | 3300048912 | Bacteria | 11054 |
| 827 | Ga0496109_0005573 | 3300048912 | Bacteria | 10539 |
| 828 | Ga0496109_0063635 | 3300048912 | Bacteria | 3374 |
| 829 | Ga0496109_0071841 | 3300048912 | Bacteria | 3178 |
| 830 | Ga0496109_0156883 | 3300048912 | Bacteria | 2132 |
| 831 | Ga0496109_0227494 | 3300048912 | Bacteria | 1754 |
| 832 | Ga0496109_0482366 | 3300048912 | Bacteria | 1170 |
| 833 | Ga0496110_0033218 | 3300048913 | Bacteria | 4461 |
| 834 | Ga0496110_0046222 | 3300048913 | Bacteria | 3808 |
| 835 | Ga0496110_0050897 | 3300048913 | Bacteria | 3639 |
| 836 | Ga0496110_0078503 | 3300048913 | Unclassified | 2939 |
| 837 | Ga0496110_0167232 | 3300048913 | Bacteria | 1994 |
| 838 | Ga0496110_0491924 | 3300048913 | Bacteria | 1117 |
| 839 | Ga0496110_0566893 | 3300048913 | Bacteria | 1031 |
| 840 | Ga0496111_0008451 | 3300048914 | Bacteria | 6817 |
| 841 | Ga0496111_0015430 | 3300048914 | Bacteria | 5243 |
| 842 | Ga0496111_0079336 | 3300048914 | Bacteria | 2394 |
| 843 | Ga0496111_0125221 | 3300048914 | Bacteria | 1899 |
| 844 | Ga0496111_0292613 | 3300048914 | Bacteria | 1208 |
| 845 | Ga0496111_0320454 | 3300048914 | Bacteria | 1148 |
| 846 | Ga0496112_0022139 | 3300048915 | Bacteria | 6055 |
| 847 | Ga0496112_0051586 | 3300048915 | Bacteria | 4035 |
| 848 | Ga0496112_0182050 | 3300048915 | Bacteria | 2065 |
| 849 | Ga0496112_0624744 | 3300048915 | Bacteria | 1008 |
| 850 | Ga0496113_0060094 | 3300048916 | Bacteria | 2864 |
| 851 | Ga0496113_0091870 | 3300048916 | Bacteria | 2341 |
| 852 | Ga0496113_0148427 | 3300048916 | Bacteria | 1849 |
| 853 | Ga0496113_1030291 | 3300048916 | Bacteria | 647 |
| 854 | Ga0496113_1290757 | 3300048916 | Bacteria | 568 |
| 855 | Ga0496113_1449382 | 3300048916 | Unclassified | 531 |
| 856 | Ga0496114_0010264 | 3300048917 | Bacteria | 7452 |
| 857 | Ga0496114_0023553 | 3300048917 | Bacteria | 5025 |
| 858 | Ga0496114_0029079 | 3300048917 | Bacteria | 4539 |
| 859 | Ga0496114_0119004 | 3300048917 | Bacteria | 2270 |
| 860 | Ga0496114_0203360 | 3300048917 | Bacteria | 1735 |
| 861 | Ga0496114_0354258 | 3300048917 | Bacteria | 1298 |
| 862 | Ga0496114_0417050 | 3300048917 | Bacteria | 1189 |
| 863 | Ga0496114_0832881 | 3300048917 | Bacteria | 802 |
| 864 | Ga0496114_0866352 | 3300048917 | Bacteria | 784 |
| 865 | Ga0496114_1202701 | 3300048917 | Bacteria | 644 |
| 866 | Ga0496114_1722616 | 3300048917 | Unclassified | 515 |
| 867 | Ga0496115_0008936 | 3300048918 | Bacteria | 7430 |
| 868 | Ga0496115_0011555 | 3300048918 | Bacteria | 6619 |
| 869 | Ga0496115_0053205 | 3300048918 | Bacteria | 3248 |
| 870 | Ga0496115_0066404 | 3300048918 | Bacteria | 2915 |
| 871 | Ga0496115_0079634 | 3300048918 | Bacteria | 2667 |
| 872 | Ga0496115_0095989 | 3300048918 | Bacteria | 2427 |
| 873 | Ga0496115_0163098 | 3300048918 | Bacteria | 1843 |
| 874 | Ga0496115_0274182 | 3300048918 | Bacteria | 1385 |
| 875 | Ga0496115_0313295 | 3300048918 | Bacteria | 1285 |
| 876 | Ga0501031_0004850 | 3300049568 | Bacteria | 8743 |
| 877 | Ga0501031_0031722 | 3300049568 | Bacteria | 3447 |
| 878 | Ga0501032_0034116 | 3300049569 | Bacteria | 3484 |
| 879 | Ga0501034_0339198 | 3300049571 | Bacteria | 1433 |
| 880 | Ga0501034_0387538 | 3300049571 | Bacteria | 1322 |
| 881 | Ga0501036_0012418 | 3300049572 | Bacteria | 7056 |
| 882 | Ga0501036_0014731 | 3300049572 | Bacteria | 6522 |
| 883 | Ga0501037_0085622 | 3300049573 | Bacteria | 2282 |
| 884 | Ga0501037_0122880 | 3300049573 | Bacteria | 1865 |
| 885 | Ga0501038_0011136 | 3300049574 | Bacteria | 8213 |
| 886 | Ga0501038_0215237 | 3300049574 | Bacteria | 1535 |
| 887 | Ga0501038_0234032 | 3300049574 | Bacteria | 1461 |
| 888 | Ga0501039_0043081 | 3300049575 | Bacteria | 3487 |
| 889 | Ga0501040_0063391 | 3300049576 | Bacteria | 2543 |
| 890 | Ga0501041_0003188 | 3300049577 | Bacteria | 9434 |
| 891 | Ga0501042_0002606 | 3300049578 | Bacteria | 11090 |
| 892 | Ga0501042_0075677 | 3300049578 | Bacteria | 2409 |
| 893 | Ga0501043_0518683 | 3300049579 | Bacteria | 888 |
| 894 | Ga0501046_0001782 | 3300049580 | Bacteria | 20562 |
| 895 | Ga0501046_0107626 | 3300049580 | Bacteria | 2133 |
| 896 | Ga0501046_0310012 | 3300049580 | Bacteria | 1151 |
| 897 | Ga0501047_0664340 | 3300049581 | Bacteria | 861 |
| 898 | Ga0501048_0007986 | 3300049582 | Bacteria | 8010 |
| 899 | Ga0501048_0077979 | 3300049582 | Bacteria | 2338 |
| 900 | Ga0501067_0194403 | 3300049583 | Bacteria | 1130 |
| 901 | Ga0501067_0459853 | 3300049583 | Bacteria | 711 |
| 902 | Ga0501067_0649277 | 3300049583 | Bacteria | 592 |
| 903 | Ga0501068_0005297 | 3300049584 | Bacteria | 7044 |
| 904 | Ga0501068_0017559 | 3300049584 | Bacteria | 4139 |
| 905 | Ga0501068_0333144 | 3300049584 | Unclassified | 974 |
| 906 | Ga0501069_0004693 | 3300049585 | Bacteria | 7064 |
| 907 | Ga0501069_0087395 | 3300049585 | Unclassified | 1761 |
| 908 | Ga0501070_0001614 | 3300049586 | Bacteria | 20005 |
| 909 | Ga0501070_0295283 | 3300049586 | Bacteria | 1321 |
| 910 | Ga0501070_0738315 | 3300049586 | Bacteria | 776 |
| 911 | Ga0501071_0004871 | 3300049587 | Bacteria | 8557 |
| 912 | Ga0501071_0106467 | 3300049587 | Bacteria | 2070 |
| 913 | Ga0501072_0006639 | 3300049588 | Bacteria | 8804 |
| 914 | Ga0501072_0084433 | 3300049588 | Bacteria | 2517 |
| 915 | Ga0501072_0572807 | 3300049588 | Bacteria | 891 |
| 916 | Ga0501073_0001427 | 3300049589 | Bacteria | 17658 |
| 917 | Ga0501074_0003559 | 3300049590 | Bacteria | 11042 |
| 918 | Ga0501074_0013802 | 3300049590 | Bacteria | 5876 |
| 919 | Ga0501074_0248729 | 3300049590 | Bacteria | 1264 |
| 920 | Ga0501075_0001342 | 3300049591 | Bacteria | 15979 |
| 921 | Ga0501075_0100514 | 3300049591 | Bacteria | 2196 |
| 922 | Ga0501075_0298350 | 3300049591 | Bacteria | 1228 |
| 923 | Ga0501076_0007652 | 3300049592 | Bacteria | 7867 |
| 924 | Ga0501076_0288524 | 3300049592 | Bacteria | 1344 |
| 925 | Ga0501077_0001984 | 3300049593 | Bacteria | 12353 |
| 926 | Ga0501079_0060374 | 3300049741 | Bacteria | 2924 |
| 927 | Ga0501080_0046811 | 3300049742 | Bacteria | 4026 |
| 928 | Ga0501080_0084203 | 3300049742 | Bacteria | 2955 |
| 929 | Ga0501080_0290170 | 3300049742 | Bacteria | 1485 |
| 930 | Ga0501081_0082497 | 3300049743 | Bacteria | 2252 |
| 931 | Ga0501083_0005829 | 3300049744 | Bacteria | 8722 |
| 932 | Ga0501083_0010453 | 3300049744 | Bacteria | 6535 |
| 933 | Ga0501035_0099819 | 3300049822 | Bacteria | 2548 |
| 934 | Ga0501044_0127243 | 3300049823 | Bacteria | 2544 |
| 935 | Ga0501044_0270353 | 3300049823 | Bacteria | 1636 |
| 936 | Ga0501045_0005139 | 3300049824 | Bacteria | 9061 |
| 937 | Ga0501045_0048481 | 3300049824 | Bacteria | 3096 |
| 938 | nmdc:mga03683_529018_c1 | 3300050489 | Unclassified | 573 |
| 939 | nmdc:mga00v17_55325_c1 | 3300050491 | Bacteria | 2423 |
| 940 | nmdc:mga0yw44_29577_c1 | 3300050492 | Bacteria | 3163 |
| 941 | nmdc:mga0yw44_926255_c1 | 3300050492 | Unclassified | 591 |
| 942 | nmdc:mga05p37_1850308_c1 | 3300050507 | Unclassified | 580 |
| 943 | nmdc:mga05p37_31165_c1 | 3300050507 | Bacteria | 6513 |
| 944 | nmdc:mga09592_28989_c1 | 3300050508 | Bacteria | 4603 |
| 945 | nmdc:mga09592_370014_c1 | 3300050508 | Bacteria | 1240 |
| 946 | nmdc:mga0qj67_569574_c1 | 3300050509 | Unclassified | 908 |
| 947 | nmdc:mga06r32_100701_c1 | 3300050510 | Bacteria | 2835 |
| 948 | nmdc:mga06r32_392953_c1 | 3300050510 | Bacteria | 1369 |
| 949 | nmdc:mga06r32_633346_c1 | 3300050510 | Bacteria | 1038 |
| 950 | nmdc:mga08y16_258745_c1 | 3300050511 | Unclassified | 1798 |
| 951 | nmdc:mga08y16_405054_c1 | 3300050511 | Bacteria | 1396 |
| 952 | nmdc:mga0n895_1057330_c1 | 3300050512 | Unclassified | 791 |
| 953 | nmdc:mga0n895_489355_c1 | 3300050512 | Bacteria | 1240 |
| 954 | nmdc:mga0n895_576472_c1 | 3300050512 | Bacteria | 1129 |
| 955 | nmdc:mga0n895_845287_c1 | 3300050512 | Unclassified | 903 |
| 956 | nmdc:mga0n895_938204_c1 | 3300050512 | Bacteria | 849 |
| 957 | nmdc:mga0rr50_251531_c1 | 3300050513 | Bacteria | 1468 |
| 958 | nmdc:mga0rr50_450202_c1 | 3300050513 | Unclassified | 1091 |
| 959 | nmdc:mga0a205_1204193_c1 | 3300050515 | Bacteria | 605 |
| 960 | nmdc:mga0a205_34242_c1 | 3300050515 | Bacteria | 4873 |
| 961 | Ga0495601_0000082 | 3300053077 | Bacteria | 51242 |
| 962 | Ga0495601_0011446 | 3300053077 | Bacteria | 5306 |
| 963 | Ga0495601_0019054 | 3300053077 | Bacteria | 4182 |
| 964 | Ga0495601_0026834 | 3300053077 | Bacteria | 3558 |
| 965 | Ga0495601_0109045 | 3300053077 | Bacteria | 1792 |
| 966 | Ga0495601_0121088 | 3300053077 | Unclassified | 1699 |
| 967 | Ga0495601_0192854 | 3300053077 | Unclassified | 1331 |
| 968 | Ga0495601_0213185 | 3300053077 | Bacteria | 1261 |
| 969 | Ga0495601_0352464 | 3300053077 | Bacteria | 957 |
| 970 | Ga0495601_0418064 | 3300053077 | Bacteria | 868 |
| 971 | Ga0495601_0814920 | 3300053077 | Unclassified | 592 |
| 972 | Ga0495601_0904344 | 3300053077 | Unclassified | 557 |
| 973 | Ga0495612_0001482 | 3300053078 | Bacteria | 9660 |
| 974 | Ga0495612_0008514 | 3300053078 | Bacteria | 4160 |
| 975 | Ga0495612_0081436 | 3300053078 | Bacteria | 1360 |
| 976 | Ga0495612_0133194 | 3300053078 | Bacteria | 1075 |
| 977 | Ga0495612_0303397 | 3300053078 | Bacteria | 716 |
| 978 | Ga0495595_0014003 | 3300053084 | Bacteria | 3395 |
| 979 | Ga0495595_0053143 | 3300053084 | Bacteria | 1881 |
| 980 | Ga0495595_0209416 | 3300053084 | Bacteria | 971 |
| 981 | Ga0495619_0006116 | 3300053085 | Bacteria | 7624 |
| 982 | Ga0495619_0026063 | 3300053085 | Bacteria | 3759 |
| 983 | Ga0495619_0029797 | 3300053085 | Bacteria | 3528 |
| 984 | Ga0495619_0035136 | 3300053085 | Bacteria | 3260 |
| 985 | Ga0495619_0288090 | 3300053085 | Bacteria | 1138 |
| 986 | Ga0495619_0634575 | 3300053085 | Archaea | 729 |
| 987 | Ga0495619_0730243 | 3300053085 | Unclassified | 672 |
| 988 | Ga0495619_0900692 | 3300053085 | Unclassified | 595 |
| 989 | Ga0495619_1072916 | 3300053085 | Bacteria | 537 |
| 990 | Ga0500566_0036553 | 3300053094 | Bacteria | 2848 |
| 991 | Ga0500657_180165 | 3300053728 | Bacteria | 734 |
| 992 | Ga0501084_0052695 | 3300054114 | Bacteria | 3403 |
| 993 | Ga0501082_0090387 | 3300060353 | Bacteria | 2643 |
| 994 | Ga0501082_0119035 | 3300060353 | Bacteria | 2288 |
| 995 | Ga0466962_0242558 | 3300061719 | Unclassified | 885 |
| 996 | Ga0466962_0558579 | 3300061719 | Bacteria | 582 |
| 997 | Ga0530510_0025581 | 3300061734 | Bacteria | 4221 |
| 998 | Ga0530510_0080608 | 3300061734 | Bacteria | 2369 |
| 999 | Ga0530510_0215800 | 3300061734 | Bacteria | 1425 |
| 1000 | Ga0105248_11620055 | |||
| 1001 | ARSoilOldRDRAFT_c018305 | |||
| 1002 | ARCol0yngRDRAFT_1004101 | |||
| 1003 | JGI25407J50210_10010134 | |||
| 1004 | JGI25407J50210_10055697 | |||
| 1005 | Ga0070658_10046325 | |||
| 1006 | Ga0070683_100001618 | |||
| 1007 | Ga0070683_100004037 | |||
| 1008 | Ga0070683_100024659 | |||
| 1009 | Ga0070683_100225996 | |||
| 1010 | Ga0070683_100244202 | |||
| 1011 | Ga0070683_100480038 | |||
| 1012 | Ga0068869_101119060 | |||
| 1013 | Ga0070680_100014480 | |||
| 1014 | Ga0070680_100038421 | |||
| 1015 | Ga0070680_100045407 | |||
| 1016 | Ga0070680_100228698 | |||
| 1017 | Ga0070680_100543419 | |||
| 1018 | Ga0070680_100599236 | |||
| 1019 | Ga0070682_100036952 | |||
| 1020 | Ga0070682_100450233 | |||
| 1021 | Ga0068868_100450303 | |||
| 1022 | Ga0068868_101567529 | |||
| 1023 | Ga0068868_101613621 | |||
| 1024 | Ga0068868_102102625 | |||
| 1025 | Ga0070660_100004204 | |||
| 1026 | Ga0070660_100008236 | |||
| 1027 | Ga0070660_100030781 | |||
| 1028 | Ga0070660_100176630 | |||
| 1029 | Ga0070691_10131992 | |||
| 1030 | Ga0070661_100037480 | |||
| 1031 | Ga0070661_100402984 | |||
| 1032 | Ga0070661_100464306 | |||
| 1033 | Ga0070692_10059677 | |||
| 1034 | Ga0070692_10113771 | |||
| 1035 | Ga0070692_10885315 | |||
| 1036 | Ga0070668_101421743 | |||
| 1037 | Ga0070671_100088351 | |||
| 1038 | Ga0070671_101454634 | |||
| 1039 | Ga0070673_100655696 | |||
| 1040 | Ga0070659_100044012 | |||
| 1041 | Ga0070659_100104376 | |||
| 1042 | Ga0070659_100395487 | |||
| 1043 | Ga0070659_100473885 | |||
| 1044 | Ga0070709_10147435 | |||
| 1045 | Ga0070709_10421862 | |||
| 1046 | Ga0070714_100007601 | |||
| 1047 | Ga0070714_100016982 | |||
| 1048 | Ga0070714_100437922 | |||
| 1049 | Ga0070714_100442941 | |||
| 1050 | Ga0070714_100853464 | |||
| 1051 | Ga0070714_102195250 | |||
| 1052 | Ga0070713_100001979 | |||
| 1053 | Ga0070713_100142875 | |||
| 1054 | Ga0070713_100175846 | |||
| 1055 | Ga0070713_100210275 | |||
| 1056 | Ga0070713_100933916 | |||
| 1057 | Ga0070713_101077840 | |||
| 1058 | Ga0070713_101470755 | |||
| 1059 | Ga0070713_101718825 | |||
| 1060 | Ga0070710_10001198 | |||
| 1061 | Ga0070710_10022719 | |||
| 1062 | Ga0070710_10080619 | |||
| 1063 | Ga0070710_10534886 | |||
| 1064 | Ga0070710_10722536 | |||
| 1065 | Ga0070710_10743055 | |||
| 1066 | Ga0070701_10767539 | |||
| 1067 | Ga0070711_100016338 | |||
| 1068 | Ga0070711_100016526 | |||
| 1069 | Ga0070711_100027857 | |||
| 1070 | Ga0070711_100053977 | |||
| 1071 | Ga0070694_100080056 | |||
| 1072 | Ga0070708_100771315 | |||
| 1073 | Ga0070663_100301716 | |||
| 1074 | Ga0070663_100380750 | |||
| 1075 | Ga0070663_101260541 | |||
| 1076 | Ga0070678_100655740 | |||
| 1077 | Ga0070678_101239106 | |||
| 1078 | Ga0070678_102341847 | |||
| 1079 | Ga0070662_100211703 | |||
| 1080 | Ga0070681_10003984 | |||
| 1081 | Ga0070681_10009371 | |||
| 1082 | Ga0070681_10020410 | |||
| 1083 | Ga0070681_10420534 | |||
| 1084 | Ga0070681_11108094 | |||
| 1085 | Ga0068867_102283975 | |||
| 1086 | Ga0070685_10425637 | |||
| 1087 | Ga0070706_100249775 | |||
| 1088 | Ga0070707_100000445 | |||
| 1089 | Ga0070707_100318397 | |||
| 1090 | Ga0070707_100365301 | |||
| 1091 | Ga0070698_100324261 | |||
| 1092 | Ga0070679_100011917 | |||
| 1093 | Ga0070679_100014687 | |||
| 1094 | Ga0070679_100026708 | |||
| 1095 | Ga0070679_100032618 | |||
| 1096 | Ga0070679_100093684 | |||
| 1097 | Ga0070679_100405563 | |||
| 1098 | Ga0070684_100020900 | |||
| 1099 | Ga0070684_100040098 | |||
| 1100 | Ga0070684_100046844 | |||
| 1101 | Ga0070684_100137345 | |||
| 1102 | Ga0070684_100803058 | |||
| 1103 | Ga0070684_102027899 | |||
| 1104 | Ga0068853_100028009 | |||
| 1105 | Ga0068853_100087810 | |||
| 1106 | Ga0070672_100773624 | |||
| 1107 | Ga0070695_100119158 | |||
| 1108 | Ga0070693_100357570 | |||
| 1109 | Ga0070665_100056274 | |||
| 1110 | Ga0070704_100007156 | |||
| 1111 | Ga0070704_100046747 | |||
| 1112 | Ga0068855_100017510 | |||
| 1113 | Ga0068855_100029199 | |||
| 1114 | Ga0068855_100072111 | |||
| 1115 | Ga0068855_100090005 | |||
| 1116 | Ga0068855_100124099 | |||
| 1117 | Ga0070664_100056337 | |||
| 1118 | Ga0070664_100066143 | |||
| 1119 | Ga0070664_100947117 | |||
| 1120 | Ga0068857_100077305 | |||
| 1121 | Ga0068857_100082734 | |||
| 1122 | Ga0068857_101087488 | |||
| 1123 | Ga0068854_100742018 | |||
| 1124 | Ga0068856_100083740 | |||
| 1125 | Ga0068856_100239210 | |||
| 1126 | Ga0068856_100346098 | |||
| 1127 | Ga0068856_100506060 | |||
| 1128 | Ga0070702_100055343 | |||
| 1129 | Ga0070702_100071092 | |||
| 1130 | Ga0070702_100602270 | |||
| 1131 | Ga0068852_100156433 | |||
| 1132 | Ga0068852_100614980 | |||
| 1133 | Ga0068852_100853387 | |||
| 1134 | Ga0068852_101814320 | |||
| 1135 | Ga0068859_101816869 | |||
| 1136 | Ga0068864_100589514 | |||
| 1137 | Ga0068861_101779948 | |||
| 1138 | Ga0068870_11057064 | |||
| 1139 | Ga0068863_100654396 | |||
| 1140 | Ga0068860_100685859 | |||
| 1141 | Ga0068860_101612365 | |||
| 1142 | Ga0081455_10016553 | |||
| 1143 | Ga0081538_10025660 | |||
| 1144 | Ga0081540_1073518 | |||
| 1145 | Ga0070717_10015481 | |||
| 1146 | Ga0070717_10064315 | |||
| 1147 | Ga0070717_10083763 | |||
| 1148 | Ga0070717_10173225 | |||
| 1149 | Ga0070717_10702232 | |||
| 1150 | Ga0070717_10893284 | |||
| 1151 | Ga0070717_11525256 | |||
| 1152 | Ga0075365_10336474 | |||
| 1153 | Ga0075364_10056535 | |||
| 1154 | Ga0075364_10076268 | |||
| 1155 | Ga0075364_10165487 | |||
| 1156 | Ga0075432_10002081 | |||
| 1157 | Ga0070715_10000804 | |||
| 1158 | Ga0070715_10026658 | |||
| 1159 | Ga0070716_100001564 | |||
| 1160 | Ga0070716_100033017 | |||
| 1161 | Ga0070716_100846515 | |||
| 1162 | Ga0070716_101567659 | |||
| 1163 | Ga0070712_100016804 | |||
| 1164 | Ga0070712_100092879 | |||
| 1165 | Ga0070712_100178712 | |||
| 1166 | Ga0070712_100373333 | |||
| 1167 | Ga0070712_100383775 | |||
| 1168 | Ga0070712_100404855 | |||
| 1169 | Ga0070712_100744820 | |||
| 1170 | Ga0070712_100826192 | |||
| 1171 | Ga0097621_100999889 | |||
| 1172 | Ga0097621_101283954 | |||
| 1173 | Ga0068871_100744676 | |||
| 1174 | Ga0075428_100060924 | |||
| 1175 | Ga0075430_100023972 | |||
| 1176 | Ga0075431_100726193 | |||
| 1177 | Ga0075433_10022357 | |||
| 1178 | Ga0075433_10323489 | |||
| 1179 | Ga0075433_10332983 | |||
| 1180 | Ga0075433_11538861 | |||
| 1181 | Ga0075434_100529904 | |||
| 1182 | Ga0075434_100567574 | |||
| 1183 | Ga0075434_100634759 | |||
| 1184 | Ga0075434_101288477 | |||
| 1185 | Ga0075429_100121549 | |||
| 1186 | Ga0075429_100171637 | |||
| 1187 | Ga0097620_101816523 | |||
| 1188 | Ga0075435_100954863 | |||
| 1189 | Ga0105251_10162270 | |||
| 1190 | Ga0105240_10080020 | |||
| 1191 | Ga0105240_10115984 | |||
| 1192 | Ga0105240_10341446 | |||
| 1193 | Ga0111539_10012361 | |||
| 1194 | Ga0111539_10878690 | |||
| 1195 | Ga0105245_10010834 | |||
| 1196 | Ga0105245_10072081 | |||
| 1197 | Ga0105245_10072772 | |||
| 1198 | Ga0105245_10171030 | |||
| 1199 | Ga0105245_10541552 | |||
| 1200 | Ga0105245_11092065 | |||
| 1201 | Ga0105245_11619371 | |||
| 1202 | Ga0105247_10243341 | |||
| 1203 | Ga0105247_10764542 | |||
| 1204 | Ga0105247_11611717 | |||
| 1205 | Ga0114129_10012279 | |||
| 1206 | Ga0105243_10047086 | |||
| 1207 | Ga0105241_10756674 | |||
| 1208 | Ga0105241_12108453 | |||
| 1209 | Ga0105242_10330216 | |||
| 1210 | Ga0105248_10090057 | |||
| 1211 | Ga0105248_10524673 | |||
| 1212 | Ga0105237_10085590 | |||
| 1213 | Ga0105237_10163848 | |||
| 1214 | Ga0105238_11222086 | |||
| 1215 | Ga0105249_10058633 | |||
| 1216 | Ga0105239_10117623 | |||
| 1217 | Ga0105239_10324948 | |||
| 1218 | Ga0105239_10542001 | |||
| 1219 | Ga0105239_11027185 | |||
| 1220 | Ga0105246_10061389 | |||
| 1221 | Ga0105246_10194063 | |||
| 1222 | Ga0105246_10674620 | |||
| 1223 | Ga0157337_1001970 | |||
| 1224 | Ga0157345_1004708 | |||
| 1225 | Ga0157338_1083782 | |||
| 1226 | Ga0157373_10160091 | |||
| 1227 | Ga0157371_10123923 | |||
| 1228 | Ga0157371_10155000 | |||
| 1229 | Ga0157370_10003288 | |||
| 1230 | Ga0157370_10019501 | |||
| 1231 | Ga0157370_10030905 | |||
| 1232 | Ga0157370_10104682 | |||
| 1233 | Ga0157370_10957836 | |||
| 1234 | Ga0157370_11269960 | |||
| 1235 | Ga0157369_10001003 | |||
| 1236 | Ga0157369_10037234 | |||
| 1237 | Ga0157369_10235657 | |||
| 1238 | Ga0157369_11322061 | |||
| 1239 | Ga0157369_12022822 | |||
| 1240 | Ga0157374_10041234 | |||
| 1241 | Ga0157374_10063540 | |||
| 1242 | Ga0157374_10100741 | |||
| 1243 | Ga0157374_10482043 | |||
| 1244 | Ga0157374_10521786 | |||
| 1245 | Ga0157374_11573131 | |||
| 1246 | Ga0157374_12011758 | |||
| 1247 | Ga0157378_10304071 | |||
| 1248 | Ga0163162_10094964 | |||
| 1249 | Ga0163162_12463949 | |||
| 1250 | Ga0157372_10059549 | |||
| 1251 | Ga0157372_10099027 | |||
| 1252 | Ga0157372_10142077 | |||
| 1253 | Ga0157372_10241533 | |||
| 1254 | Ga0157372_10290217 | |||
| 1255 | Ga0157372_10927414 | |||
| 1256 | Ga0157372_11618537 | |||
| 1257 | Ga0157375_10078085 | |||
| 1258 | Ga0157375_12899469 | |||
| 1259 | Ga0163163_10480874 | |||
| 1260 | Ga0182008_10088788 | |||
| 1261 | Ga0182008_10335926 | |||
| 1262 | Ga0157377_10024981 | |||
| 1263 | Ga0157379_10882244 | |||
| 1264 | Ga0157376_10005638 | |||
| 1265 | Ga0157376_10078509 | |||
| 1266 | Ga0182007_10386320 | |||
| 1267 | Ga0197907_11302405 | |||
| 1268 | Ga0206356_11288287 | |||
| 1269 | Ga0206354_10189649 | |||
| 1270 | Ga0206354_11042467 | |||
| 1271 | Ga0206353_10249593 | |||
| 1272 | Ga0206353_10287330 | |||
| 1273 | Ga0206353_10846162 | |||
| 1274 | Ga0213873_10147018 | |||
| 1275 | Ga0213871_10033542 | |||
| 1276 | Ga0224712_10041711 | |||
| 1277 | Ga0224712_10118831 | |||
| 1278 | Ga0207692_10012838 | |||
| 1279 | Ga0207692_10041406 | |||
| 1280 | Ga0207692_11062515 | |||
| 1281 | Ga0207688_10006115 | |||
| 1282 | Ga0207685_10181639 | |||
| 1283 | Ga0207699_10118982 | |||
| 1284 | Ga0207699_10142354 | |||
| 1285 | Ga0207643_10028234 | |||
| 1286 | Ga0207705_10038495 | |||
| 1287 | Ga0207684_10426738 | |||
| 1288 | Ga0207654_10879797 | |||
| 1289 | Ga0207707_10012789 | |||
| 1290 | Ga0207707_10135027 | |||
| 1291 | Ga0207707_10166503 | |||
| 1292 | Ga0207707_10233233 | |||
| 1293 | Ga0207707_10315569 | |||
| 1294 | Ga0207707_10322492 | |||
| 1295 | Ga0207707_10373305 | |||
| 1296 | Ga0207695_10126218 | |||
| 1297 | Ga0207695_11177285 | |||
| 1298 | Ga0207671_10072414 | |||
| 1299 | Ga0207693_10001250 | |||
| 1300 | Ga0207693_10004134 | |||
| 1301 | Ga0207693_10194985 | |||
| 1302 | Ga0207693_10268992 | |||
| 1303 | Ga0207693_10279318 | |||
| 1304 | Ga0207693_10403284 | |||
| 1305 | Ga0207663_10008967 | |||
| 1306 | Ga0207663_10161175 | |||
| 1307 | Ga0207663_10167249 | |||
| 1308 | Ga0207663_10329727 | |||
| 1309 | Ga0207660_10017111 | |||
| 1310 | Ga0207660_10050421 | |||
| 1311 | Ga0207660_10185956 | |||
| 1312 | Ga0207660_10460299 | |||
| 1313 | Ga0207660_11655254 | |||
| 1314 | Ga0207657_10000184 | |||
| 1315 | Ga0207657_10000683 | |||
| 1316 | Ga0207657_10006110 | |||
| 1317 | Ga0207657_10152363 | |||
| 1318 | Ga0207657_10340037 | |||
| 1319 | Ga0207649_10015676 | |||
| 1320 | Ga0207649_10876424 | |||
| 1321 | Ga0207652_10053119 | |||
| 1322 | Ga0207652_10808601 | |||
| 1323 | Ga0207646_10001908 | |||
| 1324 | Ga0207646_10321857 | |||
| 1325 | Ga0207646_10548342 | |||
| 1326 | Ga0207694_11630105 | |||
| 1327 | Ga0207659_10140453 | |||
| 1328 | Ga0207687_10029370 | |||
| 1329 | Ga0207687_10228865 | |||
| 1330 | Ga0207687_10589850 | |||
| 1331 | Ga0207687_10736013 | |||
| 1332 | Ga0207700_10004525 | |||
| 1333 | Ga0207700_10062354 | |||
| 1334 | Ga0207700_10066737 | |||
| 1335 | Ga0207700_10143629 | |||
| 1336 | Ga0207700_10300222 | |||
| 1337 | Ga0207700_11045744 | |||
| 1338 | Ga0207664_10015331 | |||
| 1339 | Ga0207664_10083855 | |||
| 1340 | Ga0207664_10097280 | |||
| 1341 | Ga0207664_10151111 | |||
| 1342 | Ga0207664_10346787 | |||
| 1343 | Ga0207664_10765041 | |||
| 1344 | Ga0207644_11279576 | |||
| 1345 | Ga0207690_10023249 | |||
| 1346 | Ga0207690_10106143 | |||
| 1347 | Ga0207690_10269685 | |||
| 1348 | Ga0207690_10679419 | |||
| 1349 | Ga0207706_10202208 | |||
| 1350 | Ga0207686_10283488 | |||
| 1351 | Ga0207709_11339277 | |||
| 1352 | Ga0207669_10784452 | |||
| 1353 | Ga0207665_10000620 | |||
| 1354 | Ga0207665_10523521 | |||
| 1355 | Ga0207665_10699903 | |||
| 1356 | Ga0207691_10810845 | |||
| 1357 | Ga0207711_10251301 | |||
| 1358 | Ga0207711_11356029 | |||
| 1359 | Ga0207689_10468641 | |||
| 1360 | Ga0207661_10001205 | |||
| 1361 | Ga0207661_10037224 | |||
| 1362 | Ga0207661_10066652 | |||
| 1363 | Ga0207661_10128752 | |||
| 1364 | Ga0207661_10171014 | |||
| 1365 | Ga0207661_10407436 | |||
| 1366 | Ga0207661_10899324 | |||
| 1367 | Ga0207679_10151806 | |||
| 1368 | Ga0207679_10712132 | |||
| 1369 | Ga0207667_10024085 | |||
| 1370 | Ga0207667_10244424 | |||
| 1371 | Ga0207667_10608660 | |||
| 1372 | Ga0207667_11289104 | |||
| 1373 | Ga0207651_10353084 | |||
| 1374 | Ga0207677_10421955 | |||
| 1375 | Ga0207677_11016801 | |||
| 1376 | Ga0207677_11349274 | |||
| 1377 | Ga0207677_12161181 | |||
| 1378 | Ga0207639_10526226 | |||
| 1379 | Ga0207639_11241489 | |||
| 1380 | Ga0207678_10250853 | |||
| 1381 | Ga0207708_10016428 | |||
| 1382 | Ga0207708_11156817 | |||
| 1383 | Ga0207702_10049373 | |||
| 1384 | Ga0207702_10143391 | |||
| 1385 | Ga0207702_10384910 | |||
| 1386 | Ga0207702_10477538 | |||
| 1387 | Ga0207702_10846275 | |||
| 1388 | Ga0207702_11650765 | |||
| 1389 | Ga0207702_11855730 | |||
| 1390 | Ga0207641_11509838 | |||
| 1391 | Ga0207674_10025286 | |||
| 1392 | Ga0207674_10939236 | |||
| 1393 | Ga0207675_100135417 | |||
| 1394 | Ga0207683_10189263 | |||
| 1395 | Ga0207698_10408913 | |||
| 1396 | Ga0207698_10909242 | |||
| 1397 | Ga0207428_10044987 | |||
| 1398 | Ga0207428_10058468 | |||
| 1399 | Ga0268264_10649579 | |||
| 1400 | Ga0265337_1093193 | |||
| 1401 | Ga0265326_10038666 | |||
| 1402 | Ga0265326_10145041 | |||
| 1403 | Ga0265319_1127463 | |||
| 1404 | Ga0265334_10002535 | |||
| 1405 | Ga0265334_10014738 | |||
| 1406 | Ga0265318_10000296 | |||
| 1407 | Ga0265322_10004483 | |||
| 1408 | Ga0265322_10039015 | |||
| 1409 | Ga0265336_10009086 | |||
| 1410 | Ga0265336_10043787 | |||
| 1411 | Ga0265338_10006228 | |||
| 1412 | Ga0265338_10009103 | |||
| 1413 | Ga0265338_10014335 | |||
| 1414 | Ga0265338_10017902 | |||
| 1415 | Ga0265338_10630500 | |||
| 1416 | Ga0265338_10913177 | |||
| 1417 | Ga0265324_10010734 | |||
| 1418 | Ga0265324_10050110 | |||
| 1419 | Ga0265324_10096190 | |||
| 1420 | Ga0265330_10001988 | |||
| 1421 | Ga0265330_10095104 | |||
| 1422 | Ga0265332_10033692 | |||
| 1423 | Ga0265332_10171184 | |||
| 1424 | Ga0265328_10000451 | |||
| 1425 | Ga0265328_10007616 | |||
| 1426 | Ga0265320_10014605 | |||
| 1427 | Ga0265325_10000309 | |||
| 1428 | Ga0265325_10093910 | |||
| 1429 | Ga0265329_10040426 | |||
| 1430 | Ga0265329_10100504 | |||
| 1431 | Ga0265340_10023790 | |||
| 1432 | Ga0265340_10065712 | |||
| 1433 | Ga0265340_10230136 | |||
| 1434 | Ga0265339_10052368 | |||
| 1435 | Ga0265339_10070399 | |||
| 1436 | Ga0265331_10005204 | |||
| 1437 | Ga0265331_10170706 | |||
| 1438 | Ga0265327_10003767 | |||
| 1439 | Ga0265327_10005428 | |||
| 1440 | Ga0265327_10061828 | |||
| 1441 | Ga0265327_10232442 | |||
| 1442 | Ga0265316_10003341 | |||
| 1443 | Ga0265316_10029734 | |||
| 1444 | Ga0265316_10948189 | |||
| 1445 | Ga0265313_10002173 | |||
| 1446 | Ga0265313_10015004 | |||
| 1447 | Ga0265313_10018343 | |||
| 1448 | Ga0265313_10332627 | |||
| 1449 | Ga0265314_10020854 | |||
| 1450 | Ga0265314_10221951 | |||
| 1451 | Ga0265342_10005698 | |||
| 1452 | Ga0316583_10166797 | |||
| 1453 | Ga0373926_0030362 | |||
| 1454 | Ga0373926_0088051 | |||
| 1455 | Ga0373944_0097381 | |||
| 1456 | Ga0373951_0165470 | |||
| 1457 | Ga0373923_0321792 | |||
| 1458 | Ga0373945_0002914 | |||
| 1459 | Ga0373956_0176228 | |||
| 1460 | Ga0373956_0205402 | |||
| 1461 | Ga0373957_0110240 | |||
| 1462 | Ga0373943_0002185 | |||
| 1463 | Ga0373943_0019338 | |||
| 1464 | Ga0373955_0192196 | |||
| 1465 | Ga0373955_0285359 | |||
| 1466 | Ga0373955_0371248 | |||
| 1467 | Ga0373924_0367934 | |||
| 1468 | Ga0373935_0008309 | |||
| 1469 | Ga0373927_0046367 | |||
| 1470 | Ga0373927_0168659 | |||
| 1471 | Ga0373933_0093576 | |||
| 1472 | Ga0373933_0217245 | |||
| 1473 | Ga0373933_0334655 | |||
| 1474 | Ga0373947_0001831 | |||
| 1475 | Ga0373947_0053904 | |||
| 1476 | Ga0373937_0000308 | |||
| 1477 | Ga0373937_0329769 | |||
| 1478 | Ga0373937_0514372 | |||
| 1479 | Ga0373937_1618595 | |||
| 1480 | Ga0373925_0001399 | |||
| 1481 | Ga0373925_0050755 | |||
| 1482 | Ga0395899_0010575 | |||
| 1483 | Ga0395899_0051456 | |||
| 1484 | Ga0395900_0013234 | |||
| 1485 | Ga0395900_0266899 | |||
| 1486 | Ga0395900_0355050 | |||
| 1487 | Ga0395900_0406093 | |||
| 1488 | Ga0395900_1523480 | |||
| 1489 | Ga0395898_0007979 | |||
| 1490 | Ga0395898_0031288 | |||
| 1491 | Ga0395898_0184687 | |||
| 1492 | Ga0395898_0258314 | |||
| 1493 | Ga0395898_0401477 | |||
| 1494 | Ga0395898_0579135 | |||
| 1495 | Ga0395898_0722702 | |||
| 1496 | Ga0395898_1327919 | |||
| 1497 | Ga0395898_1465149 | |||
| 1498 | Ga0395905_0109123 | |||
| 1499 | Ga0395905_0264488 | |||
| 1500 | Ga0395905_0407358 | |||
| 1501 | Ga0395905_0419329 | |||
| 1502 | Ga0395905_0868975 | |||
| 1503 | Ga0395905_0913409 | |||
| 1504 | Ga0395905_1748416 | |||
| 1505 | Ga0395901_0085806 | |||
| 1506 | Ga0395901_0107058 | |||
| 1507 | Ga0395901_0155796 | |||
| 1508 | Ga0395901_0315428 | |||
| 1509 | Ga0395901_0568987 | |||
| 1510 | Ga0395901_0607445 | |||
| 1511 | Ga0395901_0810343 | |||
| 1512 | Ga0395901_2001383 | |||
| 1513 | Ga0436360_0570305 | |||
| 1514 | Ga0436360_0718691 | |||
| 1515 | Ga0436362_0431750 | |||
| 1516 | Ga0439453_0063814 | |||
| 1517 | Ga0451804_0842484 | |||
| 1518 | Ga0451855_1376915 | |||
| 1519 | Ga0439448_0345572 | |||
| 1520 | Ga0450902_083325 | |||
| 1521 | Ga0439458_0028399 | |||
| 1522 | Ga0439460_0087264 | |||
| 1523 | Ga0466965_0476347 | |||
| 1524 | Ga0466966_0049919 | |||
| 1525 | Ga0466966_0323023 | |||
| 1526 | Ga0466961_0005003 | |||
| 1527 | Ga0466963_0000532 | |||
| 1528 | Ga0466963_0001856 | |||
| 1529 | Ga0466963_0007505 | |||
| 1530 | Ga0466963_0007882 | |||
| 1531 | Ga0466963_0059581 | |||
| 1532 | Ga0466963_0065184 | |||
| 1533 | Ga0466963_0090962 | |||
| 1534 | Ga0466963_0271709 | |||
| 1535 | Ga0466963_0351716 | |||
| 1536 | Ga0466963_1111041 | |||
| 1537 | Ga0466964_0027586 | |||
| 1538 | Ga0466964_0056934 | |||
| 1539 | Ga0466964_0200818 | |||
| 1540 | Ga0466964_0224624 | |||
| 1541 | Ga0466971_0245788 | |||
| 1542 | Ga0466971_0714686 | |||
| 1543 | Ga0466968_0010627 | |||
| 1544 | Ga0466968_0055011 | |||
| 1545 | Ga0466968_0453167 | |||
| 1546 | Ga0466970_0535355 | |||
| 1547 | Ga0466957_0007081 | |||
| 1548 | Ga0466957_0311157 | |||
| 1549 | Ga0466957_1217920 | |||
| 1550 | Ga0466959_0011375 | |||
| 1551 | Ga0466959_0021693 | |||
| 1552 | Ga0451576_0115678 | |||
| 1553 | Ga0451576_1693411 | |||
| 1554 | Ga0466958_0015042 | |||
| 1555 | Ga0466958_0112001 | |||
| 1556 | Ga0466958_0972209 | |||
| 1557 | Ga0466967_0006110 | |||
| 1558 | Ga0466967_0009880 | |||
| 1559 | Ga0466967_0015339 | |||
| 1560 | Ga0466967_0016262 | |||
| 1561 | Ga0466967_0020316 | |||
| 1562 | Ga0466967_0044126 | |||
| 1563 | Ga0466967_0055221 | |||
| 1564 | Ga0466967_0064317 | |||
| 1565 | Ga0466967_0083195 | |||
| 1566 | Ga0466967_0120169 | |||
| 1567 | Ga0466967_0163033 | |||
| 1568 | Ga0466967_0192464 | |||
| 1569 | Ga0466967_0375051 | |||
| 1570 | Ga0466967_0463150 | |||
| 1571 | Ga0466967_0673265 | |||
| 1572 | Ga0466967_0850607 | |||
| 1573 | Ga0466967_1146501 | |||
| 1574 | Ga0466967_1163574 | |||
| 1575 | Ga0466967_1407735 | |||
| 1576 | Ga0466967_1579078 | |||
| 1577 | Ga0466967_1908516 | |||
| 1578 | Ga0466967_2488758 | |||
| 1579 | Ga0495592_0000410 | |||
| 1580 | Ga0495592_0008108 | |||
| 1581 | Ga0495592_0072952 | |||
| 1582 | Ga0495592_0124333 | |||
| 1583 | Ga0495592_0169769 | |||
| 1584 | Ga0495592_0215774 | |||
| 1585 | Ga0495603_0282350 | |||
| 1586 | Ga0495629_0026042 | |||
| 1587 | Ga0495629_0084672 | |||
| 1588 | Ga0495629_0154532 | |||
| 1589 | Ga0495629_0200141 | |||
| 1590 | Ga0495629_0233316 | |||
| 1591 | Ga0495641_0005629 | |||
| 1592 | Ga0495641_0009652 | |||
| 1593 | Ga0495641_0039888 | |||
| 1594 | Ga0495641_0154131 | |||
| 1595 | Ga0495641_0382634 | |||
| 1596 | Ga0495651_0000034 | |||
| 1597 | Ga0495651_0054593 | |||
| 1598 | Ga0495651_0056976 | |||
| 1599 | Ga0495651_0216323 | |||
| 1600 | Ga0495651_0265008 | |||
| 1601 | Ga0495651_0308257 | |||
| 1602 | Ga0495653_0001634 | |||
| 1603 | Ga0495653_0007842 | |||
| 1604 | Ga0495653_0150966 | |||
| 1605 | Ga0495653_0161884 | |||
| 1606 | Ga0495653_0296286 | |||
| 1607 | Ga0495580_0018581 | |||
| 1608 | Ga0495582_0008933 | |||
| 1609 | Ga0495582_0352125 | |||
| 1610 | Ga0495582_0483457 | |||
| 1611 | Ga0495639_0009322 | |||
| 1612 | Ga0495639_0269909 | |||
| 1613 | Ga0495662_0005815 | |||
| 1614 | Ga0495662_0137492 | |||
| 1615 | Ga0495664_0003716 | |||
| 1616 | Ga0495664_0024197 | |||
| 1617 | Ga0495664_0058659 | |||
| 1618 | Ga0495664_0170231 | |||
| 1619 | Ga0495664_0950238 | |||
| 1620 | Ga0495608_0001004 | |||
| 1621 | Ga0495608_0027586 | |||
| 1622 | Ga0495608_0035988 | |||
| 1623 | Ga0495608_0306809 | |||
| 1624 | Ga0495608_0664312 | |||
| 1625 | Ga0495608_0777675 | |||
| 1626 | Ga0495618_0008709 | |||
| 1627 | Ga0495618_0047831 | |||
| 1628 | Ga0495618_0182783 | |||
| 1629 | Ga0495618_0186969 | |||
| 1630 | Ga0495618_0198672 | |||
| 1631 | Ga0495618_0716944 | |||
| 1632 | Ga0495628_0000184 | |||
| 1633 | Ga0495628_0116001 | |||
| 1634 | Ga0495628_0176333 | |||
| 1635 | Ga0495628_0327959 | |||
| 1636 | Ga0495628_0558418 | |||
| 1637 | Ga0495628_0782852 | |||
| 1638 | Ga0495628_0933321 | |||
| 1639 | Ga0495630_0006556 | |||
| 1640 | Ga0495630_0022305 | |||
| 1641 | Ga0495630_0177965 | |||
| 1642 | Ga0495630_0235350 | |||
| 1643 | Ga0495630_0396091 | |||
| 1644 | Ga0495630_0696609 | |||
| 1645 | Ga0495666_0001186 | |||
| 1646 | Ga0495652_0000319 | |||
| 1647 | Ga0495652_0018630 | |||
| 1648 | Ga0495652_0058072 | |||
| 1649 | Ga0495652_0156930 | |||
| 1650 | Ga0495652_0219334 | |||
| 1651 | Ga0495652_0242948 | |||
| 1652 | Ga0495652_0465620 | |||
| 1653 | Ga0495652_0774125 | |||
| 1654 | Ga0495665_0003752 | |||
| 1655 | Ga0495640_0010802 | |||
| 1656 | Ga0495640_0016364 | |||
| 1657 | Ga0495640_0038013 | |||
| 1658 | Ga0495640_0124729 | |||
| 1659 | Ga0495640_0320714 | |||
| 1660 | Ga0495586_0052035 | |||
| 1661 | Ga0495586_0078082 | |||
| 1662 | Ga0495586_0466650 | |||
| 1663 | Ga0495587_0000055 | |||
| 1664 | Ga0495587_0072248 | |||
| 1665 | Ga0495587_0137127 | |||
| 1666 | Ga0495587_0838608 | |||
| 1667 | Ga0495645_0000170 | |||
| 1668 | Ga0495645_0075458 | |||
| 1669 | Ga0495645_0262930 | |||
| 1670 | Ga0495645_0503907 | |||
| 1671 | Ga0495667_0021039 | |||
| 1672 | Ga0495667_0039955 | |||
| 1673 | Ga0495667_0043555 | |||
| 1674 | Ga0495667_0085805 | |||
| 1675 | Ga0495667_0161893 | |||
| 1676 | Ga0495667_0172395 | |||
| 1677 | Ga0495667_0268327 | |||
| 1678 | Ga0495667_0424684 | |||
| 1679 | Ga0495667_0583267 | |||
| 1680 | Ga0495634_0008630 | |||
| 1681 | Ga0495634_0037619 | |||
| 1682 | Ga0495634_0075314 | |||
| 1683 | Ga0495634_0522557 | |||
| 1684 | Ga0495634_0716118 | |||
| 1685 | Ga0495635_0011475 | |||
| 1686 | Ga0495635_0031624 | |||
| 1687 | Ga0495635_0051587 | |||
| 1688 | Ga0495635_0059979 | |||
| 1689 | Ga0495635_0161873 | |||
| 1690 | Ga0495635_0600135 | |||
| 1691 | Ga0495657_0025578 | |||
| 1692 | Ga0495657_0069002 | |||
| 1693 | Ga0495657_0179041 | |||
| 1694 | Ga0495657_0225993 | |||
| 1695 | Ga0495657_0240447 | |||
| 1696 | Ga0495657_0816910 | |||
| 1697 | Ga0495599_0001220 | |||
| 1698 | Ga0495599_0061558 | |||
| 1699 | Ga0495599_0156685 | |||
| 1700 | Ga0495599_0540301 | |||
| 1701 | Ga0495599_0613858 | |||
| 1702 | Ga0495599_0626045 | |||
| 1703 | Ga0495623_0000149 | |||
| 1704 | Ga0495623_0041042 | |||
| 1705 | Ga0495623_0205186 | |||
| 1706 | Ga0495623_0259635 | |||
| 1707 | Ga0495646_0010301 | |||
| 1708 | Ga0495646_0079788 | |||
| 1709 | Ga0495646_0097428 | |||
| 1710 | Ga0495647_0001212 | |||
| 1711 | Ga0495647_0463397 | |||
| 1712 | Ga0495658_0004111 | |||
| 1713 | Ga0495658_0047705 | |||
| 1714 | Ga0495658_0069176 | |||
| 1715 | Ga0495658_0152406 | |||
| 1716 | Ga0495658_0380134 | |||
| 1717 | Ga0495613_0005204 | |||
| 1718 | Ga0495613_0011084 | |||
| 1719 | Ga0495613_0052186 | |||
| 1720 | Ga0495613_0070496 | |||
| 1721 | Ga0495624_0016643 | |||
| 1722 | Ga0495624_0026752 | |||
| 1723 | Ga0495624_0544670 | |||
| 1724 | Ga0495600_0149841 | |||
| 1725 | Ga0495600_0263300 | |||
| 1726 | Ga0495581_0005286 | |||
| 1727 | Ga0495604_0000194 | |||
| 1728 | Ga0495604_0038396 | |||
| 1729 | Ga0495604_0040857 | |||
| 1730 | Ga0495604_0610286 | |||
| 1731 | Ga0495604_0694084 | |||
| 1732 | Ga0495674_0009278 | |||
| 1733 | Ga0495674_0023647 | |||
| 1734 | Ga0495674_0025046 | |||
| 1735 | Ga0495674_0092528 | |||
| 1736 | Ga0495674_0214047 | |||
| 1737 | Ga0495674_0341898 | |||
| 1738 | Ga0495674_0360492 | |||
| 1739 | Ga0495674_0511381 | |||
| 1740 | Ga0495674_0520153 | |||
| 1741 | Ga0495676_0066273 | |||
| 1742 | Ga0495676_0068155 | |||
| 1743 | Ga0495676_0087620 | |||
| 1744 | Ga0495676_0400227 | |||
| 1745 | Ga0495680_0017928 | |||
| 1746 | Ga0495680_0028662 | |||
| 1747 | Ga0495680_0034084 | |||
| 1748 | Ga0495680_0036955 | |||
| 1749 | Ga0495675_0000029 | |||
| 1750 | Ga0495675_0202192 | |||
| 1751 | Ga0495675_0263542 | |||
| 1752 | Ga0495684_0008421 | |||
| 1753 | Ga0495684_0019490 | |||
| 1754 | Ga0495684_0028439 | |||
| 1755 | Ga0495684_0052586 | |||
| 1756 | Ga0495684_0073849 | |||
| 1757 | Ga0495684_0142758 | |||
| 1758 | Ga0495684_0183360 | |||
| 1759 | Ga0495593_0000750 | |||
| 1760 | Ga0495602_0000741 | |||
| 1761 | Ga0495602_0061366 | |||
| 1762 | Ga0495602_0087920 | |||
| 1763 | Ga0495602_0201833 | |||
| 1764 | Ga0495602_0283851 | |||
| 1765 | Ga0495602_0392215 | |||
| 1766 | Ga0495602_0681216 | |||
| 1767 | Ga0495602_0705525 | |||
| 1768 | Ga0495602_0729267 | |||
| 1769 | Ga0495602_1145511 | |||
| 1770 | Ga0495614_0000802 | |||
| 1771 | Ga0495614_0136064 | |||
| 1772 | Ga0496100_0002026 | |||
| 1773 | Ga0496100_0022421 | |||
| 1774 | Ga0496100_0050060 | |||
| 1775 | Ga0496100_0120248 | |||
| 1776 | Ga0496100_0293833 | |||
| 1777 | Ga0496100_0730144 | |||
| 1778 | Ga0496101_0007253 | |||
| 1779 | Ga0496101_0028953 | |||
| 1780 | Ga0496101_0109681 | |||
| 1781 | Ga0496101_0117841 | |||
| 1782 | Ga0496101_0244499 | |||
| 1783 | Ga0496101_0378708 | |||
| 1784 | Ga0496102_0015239 | |||
| 1785 | Ga0496102_0016614 | |||
| 1786 | Ga0496102_0092770 | |||
| 1787 | Ga0496102_0891220 | |||
| 1788 | Ga0496102_0894044 | |||
| 1789 | Ga0496102_0927624 | |||
| 1790 | Ga0496102_1360852 | |||
| 1791 | Ga0496102_1568203 | |||
| 1792 | Ga0496103_0370884 | |||
| 1793 | Ga0496104_0003169 | |||
| 1794 | Ga0496104_0007841 | |||
| 1795 | Ga0496104_0035240 | |||
| 1796 | Ga0496104_0051552 | |||
| 1797 | Ga0496104_0167467 | |||
| 1798 | Ga0496104_0299279 | |||
| 1799 | Ga0496104_0395651 | |||
| 1800 | Ga0496104_0593860 | |||
| 1801 | Ga0496105_0013301 | |||
| 1802 | Ga0496105_0018312 | |||
| 1803 | Ga0496105_0024704 | |||
| 1804 | Ga0496105_0048496 | |||
| 1805 | Ga0496105_0063378 | |||
| 1806 | Ga0496105_0096726 | |||
| 1807 | Ga0496105_0116215 | |||
| 1808 | Ga0496105_0289262 | |||
| 1809 | Ga0496105_0699396 | |||
| 1810 | Ga0496106_0001209 | |||
| 1811 | Ga0496106_0003352 | |||
| 1812 | Ga0496106_0286909 | |||
| 1813 | Ga0496106_0619780 | |||
| 1814 | Ga0496107_0022234 | |||
| 1815 | Ga0496107_0051508 | |||
| 1816 | Ga0496107_0064351 | |||
| 1817 | Ga0496107_0208732 | |||
| 1818 | Ga0496107_0514774 | |||
| 1819 | Ga0496108_0002815 | |||
| 1820 | Ga0496108_0022442 | |||
| 1821 | Ga0496108_0029182 | |||
| 1822 | Ga0496108_0050860 | |||
| 1823 | Ga0496108_0184595 | |||
| 1824 | Ga0496109_0001232 | |||
| 1825 | Ga0496109_0005020 | |||
| 1826 | Ga0496109_0005573 | |||
| 1827 | Ga0496109_0063635 | |||
| 1828 | Ga0496109_0071841 | |||
| 1829 | Ga0496109_0156883 | |||
| 1830 | Ga0496109_0227494 | |||
| 1831 | Ga0496109_0482366 | |||
| 1832 | Ga0496110_0033218 | |||
| 1833 | Ga0496110_0046222 | |||
| 1834 | Ga0496110_0050897 | |||
| 1835 | Ga0496110_0078503 | |||
| 1836 | Ga0496110_0167232 | |||
| 1837 | Ga0496110_0491924 | |||
| 1838 | Ga0496110_0566893 | |||
| 1839 | Ga0496111_0008451 | |||
| 1840 | Ga0496111_0015430 | |||
| 1841 | Ga0496111_0079336 | |||
| 1842 | Ga0496111_0125221 | |||
| 1843 | Ga0496111_0292613 | |||
| 1844 | Ga0496111_0320454 | |||
| 1845 | Ga0496112_0022139 | |||
| 1846 | Ga0496112_0051586 | |||
| 1847 | Ga0496112_0182050 | |||
| 1848 | Ga0496112_0624744 | |||
| 1849 | Ga0496113_0060094 | |||
| 1850 | Ga0496113_0091870 | |||
| 1851 | Ga0496113_0148427 | |||
| 1852 | Ga0496113_1030291 | |||
| 1853 | Ga0496113_1290757 | |||
| 1854 | Ga0496113_1449382 | |||
| 1855 | Ga0496114_0010264 | |||
| 1856 | Ga0496114_0023553 | |||
| 1857 | Ga0496114_0029079 | |||
| 1858 | Ga0496114_0119004 | |||
| 1859 | Ga0496114_0203360 | |||
| 1860 | Ga0496114_0354258 | |||
| 1861 | Ga0496114_0417050 | |||
| 1862 | Ga0496114_0832881 | |||
| 1863 | Ga0496114_0866352 | |||
| 1864 | Ga0496114_1202701 | |||
| 1865 | Ga0496114_1722616 | |||
| 1866 | Ga0496115_0008936 | |||
| 1867 | Ga0496115_0011555 | |||
| 1868 | Ga0496115_0053205 | |||
| 1869 | Ga0496115_0066404 | |||
| 1870 | Ga0496115_0079634 | |||
| 1871 | Ga0496115_0095989 | |||
| 1872 | Ga0496115_0163098 | |||
| 1873 | Ga0496115_0274182 | |||
| 1874 | Ga0496115_0313295 | |||
| 1875 | Ga0501031_0004850 | |||
| 1876 | Ga0501031_0031722 | |||
| 1877 | Ga0501032_0034116 | |||
| 1878 | Ga0501034_0339198 | |||
| 1879 | Ga0501034_0387538 | |||
| 1880 | Ga0501036_0012418 | |||
| 1881 | Ga0501036_0014731 | |||
| 1882 | Ga0501037_0085622 | |||
| 1883 | Ga0501037_0122880 | |||
| 1884 | Ga0501038_0011136 | |||
| 1885 | Ga0501038_0215237 | |||
| 1886 | Ga0501038_0234032 | |||
| 1887 | Ga0501039_0043081 | |||
| 1888 | Ga0501040_0063391 | |||
| 1889 | Ga0501041_0003188 | |||
| 1890 | Ga0501042_0002606 | |||
| 1891 | Ga0501042_0075677 | |||
| 1892 | Ga0501043_0518683 | |||
| 1893 | Ga0501046_0001782 | |||
| 1894 | Ga0501046_0107626 | |||
| 1895 | Ga0501046_0310012 | |||
| 1896 | Ga0501047_0664340 | |||
| 1897 | Ga0501048_0007986 | |||
| 1898 | Ga0501048_0077979 | |||
| 1899 | Ga0501067_0194403 | |||
| 1900 | Ga0501067_0459853 | |||
| 1901 | Ga0501067_0649277 | |||
| 1902 | Ga0501068_0005297 | |||
| 1903 | Ga0501068_0017559 | |||
| 1904 | Ga0501068_0333144 | |||
| 1905 | Ga0501069_0004693 | |||
| 1906 | Ga0501069_0087395 | |||
| 1907 | Ga0501070_0001614 | |||
| 1908 | Ga0501070_0295283 | |||
| 1909 | Ga0501070_0738315 | |||
| 1910 | Ga0501071_0004871 | |||
| 1911 | Ga0501071_0106467 | |||
| 1912 | Ga0501072_0006639 | |||
| 1913 | Ga0501072_0084433 | |||
| 1914 | Ga0501072_0572807 | |||
| 1915 | Ga0501073_0001427 | |||
| 1916 | Ga0501074_0003559 | |||
| 1917 | Ga0501074_0013802 | |||
| 1918 | Ga0501074_0248729 | |||
| 1919 | Ga0501075_0001342 | |||
| 1920 | Ga0501075_0100514 | |||
| 1921 | Ga0501075_0298350 | |||
| 1922 | Ga0501076_0007652 | |||
| 1923 | Ga0501076_0288524 | |||
| 1924 | Ga0501077_0001984 | |||
| 1925 | Ga0501079_0060374 | |||
| 1926 | Ga0501080_0046811 | |||
| 1927 | Ga0501080_0084203 | |||
| 1928 | Ga0501080_0290170 | |||
| 1929 | Ga0501081_0082497 | |||
| 1930 | Ga0501083_0005829 | |||
| 1931 | Ga0501083_0010453 | |||
| 1932 | Ga0501035_0099819 | |||
| 1933 | Ga0501044_0127243 | |||
| 1934 | Ga0501044_0270353 | |||
| 1935 | Ga0501045_0005139 | |||
| 1936 | Ga0501045_0048481 | |||
| 1937 | nmdc:mga03683_529018_c1 | |||
| 1938 | nmdc:mga00v17_55325_c1 | |||
| 1939 | nmdc:mga0yw44_29577_c1 | |||
| 1940 | nmdc:mga0yw44_926255_c1 | |||
| 1941 | nmdc:mga05p37_1850308_c1 | |||
| 1942 | nmdc:mga05p37_31165_c1 | |||
| 1943 | nmdc:mga09592_28989_c1 | |||
| 1944 | nmdc:mga09592_370014_c1 | |||
| 1945 | nmdc:mga0qj67_569574_c1 | |||
| 1946 | nmdc:mga06r32_100701_c1 | |||
| 1947 | nmdc:mga06r32_392953_c1 | |||
| 1948 | nmdc:mga06r32_633346_c1 | |||
| 1949 | nmdc:mga08y16_258745_c1 | |||
| 1950 | nmdc:mga08y16_405054_c1 | |||
| 1951 | nmdc:mga0n895_1057330_c1 | |||
| 1952 | nmdc:mga0n895_489355_c1 | |||
| 1953 | nmdc:mga0n895_576472_c1 | |||
| 1954 | nmdc:mga0n895_845287_c1 | |||
| 1955 | nmdc:mga0n895_938204_c1 | |||
| 1956 | nmdc:mga0rr50_251531_c1 | |||
| 1957 | nmdc:mga0rr50_450202_c1 | |||
| 1958 | nmdc:mga0a205_1204193_c1 | |||
| 1959 | nmdc:mga0a205_34242_c1 | |||
| 1960 | Ga0495601_0000082 | |||
| 1961 | Ga0495601_0011446 | |||
| 1962 | Ga0495601_0019054 | |||
| 1963 | Ga0495601_0026834 | |||
| 1964 | Ga0495601_0109045 | |||
| 1965 | Ga0495601_0121088 | |||
| 1966 | Ga0495601_0192854 | |||
| 1967 | Ga0495601_0213185 | |||
| 1968 | Ga0495601_0352464 | |||
| 1969 | Ga0495601_0418064 | |||
| 1970 | Ga0495601_0814920 | |||
| 1971 | Ga0495601_0904344 | |||
| 1972 | Ga0495612_0001482 | |||
| 1973 | Ga0495612_0008514 | |||
| 1974 | Ga0495612_0081436 | |||
| 1975 | Ga0495612_0133194 | |||
| 1976 | Ga0495612_0303397 | |||
| 1977 | Ga0495595_0014003 | |||
| 1978 | Ga0495595_0053143 | |||
| 1979 | Ga0495595_0209416 | |||
| 1980 | Ga0495619_0006116 | |||
| 1981 | Ga0495619_0026063 | |||
| 1982 | Ga0495619_0029797 | |||
| 1983 | Ga0495619_0035136 | |||
| 1984 | Ga0495619_0288090 | |||
| 1985 | Ga0495619_0634575 | |||
| 1986 | Ga0495619_0730243 | |||
| 1987 | Ga0495619_0900692 | |||
| 1988 | Ga0495619_1072916 | |||
| 1989 | Ga0500566_0036553 | |||
| 1990 | Ga0500657_180165 | |||
| 1991 | Ga0501084_0052695 | |||
| 1992 | Ga0501082_0090387 | |||
| 1993 | Ga0501082_0119035 | |||
| 1994 | Ga0466962_0242558 | |||
| 1995 | Ga0466962_0558579 | |||
| 1996 | Ga0530510_0025581 | |||
| 1997 | Ga0530510_0080608 | |||
| 1998 | Ga0530510_0215800 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1fr3-assembly1.cif.gz_A | the high resolution structure of a molybdate binding protein from sporomusa ovata | 0.8698 | 58 | 118 |
| 2zhh-assembly1.cif.gz_A-2 | crystal structure of soxr | 0.8671 | 5 | 49 |
| 4j2n-assembly1.cif.gz_A | crystal structure of mycobacteriophage pukovnik xis | 0.8652 | 3 | 51 |
| 1h9r-assembly1.cif.gz_A | tungstate bound complex dimop domain of mode from e.coli | 0.8537 | 58 | 118 |
| 1gus-assembly1.cif.gz_B | mopii from clostridium pasteurianum (apo1) | 0.8499 | 59 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WKT7_24_74_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8987 | 7 | 55 | 1.10.10.10 |
| af_P09833_289_351_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8917 | 57 | 118 | 2.40.50.100 |
| 1h9sA01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8913 | 61 | 116 | 2.40.50.100 |
| af_I6YE30_32_77_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.885 | 6 | 49 | 1.10.10.10 |
| af_P9WLC3_19_69_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8842 | 7 | 55 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A662MDL9-F1-model_v4 | IS607 family transposase | 0.9541 | 4 | 55 |
GO:0003677
GO:0006355 |
| AF-A0A3T1DWJ4-F1-model_v4 | deleted | 0.9408 | 64 | 118 |
|
| AF-A0A1Y0RVN6-F1-model_v4 | Transporter | 0.9395 | 64 | 118 |
GO:0015689
|
| AF-C0B219-F1-model_v4 | deleted | 0.9359 | 66 | 118 |
|
| AF-A0A3D4GMC3-F1-model_v4 | deleted | 0.9269 | 64 | 118 |
|