F487839

General Info

Members Datasets Scaffolds Average Seq Length
999 344 1998 125

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_11620055|Ga0105248_116200552
Length 124
Sequence MAKQHYSASEAAAALGISLDTLRRWDRAKRIKVTRDKSNRRVVSAREIDRLRGDGQHITARNRFRGTVTDVQVDGLMAQVELVVTEPVRIVALVTRDAVEELGLKKGMAATAIVKSTNVMVQSR

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
3 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
92 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
93 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
114 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
115 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
166 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
167 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
168 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
169 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
170 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
171 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
174 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
175 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
176 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
177 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
178 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
179 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
180 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
181 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
182 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
183 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
184 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
185 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
188 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
189 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
190 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
191 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
192 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
194 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
195 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
211 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
212 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
213 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
214 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
215 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
216 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
217 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
218 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
219 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
224 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
225 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
226 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
227 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
233 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
234 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
235 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
242 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
243 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
244 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
248 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
249 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
250 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
251 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
256 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
257 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
258 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
259 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
260 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
261 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
262 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
263 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
264 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
267 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
270 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
273 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
275 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
276 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
277 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
278 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
279 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
280 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
281 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
282 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
283 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
284 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
285 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
286 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
287 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
288 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
307 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
308 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
309 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
310 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
311 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
312 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
313 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
314 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
315 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
316 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
317 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
318 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
319 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
320 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
321 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
324 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
325 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
326 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
327 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
328 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
329 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
330 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
331 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
332 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
333 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
334 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
335 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
336 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
337 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
338 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
339 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
340 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
341 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
342 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
343 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
344 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0
Rhizoplane 10.41
Rhizosphere 88.49
Stem 0
Stem Tuber 0
Unclassified 18.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_11620055 3300009177 Bacteria 733
2 ARSoilOldRDRAFT_c018305 3300000044 Bacteria 610
3 ARCol0yngRDRAFT_1004101 3300000652 Bacteria 1060
4 JGI25407J50210_10010134 3300003373 Bacteria 2394
5 JGI25407J50210_10055697 3300003373 Unclassified 997
6 Ga0070658_10046325 3300005327 Bacteria 3519
7 Ga0070683_100001618 3300005329 Bacteria 17420
8 Ga0070683_100004037 3300005329 Bacteria 12016
9 Ga0070683_100024659 3300005329 Bacteria 5391
10 Ga0070683_100225996 3300005329 Bacteria 1779
11 Ga0070683_100244202 3300005329 Unclassified 1708
12 Ga0070683_100480038 3300005329 Bacteria 1187
13 Ga0068869_101119060 3300005334 Bacteria 690
14 Ga0070680_100014480 3300005336 Bacteria 6169
15 Ga0070680_100038421 3300005336 Bacteria 3872
16 Ga0070680_100045407 3300005336 Bacteria 3572
17 Ga0070680_100228698 3300005336 Unclassified 1570
18 Ga0070680_100543419 3300005336 Bacteria 996
19 Ga0070680_100599236 3300005336 Bacteria 946
20 Ga0070682_100036952 3300005337 Bacteria 2988
21 Ga0070682_100450233 3300005337 Bacteria 986
22 Ga0068868_100450303 3300005338 Bacteria 1120
23 Ga0068868_101567529 3300005338 Bacteria 618
24 Ga0068868_101613621 3300005338 Unclassified 610
25 Ga0068868_102102625 3300005338 Unclassified 537
26 Ga0070660_100004204 3300005339 Bacteria 9938
27 Ga0070660_100008236 3300005339 Bacteria 7286
28 Ga0070660_100030781 3300005339 Bacteria 4027
29 Ga0070660_100176630 3300005339 Bacteria 1727
30 Ga0070691_10131992 3300005341 Bacteria 1266
31 Ga0070661_100037480 3300005344 Bacteria 3527
32 Ga0070661_100402984 3300005344 Unclassified 1082
33 Ga0070661_100464306 3300005344 Bacteria 1009
34 Ga0070692_10059677 3300005345 Bacteria 2006
35 Ga0070692_10113771 3300005345 Bacteria 1500
36 Ga0070692_10885315 3300005345 Unclassified 616
37 Ga0070668_101421743 3300005347 Bacteria 633
38 Ga0070671_100088351 3300005355 Bacteria 2594
39 Ga0070671_101454634 3300005355 Bacteria 606
40 Ga0070673_100655696 3300005364 Bacteria 961
41 Ga0070659_100044012 3300005366 Bacteria 3493
42 Ga0070659_100104376 3300005366 Bacteria 2283
43 Ga0070659_100395487 3300005366 Unclassified 1166
44 Ga0070659_100473885 3300005366 Unclassified 1064
45 Ga0070709_10147435 3300005434 Bacteria 1623
46 Ga0070709_10421862 3300005434 Unclassified 1000
47 Ga0070714_100007601 3300005435 Bacteria 8438
48 Ga0070714_100016982 3300005435 Bacteria 5889
49 Ga0070714_100437922 3300005435 Bacteria 1240
50 Ga0070714_100442941 3300005435 Bacteria 1233
51 Ga0070714_100853464 3300005435 Bacteria 883
52 Ga0070714_102195250 3300005435 Unclassified 538
53 Ga0070713_100001979 3300005436 Bacteria 13224
54 Ga0070713_100142875 3300005436 Bacteria 2121
55 Ga0070713_100175846 3300005436 Bacteria 1921
56 Ga0070713_100210275 3300005436 Unclassified 1761
57 Ga0070713_100933916 3300005436 Bacteria 835
58 Ga0070713_101077840 3300005436 Bacteria 776
59 Ga0070713_101470755 3300005436 Bacteria 661
60 Ga0070713_101718825 3300005436 Unclassified 609
61 Ga0070710_10001198 3300005437 Bacteria 12272
62 Ga0070710_10022719 3300005437 Bacteria 3285
63 Ga0070710_10080619 3300005437 Bacteria 1899
64 Ga0070710_10534886 3300005437 Unclassified 807
65 Ga0070710_10722536 3300005437 Bacteria 705
66 Ga0070710_10743055 3300005437 Unclassified 696
67 Ga0070701_10767539 3300005438 Bacteria 655
68 Ga0070711_100016338 3300005439 Bacteria 4712
69 Ga0070711_100016526 3300005439 Bacteria 4687
70 Ga0070711_100027857 3300005439 Bacteria 3713
71 Ga0070711_100053977 3300005439 Bacteria 2772
72 Ga0070694_100080056 3300005444 Bacteria 2269
73 Ga0070708_100771315 3300005445 Bacteria 904
74 Ga0070663_100301716 3300005455 Bacteria 1282
75 Ga0070663_100380750 3300005455 Bacteria 1149
76 Ga0070663_101260541 3300005455 Bacteria 651
77 Ga0070678_100655740 3300005456 Bacteria 942
78 Ga0070678_101239106 3300005456 Bacteria 693
79 Ga0070678_102341847 3300005456 Unclassified 507
80 Ga0070662_100211703 3300005457 Bacteria 1543
81 Ga0070681_10003984 3300005458 Bacteria 13931
82 Ga0070681_10009371 3300005458 Bacteria 9633
83 Ga0070681_10020410 3300005458 Bacteria 6641
84 Ga0070681_10420534 3300005458 Bacteria 1248
85 Ga0070681_11108094 3300005458 Bacteria 713
86 Ga0068867_102283975 3300005459 Bacteria 514
87 Ga0070685_10425637 3300005466 Bacteria 925
88 Ga0070706_100249775 3300005467 Bacteria 1656
89 Ga0070707_100000445 3300005468 Bacteria 40989
90 Ga0070707_100318397 3300005468 Unclassified 1512
91 Ga0070707_100365301 3300005468 Bacteria 1402
92 Ga0070698_100324261 3300005471 Bacteria 1471
93 Ga0070679_100011917 3300005530 Bacteria 8298
94 Ga0070679_100014687 3300005530 Bacteria 7528
95 Ga0070679_100026708 3300005530 Bacteria 5676
96 Ga0070679_100032618 3300005530 Bacteria 5153
97 Ga0070679_100093684 3300005530 Bacteria 2991
98 Ga0070679_100405563 3300005530 Bacteria 1309
99 Ga0070684_100020900 3300005535 Bacteria 5433
100 Ga0070684_100040098 3300005535 Bacteria 4031
101 Ga0070684_100046844 3300005535 Bacteria 3746
102 Ga0070684_100137345 3300005535 Bacteria 2209
103 Ga0070684_100803058 3300005535 Bacteria 880
104 Ga0070684_102027899 3300005535 Unclassified 543
105 Ga0068853_100028009 3300005539 Bacteria 4739
106 Ga0068853_100087810 3300005539 Bacteria 2729
107 Ga0070672_100773624 3300005543 Bacteria 844
108 Ga0070695_100119158 3300005545 Bacteria 1803
109 Ga0070693_100357570 3300005547 Unclassified 1001
110 Ga0070665_100056274 3300005548 Bacteria 3944
111 Ga0070704_100007156 3300005549 Bacteria 6628
112 Ga0070704_100046747 3300005549 Bacteria 3021
113 Ga0068855_100017510 3300005563 Bacteria 8616
114 Ga0068855_100029199 3300005563 Bacteria 6595
115 Ga0068855_100072111 3300005563 Bacteria 4015
116 Ga0068855_100090005 3300005563 Bacteria 3542
117 Ga0068855_100124099 3300005563 Bacteria 2954
118 Ga0070664_100056337 3300005564 Bacteria 3340
119 Ga0070664_100066143 3300005564 Bacteria 3086
120 Ga0070664_100947117 3300005564 Bacteria 808
121 Ga0068857_100077305 3300005577 Bacteria 2969
122 Ga0068857_100082734 3300005577 Bacteria 2867
123 Ga0068857_101087488 3300005577 Bacteria 772
124 Ga0068854_100742018 3300005578 Bacteria 851
125 Ga0068856_100083740 3300005614 Bacteria 3168
126 Ga0068856_100239210 3300005614 Bacteria 1831
127 Ga0068856_100346098 3300005614 Bacteria 1505
128 Ga0068856_100506060 3300005614 Unclassified 1229
129 Ga0070702_100055343 3300005615 Unclassified 2287
130 Ga0070702_100071092 3300005615 Bacteria 2056
131 Ga0070702_100602270 3300005615 Unclassified 824
132 Ga0068852_100156433 3300005616 Bacteria 2124
133 Ga0068852_100614980 3300005616 Bacteria 1092
134 Ga0068852_100853387 3300005616 Bacteria 926
135 Ga0068852_101814320 3300005616 Unclassified 632
136 Ga0068859_101816869 3300005617 Bacteria 673
137 Ga0068864_100589514 3300005618 Bacteria 1078
138 Ga0068861_101779948 3300005719 Bacteria 611
139 Ga0068870_11057064 3300005840 Bacteria 582
140 Ga0068863_100654396 3300005841 Unclassified 1042
141 Ga0068860_100685859 3300005843 Bacteria 1034
142 Ga0068860_101612365 3300005843 Bacteria 671
143 Ga0081455_10016553 3300005937 Bacteria 7113
144 Ga0081538_10025660 3300005981 Bacteria 4147
145 Ga0081540_1073518 3300005983 Unclassified 1570
146 Ga0070717_10015481 3300006028 Bacteria 5892
147 Ga0070717_10064315 3300006028 Bacteria 3046
148 Ga0070717_10083763 3300006028 Bacteria 2682
149 Ga0070717_10173225 3300006028 Bacteria 1878
150 Ga0070717_10702232 3300006028 Bacteria 919
151 Ga0070717_10893284 3300006028 Unclassified 809
152 Ga0070717_11525256 3300006028 Unclassified 606
153 Ga0075365_10336474 3300006038 Bacteria 1064
154 Ga0075364_10056535 3300006051 Bacteria 2569
155 Ga0075364_10076268 3300006051 Bacteria 2212
156 Ga0075364_10165487 3300006051 Unclassified 1494
157 Ga0075432_10002081 3300006058 Bacteria 6664
158 Ga0070715_10000804 3300006163 Bacteria 8554
159 Ga0070715_10026658 3300006163 Bacteria 2301
160 Ga0070716_100001564 3300006173 Bacteria 10277
161 Ga0070716_100033017 3300006173 Bacteria 2828
162 Ga0070716_100846515 3300006173 Unclassified 712
163 Ga0070716_101567659 3300006173 Bacteria 540
164 Ga0070712_100016804 3300006175 Bacteria 4732
165 Ga0070712_100092879 3300006175 Unclassified 2214
166 Ga0070712_100178712 3300006175 Unclassified 1652
167 Ga0070712_100373333 3300006175 Unclassified 1172
168 Ga0070712_100383775 3300006175 Bacteria 1157
169 Ga0070712_100404855 3300006175 Bacteria 1128
170 Ga0070712_100744820 3300006175 Bacteria 838
171 Ga0070712_100826192 3300006175 Unclassified 796
172 Ga0097621_100999889 3300006237 Bacteria 782
173 Ga0097621_101283954 3300006237 Unclassified 691
174 Ga0068871_100744676 3300006358 Unclassified 900
175 Ga0075428_100060924 3300006844 Bacteria 4132
176 Ga0075430_100023972 3300006846 Bacteria 5196
177 Ga0075431_100726193 3300006847 Bacteria 970
178 Ga0075433_10022357 3300006852 Bacteria 5308
179 Ga0075433_10323489 3300006852 Bacteria 1364
180 Ga0075433_10332983 3300006852 Bacteria 1342
181 Ga0075433_11538861 3300006852 Unclassified 574
182 Ga0075434_100529904 3300006871 Bacteria 1198
183 Ga0075434_100567574 3300006871 Bacteria 1154
184 Ga0075434_100634759 3300006871 Bacteria 1087
185 Ga0075434_101288477 3300006871 Unclassified 742
186 Ga0075429_100121549 3300006880 Bacteria 2283
187 Ga0075429_100171637 3300006880 Bacteria 1899
188 Ga0097620_101816523 3300006931 Bacteria 673
189 Ga0075435_100954863 3300007076 Bacteria 748
190 Ga0105251_10162270 3300009011 Bacteria 1007
191 Ga0105240_10080020 3300009093 Bacteria 4020
192 Ga0105240_10115984 3300009093 Bacteria 3232
193 Ga0105240_10341446 3300009093 Bacteria 1701
194 Ga0111539_10012361 3300009094 Bacteria 10700
195 Ga0111539_10878690 3300009094 Bacteria 1043
196 Ga0105245_10010834 3300009098 Bacteria 7933
197 Ga0105245_10072081 3300009098 Bacteria 3138
198 Ga0105245_10072772 3300009098 Bacteria 3123
199 Ga0105245_10171030 3300009098 Bacteria 2069
200 Ga0105245_10541552 3300009098 Bacteria 1185
201 Ga0105245_11092065 3300009098 Unclassified 844
202 Ga0105245_11619371 3300009098 Bacteria 699
203 Ga0105247_10243341 3300009101 Bacteria 1227
204 Ga0105247_10764542 3300009101 Bacteria 734
205 Ga0105247_11611717 3300009101 Unclassified 533
206 Ga0114129_10012279 3300009147 Bacteria 12187
207 Ga0105243_10047086 3300009148 Bacteria 3393
208 Ga0105241_10756674 3300009174 Unclassified 891
209 Ga0105241_12108453 3300009174 Bacteria 557
210 Ga0105242_10330216 3300009176 Bacteria 1402
211 Ga0105248_10090057 3300009177 Bacteria 3454
212 Ga0105248_10524673 3300009177 Bacteria 1335
213 Ga0105237_10085590 3300009545 Bacteria 3142
214 Ga0105237_10163848 3300009545 Bacteria 2222
215 Ga0105238_11222086 3300009551 Bacteria 776
216 Ga0105249_10058633 3300009553 Bacteria 3529
217 Ga0105239_10117623 3300010375 Bacteria 2950
218 Ga0105239_10324948 3300010375 Bacteria 1735
219 Ga0105239_10542001 3300010375 Bacteria 1325
220 Ga0105239_11027185 3300010375 Unclassified 948
221 Ga0105246_10061389 3300011119 Bacteria 2615
222 Ga0105246_10194063 3300011119 Bacteria 1574
223 Ga0105246_10674620 3300011119 Unclassified 903
224 Ga0157337_1001970 3300012483 Unclassified 1123
225 Ga0157345_1004708 3300012498 Bacteria 1032
226 Ga0157338_1083782 3300012515 Bacteria 520
227 Ga0157373_10160091 3300013100 Bacteria 1584
228 Ga0157371_10123923 3300013102 Bacteria 1838
229 Ga0157371_10155000 3300013102 Bacteria 1634
230 Ga0157370_10003288 3300013104 Bacteria 19063
231 Ga0157370_10019501 3300013104 Bacteria 6801
232 Ga0157370_10030905 3300013104 Bacteria 5245
233 Ga0157370_10104682 3300013104 Bacteria 2649
234 Ga0157370_10957836 3300013104 Unclassified 776
235 Ga0157370_11269960 3300013104 Bacteria 664
236 Ga0157369_10001003 3300013105 Bacteria 35669
237 Ga0157369_10037234 3300013105 Bacteria 5326
238 Ga0157369_10235657 3300013105 Unclassified 1912
239 Ga0157369_11322061 3300013105 Unclassified 734
240 Ga0157369_12022822 3300013105 Unclassified 584
241 Ga0157374_10041234 3300013296 Bacteria 4254
242 Ga0157374_10063540 3300013296 Bacteria 3462
243 Ga0157374_10100741 3300013296 Bacteria 2769
244 Ga0157374_10482043 3300013296 Unclassified 1244
245 Ga0157374_10521786 3300013296 Unclassified 1194
246 Ga0157374_11573131 3300013296 Bacteria 681
247 Ga0157374_12011758 3300013296 Unclassified 604
248 Ga0157378_10304071 3300013297 Bacteria 1544
249 Ga0163162_10094964 3300013306 Unclassified 3068
250 Ga0163162_12463949 3300013306 Unclassified 598
251 Ga0157372_10059549 3300013307 Bacteria 4272
252 Ga0157372_10099027 3300013307 Bacteria 3325
253 Ga0157372_10142077 3300013307 Bacteria 2767
254 Ga0157372_10241533 3300013307 Bacteria 2096
255 Ga0157372_10290217 3300013307 Bacteria 1902
256 Ga0157372_10927414 3300013307 Bacteria 1010
257 Ga0157372_11618537 3300013307 Bacteria 745
258 Ga0157375_10078085 3300013308 Bacteria 3343
259 Ga0157375_12899469 3300013308 Unclassified 573
260 Ga0163163_10480874 3300014325 Bacteria 1303
261 Ga0182008_10088788 3300014497 Unclassified 1523
262 Ga0182008_10335926 3300014497 Unclassified 798
263 Ga0157377_10024981 3300014745 Bacteria 3182
264 Ga0157379_10882244 3300014968 Unclassified 848
265 Ga0157376_10005638 3300014969 Bacteria 8762
266 Ga0157376_10078509 3300014969 Unclassified 2827
267 Ga0182007_10386320 3300015262 Bacteria 532
268 Ga0197907_11302405 3300020069 Bacteria 1101
269 Ga0206356_11288287 3300020070 Bacteria 2420
270 Ga0206354_10189649 3300020081 Bacteria 1192
271 Ga0206354_11042467 3300020081 Bacteria 1023
272 Ga0206353_10249593 3300020082 Bacteria 1272
273 Ga0206353_10287330 3300020082 Bacteria 3052
274 Ga0206353_10846162 3300020082 Unclassified 971
275 Ga0213873_10147018 3300021358 Unclassified 707
276 Ga0213871_10033542 3300021441 Bacteria 1351
277 Ga0224712_10041711 3300022467 Unclassified 1735
278 Ga0224712_10118831 3300022467 Unclassified 1142
279 Ga0207692_10012838 3300025898 Bacteria 3612
280 Ga0207692_10041406 3300025898 Bacteria 2280
281 Ga0207692_11062515 3300025898 Unclassified 536
282 Ga0207688_10006115 3300025901 Bacteria 6550
283 Ga0207685_10181639 3300025905 Bacteria 976
284 Ga0207699_10118982 3300025906 Bacteria 1705
285 Ga0207699_10142354 3300025906 Bacteria 1577
286 Ga0207643_10028234 3300025908 Bacteria 3115
287 Ga0207705_10038495 3300025909 Bacteria 3424
288 Ga0207684_10426738 3300025910 Bacteria 1139
289 Ga0207654_10879797 3300025911 Bacteria 649
290 Ga0207707_10012789 3300025912 Bacteria 7301
291 Ga0207707_10135027 3300025912 Bacteria 2157
292 Ga0207707_10166503 3300025912 Bacteria 1926
293 Ga0207707_10233233 3300025912 Bacteria 1601
294 Ga0207707_10315569 3300025912 Bacteria 1350
295 Ga0207707_10322492 3300025912 Bacteria 1333
296 Ga0207707_10373305 3300025912 Bacteria 1227
297 Ga0207695_10126218 3300025913 Bacteria 2520
298 Ga0207695_11177285 3300025913 Unclassified 647
299 Ga0207671_10072414 3300025914 Bacteria 2572
300 Ga0207693_10001250 3300025915 Bacteria 22628
301 Ga0207693_10004134 3300025915 Bacteria 12318
302 Ga0207693_10194985 3300025915 Unclassified 1594
303 Ga0207693_10268992 3300025915 Bacteria 1336
304 Ga0207693_10279318 3300025915 Unclassified 1309
305 Ga0207693_10403284 3300025915 Bacteria 1069
306 Ga0207663_10008967 3300025916 Bacteria 5264
307 Ga0207663_10161175 3300025916 Unclassified 1583
308 Ga0207663_10167249 3300025916 Bacteria 1558
309 Ga0207663_10329727 3300025916 Unclassified 1149
310 Ga0207660_10017111 3300025917 Bacteria 4811
311 Ga0207660_10050421 3300025917 Bacteria 2955
312 Ga0207660_10185956 3300025917 Unclassified 1616
313 Ga0207660_10460299 3300025917 Bacteria 1029
314 Ga0207660_11655254 3300025917 Unclassified 515
315 Ga0207657_10000184 3300025919 Bacteria 64813
316 Ga0207657_10000683 3300025919 Bacteria 36161
317 Ga0207657_10006110 3300025919 Bacteria 12520
318 Ga0207657_10152363 3300025919 Bacteria 1882
319 Ga0207657_10340037 3300025919 Bacteria 1185
320 Ga0207649_10015676 3300025920 Bacteria 4258
321 Ga0207649_10876424 3300025920 Bacteria 703
322 Ga0207652_10053119 3300025921 Bacteria 3480
323 Ga0207652_10808601 3300025921 Bacteria 832
324 Ga0207646_10001908 3300025922 Bacteria 25106
325 Ga0207646_10321857 3300025922 Bacteria 1397
326 Ga0207646_10548342 3300025922 Archaea 1040
327 Ga0207694_11630105 3300025924 Bacteria 543
328 Ga0207659_10140453 3300025926 Bacteria 1874
329 Ga0207687_10029370 3300025927 Bacteria 3698
330 Ga0207687_10228865 3300025927 Bacteria 1468
331 Ga0207687_10589850 3300025927 Bacteria 936
332 Ga0207687_10736013 3300025927 Unclassified 839
333 Ga0207700_10004525 3300025928 Bacteria 8212
334 Ga0207700_10062354 3300025928 Bacteria 2831
335 Ga0207700_10066737 3300025928 Bacteria 2751
336 Ga0207700_10143629 3300025928 Bacteria 1964
337 Ga0207700_10300222 3300025928 Bacteria 1387
338 Ga0207700_11045744 3300025928 Bacteria 730
339 Ga0207664_10015331 3300025929 Bacteria 5557
340 Ga0207664_10083855 3300025929 Unclassified 2598
341 Ga0207664_10097280 3300025929 Bacteria 2424
342 Ga0207664_10151111 3300025929 Bacteria 1973
343 Ga0207664_10346787 3300025929 Unclassified 1314
344 Ga0207664_10765041 3300025929 Unclassified 869
345 Ga0207644_11279576 3300025931 Bacteria 616
346 Ga0207690_10023249 3300025932 Bacteria 3867
347 Ga0207690_10106143 3300025932 Bacteria 2015
348 Ga0207690_10269685 3300025932 Unclassified 1322
349 Ga0207690_10679419 3300025932 Bacteria 845
350 Ga0207706_10202208 3300025933 Bacteria 1742
351 Ga0207686_10283488 3300025934 Unclassified 1224
352 Ga0207709_11339277 3300025935 Bacteria 592
353 Ga0207669_10784452 3300025937 Bacteria 789
354 Ga0207665_10000620 3300025939 Bacteria 23807
355 Ga0207665_10523521 3300025939 Unclassified 918
356 Ga0207665_10699903 3300025939 Unclassified 797
357 Ga0207691_10810845 3300025940 Bacteria 786
358 Ga0207711_10251301 3300025941 Bacteria 1624
359 Ga0207711_11356029 3300025941 Bacteria 654
360 Ga0207689_10468641 3300025942 Bacteria 1054
361 Ga0207661_10001205 3300025944 Bacteria 17301
362 Ga0207661_10037224 3300025944 Bacteria 3804
363 Ga0207661_10066652 3300025944 Bacteria 2925
364 Ga0207661_10128752 3300025944 Bacteria 2165
365 Ga0207661_10171014 3300025944 Bacteria 1892
366 Ga0207661_10407436 3300025944 Bacteria 1234
367 Ga0207661_10899324 3300025944 Bacteria 815
368 Ga0207679_10151806 3300025945 Bacteria 1886
369 Ga0207679_10712132 3300025945 Bacteria 911
370 Ga0207667_10024085 3300025949 Bacteria 6693
371 Ga0207667_10244424 3300025949 Bacteria 1836
372 Ga0207667_10608660 3300025949 Bacteria 1101
373 Ga0207667_11289104 3300025949 Unclassified 707
374 Ga0207651_10353084 3300025960 Bacteria 1239
375 Ga0207677_10421955 3300026023 Bacteria 1136
376 Ga0207677_11016801 3300026023 Bacteria 752
377 Ga0207677_11349274 3300026023 Bacteria 656
378 Ga0207677_12161181 3300026023 Bacteria 518
379 Ga0207639_10526226 3300026041 Bacteria 1083
380 Ga0207639_11241489 3300026041 Unclassified 699
381 Ga0207678_10250853 3300026067 Bacteria 1515
382 Ga0207708_10016428 3300026075 Bacteria 5567
383 Ga0207708_11156817 3300026075 Bacteria 676
384 Ga0207702_10049373 3300026078 Bacteria 3551
385 Ga0207702_10143391 3300026078 Unclassified 2164
386 Ga0207702_10384910 3300026078 Unclassified 1350
387 Ga0207702_10477538 3300026078 Bacteria 1213
388 Ga0207702_10846275 3300026078 Unclassified 905
389 Ga0207702_11650765 3300026078 Bacteria 634
390 Ga0207702_11855730 3300026078 Bacteria 594
391 Ga0207641_11509838 3300026088 Unclassified 673
392 Ga0207674_10025286 3300026116 Bacteria 6336
393 Ga0207674_10939236 3300026116 Bacteria 833
394 Ga0207675_100135417 3300026118 Bacteria 2337
395 Ga0207683_10189263 3300026121 Unclassified 1868
396 Ga0207698_10408913 3300026142 Bacteria 1299
397 Ga0207698_10909242 3300026142 Bacteria 888
398 Ga0207428_10044987 3300027907 Bacteria 3559
399 Ga0207428_10058468 3300027907 Bacteria 3060
400 Ga0268264_10649579 3300028381 Bacteria 1044
401 Ga0265337_1093193 3300028556 Bacteria 821
402 Ga0265326_10038666 3300028558 Bacteria 1356
403 Ga0265326_10145041 3300028558 Bacteria 678
404 Ga0265319_1127463 3300028563 Bacteria 792
405 Ga0265334_10002535 3300028573 Bacteria 8540
406 Ga0265334_10014738 3300028573 Bacteria 3255
407 Ga0265318_10000296 3300028577 Bacteria 40669
408 Ga0265322_10004483 3300028654 Bacteria 4155
409 Ga0265322_10039015 3300028654 Bacteria 1351
410 Ga0265336_10009086 3300028666 Bacteria 3450
411 Ga0265336_10043787 3300028666 Unclassified 1363
412 Ga0265338_10006228 3300028800 Bacteria 15274
413 Ga0265338_10009103 3300028800 Bacteria 11933
414 Ga0265338_10014335 3300028800 Bacteria 8828
415 Ga0265338_10017902 3300028800 Bacteria 7610
416 Ga0265338_10630500 3300028800 Bacteria 744
417 Ga0265338_10913177 3300028800 Bacteria 597
418 Ga0265324_10010734 3300029957 Bacteria 3516
419 Ga0265324_10050110 3300029957 Bacteria 1435
420 Ga0265324_10096190 3300029957 Bacteria 1007
421 Ga0265330_10001988 3300031235 Bacteria 11348
422 Ga0265330_10095104 3300031235 Bacteria 1277
423 Ga0265332_10033692 3300031238 Unclassified 2229
424 Ga0265332_10171184 3300031238 Bacteria 906
425 Ga0265328_10000451 3300031239 Bacteria 19117
426 Ga0265328_10007616 3300031239 Bacteria 4505
427 Ga0265320_10014605 3300031240 Bacteria 4463
428 Ga0265325_10000309 3300031241 Bacteria 34328
429 Ga0265325_10093910 3300031241 Bacteria 1475
430 Ga0265329_10040426 3300031242 Bacteria 1496
431 Ga0265329_10100504 3300031242 Unclassified 920
432 Ga0265340_10023790 3300031247 Bacteria 3119
433 Ga0265340_10065712 3300031247 Bacteria 1727
434 Ga0265340_10230136 3300031247 Bacteria 829
435 Ga0265339_10052368 3300031249 Bacteria 2223
436 Ga0265339_10070399 3300031249 Bacteria 1865
437 Ga0265331_10005204 3300031250 Bacteria 7895
438 Ga0265331_10170706 3300031250 Bacteria 984
439 Ga0265327_10003767 3300031251 Bacteria 14076
440 Ga0265327_10005428 3300031251 Bacteria 10632
441 Ga0265327_10061828 3300031251 Unclassified 1908
442 Ga0265327_10232442 3300031251 Bacteria 826
443 Ga0265316_10003341 3300031344 Bacteria 16263
444 Ga0265316_10029734 3300031344 Bacteria 4487
445 Ga0265316_10948189 3300031344 Bacteria 600
446 Ga0265313_10002173 3300031595 Bacteria 17392
447 Ga0265313_10015004 3300031595 Bacteria 4544
448 Ga0265313_10018343 3300031595 Bacteria 3931
449 Ga0265313_10332627 3300031595 Unclassified 605
450 Ga0265314_10020854 3300031711 Bacteria 5053
451 Ga0265314_10221951 3300031711 Bacteria 1102
452 Ga0265342_10005698 3300031712 Bacteria 9417
453 Ga0316583_10166797 3300032133 Bacteria 766
454 Ga0373926_0030362 3300035083 Bacteria 1903
455 Ga0373926_0088051 3300035083 Unclassified 1153
456 Ga0373944_0097381 3300035089 Bacteria 990
457 Ga0373951_0165470 3300035091 Bacteria 628
458 Ga0373923_0321792 3300035111 Bacteria 734
459 Ga0373945_0002914 3300035116 Bacteria 5376
460 Ga0373956_0176228 3300035119 Bacteria 1010
461 Ga0373956_0205402 3300035119 Bacteria 934
462 Ga0373957_0110240 3300035120 Unclassified 1108
463 Ga0373943_0002185 3300035170 Bacteria 8897
464 Ga0373943_0019338 3300035170 Bacteria 3131
465 Ga0373955_0192196 3300035172 Bacteria 1214
466 Ga0373955_0285359 3300035172 Unclassified 994
467 Ga0373955_0371248 3300035172 Bacteria 868
468 Ga0373924_0367934 3300035410 Unclassified 641
469 Ga0373935_0008309 3300035692 Bacteria 6210
470 Ga0373927_0046367 3300035695 Bacteria 2812
471 Ga0373927_0168659 3300035695 Bacteria 1435
472 Ga0373933_0093576 3300035724 Unclassified 1858
473 Ga0373933_0217245 3300035724 Bacteria 1226
474 Ga0373933_0334655 3300035724 Bacteria 982
475 Ga0373947_0001831 3300035725 Bacteria 13012
476 Ga0373947_0053904 3300035725 Bacteria 2426
477 Ga0373937_0000308 3300036401 Bacteria 46115
478 Ga0373937_0329769 3300036401 Unclassified 1444
479 Ga0373937_0514372 3300036401 Bacteria 1137
480 Ga0373937_1618595 3300036401 Unclassified 595
481 Ga0373925_0001399 3300037068 Bacteria 20978
482 Ga0373925_0050755 3300037068 Bacteria 3095
483 Ga0395899_0010575 3300037312 Bacteria 7071
484 Ga0395899_0051456 3300037312 Bacteria 3057
485 Ga0395900_0013234 3300037418 Bacteria 8431
486 Ga0395900_0266899 3300037418 Bacteria 1707
487 Ga0395900_0355050 3300037418 Bacteria 1439
488 Ga0395900_0406093 3300037418 Bacteria 1325
489 Ga0395900_1523480 3300037418 Bacteria 580
490 Ga0395898_0007979 3300037466 Bacteria 11231
491 Ga0395898_0031288 3300037466 Bacteria 5319
492 Ga0395898_0184687 3300037466 Bacteria 1992
493 Ga0395898_0258314 3300037466 Bacteria 1661
494 Ga0395898_0401477 3300037466 Bacteria 1307
495 Ga0395898_0579135 3300037466 Bacteria 1065
496 Ga0395898_0722702 3300037466 Bacteria 937
497 Ga0395898_1327919 3300037466 Unclassified 648
498 Ga0395898_1465149 3300037466 Bacteria 609
499 Ga0395905_0109123 3300037471 Bacteria 2598
500 Ga0395905_0264488 3300037471 Bacteria 1605
501 Ga0395905_0407358 3300037471 Bacteria 1255
502 Ga0395905_0419329 3300037471 Bacteria 1234
503 Ga0395905_0868975 3300037471 Unclassified 805
504 Ga0395905_0913409 3300037471 Unclassified 781
505 Ga0395905_1748416 3300037471 Unclassified 527
506 Ga0395901_0085806 3300038443 Bacteria 3291
507 Ga0395901_0107058 3300038443 Bacteria 2934
508 Ga0395901_0155796 3300038443 Bacteria 2399
509 Ga0395901_0315428 3300038443 Bacteria 1618
510 Ga0395901_0568987 3300038443 Bacteria 1146
511 Ga0395901_0607445 3300038443 Unclassified 1102
512 Ga0395901_0810343 3300038443 Bacteria 924
513 Ga0395901_2001383 3300038443 Bacteria 525
514 Ga0436360_0570305 3300039438 Bacteria 2998
515 Ga0436360_0718691 3300039438 Unclassified 798
516 Ga0436362_0431750 3300039453 Bacteria 1986
517 Ga0439453_0063814 3300041408 Bacteria 767
518 Ga0451804_0842484 3300041463 Unclassified 928
519 Ga0451855_1376915 3300041511 Bacteria 553
520 Ga0439448_0345572 3300042005 Bacteria 530
521 Ga0450902_083325 3300042137 Bacteria 563
522 Ga0439458_0028399 3300042157 Bacteria 1324
523 Ga0439460_0087264 3300042461 Bacteria 987
524 Ga0466965_0476347 3300044683 Unclassified 698
525 Ga0466966_0049919 3300044684 Unclassified 2663
526 Ga0466966_0323023 3300044684 Unclassified 927
527 Ga0466961_0005003 3300044693 Bacteria 8335
528 Ga0466963_0000532 3300044694 Bacteria 17888
529 Ga0466963_0001856 3300044694 Bacteria 11523
530 Ga0466963_0007505 3300044694 Bacteria 6507
531 Ga0466963_0007882 3300044694 Bacteria 6375
532 Ga0466963_0059581 3300044694 Bacteria 2548
533 Ga0466963_0065184 3300044694 Bacteria 2442
534 Ga0466963_0090962 3300044694 Bacteria 2078
535 Ga0466963_0271709 3300044694 Bacteria 1191
536 Ga0466963_0351716 3300044694 Bacteria 1038
537 Ga0466963_1111041 3300044694 Bacteria 556
538 Ga0466964_0027586 3300044706 Bacteria 2231
539 Ga0466964_0056934 3300044706 Bacteria 1617
540 Ga0466964_0200818 3300044706 Bacteria 957
541 Ga0466964_0224624 3300044706 Unclassified 913
542 Ga0466971_0245788 3300044719 Bacteria 852
543 Ga0466971_0714686 3300044719 Unclassified 504
544 Ga0466968_0010627 3300044735 Bacteria 3574
545 Ga0466968_0055011 3300044735 Bacteria 1707
546 Ga0466968_0453167 3300044735 Bacteria 634
547 Ga0466970_0535355 3300044765 Unclassified 676
548 Ga0466957_0007081 3300044842 Bacteria 6341
549 Ga0466957_0311157 3300044842 Bacteria 1060
550 Ga0466957_1217920 3300044842 Unclassified 545
551 Ga0466959_0011375 3300045049 Bacteria 6393
552 Ga0466959_0021693 3300045049 Bacteria 4740
553 Ga0451576_0115678 3300045051 Bacteria 2792
554 Ga0451576_1693411 3300045051 Unclassified 655
555 Ga0466958_0015042 3300045836 Bacteria 4427
556 Ga0466958_0112001 3300045836 Unclassified 1704
557 Ga0466958_0972209 3300045836 Bacteria 554
558 Ga0466967_0006110 3300045976 Bacteria 8470
559 Ga0466967_0009880 3300045976 Bacteria 7117
560 Ga0466967_0015339 3300045976 Bacteria 6001
561 Ga0466967_0016262 3300045976 Bacteria 5860
562 Ga0466967_0020316 3300045976 Bacteria 5364
563 Ga0466967_0044126 3300045976 Bacteria 3865
564 Ga0466967_0055221 3300045976 Bacteria 3498
565 Ga0466967_0064317 3300045976 Bacteria 3262
566 Ga0466967_0083195 3300045976 Bacteria 2894
567 Ga0466967_0120169 3300045976 Bacteria 2426
568 Ga0466967_0163033 3300045976 Bacteria 2094
569 Ga0466967_0192464 3300045976 Bacteria 1928
570 Ga0466967_0375051 3300045976 Bacteria 1380
571 Ga0466967_0463150 3300045976 Bacteria 1240
572 Ga0466967_0673265 3300045976 Bacteria 1024
573 Ga0466967_0850607 3300045976 Unclassified 906
574 Ga0466967_1146501 3300045976 Unclassified 775
575 Ga0466967_1163574 3300045976 Unclassified 768
576 Ga0466967_1407735 3300045976 Bacteria 694
577 Ga0466967_1579078 3300045976 Unclassified 653
578 Ga0466967_1908516 3300045976 Bacteria 591
579 Ga0466967_2488758 3300045976 Bacteria 513
580 Ga0495592_0000410 3300046454 Bacteria 32753
581 Ga0495592_0008108 3300046454 Bacteria 7887
582 Ga0495592_0072952 3300046454 Bacteria 2497
583 Ga0495592_0124333 3300046454 Bacteria 1811
584 Ga0495592_0169769 3300046454 Unclassified 1495
585 Ga0495592_0215774 3300046454 Unclassified 1286
586 Ga0495603_0282350 3300046455 Bacteria 954
587 Ga0495629_0026042 3300046459 Bacteria 4156
588 Ga0495629_0084672 3300046459 Bacteria 2212
589 Ga0495629_0154532 3300046459 Bacteria 1595
590 Ga0495629_0200141 3300046459 Bacteria 1381
591 Ga0495629_0233316 3300046459 Bacteria 1268
592 Ga0495641_0005629 3300046461 Bacteria 8372
593 Ga0495641_0009652 3300046461 Bacteria 5708
594 Ga0495641_0039888 3300046461 Bacteria 2186
595 Ga0495641_0154131 3300046461 Bacteria 1027
596 Ga0495641_0382634 3300046461 Unclassified 638
597 Ga0495651_0000034 3300046462 Bacteria 99213
598 Ga0495651_0054593 3300046462 Bacteria 3072
599 Ga0495651_0056976 3300046462 Bacteria 3001
600 Ga0495651_0216323 3300046462 Bacteria 1329
601 Ga0495651_0265008 3300046462 Bacteria 1167
602 Ga0495651_0308257 3300046462 Bacteria 1060
603 Ga0495653_0001634 3300046463 Bacteria 17597
604 Ga0495653_0007842 3300046463 Bacteria 8742
605 Ga0495653_0150966 3300046463 Bacteria 1623
606 Ga0495653_0161884 3300046463 Bacteria 1553
607 Ga0495653_0296286 3300046463 Unclassified 1056
608 Ga0495580_0018581 3300046472 Bacteria 5174
609 Ga0495582_0008933 3300046473 Bacteria 5530
610 Ga0495582_0352125 3300046473 Bacteria 848
611 Ga0495582_0483457 3300046473 Unclassified 715
612 Ga0495639_0009322 3300046475 Bacteria 4209
613 Ga0495639_0269909 3300046475 Bacteria 844
614 Ga0495662_0005815 3300046476 Bacteria 6172
615 Ga0495662_0137492 3300046476 Bacteria 1202
616 Ga0495664_0003716 3300046477 Bacteria 8323
617 Ga0495664_0024197 3300046477 Bacteria 3528
618 Ga0495664_0058659 3300046477 Bacteria 2290
619 Ga0495664_0170231 3300046477 Unclassified 1321
620 Ga0495664_0950238 3300046477 Bacteria 501
621 Ga0495608_0001004 3300046511 Bacteria 19861
622 Ga0495608_0027586 3300046511 Bacteria 3863
623 Ga0495608_0035988 3300046511 Bacteria 3334
624 Ga0495608_0306809 3300046511 Bacteria 982
625 Ga0495608_0664312 3300046511 Unclassified 622
626 Ga0495608_0777675 3300046511 Unclassified 566
627 Ga0495618_0008709 3300046514 Bacteria 6132
628 Ga0495618_0047831 3300046514 Bacteria 2699
629 Ga0495618_0182783 3300046514 Bacteria 1332
630 Ga0495618_0186969 3300046514 Bacteria 1315
631 Ga0495618_0198672 3300046514 Unclassified 1270
632 Ga0495618_0716944 3300046514 Bacteria 587
633 Ga0495628_0000184 3300046516 Bacteria 54832
634 Ga0495628_0116001 3300046516 Bacteria 2057
635 Ga0495628_0176333 3300046516 Unclassified 1619
636 Ga0495628_0327959 3300046516 Bacteria 1128
637 Ga0495628_0558418 3300046516 Unclassified 821
638 Ga0495628_0782852 3300046516 Bacteria 668
639 Ga0495628_0933321 3300046516 Unclassified 600
640 Ga0495630_0006556 3300046517 Bacteria 8289
641 Ga0495630_0022305 3300046517 Bacteria 4676
642 Ga0495630_0177965 3300046517 Unclassified 1621
643 Ga0495630_0235350 3300046517 Unclassified 1399
644 Ga0495630_0396091 3300046517 Bacteria 1058
645 Ga0495630_0696609 3300046517 Unclassified 777
646 Ga0495666_0001186 3300046526 Bacteria 12548
647 Ga0495652_0000319 3300046529 Bacteria 56845
648 Ga0495652_0018630 3300046529 Bacteria 6186
649 Ga0495652_0058072 3300046529 Bacteria 3278
650 Ga0495652_0156930 3300046529 Unclassified 1771
651 Ga0495652_0219334 3300046529 Bacteria 1430
652 Ga0495652_0242948 3300046529 Unclassified 1338
653 Ga0495652_0465620 3300046529 Unclassified 882
654 Ga0495652_0774125 3300046529 Bacteria 641
655 Ga0495665_0003752 3300046531 Bacteria 8219
656 Ga0495640_0010802 3300046533 Bacteria 7043
657 Ga0495640_0016364 3300046533 Bacteria 5548
658 Ga0495640_0038013 3300046533 Unclassified 3389
659 Ga0495640_0124729 3300046533 Unclassified 1671
660 Ga0495640_0320714 3300046533 Bacteria 960
661 Ga0495586_0052035 3300046535 Bacteria 2216
662 Ga0495586_0078082 3300046535 Bacteria 1816
663 Ga0495586_0466650 3300046535 Bacteria 728
664 Ga0495587_0000055 3300046536 Bacteria 97024
665 Ga0495587_0072248 3300046536 Bacteria 2006
666 Ga0495587_0137127 3300046536 Unclassified 1397
667 Ga0495587_0838608 3300046536 Bacteria 501
668 Ga0495645_0000170 3300046543 Bacteria 45455
669 Ga0495645_0075458 3300046543 Bacteria 2426
670 Ga0495645_0262930 3300046543 Unclassified 1141
671 Ga0495645_0503907 3300046543 Unclassified 756
672 Ga0495667_0021039 3300046559 Bacteria 4400
673 Ga0495667_0039955 3300046559 Bacteria 3116
674 Ga0495667_0043555 3300046559 Bacteria 2974
675 Ga0495667_0085805 3300046559 Bacteria 2043
676 Ga0495667_0161893 3300046559 Bacteria 1439
677 Ga0495667_0172395 3300046559 Bacteria 1390
678 Ga0495667_0268327 3300046559 Unclassified 1085
679 Ga0495667_0424684 3300046559 Bacteria 836
680 Ga0495667_0583267 3300046559 Unclassified 697
681 Ga0495634_0008630 3300046642 Bacteria 7563
682 Ga0495634_0037619 3300046642 Bacteria 3305
683 Ga0495634_0075314 3300046642 Bacteria 2216
684 Ga0495634_0522557 3300046642 Bacteria 694
685 Ga0495634_0716118 3300046642 Unclassified 575
686 Ga0495635_0011475 3300046663 Bacteria 6212
687 Ga0495635_0031624 3300046663 Bacteria 3673
688 Ga0495635_0051587 3300046663 Unclassified 2833
689 Ga0495635_0059979 3300046663 Bacteria 2616
690 Ga0495635_0161873 3300046663 Bacteria 1523
691 Ga0495635_0600135 3300046663 Bacteria 719
692 Ga0495657_0025578 3300046675 Bacteria 4190
693 Ga0495657_0069002 3300046675 Bacteria 2314
694 Ga0495657_0179041 3300046675 Bacteria 1302
695 Ga0495657_0225993 3300046675 Unclassified 1133
696 Ga0495657_0240447 3300046675 Bacteria 1093
697 Ga0495657_0816910 3300046675 Unclassified 532
698 Ga0495599_0001220 3300046678 Bacteria 14572
699 Ga0495599_0061558 3300046678 Bacteria 2345
700 Ga0495599_0156685 3300046678 Bacteria 1409
701 Ga0495599_0540301 3300046678 Bacteria 683
702 Ga0495599_0613858 3300046678 Bacteria 632
703 Ga0495599_0626045 3300046678 Archaea 625
704 Ga0495623_0000149 3300046679 Bacteria 42958
705 Ga0495623_0041042 3300046679 Bacteria 2953
706 Ga0495623_0205186 3300046679 Unclassified 1131
707 Ga0495623_0259635 3300046679 Unclassified 974
708 Ga0495646_0010301 3300046680 Bacteria 5946
709 Ga0495646_0079788 3300046680 Bacteria 1910
710 Ga0495646_0097428 3300046680 Bacteria 1690
711 Ga0495647_0001212 3300046681 Bacteria 7962
712 Ga0495647_0463397 3300046681 Bacteria 587
713 Ga0495658_0004111 3300046683 Bacteria 7167
714 Ga0495658_0047705 3300046683 Bacteria 2413
715 Ga0495658_0069176 3300046683 Bacteria 2046
716 Ga0495658_0152406 3300046683 Unclassified 1421
717 Ga0495658_0380134 3300046683 Unclassified 899
718 Ga0495613_0005204 3300046689 Bacteria 9767
719 Ga0495613_0011084 3300046689 Bacteria 6693
720 Ga0495613_0052186 3300046689 Bacteria 3012
721 Ga0495613_0070496 3300046689 Bacteria 2549
722 Ga0495624_0016643 3300046690 Bacteria 4949
723 Ga0495624_0026752 3300046690 Bacteria 3779
724 Ga0495624_0544670 3300046690 Unclassified 693
725 Ga0495600_0149841 3300046809 Unclassified 1511
726 Ga0495600_0263300 3300046809 Unclassified 1095
727 Ga0495581_0005286 3300047315 Bacteria 7468
728 Ga0495604_0000194 3300047317 Bacteria 54877
729 Ga0495604_0038396 3300047317 Bacteria 3767
730 Ga0495604_0040857 3300047317 Bacteria 3640
731 Ga0495604_0610286 3300047317 Unclassified 699
732 Ga0495604_0694084 3300047317 Bacteria 647
733 Ga0495674_0009278 3300047319 Bacteria 9349
734 Ga0495674_0023647 3300047319 Bacteria 5658
735 Ga0495674_0025046 3300047319 Bacteria 5476
736 Ga0495674_0092528 3300047319 Bacteria 2581
737 Ga0495674_0214047 3300047319 Bacteria 1595
738 Ga0495674_0341898 3300047319 Bacteria 1216
739 Ga0495674_0360492 3300047319 Unclassified 1179
740 Ga0495674_0511381 3300047319 Bacteria 960
741 Ga0495674_0520153 3300047319 Bacteria 950
742 Ga0495676_0066273 3300047321 Bacteria 2799
743 Ga0495676_0068155 3300047321 Bacteria 2750
744 Ga0495676_0087620 3300047321 Bacteria 2339
745 Ga0495676_0400227 3300047321 Bacteria 911
746 Ga0495680_0017928 3300047322 Bacteria 6024
747 Ga0495680_0028662 3300047322 Bacteria 4564
748 Ga0495680_0034084 3300047322 Bacteria 4117
749 Ga0495680_0036955 3300047322 Bacteria 3915
750 Ga0495675_0000029 3300047444 Bacteria 105305
751 Ga0495675_0202192 3300047444 Bacteria 1209
752 Ga0495675_0263542 3300047444 Bacteria 1032
753 Ga0495684_0008421 3300047471 Bacteria 7990
754 Ga0495684_0019490 3300047471 Bacteria 5225
755 Ga0495684_0028439 3300047471 Bacteria 4292
756 Ga0495684_0052586 3300047471 Bacteria 3108
757 Ga0495684_0073849 3300047471 Bacteria 2591
758 Ga0495684_0142758 3300047471 Unclassified 1795
759 Ga0495684_0183360 3300047471 Unclassified 1551
760 Ga0495593_0000750 3300047673 Bacteria 18855
761 Ga0495602_0000741 3300048088 Bacteria 30911
762 Ga0495602_0061366 3300048088 Bacteria 3270
763 Ga0495602_0087920 3300048088 Bacteria 2588
764 Ga0495602_0201833 3300048088 Bacteria 1516
765 Ga0495602_0283851 3300048088 Bacteria 1218
766 Ga0495602_0392215 3300048088 Bacteria 992
767 Ga0495602_0681216 3300048088 Bacteria 699
768 Ga0495602_0705525 3300048088 Bacteria 684
769 Ga0495602_0729267 3300048088 Bacteria 670
770 Ga0495602_1145511 3300048088 Bacteria 508
771 Ga0495614_0000802 3300048089 Bacteria 13308
772 Ga0495614_0136064 3300048089 Unclassified 1090
773 Ga0496100_0002026 3300048903 Bacteria 10143
774 Ga0496100_0022421 3300048903 Bacteria 3821
775 Ga0496100_0050060 3300048903 Bacteria 2705
776 Ga0496100_0120248 3300048903 Bacteria 1836
777 Ga0496100_0293833 3300048903 Bacteria 1214
778 Ga0496100_0730144 3300048903 Bacteria 774
779 Ga0496101_0007253 3300048904 Bacteria 7172
780 Ga0496101_0028953 3300048904 Bacteria 3871
781 Ga0496101_0109681 3300048904 Bacteria 2076
782 Ga0496101_0117841 3300048904 Bacteria 2005
783 Ga0496101_0244499 3300048904 Bacteria 1397
784 Ga0496101_0378708 3300048904 Bacteria 1113
785 Ga0496102_0015239 3300048905 Bacteria 6693
786 Ga0496102_0016614 3300048905 Bacteria 6434
787 Ga0496102_0092770 3300048905 Bacteria 2797
788 Ga0496102_0891220 3300048905 Bacteria 811
789 Ga0496102_0894044 3300048905 Bacteria 810
790 Ga0496102_0927624 3300048905 Bacteria 792
791 Ga0496102_1360852 3300048905 Bacteria 629
792 Ga0496102_1568203 3300048905 Unclassified 577
793 Ga0496103_0370884 3300048906 Bacteria 920
794 Ga0496104_0003169 3300048907 Bacteria 14147
795 Ga0496104_0007841 3300048907 Bacteria 9462
796 Ga0496104_0035240 3300048907 Bacteria 4673
797 Ga0496104_0051552 3300048907 Bacteria 3884
798 Ga0496104_0167467 3300048907 Bacteria 2107
799 Ga0496104_0299279 3300048907 Bacteria 1521
800 Ga0496104_0395651 3300048907 Unclassified 1294
801 Ga0496104_0593860 3300048907 Unclassified 1017
802 Ga0496105_0013301 3300048908 Bacteria 6530
803 Ga0496105_0018312 3300048908 Bacteria 5626
804 Ga0496105_0024704 3300048908 Bacteria 4884
805 Ga0496105_0048496 3300048908 Bacteria 3505
806 Ga0496105_0063378 3300048908 Bacteria 3050
807 Ga0496105_0096726 3300048908 Bacteria 2438
808 Ga0496105_0116215 3300048908 Bacteria 2207
809 Ga0496105_0289262 3300048908 Bacteria 1319
810 Ga0496105_0699396 3300048908 Bacteria 778
811 Ga0496106_0001209 3300048909 Bacteria 19302
812 Ga0496106_0003352 3300048909 Bacteria 11940
813 Ga0496106_0286909 3300048909 Unclassified 1319
814 Ga0496106_0619780 3300048909 Bacteria 866
815 Ga0496107_0022234 3300048910 Bacteria 4481
816 Ga0496107_0051508 3300048910 Bacteria 2969
817 Ga0496107_0064351 3300048910 Bacteria 2659
818 Ga0496107_0208732 3300048910 Bacteria 1452
819 Ga0496107_0514774 3300048910 Unclassified 887
820 Ga0496108_0002815 3300048911 Bacteria 13953
821 Ga0496108_0022442 3300048911 Bacteria 5188
822 Ga0496108_0029182 3300048911 Bacteria 4567
823 Ga0496108_0050860 3300048911 Bacteria 3471
824 Ga0496108_0184595 3300048911 Bacteria 1806
825 Ga0496109_0001232 3300048912 Bacteria 21266
826 Ga0496109_0005020 3300048912 Bacteria 11054
827 Ga0496109_0005573 3300048912 Bacteria 10539
828 Ga0496109_0063635 3300048912 Bacteria 3374
829 Ga0496109_0071841 3300048912 Bacteria 3178
830 Ga0496109_0156883 3300048912 Bacteria 2132
831 Ga0496109_0227494 3300048912 Bacteria 1754
832 Ga0496109_0482366 3300048912 Bacteria 1170
833 Ga0496110_0033218 3300048913 Bacteria 4461
834 Ga0496110_0046222 3300048913 Bacteria 3808
835 Ga0496110_0050897 3300048913 Bacteria 3639
836 Ga0496110_0078503 3300048913 Unclassified 2939
837 Ga0496110_0167232 3300048913 Bacteria 1994
838 Ga0496110_0491924 3300048913 Bacteria 1117
839 Ga0496110_0566893 3300048913 Bacteria 1031
840 Ga0496111_0008451 3300048914 Bacteria 6817
841 Ga0496111_0015430 3300048914 Bacteria 5243
842 Ga0496111_0079336 3300048914 Bacteria 2394
843 Ga0496111_0125221 3300048914 Bacteria 1899
844 Ga0496111_0292613 3300048914 Bacteria 1208
845 Ga0496111_0320454 3300048914 Bacteria 1148
846 Ga0496112_0022139 3300048915 Bacteria 6055
847 Ga0496112_0051586 3300048915 Bacteria 4035
848 Ga0496112_0182050 3300048915 Bacteria 2065
849 Ga0496112_0624744 3300048915 Bacteria 1008
850 Ga0496113_0060094 3300048916 Bacteria 2864
851 Ga0496113_0091870 3300048916 Bacteria 2341
852 Ga0496113_0148427 3300048916 Bacteria 1849
853 Ga0496113_1030291 3300048916 Bacteria 647
854 Ga0496113_1290757 3300048916 Bacteria 568
855 Ga0496113_1449382 3300048916 Unclassified 531
856 Ga0496114_0010264 3300048917 Bacteria 7452
857 Ga0496114_0023553 3300048917 Bacteria 5025
858 Ga0496114_0029079 3300048917 Bacteria 4539
859 Ga0496114_0119004 3300048917 Bacteria 2270
860 Ga0496114_0203360 3300048917 Bacteria 1735
861 Ga0496114_0354258 3300048917 Bacteria 1298
862 Ga0496114_0417050 3300048917 Bacteria 1189
863 Ga0496114_0832881 3300048917 Bacteria 802
864 Ga0496114_0866352 3300048917 Bacteria 784
865 Ga0496114_1202701 3300048917 Bacteria 644
866 Ga0496114_1722616 3300048917 Unclassified 515
867 Ga0496115_0008936 3300048918 Bacteria 7430
868 Ga0496115_0011555 3300048918 Bacteria 6619
869 Ga0496115_0053205 3300048918 Bacteria 3248
870 Ga0496115_0066404 3300048918 Bacteria 2915
871 Ga0496115_0079634 3300048918 Bacteria 2667
872 Ga0496115_0095989 3300048918 Bacteria 2427
873 Ga0496115_0163098 3300048918 Bacteria 1843
874 Ga0496115_0274182 3300048918 Bacteria 1385
875 Ga0496115_0313295 3300048918 Bacteria 1285
876 Ga0501031_0004850 3300049568 Bacteria 8743
877 Ga0501031_0031722 3300049568 Bacteria 3447
878 Ga0501032_0034116 3300049569 Bacteria 3484
879 Ga0501034_0339198 3300049571 Bacteria 1433
880 Ga0501034_0387538 3300049571 Bacteria 1322
881 Ga0501036_0012418 3300049572 Bacteria 7056
882 Ga0501036_0014731 3300049572 Bacteria 6522
883 Ga0501037_0085622 3300049573 Bacteria 2282
884 Ga0501037_0122880 3300049573 Bacteria 1865
885 Ga0501038_0011136 3300049574 Bacteria 8213
886 Ga0501038_0215237 3300049574 Bacteria 1535
887 Ga0501038_0234032 3300049574 Bacteria 1461
888 Ga0501039_0043081 3300049575 Bacteria 3487
889 Ga0501040_0063391 3300049576 Bacteria 2543
890 Ga0501041_0003188 3300049577 Bacteria 9434
891 Ga0501042_0002606 3300049578 Bacteria 11090
892 Ga0501042_0075677 3300049578 Bacteria 2409
893 Ga0501043_0518683 3300049579 Bacteria 888
894 Ga0501046_0001782 3300049580 Bacteria 20562
895 Ga0501046_0107626 3300049580 Bacteria 2133
896 Ga0501046_0310012 3300049580 Bacteria 1151
897 Ga0501047_0664340 3300049581 Bacteria 861
898 Ga0501048_0007986 3300049582 Bacteria 8010
899 Ga0501048_0077979 3300049582 Bacteria 2338
900 Ga0501067_0194403 3300049583 Bacteria 1130
901 Ga0501067_0459853 3300049583 Bacteria 711
902 Ga0501067_0649277 3300049583 Bacteria 592
903 Ga0501068_0005297 3300049584 Bacteria 7044
904 Ga0501068_0017559 3300049584 Bacteria 4139
905 Ga0501068_0333144 3300049584 Unclassified 974
906 Ga0501069_0004693 3300049585 Bacteria 7064
907 Ga0501069_0087395 3300049585 Unclassified 1761
908 Ga0501070_0001614 3300049586 Bacteria 20005
909 Ga0501070_0295283 3300049586 Bacteria 1321
910 Ga0501070_0738315 3300049586 Bacteria 776
911 Ga0501071_0004871 3300049587 Bacteria 8557
912 Ga0501071_0106467 3300049587 Bacteria 2070
913 Ga0501072_0006639 3300049588 Bacteria 8804
914 Ga0501072_0084433 3300049588 Bacteria 2517
915 Ga0501072_0572807 3300049588 Bacteria 891
916 Ga0501073_0001427 3300049589 Bacteria 17658
917 Ga0501074_0003559 3300049590 Bacteria 11042
918 Ga0501074_0013802 3300049590 Bacteria 5876
919 Ga0501074_0248729 3300049590 Bacteria 1264
920 Ga0501075_0001342 3300049591 Bacteria 15979
921 Ga0501075_0100514 3300049591 Bacteria 2196
922 Ga0501075_0298350 3300049591 Bacteria 1228
923 Ga0501076_0007652 3300049592 Bacteria 7867
924 Ga0501076_0288524 3300049592 Bacteria 1344
925 Ga0501077_0001984 3300049593 Bacteria 12353
926 Ga0501079_0060374 3300049741 Bacteria 2924
927 Ga0501080_0046811 3300049742 Bacteria 4026
928 Ga0501080_0084203 3300049742 Bacteria 2955
929 Ga0501080_0290170 3300049742 Bacteria 1485
930 Ga0501081_0082497 3300049743 Bacteria 2252
931 Ga0501083_0005829 3300049744 Bacteria 8722
932 Ga0501083_0010453 3300049744 Bacteria 6535
933 Ga0501035_0099819 3300049822 Bacteria 2548
934 Ga0501044_0127243 3300049823 Bacteria 2544
935 Ga0501044_0270353 3300049823 Bacteria 1636
936 Ga0501045_0005139 3300049824 Bacteria 9061
937 Ga0501045_0048481 3300049824 Bacteria 3096
938 nmdc:mga03683_529018_c1 3300050489 Unclassified 573
939 nmdc:mga00v17_55325_c1 3300050491 Bacteria 2423
940 nmdc:mga0yw44_29577_c1 3300050492 Bacteria 3163
941 nmdc:mga0yw44_926255_c1 3300050492 Unclassified 591
942 nmdc:mga05p37_1850308_c1 3300050507 Unclassified 580
943 nmdc:mga05p37_31165_c1 3300050507 Bacteria 6513
944 nmdc:mga09592_28989_c1 3300050508 Bacteria 4603
945 nmdc:mga09592_370014_c1 3300050508 Bacteria 1240
946 nmdc:mga0qj67_569574_c1 3300050509 Unclassified 908
947 nmdc:mga06r32_100701_c1 3300050510 Bacteria 2835
948 nmdc:mga06r32_392953_c1 3300050510 Bacteria 1369
949 nmdc:mga06r32_633346_c1 3300050510 Bacteria 1038
950 nmdc:mga08y16_258745_c1 3300050511 Unclassified 1798
951 nmdc:mga08y16_405054_c1 3300050511 Bacteria 1396
952 nmdc:mga0n895_1057330_c1 3300050512 Unclassified 791
953 nmdc:mga0n895_489355_c1 3300050512 Bacteria 1240
954 nmdc:mga0n895_576472_c1 3300050512 Bacteria 1129
955 nmdc:mga0n895_845287_c1 3300050512 Unclassified 903
956 nmdc:mga0n895_938204_c1 3300050512 Bacteria 849
957 nmdc:mga0rr50_251531_c1 3300050513 Bacteria 1468
958 nmdc:mga0rr50_450202_c1 3300050513 Unclassified 1091
959 nmdc:mga0a205_1204193_c1 3300050515 Bacteria 605
960 nmdc:mga0a205_34242_c1 3300050515 Bacteria 4873
961 Ga0495601_0000082 3300053077 Bacteria 51242
962 Ga0495601_0011446 3300053077 Bacteria 5306
963 Ga0495601_0019054 3300053077 Bacteria 4182
964 Ga0495601_0026834 3300053077 Bacteria 3558
965 Ga0495601_0109045 3300053077 Bacteria 1792
966 Ga0495601_0121088 3300053077 Unclassified 1699
967 Ga0495601_0192854 3300053077 Unclassified 1331
968 Ga0495601_0213185 3300053077 Bacteria 1261
969 Ga0495601_0352464 3300053077 Bacteria 957
970 Ga0495601_0418064 3300053077 Bacteria 868
971 Ga0495601_0814920 3300053077 Unclassified 592
972 Ga0495601_0904344 3300053077 Unclassified 557
973 Ga0495612_0001482 3300053078 Bacteria 9660
974 Ga0495612_0008514 3300053078 Bacteria 4160
975 Ga0495612_0081436 3300053078 Bacteria 1360
976 Ga0495612_0133194 3300053078 Bacteria 1075
977 Ga0495612_0303397 3300053078 Bacteria 716
978 Ga0495595_0014003 3300053084 Bacteria 3395
979 Ga0495595_0053143 3300053084 Bacteria 1881
980 Ga0495595_0209416 3300053084 Bacteria 971
981 Ga0495619_0006116 3300053085 Bacteria 7624
982 Ga0495619_0026063 3300053085 Bacteria 3759
983 Ga0495619_0029797 3300053085 Bacteria 3528
984 Ga0495619_0035136 3300053085 Bacteria 3260
985 Ga0495619_0288090 3300053085 Bacteria 1138
986 Ga0495619_0634575 3300053085 Archaea 729
987 Ga0495619_0730243 3300053085 Unclassified 672
988 Ga0495619_0900692 3300053085 Unclassified 595
989 Ga0495619_1072916 3300053085 Bacteria 537
990 Ga0500566_0036553 3300053094 Bacteria 2848
991 Ga0500657_180165 3300053728 Bacteria 734
992 Ga0501084_0052695 3300054114 Bacteria 3403
993 Ga0501082_0090387 3300060353 Bacteria 2643
994 Ga0501082_0119035 3300060353 Bacteria 2288
995 Ga0466962_0242558 3300061719 Unclassified 885
996 Ga0466962_0558579 3300061719 Bacteria 582
997 Ga0530510_0025581 3300061734 Bacteria 4221
998 Ga0530510_0080608 3300061734 Bacteria 2369
999 Ga0530510_0215800 3300061734 Bacteria 1425
1000 Ga0105248_11620055
1001 ARSoilOldRDRAFT_c018305
1002 ARCol0yngRDRAFT_1004101
1003 JGI25407J50210_10010134
1004 JGI25407J50210_10055697
1005 Ga0070658_10046325
1006 Ga0070683_100001618
1007 Ga0070683_100004037
1008 Ga0070683_100024659
1009 Ga0070683_100225996
1010 Ga0070683_100244202
1011 Ga0070683_100480038
1012 Ga0068869_101119060
1013 Ga0070680_100014480
1014 Ga0070680_100038421
1015 Ga0070680_100045407
1016 Ga0070680_100228698
1017 Ga0070680_100543419
1018 Ga0070680_100599236
1019 Ga0070682_100036952
1020 Ga0070682_100450233
1021 Ga0068868_100450303
1022 Ga0068868_101567529
1023 Ga0068868_101613621
1024 Ga0068868_102102625
1025 Ga0070660_100004204
1026 Ga0070660_100008236
1027 Ga0070660_100030781
1028 Ga0070660_100176630
1029 Ga0070691_10131992
1030 Ga0070661_100037480
1031 Ga0070661_100402984
1032 Ga0070661_100464306
1033 Ga0070692_10059677
1034 Ga0070692_10113771
1035 Ga0070692_10885315
1036 Ga0070668_101421743
1037 Ga0070671_100088351
1038 Ga0070671_101454634
1039 Ga0070673_100655696
1040 Ga0070659_100044012
1041 Ga0070659_100104376
1042 Ga0070659_100395487
1043 Ga0070659_100473885
1044 Ga0070709_10147435
1045 Ga0070709_10421862
1046 Ga0070714_100007601
1047 Ga0070714_100016982
1048 Ga0070714_100437922
1049 Ga0070714_100442941
1050 Ga0070714_100853464
1051 Ga0070714_102195250
1052 Ga0070713_100001979
1053 Ga0070713_100142875
1054 Ga0070713_100175846
1055 Ga0070713_100210275
1056 Ga0070713_100933916
1057 Ga0070713_101077840
1058 Ga0070713_101470755
1059 Ga0070713_101718825
1060 Ga0070710_10001198
1061 Ga0070710_10022719
1062 Ga0070710_10080619
1063 Ga0070710_10534886
1064 Ga0070710_10722536
1065 Ga0070710_10743055
1066 Ga0070701_10767539
1067 Ga0070711_100016338
1068 Ga0070711_100016526
1069 Ga0070711_100027857
1070 Ga0070711_100053977
1071 Ga0070694_100080056
1072 Ga0070708_100771315
1073 Ga0070663_100301716
1074 Ga0070663_100380750
1075 Ga0070663_101260541
1076 Ga0070678_100655740
1077 Ga0070678_101239106
1078 Ga0070678_102341847
1079 Ga0070662_100211703
1080 Ga0070681_10003984
1081 Ga0070681_10009371
1082 Ga0070681_10020410
1083 Ga0070681_10420534
1084 Ga0070681_11108094
1085 Ga0068867_102283975
1086 Ga0070685_10425637
1087 Ga0070706_100249775
1088 Ga0070707_100000445
1089 Ga0070707_100318397
1090 Ga0070707_100365301
1091 Ga0070698_100324261
1092 Ga0070679_100011917
1093 Ga0070679_100014687
1094 Ga0070679_100026708
1095 Ga0070679_100032618
1096 Ga0070679_100093684
1097 Ga0070679_100405563
1098 Ga0070684_100020900
1099 Ga0070684_100040098
1100 Ga0070684_100046844
1101 Ga0070684_100137345
1102 Ga0070684_100803058
1103 Ga0070684_102027899
1104 Ga0068853_100028009
1105 Ga0068853_100087810
1106 Ga0070672_100773624
1107 Ga0070695_100119158
1108 Ga0070693_100357570
1109 Ga0070665_100056274
1110 Ga0070704_100007156
1111 Ga0070704_100046747
1112 Ga0068855_100017510
1113 Ga0068855_100029199
1114 Ga0068855_100072111
1115 Ga0068855_100090005
1116 Ga0068855_100124099
1117 Ga0070664_100056337
1118 Ga0070664_100066143
1119 Ga0070664_100947117
1120 Ga0068857_100077305
1121 Ga0068857_100082734
1122 Ga0068857_101087488
1123 Ga0068854_100742018
1124 Ga0068856_100083740
1125 Ga0068856_100239210
1126 Ga0068856_100346098
1127 Ga0068856_100506060
1128 Ga0070702_100055343
1129 Ga0070702_100071092
1130 Ga0070702_100602270
1131 Ga0068852_100156433
1132 Ga0068852_100614980
1133 Ga0068852_100853387
1134 Ga0068852_101814320
1135 Ga0068859_101816869
1136 Ga0068864_100589514
1137 Ga0068861_101779948
1138 Ga0068870_11057064
1139 Ga0068863_100654396
1140 Ga0068860_100685859
1141 Ga0068860_101612365
1142 Ga0081455_10016553
1143 Ga0081538_10025660
1144 Ga0081540_1073518
1145 Ga0070717_10015481
1146 Ga0070717_10064315
1147 Ga0070717_10083763
1148 Ga0070717_10173225
1149 Ga0070717_10702232
1150 Ga0070717_10893284
1151 Ga0070717_11525256
1152 Ga0075365_10336474
1153 Ga0075364_10056535
1154 Ga0075364_10076268
1155 Ga0075364_10165487
1156 Ga0075432_10002081
1157 Ga0070715_10000804
1158 Ga0070715_10026658
1159 Ga0070716_100001564
1160 Ga0070716_100033017
1161 Ga0070716_100846515
1162 Ga0070716_101567659
1163 Ga0070712_100016804
1164 Ga0070712_100092879
1165 Ga0070712_100178712
1166 Ga0070712_100373333
1167 Ga0070712_100383775
1168 Ga0070712_100404855
1169 Ga0070712_100744820
1170 Ga0070712_100826192
1171 Ga0097621_100999889
1172 Ga0097621_101283954
1173 Ga0068871_100744676
1174 Ga0075428_100060924
1175 Ga0075430_100023972
1176 Ga0075431_100726193
1177 Ga0075433_10022357
1178 Ga0075433_10323489
1179 Ga0075433_10332983
1180 Ga0075433_11538861
1181 Ga0075434_100529904
1182 Ga0075434_100567574
1183 Ga0075434_100634759
1184 Ga0075434_101288477
1185 Ga0075429_100121549
1186 Ga0075429_100171637
1187 Ga0097620_101816523
1188 Ga0075435_100954863
1189 Ga0105251_10162270
1190 Ga0105240_10080020
1191 Ga0105240_10115984
1192 Ga0105240_10341446
1193 Ga0111539_10012361
1194 Ga0111539_10878690
1195 Ga0105245_10010834
1196 Ga0105245_10072081
1197 Ga0105245_10072772
1198 Ga0105245_10171030
1199 Ga0105245_10541552
1200 Ga0105245_11092065
1201 Ga0105245_11619371
1202 Ga0105247_10243341
1203 Ga0105247_10764542
1204 Ga0105247_11611717
1205 Ga0114129_10012279
1206 Ga0105243_10047086
1207 Ga0105241_10756674
1208 Ga0105241_12108453
1209 Ga0105242_10330216
1210 Ga0105248_10090057
1211 Ga0105248_10524673
1212 Ga0105237_10085590
1213 Ga0105237_10163848
1214 Ga0105238_11222086
1215 Ga0105249_10058633
1216 Ga0105239_10117623
1217 Ga0105239_10324948
1218 Ga0105239_10542001
1219 Ga0105239_11027185
1220 Ga0105246_10061389
1221 Ga0105246_10194063
1222 Ga0105246_10674620
1223 Ga0157337_1001970
1224 Ga0157345_1004708
1225 Ga0157338_1083782
1226 Ga0157373_10160091
1227 Ga0157371_10123923
1228 Ga0157371_10155000
1229 Ga0157370_10003288
1230 Ga0157370_10019501
1231 Ga0157370_10030905
1232 Ga0157370_10104682
1233 Ga0157370_10957836
1234 Ga0157370_11269960
1235 Ga0157369_10001003
1236 Ga0157369_10037234
1237 Ga0157369_10235657
1238 Ga0157369_11322061
1239 Ga0157369_12022822
1240 Ga0157374_10041234
1241 Ga0157374_10063540
1242 Ga0157374_10100741
1243 Ga0157374_10482043
1244 Ga0157374_10521786
1245 Ga0157374_11573131
1246 Ga0157374_12011758
1247 Ga0157378_10304071
1248 Ga0163162_10094964
1249 Ga0163162_12463949
1250 Ga0157372_10059549
1251 Ga0157372_10099027
1252 Ga0157372_10142077
1253 Ga0157372_10241533
1254 Ga0157372_10290217
1255 Ga0157372_10927414
1256 Ga0157372_11618537
1257 Ga0157375_10078085
1258 Ga0157375_12899469
1259 Ga0163163_10480874
1260 Ga0182008_10088788
1261 Ga0182008_10335926
1262 Ga0157377_10024981
1263 Ga0157379_10882244
1264 Ga0157376_10005638
1265 Ga0157376_10078509
1266 Ga0182007_10386320
1267 Ga0197907_11302405
1268 Ga0206356_11288287
1269 Ga0206354_10189649
1270 Ga0206354_11042467
1271 Ga0206353_10249593
1272 Ga0206353_10287330
1273 Ga0206353_10846162
1274 Ga0213873_10147018
1275 Ga0213871_10033542
1276 Ga0224712_10041711
1277 Ga0224712_10118831
1278 Ga0207692_10012838
1279 Ga0207692_10041406
1280 Ga0207692_11062515
1281 Ga0207688_10006115
1282 Ga0207685_10181639
1283 Ga0207699_10118982
1284 Ga0207699_10142354
1285 Ga0207643_10028234
1286 Ga0207705_10038495
1287 Ga0207684_10426738
1288 Ga0207654_10879797
1289 Ga0207707_10012789
1290 Ga0207707_10135027
1291 Ga0207707_10166503
1292 Ga0207707_10233233
1293 Ga0207707_10315569
1294 Ga0207707_10322492
1295 Ga0207707_10373305
1296 Ga0207695_10126218
1297 Ga0207695_11177285
1298 Ga0207671_10072414
1299 Ga0207693_10001250
1300 Ga0207693_10004134
1301 Ga0207693_10194985
1302 Ga0207693_10268992
1303 Ga0207693_10279318
1304 Ga0207693_10403284
1305 Ga0207663_10008967
1306 Ga0207663_10161175
1307 Ga0207663_10167249
1308 Ga0207663_10329727
1309 Ga0207660_10017111
1310 Ga0207660_10050421
1311 Ga0207660_10185956
1312 Ga0207660_10460299
1313 Ga0207660_11655254
1314 Ga0207657_10000184
1315 Ga0207657_10000683
1316 Ga0207657_10006110
1317 Ga0207657_10152363
1318 Ga0207657_10340037
1319 Ga0207649_10015676
1320 Ga0207649_10876424
1321 Ga0207652_10053119
1322 Ga0207652_10808601
1323 Ga0207646_10001908
1324 Ga0207646_10321857
1325 Ga0207646_10548342
1326 Ga0207694_11630105
1327 Ga0207659_10140453
1328 Ga0207687_10029370
1329 Ga0207687_10228865
1330 Ga0207687_10589850
1331 Ga0207687_10736013
1332 Ga0207700_10004525
1333 Ga0207700_10062354
1334 Ga0207700_10066737
1335 Ga0207700_10143629
1336 Ga0207700_10300222
1337 Ga0207700_11045744
1338 Ga0207664_10015331
1339 Ga0207664_10083855
1340 Ga0207664_10097280
1341 Ga0207664_10151111
1342 Ga0207664_10346787
1343 Ga0207664_10765041
1344 Ga0207644_11279576
1345 Ga0207690_10023249
1346 Ga0207690_10106143
1347 Ga0207690_10269685
1348 Ga0207690_10679419
1349 Ga0207706_10202208
1350 Ga0207686_10283488
1351 Ga0207709_11339277
1352 Ga0207669_10784452
1353 Ga0207665_10000620
1354 Ga0207665_10523521
1355 Ga0207665_10699903
1356 Ga0207691_10810845
1357 Ga0207711_10251301
1358 Ga0207711_11356029
1359 Ga0207689_10468641
1360 Ga0207661_10001205
1361 Ga0207661_10037224
1362 Ga0207661_10066652
1363 Ga0207661_10128752
1364 Ga0207661_10171014
1365 Ga0207661_10407436
1366 Ga0207661_10899324
1367 Ga0207679_10151806
1368 Ga0207679_10712132
1369 Ga0207667_10024085
1370 Ga0207667_10244424
1371 Ga0207667_10608660
1372 Ga0207667_11289104
1373 Ga0207651_10353084
1374 Ga0207677_10421955
1375 Ga0207677_11016801
1376 Ga0207677_11349274
1377 Ga0207677_12161181
1378 Ga0207639_10526226
1379 Ga0207639_11241489
1380 Ga0207678_10250853
1381 Ga0207708_10016428
1382 Ga0207708_11156817
1383 Ga0207702_10049373
1384 Ga0207702_10143391
1385 Ga0207702_10384910
1386 Ga0207702_10477538
1387 Ga0207702_10846275
1388 Ga0207702_11650765
1389 Ga0207702_11855730
1390 Ga0207641_11509838
1391 Ga0207674_10025286
1392 Ga0207674_10939236
1393 Ga0207675_100135417
1394 Ga0207683_10189263
1395 Ga0207698_10408913
1396 Ga0207698_10909242
1397 Ga0207428_10044987
1398 Ga0207428_10058468
1399 Ga0268264_10649579
1400 Ga0265337_1093193
1401 Ga0265326_10038666
1402 Ga0265326_10145041
1403 Ga0265319_1127463
1404 Ga0265334_10002535
1405 Ga0265334_10014738
1406 Ga0265318_10000296
1407 Ga0265322_10004483
1408 Ga0265322_10039015
1409 Ga0265336_10009086
1410 Ga0265336_10043787
1411 Ga0265338_10006228
1412 Ga0265338_10009103
1413 Ga0265338_10014335
1414 Ga0265338_10017902
1415 Ga0265338_10630500
1416 Ga0265338_10913177
1417 Ga0265324_10010734
1418 Ga0265324_10050110
1419 Ga0265324_10096190
1420 Ga0265330_10001988
1421 Ga0265330_10095104
1422 Ga0265332_10033692
1423 Ga0265332_10171184
1424 Ga0265328_10000451
1425 Ga0265328_10007616
1426 Ga0265320_10014605
1427 Ga0265325_10000309
1428 Ga0265325_10093910
1429 Ga0265329_10040426
1430 Ga0265329_10100504
1431 Ga0265340_10023790
1432 Ga0265340_10065712
1433 Ga0265340_10230136
1434 Ga0265339_10052368
1435 Ga0265339_10070399
1436 Ga0265331_10005204
1437 Ga0265331_10170706
1438 Ga0265327_10003767
1439 Ga0265327_10005428
1440 Ga0265327_10061828
1441 Ga0265327_10232442
1442 Ga0265316_10003341
1443 Ga0265316_10029734
1444 Ga0265316_10948189
1445 Ga0265313_10002173
1446 Ga0265313_10015004
1447 Ga0265313_10018343
1448 Ga0265313_10332627
1449 Ga0265314_10020854
1450 Ga0265314_10221951
1451 Ga0265342_10005698
1452 Ga0316583_10166797
1453 Ga0373926_0030362
1454 Ga0373926_0088051
1455 Ga0373944_0097381
1456 Ga0373951_0165470
1457 Ga0373923_0321792
1458 Ga0373945_0002914
1459 Ga0373956_0176228
1460 Ga0373956_0205402
1461 Ga0373957_0110240
1462 Ga0373943_0002185
1463 Ga0373943_0019338
1464 Ga0373955_0192196
1465 Ga0373955_0285359
1466 Ga0373955_0371248
1467 Ga0373924_0367934
1468 Ga0373935_0008309
1469 Ga0373927_0046367
1470 Ga0373927_0168659
1471 Ga0373933_0093576
1472 Ga0373933_0217245
1473 Ga0373933_0334655
1474 Ga0373947_0001831
1475 Ga0373947_0053904
1476 Ga0373937_0000308
1477 Ga0373937_0329769
1478 Ga0373937_0514372
1479 Ga0373937_1618595
1480 Ga0373925_0001399
1481 Ga0373925_0050755
1482 Ga0395899_0010575
1483 Ga0395899_0051456
1484 Ga0395900_0013234
1485 Ga0395900_0266899
1486 Ga0395900_0355050
1487 Ga0395900_0406093
1488 Ga0395900_1523480
1489 Ga0395898_0007979
1490 Ga0395898_0031288
1491 Ga0395898_0184687
1492 Ga0395898_0258314
1493 Ga0395898_0401477
1494 Ga0395898_0579135
1495 Ga0395898_0722702
1496 Ga0395898_1327919
1497 Ga0395898_1465149
1498 Ga0395905_0109123
1499 Ga0395905_0264488
1500 Ga0395905_0407358
1501 Ga0395905_0419329
1502 Ga0395905_0868975
1503 Ga0395905_0913409
1504 Ga0395905_1748416
1505 Ga0395901_0085806
1506 Ga0395901_0107058
1507 Ga0395901_0155796
1508 Ga0395901_0315428
1509 Ga0395901_0568987
1510 Ga0395901_0607445
1511 Ga0395901_0810343
1512 Ga0395901_2001383
1513 Ga0436360_0570305
1514 Ga0436360_0718691
1515 Ga0436362_0431750
1516 Ga0439453_0063814
1517 Ga0451804_0842484
1518 Ga0451855_1376915
1519 Ga0439448_0345572
1520 Ga0450902_083325
1521 Ga0439458_0028399
1522 Ga0439460_0087264
1523 Ga0466965_0476347
1524 Ga0466966_0049919
1525 Ga0466966_0323023
1526 Ga0466961_0005003
1527 Ga0466963_0000532
1528 Ga0466963_0001856
1529 Ga0466963_0007505
1530 Ga0466963_0007882
1531 Ga0466963_0059581
1532 Ga0466963_0065184
1533 Ga0466963_0090962
1534 Ga0466963_0271709
1535 Ga0466963_0351716
1536 Ga0466963_1111041
1537 Ga0466964_0027586
1538 Ga0466964_0056934
1539 Ga0466964_0200818
1540 Ga0466964_0224624
1541 Ga0466971_0245788
1542 Ga0466971_0714686
1543 Ga0466968_0010627
1544 Ga0466968_0055011
1545 Ga0466968_0453167
1546 Ga0466970_0535355
1547 Ga0466957_0007081
1548 Ga0466957_0311157
1549 Ga0466957_1217920
1550 Ga0466959_0011375
1551 Ga0466959_0021693
1552 Ga0451576_0115678
1553 Ga0451576_1693411
1554 Ga0466958_0015042
1555 Ga0466958_0112001
1556 Ga0466958_0972209
1557 Ga0466967_0006110
1558 Ga0466967_0009880
1559 Ga0466967_0015339
1560 Ga0466967_0016262
1561 Ga0466967_0020316
1562 Ga0466967_0044126
1563 Ga0466967_0055221
1564 Ga0466967_0064317
1565 Ga0466967_0083195
1566 Ga0466967_0120169
1567 Ga0466967_0163033
1568 Ga0466967_0192464
1569 Ga0466967_0375051
1570 Ga0466967_0463150
1571 Ga0466967_0673265
1572 Ga0466967_0850607
1573 Ga0466967_1146501
1574 Ga0466967_1163574
1575 Ga0466967_1407735
1576 Ga0466967_1579078
1577 Ga0466967_1908516
1578 Ga0466967_2488758
1579 Ga0495592_0000410
1580 Ga0495592_0008108
1581 Ga0495592_0072952
1582 Ga0495592_0124333
1583 Ga0495592_0169769
1584 Ga0495592_0215774
1585 Ga0495603_0282350
1586 Ga0495629_0026042
1587 Ga0495629_0084672
1588 Ga0495629_0154532
1589 Ga0495629_0200141
1590 Ga0495629_0233316
1591 Ga0495641_0005629
1592 Ga0495641_0009652
1593 Ga0495641_0039888
1594 Ga0495641_0154131
1595 Ga0495641_0382634
1596 Ga0495651_0000034
1597 Ga0495651_0054593
1598 Ga0495651_0056976
1599 Ga0495651_0216323
1600 Ga0495651_0265008
1601 Ga0495651_0308257
1602 Ga0495653_0001634
1603 Ga0495653_0007842
1604 Ga0495653_0150966
1605 Ga0495653_0161884
1606 Ga0495653_0296286
1607 Ga0495580_0018581
1608 Ga0495582_0008933
1609 Ga0495582_0352125
1610 Ga0495582_0483457
1611 Ga0495639_0009322
1612 Ga0495639_0269909
1613 Ga0495662_0005815
1614 Ga0495662_0137492
1615 Ga0495664_0003716
1616 Ga0495664_0024197
1617 Ga0495664_0058659
1618 Ga0495664_0170231
1619 Ga0495664_0950238
1620 Ga0495608_0001004
1621 Ga0495608_0027586
1622 Ga0495608_0035988
1623 Ga0495608_0306809
1624 Ga0495608_0664312
1625 Ga0495608_0777675
1626 Ga0495618_0008709
1627 Ga0495618_0047831
1628 Ga0495618_0182783
1629 Ga0495618_0186969
1630 Ga0495618_0198672
1631 Ga0495618_0716944
1632 Ga0495628_0000184
1633 Ga0495628_0116001
1634 Ga0495628_0176333
1635 Ga0495628_0327959
1636 Ga0495628_0558418
1637 Ga0495628_0782852
1638 Ga0495628_0933321
1639 Ga0495630_0006556
1640 Ga0495630_0022305
1641 Ga0495630_0177965
1642 Ga0495630_0235350
1643 Ga0495630_0396091
1644 Ga0495630_0696609
1645 Ga0495666_0001186
1646 Ga0495652_0000319
1647 Ga0495652_0018630
1648 Ga0495652_0058072
1649 Ga0495652_0156930
1650 Ga0495652_0219334
1651 Ga0495652_0242948
1652 Ga0495652_0465620
1653 Ga0495652_0774125
1654 Ga0495665_0003752
1655 Ga0495640_0010802
1656 Ga0495640_0016364
1657 Ga0495640_0038013
1658 Ga0495640_0124729
1659 Ga0495640_0320714
1660 Ga0495586_0052035
1661 Ga0495586_0078082
1662 Ga0495586_0466650
1663 Ga0495587_0000055
1664 Ga0495587_0072248
1665 Ga0495587_0137127
1666 Ga0495587_0838608
1667 Ga0495645_0000170
1668 Ga0495645_0075458
1669 Ga0495645_0262930
1670 Ga0495645_0503907
1671 Ga0495667_0021039
1672 Ga0495667_0039955
1673 Ga0495667_0043555
1674 Ga0495667_0085805
1675 Ga0495667_0161893
1676 Ga0495667_0172395
1677 Ga0495667_0268327
1678 Ga0495667_0424684
1679 Ga0495667_0583267
1680 Ga0495634_0008630
1681 Ga0495634_0037619
1682 Ga0495634_0075314
1683 Ga0495634_0522557
1684 Ga0495634_0716118
1685 Ga0495635_0011475
1686 Ga0495635_0031624
1687 Ga0495635_0051587
1688 Ga0495635_0059979
1689 Ga0495635_0161873
1690 Ga0495635_0600135
1691 Ga0495657_0025578
1692 Ga0495657_0069002
1693 Ga0495657_0179041
1694 Ga0495657_0225993
1695 Ga0495657_0240447
1696 Ga0495657_0816910
1697 Ga0495599_0001220
1698 Ga0495599_0061558
1699 Ga0495599_0156685
1700 Ga0495599_0540301
1701 Ga0495599_0613858
1702 Ga0495599_0626045
1703 Ga0495623_0000149
1704 Ga0495623_0041042
1705 Ga0495623_0205186
1706 Ga0495623_0259635
1707 Ga0495646_0010301
1708 Ga0495646_0079788
1709 Ga0495646_0097428
1710 Ga0495647_0001212
1711 Ga0495647_0463397
1712 Ga0495658_0004111
1713 Ga0495658_0047705
1714 Ga0495658_0069176
1715 Ga0495658_0152406
1716 Ga0495658_0380134
1717 Ga0495613_0005204
1718 Ga0495613_0011084
1719 Ga0495613_0052186
1720 Ga0495613_0070496
1721 Ga0495624_0016643
1722 Ga0495624_0026752
1723 Ga0495624_0544670
1724 Ga0495600_0149841
1725 Ga0495600_0263300
1726 Ga0495581_0005286
1727 Ga0495604_0000194
1728 Ga0495604_0038396
1729 Ga0495604_0040857
1730 Ga0495604_0610286
1731 Ga0495604_0694084
1732 Ga0495674_0009278
1733 Ga0495674_0023647
1734 Ga0495674_0025046
1735 Ga0495674_0092528
1736 Ga0495674_0214047
1737 Ga0495674_0341898
1738 Ga0495674_0360492
1739 Ga0495674_0511381
1740 Ga0495674_0520153
1741 Ga0495676_0066273
1742 Ga0495676_0068155
1743 Ga0495676_0087620
1744 Ga0495676_0400227
1745 Ga0495680_0017928
1746 Ga0495680_0028662
1747 Ga0495680_0034084
1748 Ga0495680_0036955
1749 Ga0495675_0000029
1750 Ga0495675_0202192
1751 Ga0495675_0263542
1752 Ga0495684_0008421
1753 Ga0495684_0019490
1754 Ga0495684_0028439
1755 Ga0495684_0052586
1756 Ga0495684_0073849
1757 Ga0495684_0142758
1758 Ga0495684_0183360
1759 Ga0495593_0000750
1760 Ga0495602_0000741
1761 Ga0495602_0061366
1762 Ga0495602_0087920
1763 Ga0495602_0201833
1764 Ga0495602_0283851
1765 Ga0495602_0392215
1766 Ga0495602_0681216
1767 Ga0495602_0705525
1768 Ga0495602_0729267
1769 Ga0495602_1145511
1770 Ga0495614_0000802
1771 Ga0495614_0136064
1772 Ga0496100_0002026
1773 Ga0496100_0022421
1774 Ga0496100_0050060
1775 Ga0496100_0120248
1776 Ga0496100_0293833
1777 Ga0496100_0730144
1778 Ga0496101_0007253
1779 Ga0496101_0028953
1780 Ga0496101_0109681
1781 Ga0496101_0117841
1782 Ga0496101_0244499
1783 Ga0496101_0378708
1784 Ga0496102_0015239
1785 Ga0496102_0016614
1786 Ga0496102_0092770
1787 Ga0496102_0891220
1788 Ga0496102_0894044
1789 Ga0496102_0927624
1790 Ga0496102_1360852
1791 Ga0496102_1568203
1792 Ga0496103_0370884
1793 Ga0496104_0003169
1794 Ga0496104_0007841
1795 Ga0496104_0035240
1796 Ga0496104_0051552
1797 Ga0496104_0167467
1798 Ga0496104_0299279
1799 Ga0496104_0395651
1800 Ga0496104_0593860
1801 Ga0496105_0013301
1802 Ga0496105_0018312
1803 Ga0496105_0024704
1804 Ga0496105_0048496
1805 Ga0496105_0063378
1806 Ga0496105_0096726
1807 Ga0496105_0116215
1808 Ga0496105_0289262
1809 Ga0496105_0699396
1810 Ga0496106_0001209
1811 Ga0496106_0003352
1812 Ga0496106_0286909
1813 Ga0496106_0619780
1814 Ga0496107_0022234
1815 Ga0496107_0051508
1816 Ga0496107_0064351
1817 Ga0496107_0208732
1818 Ga0496107_0514774
1819 Ga0496108_0002815
1820 Ga0496108_0022442
1821 Ga0496108_0029182
1822 Ga0496108_0050860
1823 Ga0496108_0184595
1824 Ga0496109_0001232
1825 Ga0496109_0005020
1826 Ga0496109_0005573
1827 Ga0496109_0063635
1828 Ga0496109_0071841
1829 Ga0496109_0156883
1830 Ga0496109_0227494
1831 Ga0496109_0482366
1832 Ga0496110_0033218
1833 Ga0496110_0046222
1834 Ga0496110_0050897
1835 Ga0496110_0078503
1836 Ga0496110_0167232
1837 Ga0496110_0491924
1838 Ga0496110_0566893
1839 Ga0496111_0008451
1840 Ga0496111_0015430
1841 Ga0496111_0079336
1842 Ga0496111_0125221
1843 Ga0496111_0292613
1844 Ga0496111_0320454
1845 Ga0496112_0022139
1846 Ga0496112_0051586
1847 Ga0496112_0182050
1848 Ga0496112_0624744
1849 Ga0496113_0060094
1850 Ga0496113_0091870
1851 Ga0496113_0148427
1852 Ga0496113_1030291
1853 Ga0496113_1290757
1854 Ga0496113_1449382
1855 Ga0496114_0010264
1856 Ga0496114_0023553
1857 Ga0496114_0029079
1858 Ga0496114_0119004
1859 Ga0496114_0203360
1860 Ga0496114_0354258
1861 Ga0496114_0417050
1862 Ga0496114_0832881
1863 Ga0496114_0866352
1864 Ga0496114_1202701
1865 Ga0496114_1722616
1866 Ga0496115_0008936
1867 Ga0496115_0011555
1868 Ga0496115_0053205
1869 Ga0496115_0066404
1870 Ga0496115_0079634
1871 Ga0496115_0095989
1872 Ga0496115_0163098
1873 Ga0496115_0274182
1874 Ga0496115_0313295
1875 Ga0501031_0004850
1876 Ga0501031_0031722
1877 Ga0501032_0034116
1878 Ga0501034_0339198
1879 Ga0501034_0387538
1880 Ga0501036_0012418
1881 Ga0501036_0014731
1882 Ga0501037_0085622
1883 Ga0501037_0122880
1884 Ga0501038_0011136
1885 Ga0501038_0215237
1886 Ga0501038_0234032
1887 Ga0501039_0043081
1888 Ga0501040_0063391
1889 Ga0501041_0003188
1890 Ga0501042_0002606
1891 Ga0501042_0075677
1892 Ga0501043_0518683
1893 Ga0501046_0001782
1894 Ga0501046_0107626
1895 Ga0501046_0310012
1896 Ga0501047_0664340
1897 Ga0501048_0007986
1898 Ga0501048_0077979
1899 Ga0501067_0194403
1900 Ga0501067_0459853
1901 Ga0501067_0649277
1902 Ga0501068_0005297
1903 Ga0501068_0017559
1904 Ga0501068_0333144
1905 Ga0501069_0004693
1906 Ga0501069_0087395
1907 Ga0501070_0001614
1908 Ga0501070_0295283
1909 Ga0501070_0738315
1910 Ga0501071_0004871
1911 Ga0501071_0106467
1912 Ga0501072_0006639
1913 Ga0501072_0084433
1914 Ga0501072_0572807
1915 Ga0501073_0001427
1916 Ga0501074_0003559
1917 Ga0501074_0013802
1918 Ga0501074_0248729
1919 Ga0501075_0001342
1920 Ga0501075_0100514
1921 Ga0501075_0298350
1922 Ga0501076_0007652
1923 Ga0501076_0288524
1924 Ga0501077_0001984
1925 Ga0501079_0060374
1926 Ga0501080_0046811
1927 Ga0501080_0084203
1928 Ga0501080_0290170
1929 Ga0501081_0082497
1930 Ga0501083_0005829
1931 Ga0501083_0010453
1932 Ga0501035_0099819
1933 Ga0501044_0127243
1934 Ga0501044_0270353
1935 Ga0501045_0005139
1936 Ga0501045_0048481
1937 nmdc:mga03683_529018_c1
1938 nmdc:mga00v17_55325_c1
1939 nmdc:mga0yw44_29577_c1
1940 nmdc:mga0yw44_926255_c1
1941 nmdc:mga05p37_1850308_c1
1942 nmdc:mga05p37_31165_c1
1943 nmdc:mga09592_28989_c1
1944 nmdc:mga09592_370014_c1
1945 nmdc:mga0qj67_569574_c1
1946 nmdc:mga06r32_100701_c1
1947 nmdc:mga06r32_392953_c1
1948 nmdc:mga06r32_633346_c1
1949 nmdc:mga08y16_258745_c1
1950 nmdc:mga08y16_405054_c1
1951 nmdc:mga0n895_1057330_c1
1952 nmdc:mga0n895_489355_c1
1953 nmdc:mga0n895_576472_c1
1954 nmdc:mga0n895_845287_c1
1955 nmdc:mga0n895_938204_c1
1956 nmdc:mga0rr50_251531_c1
1957 nmdc:mga0rr50_450202_c1
1958 nmdc:mga0a205_1204193_c1
1959 nmdc:mga0a205_34242_c1
1960 Ga0495601_0000082
1961 Ga0495601_0011446
1962 Ga0495601_0019054
1963 Ga0495601_0026834
1964 Ga0495601_0109045
1965 Ga0495601_0121088
1966 Ga0495601_0192854
1967 Ga0495601_0213185
1968 Ga0495601_0352464
1969 Ga0495601_0418064
1970 Ga0495601_0814920
1971 Ga0495601_0904344
1972 Ga0495612_0001482
1973 Ga0495612_0008514
1974 Ga0495612_0081436
1975 Ga0495612_0133194
1976 Ga0495612_0303397
1977 Ga0495595_0014003
1978 Ga0495595_0053143
1979 Ga0495595_0209416
1980 Ga0495619_0006116
1981 Ga0495619_0026063
1982 Ga0495619_0029797
1983 Ga0495619_0035136
1984 Ga0495619_0288090
1985 Ga0495619_0634575
1986 Ga0495619_0730243
1987 Ga0495619_0900692
1988 Ga0495619_1072916
1989 Ga0500566_0036553
1990 Ga0500657_180165
1991 Ga0501084_0052695
1992 Ga0501082_0090387
1993 Ga0501082_0119035
1994 Ga0466962_0242558
1995 Ga0466962_0558579
1996 Ga0530510_0025581
1997 Ga0530510_0080608
1998 Ga0530510_0215800

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13411

MerR_1

MerR HTH family regulatory protein

6

53

0.98

PF03459

TOBE

TOBE domain

58

121

0.97

PF00376

MerR

MerR family regulatory protein

7

43

0.95

PF12728

HTH_17

Helix-turn-helix domain

6

53

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fr3-assembly1.cif.gz_A the high resolution structure of a molybdate binding protein from sporomusa ovata 0.8698 58 118
2zhh-assembly1.cif.gz_A-2 crystal structure of soxr 0.8671 5 49
4j2n-assembly1.cif.gz_A crystal structure of mycobacteriophage pukovnik xis 0.8652 3 51
1h9r-assembly1.cif.gz_A tungstate bound complex dimop domain of mode from e.coli 0.8537 58 118
1gus-assembly1.cif.gz_B mopii from clostridium pasteurianum (apo1) 0.8499 59 122
ID Description Score Start End Superfamily
af_P9WKT7_24_74_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8987 7 55 1.10.10.10
af_P09833_289_351_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8917 57 118 2.40.50.100
1h9sA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8913 61 116 2.40.50.100
af_I6YE30_32_77_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.885 6 49 1.10.10.10
af_P9WLC3_19_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8842 7 55 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A662MDL9-F1-model_v4 IS607 family transposase 0.9541 4 55 GO:0003677
GO:0006355
AF-A0A3T1DWJ4-F1-model_v4 deleted 0.9408 64 118
AF-A0A1Y0RVN6-F1-model_v4 Transporter 0.9395 64 118 GO:0015689
AF-C0B219-F1-model_v4 deleted 0.9359 66 118
AF-A0A3D4GMC3-F1-model_v4 deleted 0.9269 64 118

Map