F487771

General Info

Members Datasets Scaffolds Average Seq Length
996 283 1992 73

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_12473134|Ga0105248_124731341
Length 86
Sequence MIRIIEQTTPPEPSMIVCVCNNISDREIRQAIDLGLTSMADLYKELGVGTCCGKCVSYAREVMHEHLDSKTTVTELRRTPHGGLAA

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
61 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
64 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
92 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
93 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
94 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
95 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
96 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
97 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
98 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
110 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
111 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
112 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
113 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
114 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
115 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
116 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
117 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
118 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
135 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
138 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
148 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
149 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
157 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
166 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
174 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
177 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
178 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
193 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
194 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
205 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
208 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
209 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
210 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
211 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
216 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
217 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
238 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
239 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
240 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
241 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
249 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
250 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
258 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
259 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
262 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
263 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
264 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
265 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
266 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
267 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.09
Metatranscriptomes 2.91
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.71
Nodule 0.1
Rhizoplane 5.42
Rhizosphere 88.76
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_12473134 3300009177 Bacteria 592
2 JGI25154J39366_1000670 3300002738 Bacteria 15956
3 JGI25159J45721_1001532 3300002987 Bacteria 9476
4 rootL2_10103899 3300003322 Bacteria 1629
5 Ga0055525_1000081 3300003759 Bacteria 161329
6 Ga0055526_1000230 3300003771 Bacteria 46917
7 Ga0055537_1002246 3300003773 Bacteria 6658
8 Ga0055524_1022761 3300003775 Bacteria 2037
9 Ga0055540_1085896 3300003792 Bacteria 598
10 Ga0055531_10030970 3300003794 Bacteria 1782
11 Ga0055543_1006879 3300004625 Bacteria 2695
12 Ga0065165_1000067 3300005262 Bacteria 170811
13 Ga0065165_1000557 3300005262 Bacteria 55476
14 Ga0065165_1071080 3300005262 Bacteria 925
15 Ga0065165_1078656 3300005262 Bacteria 860
16 Ga0070658_10654407 3300005327 Bacteria 911
17 Ga0070680_100130528 3300005336 Bacteria 2102
18 Ga0068868_101777527 3300005338 Bacteria 582
19 Ga0070660_100002678 3300005339 Bacteria 12237
20 Ga0070660_100037924 3300005339 Bacteria 3655
21 Ga0070660_100197004 3300005339 Bacteria 1633
22 Ga0070661_100024888 3300005344 Bacteria 4297
23 Ga0070661_100326985 3300005344 Bacteria 1198
24 Ga0070675_100780860 3300005354 Bacteria 873
25 Ga0070674_101764873 3300005356 Bacteria 560
26 Ga0070659_100049279 3300005366 Bacteria 3311
27 Ga0070659_100207689 3300005366 Bacteria 1613
28 Ga0070659_100938602 3300005366 Bacteria 757
29 Ga0070662_100136589 3300005457 Bacteria 1896
30 Ga0070662_100302664 3300005457 Bacteria 1299
31 Ga0068867_100277967 3300005459 Bacteria 1372
32 Ga0070679_100702778 3300005530 Bacteria 954
33 Ga0070684_101611066 3300005535 Bacteria 612
34 Ga0068853_101627186 3300005539 Bacteria 626
35 Ga0070693_100875937 3300005547 Bacteria 671
36 Ga0068855_100098692 3300005563 Bacteria 3364
37 Ga0070664_100053810 3300005564 Bacteria 3413
38 Ga0070664_100133849 3300005564 Bacteria 2178
39 Ga0070664_100298015 3300005564 Bacteria 1456
40 Ga0068857_100509089 3300005577 Bacteria 1130
41 Ga0068854_100697696 3300005578 Bacteria 876
42 Ga0068852_101560614 3300005616 Bacteria 683
43 Ga0068863_101542008 3300005841 Bacteria 673
44 Ga0070717_10211944 3300006028 Bacteria 1700
45 Ga0097621_100128970 3300006237 Bacteria 2151
46 Ga0075370_10062548 3300006353 Bacteria 2121
47 Ga0075370_11018165 3300006353 Bacteria 508
48 Ga0068871_100174241 3300006358 Bacteria 1846
49 Ga0068865_100068813 3300006881 Bacteria 2504
50 Ga0099826_10000003 3300006948 Bacteria 1067817
51 Ga0105244_10157532 3300009036 Bacteria 1086
52 Ga0105244_10333189 3300009036 Bacteria 700
53 Ga0105240_10705832 3300009093 Bacteria 1101
54 Ga0105240_11918637 3300009093 Bacteria 616
55 Ga0105240_12608007 3300009093 Bacteria 522
56 Ga0105245_10132626 3300009098 Bacteria 2338
57 Ga0105243_10007534 3300009148 Bacteria 8369
58 Ga0105241_10048117 3300009174 Bacteria 3244
59 Ga0105242_12434121 3300009176 Unclassified 571
60 Ga0105248_12598280 3300009177 Bacteria 577
61 Ga0105237_10381823 3300009545 Bacteria 1414
62 Ga0105238_10145680 3300009551 Bacteria 2345
63 Ga0105239_10678609 3300010375 Bacteria 1177
64 Ga0105239_12854368 3300010375 Bacteria 564
65 Ga0105246_10095690 3300011119 Bacteria 2150
66 Ga0157313_1015373 3300012503 Bacteria 718
67 Ga0157369_11761853 3300013105 Bacteria 629
68 Ga0157374_10119669 3300013296 Bacteria 2540
69 Ga0157378_10346035 3300013297 Bacteria 1451
70 Ga0157372_11034194 3300013307 Bacteria 951
71 Ga0157375_11616591 3300013308 Bacteria 766
72 Ga0182008_10000139 3300014497 Bacteria 55735
73 Ga0182008_10019020 3300014497 Bacteria 3551
74 Ga0182006_1000010 3300015261 Bacteria 413414
75 Ga0182006_1054510 3300015261 Bacteria 1530
76 Ga0182007_10000021 3300015262 Bacteria 193408
77 Ga0182007_10043573 3300015262 Bacteria 1491
78 Ga0182007_10055714 3300015262 Bacteria 1299
79 Ga0182005_1000009 3300015265 Bacteria 455334
80 Ga0163161_10060584 3300017792 Bacteria 2755
81 Ga0213872_10000631 3300021361 Bacteria 26652
82 Ga0213872_10040113 3300021361 Bacteria 2137
83 Ga0213872_10089450 3300021361 Bacteria 1378
84 Ga0213872_10094764 3300021361 Bacteria 1333
85 Ga0209563_100015 3300025230 Bacteria 879901
86 Ga0209437_130671 3300025233 Bacteria 547
87 Ga0209646_1000114 3300025246 Bacteria 152958
88 Ga0209677_109519 3300025253 Bacteria 1732
89 Ga0209148_1000413 3300025254 Bacteria 48939
90 Ga0209130_1000223 3300025284 Bacteria 74374
91 Ga0209564_1000006 3300025295 Bacteria 1100927
92 Ga0207426_1056332 3300025302 Bacteria 1148
93 Ga0207655_1093819 3300025728 Bacteria 1050
94 Ga0207655_1224041 3300025728 Bacteria 546
95 Ga0207647_10774210 3300025904 Bacteria 518
96 Ga0207705_10053088 3300025909 Bacteria 2919
97 Ga0207705_10182820 3300025909 Bacteria 1583
98 Ga0207705_10220572 3300025909 Bacteria 1440
99 Ga0207684_10749475 3300025910 Bacteria 828
100 Ga0207654_10079673 3300025911 Bacteria 1968
101 Ga0207657_10056935 3300025919 Bacteria 3371
102 Ga0207657_10847649 3300025919 Bacteria 705
103 Ga0207649_10156874 3300025920 Bacteria 1573
104 Ga0207652_10278993 3300025921 Bacteria 1507
105 Ga0207659_10719861 3300025926 Bacteria 855
106 Ga0207687_10887543 3300025927 Bacteria 763
107 Ga0207690_10016637 3300025932 Bacteria 4480
108 Ga0207690_10586051 3300025932 Bacteria 909
109 Ga0207690_10780919 3300025932 Bacteria 789
110 Ga0207706_10285732 3300025933 Bacteria 1438
111 Ga0207706_11092913 3300025933 Bacteria 667
112 Ga0207686_10239719 3300025934 Bacteria 1319
113 Ga0207704_10808736 3300025938 Bacteria 783
114 Ga0207679_10186908 3300025945 Bacteria 1719
115 Ga0207679_10213615 3300025945 Bacteria 1619
116 Ga0207667_10316869 3300025949 Bacteria 1593
117 Ga0207667_10371129 3300025949 Bacteria 1458
118 Ga0207658_11499474 3300025986 Bacteria 617
119 Ga0207639_10481805 3300026041 Bacteria 1131
120 Ga0207678_10104642 3300026067 Bacteria 2415
121 Ga0207702_10699159 3300026078 Bacteria 999
122 Ga0207702_10869980 3300026078 Bacteria 892
123 Ga0207674_10038432 3300026116 Bacteria 4966
124 Ga0207674_10135688 3300026116 Bacteria 2423
125 Ga0207698_10243948 3300026142 Bacteria 1639
126 Ga0316177_1093954 3300030731 Bacteria 4864
127 Ga0316177_1181207 3300030731 Bacteria 1039
128 Ga0316177_1198479 3300030731 Bacteria 1289
129 Ga0316176_1157183 3300030732 Bacteria 623
130 Ga0314311_1037978 3300030733 Bacteria 552
131 Ga0316178_1149861 3300030735 Bacteria 1242
132 Ga0316180_1108186 3300030736 Bacteria 3525
133 Ga0316183_1151597 3300030742 Bacteria 730
134 Ga0316181_1035950 3300030744 Bacteria 1348
135 Ga0316182_1210702 3300030745 Bacteria 945
136 Ga0316182_1215090 3300030745 Bacteria 981
137 Ga0316182_1316829 3300030745 Bacteria 928
138 Ga0316182_1425935 3300030745 Bacteria 636
139 Ga0307408_100750721 3300031548 Bacteria 881
140 Ga0307406_11861903 3300031901 Bacteria 536
141 Ga0307406_11887745 3300031901 Bacteria 532
142 Ga0307414_10085640 3300032004 Bacteria 2322
143 Ga0307411_10888988 3300032005 Bacteria 791
144 Ga0395899_0004849 3300037312 Bacteria 10477
145 Ga0395899_0034614 3300037312 Bacteria 3794
146 Ga0395899_0043951 3300037312 Bacteria 3329
147 Ga0395899_0158889 3300037312 Bacteria 1598
148 Ga0395899_0173002 3300037312 Bacteria 1519
149 Ga0395899_0542578 3300037312 Bacteria 749
150 Ga0395899_0601278 3300037312 Bacteria 700
151 Ga0395899_0869102 3300037312 Bacteria 552
152 Ga0395899_0908777 3300037312 Bacteria 536
153 Ga0395900_0000532 3300037418 Bacteria 53751
154 Ga0395900_0030801 3300037418 Bacteria 5509
155 Ga0395900_0066428 3300037418 Bacteria 3705
156 Ga0395900_0185201 3300037418 Bacteria 2113
157 Ga0395900_0372910 3300037418 Bacteria 1396
158 Ga0395900_0400222 3300037418 Bacteria 1337
159 Ga0395900_0418299 3300037418 Bacteria 1301
160 Ga0395900_1157780 3300037418 Bacteria 689
161 Ga0395900_1524864 3300037418 Bacteria 580
162 Ga0395900_1677174 3300037418 Bacteria 546
163 Ga0395898_0036108 3300037466 Bacteria 4909
164 Ga0395898_0080917 3300037466 Bacteria 3132
165 Ga0395898_0187300 3300037466 Bacteria 1977
166 Ga0395898_0422945 3300037466 Bacteria 1269
167 Ga0395898_0546268 3300037466 Bacteria 1100
168 Ga0395898_0546651 3300037466 Bacteria 1100
169 Ga0395898_0653997 3300037466 Bacteria 993
170 Ga0395898_0670284 3300037466 Bacteria 979
171 Ga0395898_1018450 3300037466 Bacteria 763
172 Ga0395898_1213125 3300037466 Bacteria 685
173 Ga0395905_0040026 3300037471 Bacteria 4397
174 Ga0395905_0105375 3300037471 Bacteria 2647
175 Ga0395905_0149502 3300037471 Bacteria 2197
176 Ga0395905_0158974 3300037471 Bacteria 2124
177 Ga0395905_0250477 3300037471 Bacteria 1654
178 Ga0395905_0268362 3300037471 Bacteria 1592
179 Ga0395905_1121319 3300037471 Bacteria 690
180 Ga0395905_1871796 3300037471 Bacteria 506
181 Ga0395905_1888248 3300037471 Bacteria 503
182 Ga0395901_0000765 3300038443 Bacteria 36025
183 Ga0395901_0009241 3300038443 Bacteria 9990
184 Ga0395901_0020645 3300038443 Bacteria 6740
185 Ga0395901_0155762 3300038443 Bacteria 2400
186 Ga0395901_0212222 3300038443 Bacteria 2026
187 Ga0395901_0323745 3300038443 Bacteria 1594
188 Ga0395901_0373063 3300038443 Bacteria 1469
189 Ga0395901_0430149 3300038443 Bacteria 1352
190 Ga0395901_1044422 3300038443 Bacteria 790
191 Ga0395901_1192588 3300038443 Bacteria 727
192 Ga0395901_1864630 3300038443 Bacteria 549
193 Ga0436361_0026947 3300039447 Bacteria 1380
194 Ga0436361_0364508 3300039447 Bacteria 13099
195 Ga0436361_0480035 3300039447 Bacteria 16007
196 Ga0436361_0525833 3300039447 Bacteria 13362
197 Ga0439453_0132070 3300041408 Bacteria 581
198 Ga0439433_0155683 3300041999 Bacteria 590
199 Ga0439442_061264 3300042002 Bacteria 798
200 Ga0439448_0032882 3300042005 Bacteria 1652
201 Ga0439448_0066760 3300042005 Bacteria 1194
202 Ga0439449_0011417 3300042007 Bacteria 3343
203 Ga0439450_033309 3300042008 Bacteria 1168
204 Ga0439450_056493 3300042008 Bacteria 942
205 Ga0439455_0007800 3300042012 Bacteria 2277
206 Ga0439455_0029378 3300042012 Bacteria 1358
207 Ga0450911_015539 3300042115 Bacteria 1007
208 Ga0450904_000273 3300042139 Bacteria 11158
209 Ga0439458_0016928 3300042157 Bacteria 1660
210 Ga0439458_0024670 3300042157 Bacteria 1407
211 Ga0466969_0019637 3300044656 Bacteria 3510
212 Ga0466969_0112450 3300044656 Bacteria 1273
213 Ga0466969_0469260 3300044656 Bacteria 573
214 Ga0466972_0042771 3300044658 Bacteria 2201
215 Ga0466972_0043057 3300044658 Bacteria 2193
216 Ga0466972_0067582 3300044658 Bacteria 1707
217 Ga0466965_0014877 3300044683 Bacteria 3688
218 Ga0466965_0015290 3300044683 Bacteria 3645
219 Ga0466965_0018107 3300044683 Bacteria 3372
220 Ga0466965_0087902 3300044683 Bacteria 1577
221 Ga0466966_0128693 3300044684 Bacteria 1551
222 Ga0466961_0045669 3300044693 Bacteria 2802
223 Ga0466961_0114585 3300044693 Bacteria 1694
224 Ga0466961_0634889 3300044693 Bacteria 641
225 Ga0466963_0410003 3300044694 Bacteria 956
226 Ga0466964_0001539 3300044706 Bacteria 7935
227 Ga0466964_0043165 3300044706 Bacteria 1828
228 Ga0466964_0288039 3300044706 Bacteria 823
229 Ga0466971_0162201 3300044719 Bacteria 1046
230 Ga0466971_0263913 3300044719 Bacteria 822
231 Ga0466971_0296000 3300044719 Bacteria 776
232 Ga0466971_0369581 3300044719 Bacteria 696
233 Ga0466968_0000926 3300044735 Bacteria 10332
234 Ga0466968_0074261 3300044735 Bacteria 1484
235 Ga0466970_0173759 3300044765 Bacteria 1194
236 Ga0466970_0406328 3300044765 Bacteria 777
237 Ga0466957_0027060 3300044842 Bacteria 3406
238 Ga0466957_0032135 3300044842 Bacteria 3141
239 Ga0466957_0086991 3300044842 Bacteria 1953
240 Ga0466957_0180543 3300044842 Bacteria 1378
241 Ga0466957_0914744 3300044842 Bacteria 627
242 Ga0466960_0294118 3300044901 Bacteria 913
243 Ga0466959_0007759 3300045049 Bacteria 7548
244 Ga0466959_0050262 3300045049 Bacteria 3061
245 Ga0466959_0053562 3300045049 Bacteria 2949
246 Ga0466959_0126403 3300045049 Bacteria 1814
247 Ga0466958_0079662 3300045836 Bacteria 2014
248 Ga0466958_0088891 3300045836 Bacteria 1909
249 Ga0466958_0201244 3300045836 Bacteria 1267
250 Ga0466958_0554829 3300045836 Bacteria 746
251 Ga0466967_0006502 3300045976 Bacteria 8280
252 Ga0466967_0032371 3300045976 Bacteria 4414
253 Ga0466967_0073003 3300045976 Bacteria 3077
254 Ga0495617_000043 3300046452 Bacteria 121136
255 Ga0495617_001071 3300046452 Bacteria 12465
256 Ga0495617_009397 3300046452 Bacteria 3357
257 Ga0495617_024277 3300046452 Bacteria 2046
258 Ga0495617_051608 3300046452 Bacteria 1367
259 Ga0495617_239981 3300046452 Bacteria 560
260 Ga0495627_000247 3300046453 Bacteria 56624
261 Ga0495627_008129 3300046453 Bacteria 3952
262 Ga0495627_038526 3300046453 Bacteria 1477
263 Ga0495627_159839 3300046453 Bacteria 627
264 Ga0495603_0017688 3300046455 Bacteria 4314
265 Ga0495603_0157400 3300046455 Bacteria 1318
266 Ga0495590_0000049 3300046457 Bacteria 113002
267 Ga0495590_0005451 3300046457 Bacteria 5046
268 Ga0495590_0055219 3300046457 Bacteria 1388
269 Ga0495590_0124301 3300046457 Bacteria 925
270 Ga0495590_0171652 3300046457 Bacteria 791
271 Ga0495591_010480 3300046458 Bacteria 3591
272 Ga0495591_028765 3300046458 Bacteria 1696
273 Ga0495591_102543 3300046458 Bacteria 708
274 Ga0495629_0014104 3300046459 Bacteria 5757
275 Ga0495629_0219969 3300046459 Bacteria 1310
276 Ga0495629_0485070 3300046459 Bacteria 835
277 Ga0495629_1086774 3300046459 Bacteria 517
278 Ga0495638_0010816 3300046460 Bacteria 6310
279 Ga0495638_0090429 3300046460 Bacteria 1845
280 Ga0495638_0131883 3300046460 Bacteria 1467
281 Ga0495638_0168882 3300046460 Bacteria 1256
282 Ga0495638_0230433 3300046460 Bacteria 1031
283 Ga0495653_0072921 3300046463 Bacteria 2563
284 Ga0495653_0158980 3300046463 Bacteria 1570
285 Ga0495650_0000712 3300046471 Bacteria 42514
286 Ga0495650_0006967 3300046471 Bacteria 6910
287 Ga0495580_0184082 3300046472 Bacteria 1442
288 Ga0495582_0030535 3300046473 Bacteria 2958
289 Ga0495582_0189328 3300046473 Bacteria 1174
290 Ga0495605_0000005 3300046474 Bacteria 376973
291 Ga0495605_0000307 3300046474 Bacteria 52199
292 Ga0495605_0000369 3300046474 Bacteria 42654
293 Ga0495605_0011689 3300046474 Bacteria 4885
294 Ga0495605_0023305 3300046474 Bacteria 3258
295 Ga0495605_0064086 3300046474 Bacteria 1752
296 Ga0495605_0080493 3300046474 Bacteria 1524
297 Ga0495605_0081088 3300046474 Bacteria 1517
298 Ga0495605_0119836 3300046474 Bacteria 1193
299 Ga0495605_0148907 3300046474 Bacteria 1045
300 Ga0495605_0155623 3300046474 Bacteria 1017
301 Ga0495605_0444720 3300046474 Bacteria 534
302 Ga0495639_0045734 3300046475 Bacteria 1981
303 Ga0495662_0202742 3300046476 Bacteria 978
304 Ga0495584_0000189 3300046491 Bacteria 43548
305 Ga0495584_0000381 3300046491 Bacteria 30594
306 Ga0495584_0001010 3300046491 Bacteria 17589
307 Ga0495584_0004702 3300046491 Bacteria 7311
308 Ga0495584_0006729 3300046491 Bacteria 6012
309 Ga0495584_0007292 3300046491 Bacteria 5769
310 Ga0495584_0010624 3300046491 Bacteria 4729
311 Ga0495584_0028409 3300046491 Bacteria 2834
312 Ga0495584_0029554 3300046491 Bacteria 2778
313 Ga0495584_0029963 3300046491 Bacteria 2757
314 Ga0495584_0037345 3300046491 Bacteria 2454
315 Ga0495584_0042591 3300046491 Bacteria 2291
316 Ga0495584_0054695 3300046491 Bacteria 2008
317 Ga0495584_0064368 3300046491 Bacteria 1843
318 Ga0495584_0283117 3300046491 Bacteria 842
319 Ga0495584_0442060 3300046491 Bacteria 661
320 Ga0495585_0002729 3300046492 Bacteria 12326
321 Ga0495585_0002966 3300046492 Bacteria 11715
322 Ga0495585_0002967 3300046492 Bacteria 11711
323 Ga0495585_0013180 3300046492 Bacteria 4844
324 Ga0495585_0014484 3300046492 Bacteria 4593
325 Ga0495585_0016080 3300046492 Bacteria 4337
326 Ga0495585_0026008 3300046492 Bacteria 3346
327 Ga0495585_0044194 3300046492 Bacteria 2489
328 Ga0495585_0049365 3300046492 Bacteria 2336
329 Ga0495585_0058941 3300046492 Bacteria 2117
330 Ga0495585_0060694 3300046492 Bacteria 2080
331 Ga0495585_0069116 3300046492 Bacteria 1928
332 Ga0495585_0069781 3300046492 Bacteria 1917
333 Ga0495585_0082095 3300046492 Bacteria 1745
334 Ga0495585_0109751 3300046492 Bacteria 1468
335 Ga0495585_0115701 3300046492 Bacteria 1422
336 Ga0495585_0119865 3300046492 Bacteria 1392
337 Ga0495585_0133857 3300046492 Bacteria 1302
338 Ga0495585_0161285 3300046492 Bacteria 1163
339 Ga0495585_0162341 3300046492 Bacteria 1158
340 Ga0495585_0199799 3300046492 Bacteria 1019
341 Ga0495594_0003033 3300046499 Bacteria 8706
342 Ga0495594_0005448 3300046499 Bacteria 6541
343 Ga0495594_0030723 3300046499 Bacteria 2909
344 Ga0495594_0094886 3300046499 Bacteria 1674
345 Ga0495594_0187952 3300046499 Bacteria 1176
346 Ga0495596_0001586 3300046500 Bacteria 12975
347 Ga0495596_0003904 3300046500 Bacteria 7389
348 Ga0495596_0008294 3300046500 Bacteria 4629
349 Ga0495596_0033173 3300046500 Bacteria 2054
350 Ga0495596_0039326 3300046500 Bacteria 1868
351 Ga0495596_0042244 3300046500 Bacteria 1796
352 Ga0495596_0061797 3300046500 Bacteria 1458
353 Ga0495596_0071555 3300046500 Bacteria 1346
354 Ga0495596_0094808 3300046500 Bacteria 1158
355 Ga0495596_0227910 3300046500 Bacteria 723
356 Ga0495607_0002398 3300046501 Bacteria 15284
357 Ga0495607_0002581 3300046501 Bacteria 14614
358 Ga0495607_0003606 3300046501 Bacteria 11763
359 Ga0495607_0003921 3300046501 Bacteria 11213
360 Ga0495607_0006947 3300046501 Bacteria 7887
361 Ga0495607_0008891 3300046501 Bacteria 6841
362 Ga0495607_0033283 3300046501 Bacteria 3137
363 Ga0495607_0050978 3300046501 Bacteria 2406
364 Ga0495607_0119637 3300046501 Bacteria 1384
365 Ga0495607_0253241 3300046501 Bacteria 846
366 Ga0495607_0279554 3300046501 Bacteria 792
367 Ga0495607_0287526 3300046501 Bacteria 778
368 Ga0495607_0332690 3300046501 Bacteria 705
369 Ga0495607_0485610 3300046501 Bacteria 550
370 Ga0495583_0000264 3300046506 Bacteria 86123
371 Ga0495583_0000268 3300046506 Bacteria 85709
372 Ga0495583_0001992 3300046506 Bacteria 18715
373 Ga0495583_0002656 3300046506 Bacteria 14888
374 Ga0495583_0002775 3300046506 Bacteria 14435
375 Ga0495583_0006408 3300046506 Bacteria 7700
376 Ga0495583_0007531 3300046506 Bacteria 6812
377 Ga0495583_0013012 3300046506 Bacteria 4670
378 Ga0495583_0014634 3300046506 Bacteria 4316
379 Ga0495583_0028526 3300046506 Bacteria 2742
380 Ga0495583_0030850 3300046506 Bacteria 2605
381 Ga0495583_0053516 3300046506 Bacteria 1831
382 Ga0495583_0106699 3300046506 Bacteria 1190
383 Ga0495583_0164305 3300046506 Bacteria 914
384 Ga0495583_0236810 3300046506 Bacteria 734
385 Ga0495606_0001344 3300046507 Bacteria 33466
386 Ga0495606_0002788 3300046507 Bacteria 19515
387 Ga0495606_0021485 3300046507 Bacteria 4727
388 Ga0495606_0023123 3300046507 Bacteria 4513
389 Ga0495606_0041922 3300046507 Bacteria 3066
390 Ga0495606_0056915 3300046507 Bacteria 2520
391 Ga0495606_0083690 3300046507 Bacteria 1977
392 Ga0495606_0121870 3300046507 Bacteria 1560
393 Ga0495606_0125002 3300046507 Bacteria 1535
394 Ga0495606_0168908 3300046507 Bacteria 1270
395 Ga0495606_0364156 3300046507 Bacteria 763
396 Ga0495606_0377303 3300046507 Bacteria 745
397 Ga0495610_0000442 3300046512 Bacteria 42791
398 Ga0495610_0018215 3300046512 Bacteria 3974
399 Ga0495610_0160194 3300046512 Bacteria 952
400 Ga0495610_0319523 3300046512 Bacteria 593
401 Ga0495616_0000155 3300046513 Bacteria 59750
402 Ga0495616_0003502 3300046513 Bacteria 10040
403 Ga0495616_0005558 3300046513 Bacteria 7737
404 Ga0495616_0006493 3300046513 Bacteria 7072
405 Ga0495616_0012092 3300046513 Bacteria 4913
406 Ga0495616_0013934 3300046513 Bacteria 4517
407 Ga0495616_0017378 3300046513 Bacteria 3968
408 Ga0495616_0017852 3300046513 Bacteria 3908
409 Ga0495616_0032791 3300046513 Bacteria 2711
410 Ga0495616_0047018 3300046513 Bacteria 2175
411 Ga0495616_0047793 3300046513 Bacteria 2153
412 Ga0495616_0058720 3300046513 Bacteria 1893
413 Ga0495616_0064010 3300046513 Bacteria 1795
414 Ga0495616_0078093 3300046513 Bacteria 1588
415 Ga0495616_0159256 3300046513 Bacteria 1016
416 Ga0495616_0162811 3300046513 Bacteria 1002
417 Ga0495616_0212734 3300046513 Bacteria 845
418 Ga0495616_0310614 3300046513 Bacteria 664
419 Ga0495620_0009009 3300046515 Bacteria 5329
420 Ga0495620_0185955 3300046515 Bacteria 802
421 Ga0495630_0237102 3300046517 Bacteria 1394
422 Ga0495631_0001564 3300046518 Bacteria 13745
423 Ga0495631_0003970 3300046518 Bacteria 7984
424 Ga0495631_0005601 3300046518 Bacteria 6562
425 Ga0495631_0006371 3300046518 Bacteria 6099
426 Ga0495631_0010210 3300046518 Bacteria 4656
427 Ga0495631_0014678 3300046518 Bacteria 3774
428 Ga0495631_0017046 3300046518 Bacteria 3444
429 Ga0495631_0034411 3300046518 Bacteria 2271
430 Ga0495631_0040247 3300046518 Bacteria 2071
431 Ga0495631_0051121 3300046518 Bacteria 1806
432 Ga0495631_0053313 3300046518 Bacteria 1765
433 Ga0495631_0054982 3300046518 Bacteria 1734
434 Ga0495631_0067631 3300046518 Bacteria 1545
435 Ga0495631_0093272 3300046518 Bacteria 1296
436 Ga0495631_0117710 3300046518 Bacteria 1142
437 Ga0495631_0199501 3300046518 Bacteria 855
438 Ga0495631_0470594 3300046518 Bacteria 535
439 Ga0495632_0000946 3300046519 Bacteria 25368
440 Ga0495632_0001552 3300046519 Bacteria 18957
441 Ga0495632_0001767 3300046519 Bacteria 17490
442 Ga0495632_0002020 3300046519 Bacteria 15994
443 Ga0495632_0011623 3300046519 Bacteria 5127
444 Ga0495632_0014069 3300046519 Bacteria 4541
445 Ga0495632_0016352 3300046519 Bacteria 4130
446 Ga0495632_0062317 3300046519 Bacteria 1808
447 Ga0495632_0079215 3300046519 Bacteria 1568
448 Ga0495632_0300295 3300046519 Bacteria 712
449 Ga0495637_0000014 3300046520 Bacteria 228956
450 Ga0495637_0010148 3300046520 Bacteria 4567
451 Ga0495637_0020087 3300046520 Bacteria 3077
452 Ga0495637_0042967 3300046520 Bacteria 1931
453 Ga0495637_0296286 3300046520 Bacteria 575
454 Ga0495643_0000079 3300046522 Bacteria 162735
455 Ga0495643_0000983 3300046522 Bacteria 29263
456 Ga0495643_0001644 3300046522 Bacteria 19722
457 Ga0495643_0008318 3300046522 Bacteria 6581
458 Ga0495643_0028868 3300046522 Bacteria 3106
459 Ga0495643_0042374 3300046522 Bacteria 2480
460 Ga0495643_0173775 3300046522 Bacteria 1051
461 Ga0495643_0347806 3300046522 Bacteria 664
462 Ga0495643_0378633 3300046522 Bacteria 628
463 Ga0495644_0009149 3300046523 Bacteria 3816
464 Ga0495644_0017153 3300046523 Bacteria 2769
465 Ga0495644_0029032 3300046523 Bacteria 2091
466 Ga0495644_0032688 3300046523 Bacteria 1966
467 Ga0495644_0033555 3300046523 Bacteria 1938
468 Ga0495644_0038429 3300046523 Bacteria 1805
469 Ga0495644_0039930 3300046523 Bacteria 1769
470 Ga0495644_0048988 3300046523 Bacteria 1586
471 Ga0495644_0078073 3300046523 Bacteria 1247
472 Ga0495644_0078781 3300046523 Bacteria 1241
473 Ga0495644_0086730 3300046523 Bacteria 1180
474 Ga0495644_0229824 3300046523 Bacteria 718
475 Ga0495644_0263590 3300046523 Bacteria 670
476 Ga0495648_0000117 3300046524 Bacteria 97341
477 Ga0495648_0002578 3300046524 Bacteria 16619
478 Ga0495648_0014773 3300046524 Bacteria 5691
479 Ga0495648_0029226 3300046524 Bacteria 3661
480 Ga0495648_0031415 3300046524 Bacteria 3496
481 Ga0495648_0038675 3300046524 Bacteria 3047
482 Ga0495648_0052537 3300046524 Bacteria 2474
483 Ga0495648_0053280 3300046524 Bacteria 2451
484 Ga0495648_0056796 3300046524 Bacteria 2352
485 Ga0495648_0285641 3300046524 Bacteria 780
486 Ga0495663_0008073 3300046525 Bacteria 2912
487 Ga0495663_0242935 3300046525 Bacteria 637
488 Ga0495666_0004728 3300046526 Bacteria 6886
489 Ga0495666_0032133 3300046526 Bacteria 2570
490 Ga0495666_0079358 3300046526 Bacteria 1554
491 Ga0495642_0000152 3300046528 Bacteria 40332
492 Ga0495642_0000298 3300046528 Bacteria 27999
493 Ga0495642_0004112 3300046528 Bacteria 5676
494 Ga0495642_0005232 3300046528 Bacteria 4988
495 Ga0495642_0005678 3300046528 Bacteria 4788
496 Ga0495642_0008277 3300046528 Bacteria 3978
497 Ga0495642_0013667 3300046528 Bacteria 3143
498 Ga0495642_0017204 3300046528 Bacteria 2823
499 Ga0495642_0024026 3300046528 Bacteria 2409
500 Ga0495642_0024632 3300046528 Bacteria 2381
501 Ga0495642_0057479 3300046528 Bacteria 1608
502 Ga0495642_0063887 3300046528 Bacteria 1531
503 Ga0495642_0129619 3300046528 Bacteria 1085
504 Ga0495642_0166344 3300046528 Bacteria 957
505 Ga0495642_0184000 3300046528 Bacteria 909
506 Ga0495642_0225603 3300046528 Bacteria 818
507 Ga0495654_0012094 3300046530 Bacteria 4645
508 Ga0495654_0014969 3300046530 Bacteria 4122
509 Ga0495654_0019223 3300046530 Bacteria 3574
510 Ga0495654_0070936 3300046530 Bacteria 1651
511 Ga0495654_0111161 3300046530 Bacteria 1250
512 Ga0495654_0153174 3300046530 Bacteria 1018
513 Ga0495654_0173002 3300046530 Bacteria 940
514 Ga0495654_0399047 3300046530 Bacteria 546
515 Ga0495654_0444142 3300046530 Bacteria 511
516 Ga0495665_0110378 3300046531 Bacteria 1442
517 Ga0495665_0134824 3300046531 Bacteria 1292
518 Ga0495665_0185090 3300046531 Bacteria 1081
519 Ga0495665_0498466 3300046531 Bacteria 613
520 Ga0495640_0077092 3300046533 Bacteria 2223
521 Ga0495586_0004963 3300046535 Bacteria 7116
522 Ga0495586_0039299 3300046535 Bacteria 2543
523 Ga0495586_0068334 3300046535 Bacteria 1938
524 Ga0495586_0096343 3300046535 Bacteria 1638
525 Ga0495586_0923943 3300046535 Bacteria 503
526 Ga0495587_0030352 3300046536 Bacteria 3278
527 Ga0495587_0073957 3300046536 Bacteria 1979
528 Ga0495587_0239538 3300046536 Bacteria 1021
529 Ga0495609_0000028 3300046538 Bacteria 219908
530 Ga0495609_0001580 3300046538 Bacteria 14881
531 Ga0495609_0004136 3300046538 Bacteria 8064
532 Ga0495609_0023329 3300046538 Bacteria 2844
533 Ga0495609_0047620 3300046538 Bacteria 1918
534 Ga0495609_0070237 3300046538 Bacteria 1539
535 Ga0495609_0073998 3300046538 Bacteria 1494
536 Ga0495609_0094463 3300046538 Bacteria 1298
537 Ga0495609_0102485 3300046538 Bacteria 1239
538 Ga0495609_0153894 3300046538 Bacteria 977
539 Ga0495609_0235806 3300046538 Bacteria 756
540 Ga0495597_0001289 3300046542 Bacteria 18438
541 Ga0495597_0004948 3300046542 Bacteria 7162
542 Ga0495597_0006602 3300046542 Bacteria 5983
543 Ga0495597_0006753 3300046542 Bacteria 5907
544 Ga0495597_0009390 3300046542 Bacteria 4836
545 Ga0495597_0016069 3300046542 Bacteria 3538
546 Ga0495597_0016877 3300046542 Bacteria 3443
547 Ga0495597_0034651 3300046542 Bacteria 2281
548 Ga0495597_0056673 3300046542 Bacteria 1715
549 Ga0495597_0073618 3300046542 Bacteria 1468
550 Ga0495597_0078135 3300046542 Bacteria 1418
551 Ga0495597_0094352 3300046542 Bacteria 1267
552 Ga0495597_0113121 3300046542 Bacteria 1136
553 Ga0495597_0168357 3300046542 Bacteria 891
554 Ga0495597_0249382 3300046542 Bacteria 698
555 Ga0495645_0375222 3300046543 Bacteria 911
556 Ga0495622_0000129 3300046557 Bacteria 65178
557 Ga0495622_0038565 3300046557 Bacteria 2224
558 Ga0495622_0041520 3300046557 Bacteria 2139
559 Ga0495622_0098440 3300046557 Bacteria 1341
560 Ga0495633_0001828 3300046558 Bacteria 15632
561 Ga0495633_0002477 3300046558 Bacteria 13017
562 Ga0495633_0003852 3300046558 Bacteria 9806
563 Ga0495633_0006874 3300046558 Bacteria 6662
564 Ga0495633_0009269 3300046558 Bacteria 5452
565 Ga0495633_0011544 3300046558 Bacteria 4755
566 Ga0495633_0014477 3300046558 Bacteria 4123
567 Ga0495633_0015075 3300046558 Bacteria 4018
568 Ga0495633_0019197 3300046558 Bacteria 3458
569 Ga0495633_0019807 3300046558 Bacteria 3396
570 Ga0495633_0027462 3300046558 Bacteria 2782
571 Ga0495633_0172796 3300046558 Bacteria 996
572 Ga0495633_0191132 3300046558 Bacteria 941
573 Ga0495633_0244924 3300046558 Bacteria 818
574 Ga0495633_0274949 3300046558 Bacteria 767
575 Ga0495633_0359277 3300046558 Bacteria 659
576 Ga0495656_0036388 3300046615 Bacteria 2027
577 Ga0495656_0038818 3300046615 Bacteria 1974
578 Ga0495656_0070233 3300046615 Bacteria 1553
579 Ga0495656_0111450 3300046615 Bacteria 1280
580 Ga0495656_0124075 3300046615 Bacteria 1222
581 Ga0495656_0273909 3300046615 Bacteria 858
582 Ga0495656_0337412 3300046615 Bacteria 779
583 Ga0495656_0798923 3300046615 Bacteria 510
584 Ga0495668_0003037 3300046616 Bacteria 13064
585 Ga0495668_0004927 3300046616 Bacteria 9260
586 Ga0495668_0009985 3300046616 Bacteria 5781
587 Ga0495668_0011636 3300046616 Bacteria 5261
588 Ga0495668_0014305 3300046616 Bacteria 4656
589 Ga0495668_0022333 3300046616 Bacteria 3617
590 Ga0495668_0022766 3300046616 Bacteria 3580
591 Ga0495668_0024141 3300046616 Bacteria 3459
592 Ga0495668_0068838 3300046616 Bacteria 1946
593 Ga0495668_0083093 3300046616 Bacteria 1756
594 Ga0495668_0112299 3300046616 Bacteria 1490
595 Ga0495668_0140926 3300046616 Bacteria 1319
596 Ga0495668_0172030 3300046616 Bacteria 1186
597 Ga0495611_0000131 3300046648 Bacteria 52209
598 Ga0495611_0005435 3300046648 Bacteria 5447
599 Ga0495611_0015727 3300046648 Bacteria 3233
600 Ga0495611_0027550 3300046648 Bacteria 2484
601 Ga0495611_0045613 3300046648 Bacteria 1963
602 Ga0495611_0065320 3300046648 Bacteria 1658
603 Ga0495611_0112695 3300046648 Bacteria 1266
604 Ga0495611_0128829 3300046648 Bacteria 1180
605 Ga0495611_0133464 3300046648 Bacteria 1158
606 Ga0495611_0197718 3300046648 Bacteria 938
607 Ga0495611_0250306 3300046648 Bacteria 821
608 Ga0495625_0006244 3300046660 Bacteria 10672
609 Ga0495625_0026584 3300046660 Bacteria 4371
610 Ga0495625_0043330 3300046660 Bacteria 3264
611 Ga0495625_0069573 3300046660 Bacteria 2473
612 Ga0495625_0071783 3300046660 Bacteria 2429
613 Ga0495625_0155367 3300046660 Bacteria 1535
614 Ga0495625_0349823 3300046660 Bacteria 934
615 Ga0495625_0349895 3300046660 Bacteria 934
616 Ga0495625_0390430 3300046660 Bacteria 871
617 Ga0495625_0398439 3300046660 Bacteria 860
618 Ga0495635_0873241 3300046663 Bacteria 577
619 Ga0495659_0294119 3300046664 Bacteria 685
620 Ga0495659_0321532 3300046664 Bacteria 657
621 Ga0495661_0000157 3300046665 Bacteria 80637
622 Ga0495661_0001565 3300046665 Bacteria 18840
623 Ga0495661_0001646 3300046665 Bacteria 18210
624 Ga0495661_0012412 3300046665 Bacteria 5752
625 Ga0495661_0013674 3300046665 Bacteria 5448
626 Ga0495661_0020350 3300046665 Bacteria 4334
627 Ga0495661_0020967 3300046665 Bacteria 4263
628 Ga0495661_0026806 3300046665 Bacteria 3706
629 Ga0495661_0033074 3300046665 Bacteria 3263
630 Ga0495661_0040547 3300046665 Bacteria 2886
631 Ga0495661_0044499 3300046665 Bacteria 2720
632 Ga0495661_0052997 3300046665 Bacteria 2441
633 Ga0495661_0054123 3300046665 Bacteria 2411
634 Ga0495661_0055376 3300046665 Bacteria 2377
635 Ga0495661_0066865 3300046665 Bacteria 2113
636 Ga0495661_0072921 3300046665 Bacteria 2001
637 Ga0495661_0085415 3300046665 Bacteria 1808
638 Ga0495661_0094752 3300046665 Bacteria 1691
639 Ga0495661_0096569 3300046665 Bacteria 1670
640 Ga0495661_0121407 3300046665 Bacteria 1443
641 Ga0495661_0161292 3300046665 Bacteria 1203
642 Ga0495661_0165696 3300046665 Bacteria 1182
643 Ga0495661_0212805 3300046665 Bacteria 1005
644 Ga0495661_0250686 3300046665 Bacteria 904
645 Ga0495661_0286113 3300046665 Bacteria 829
646 Ga0495661_0527733 3300046665 Bacteria 560
647 Ga0495588_0000113 3300046674 Bacteria 137279
648 Ga0495588_0009087 3300046674 Bacteria 4580
649 Ga0495588_0014784 3300046674 Bacteria 3743
650 Ga0495588_0032606 3300046674 Bacteria 2626
651 Ga0495588_0058969 3300046674 Bacteria 1984
652 Ga0495588_0075627 3300046674 Bacteria 1754
653 Ga0495588_0123966 3300046674 Bacteria 1362
654 Ga0495588_0171498 3300046674 Bacteria 1147
655 Ga0495588_0186869 3300046674 Bacteria 1094
656 Ga0495588_0214786 3300046674 Bacteria 1015
657 Ga0495588_0235441 3300046674 Bacteria 966
658 Ga0495588_0255491 3300046674 Bacteria 923
659 Ga0495588_0428200 3300046674 Bacteria 694
660 Ga0495588_0665837 3300046674 Bacteria 544
661 Ga0495599_0455564 3300046678 Bacteria 757
662 Ga0495623_0043478 3300046679 Bacteria 2859
663 Ga0495623_0100948 3300046679 Bacteria 1758
664 Ga0495623_0109730 3300046679 Bacteria 1673
665 Ga0495646_0252129 3300046680 Bacteria 945
666 Ga0495669_0000218 3300046684 Bacteria 34510
667 Ga0495669_0000610 3300046684 Bacteria 15633
668 Ga0495669_0001479 3300046684 Bacteria 9687
669 Ga0495669_0013774 3300046684 Bacteria 3451
670 Ga0495669_0015377 3300046684 Bacteria 3277
671 Ga0495669_0032719 3300046684 Bacteria 2286
672 Ga0495669_0067264 3300046684 Bacteria 1628
673 Ga0495669_0083026 3300046684 Bacteria 1472
674 Ga0495669_0460603 3300046684 Bacteria 618
675 Ga0495613_0128655 3300046689 Bacteria 1814
676 Ga0495613_0511722 3300046689 Bacteria 807
677 Ga0495670_0000426 3300046691 Bacteria 20188
678 Ga0495670_0004836 3300046691 Bacteria 6613
679 Ga0495670_0005025 3300046691 Bacteria 6506
680 Ga0495670_0011083 3300046691 Bacteria 4433
681 Ga0495670_0014012 3300046691 Bacteria 3944
682 Ga0495670_0014508 3300046691 Bacteria 3872
683 Ga0495670_0018887 3300046691 Bacteria 3396
684 Ga0495670_0020336 3300046691 Bacteria 3272
685 Ga0495670_0027730 3300046691 Bacteria 2808
686 Ga0495670_0033824 3300046691 Bacteria 2544
687 Ga0495670_0094580 3300046691 Bacteria 1532
688 Ga0495670_0365571 3300046691 Bacteria 777
689 Ga0495670_0437087 3300046691 Bacteria 708
690 Ga0495671_0000358 3300046692 Bacteria 37933
691 Ga0495671_0008900 3300046692 Bacteria 5638
692 Ga0495671_0016277 3300046692 Bacteria 3973
693 Ga0495671_0018643 3300046692 Bacteria 3680
694 Ga0495671_0096387 3300046692 Bacteria 1447
695 Ga0495671_0119107 3300046692 Bacteria 1288
696 Ga0495671_0163778 3300046692 Bacteria 1081
697 Ga0495649_0000255 3300046694 Bacteria 47515
698 Ga0495649_0001872 3300046694 Bacteria 15397
699 Ga0495649_0022145 3300046694 Bacteria 3555
700 Ga0495649_0041618 3300046694 Bacteria 2512
701 Ga0495649_0044506 3300046694 Bacteria 2423
702 Ga0495649_0054416 3300046694 Bacteria 2164
703 Ga0495649_0099647 3300046694 Bacteria 1545
704 Ga0495649_0113971 3300046694 Bacteria 1432
705 Ga0495649_0135756 3300046694 Bacteria 1297
706 Ga0495649_0184448 3300046694 Bacteria 1087
707 Ga0495589_0000098 3300046794 Bacteria 83860
708 Ga0495589_0000117 3300046794 Bacteria 75549
709 Ga0495589_0001281 3300046794 Bacteria 14866
710 Ga0495589_0001522 3300046794 Bacteria 13335
711 Ga0495589_0011124 3300046794 Bacteria 4670
712 Ga0495589_0012107 3300046794 Bacteria 4473
713 Ga0495589_0017704 3300046794 Bacteria 3656
714 Ga0495589_0021858 3300046794 Bacteria 3268
715 Ga0495589_0064812 3300046794 Bacteria 1791
716 Ga0495589_0118464 3300046794 Bacteria 1275
717 Ga0495589_0144094 3300046794 Bacteria 1139
718 Ga0495589_0307105 3300046794 Bacteria 734
719 Ga0495589_0329866 3300046794 Bacteria 704
720 Ga0495589_0515914 3300046794 Bacteria 545
721 Ga0495600_0011562 3300046809 Bacteria 5504
722 Ga0495600_0194387 3300046809 Bacteria 1304
723 Ga0495660_0004572 3300046810 Bacteria 8355
724 Ga0495660_0008234 3300046810 Bacteria 6108
725 Ga0495660_0011157 3300046810 Bacteria 5218
726 Ga0495660_0020372 3300046810 Bacteria 3801
727 Ga0495660_0029108 3300046810 Bacteria 3118
728 Ga0495660_0037327 3300046810 Bacteria 2706
729 Ga0495660_0039018 3300046810 Bacteria 2638
730 Ga0495660_0041768 3300046810 Bacteria 2536
731 Ga0495660_0068479 3300046810 Bacteria 1888
732 Ga0495660_0101822 3300046810 Bacteria 1477
733 Ga0495660_0171376 3300046810 Bacteria 1057
734 Ga0495581_0035332 3300047315 Bacteria 2892
735 Ga0495581_0037032 3300047315 Bacteria 2822
736 Ga0495581_0238063 3300047315 Bacteria 1064
737 Ga0495604_0006846 3300047317 Bacteria 9031
738 Ga0495604_0104126 3300047317 Bacteria 2080
739 Ga0495604_0221152 3300047317 Bacteria 1303
740 Ga0495604_0331850 3300047317 Bacteria 1014
741 Ga0495604_0369989 3300047317 Bacteria 949
742 Ga0495636_0029858 3300047318 Bacteria 2226
743 Ga0495636_0338582 3300047318 Bacteria 709
744 Ga0495674_0001330 3300047319 Bacteria 24082
745 Ga0495672_0000014 3300047320 Bacteria 505636
746 Ga0495672_0000102 3300047320 Bacteria 137373
747 Ga0495672_0000423 3300047320 Bacteria 50688
748 Ga0495672_0002778 3300047320 Bacteria 15654
749 Ga0495672_0105527 3300047320 Bacteria 1520
750 Ga0495672_0119694 3300047320 Bacteria 1401
751 Ga0495672_0249388 3300047320 Bacteria 862
752 Ga0495672_0250640 3300047320 Bacteria 859
753 Ga0495672_0427237 3300047320 Bacteria 601
754 Ga0495676_0000034 3300047321 Bacteria 124977
755 Ga0495676_0050121 3300047321 Bacteria 3351
756 Ga0495676_0124730 3300047321 Bacteria 1868
757 Ga0495676_0331743 3300047321 Bacteria 1020
758 Ga0495680_0013628 3300047322 Bacteria 7082
759 Ga0495680_0215200 3300047322 Bacteria 1374
760 Ga0495680_0396937 3300047322 Bacteria 953
761 Ga0495683_0000275 3300047323 Bacteria 45085
762 Ga0495683_0001409 3300047323 Bacteria 15856
763 Ga0495683_0029791 3300047323 Bacteria 2788
764 Ga0495683_0036650 3300047323 Bacteria 2489
765 Ga0495683_0065165 3300047323 Bacteria 1798
766 Ga0495683_0070930 3300047323 Bacteria 1710
767 Ga0495683_0079804 3300047323 Bacteria 1597
768 Ga0495683_0088567 3300047323 Bacteria 1502
769 Ga0495683_0165346 3300047323 Bacteria 1020
770 Ga0495683_0169640 3300047323 Bacteria 1004
771 Ga0495683_0256594 3300047323 Bacteria 765
772 Ga0495687_000054 3300047443 Bacteria 194607
773 Ga0495687_000060 3300047443 Bacteria 179124
774 Ga0495687_000410 3300047443 Bacteria 53080
775 Ga0495687_001444 3300047443 Bacteria 21817
776 Ga0495687_002747 3300047443 Bacteria 13641
777 Ga0495687_005962 3300047443 Bacteria 7602
778 Ga0495687_156750 3300047443 Bacteria 771
779 Ga0495687_267729 3300047443 Bacteria 501
780 Ga0495675_0030447 3300047444 Bacteria 3443
781 Ga0495675_0591930 3300047444 Bacteria 629
782 Ga0495677_0000012 3300047445 Bacteria 146763
783 Ga0495677_0000859 3300047445 Bacteria 12291
784 Ga0495677_0002585 3300047445 Bacteria 7085
785 Ga0495677_0004679 3300047445 Bacteria 5218
786 Ga0495677_0005010 3300047445 Bacteria 5053
787 Ga0495677_0006469 3300047445 Bacteria 4428
788 Ga0495677_0007792 3300047445 Bacteria 3990
789 Ga0495677_0012634 3300047445 Bacteria 3077
790 Ga0495677_0041736 3300047445 Bacteria 1679
791 Ga0495677_0046639 3300047445 Bacteria 1590
792 Ga0495677_0048879 3300047445 Bacteria 1554
793 Ga0495677_0050428 3300047445 Bacteria 1531
794 Ga0495677_0074954 3300047445 Bacteria 1263
795 Ga0495677_0112917 3300047445 Bacteria 1033
796 Ga0495677_0240189 3300047445 Bacteria 707
797 Ga0495677_0357488 3300047445 Bacteria 576
798 Ga0495679_005625 3300047446 Bacteria 5528
799 Ga0495679_007572 3300047446 Bacteria 4512
800 Ga0495679_012477 3300047446 Bacteria 3232
801 Ga0495679_038474 3300047446 Bacteria 1498
802 Ga0495679_042792 3300047446 Bacteria 1395
803 Ga0495685_018405 3300047447 Bacteria 2397
804 Ga0495685_035909 3300047447 Bacteria 1702
805 Ga0495685_041677 3300047447 Bacteria 1568
806 Ga0495685_130701 3300047447 Bacteria 821
807 Ga0495685_234484 3300047447 Bacteria 584
808 Ga0495673_0000033 3300047469 Bacteria 354152
809 Ga0495673_0000034 3300047469 Bacteria 326920
810 Ga0495673_0204443 3300047469 Bacteria 737
811 Ga0495673_0223368 3300047469 Bacteria 696
812 Ga0495681_0002251 3300047470 Bacteria 13866
813 Ga0495681_0011061 3300047470 Bacteria 5409
814 Ga0495681_0012525 3300047470 Bacteria 4978
815 Ga0495681_0022450 3300047470 Bacteria 3375
816 Ga0495681_0045527 3300047470 Bacteria 2099
817 Ga0495681_0064791 3300047470 Bacteria 1672
818 Ga0495681_0065592 3300047470 Bacteria 1659
819 Ga0495681_0104984 3300047470 Bacteria 1230
820 Ga0495681_0157349 3300047470 Bacteria 948
821 Ga0495681_0214120 3300047470 Bacteria 775
822 Ga0495686_0000219 3300047472 Bacteria 105435
823 Ga0495686_0004323 3300047472 Bacteria 11742
824 Ga0495686_0018074 3300047472 Bacteria 4738
825 Ga0495686_0059219 3300047472 Bacteria 2385
826 Ga0495686_0125391 3300047472 Bacteria 1527
827 Ga0495686_0170863 3300047472 Bacteria 1264
828 Ga0495593_0004749 3300047673 Bacteria 8074
829 Ga0495593_0029350 3300047673 Bacteria 3015
830 Ga0495593_0041852 3300047673 Bacteria 2461
831 Ga0495593_0092920 3300047673 Bacteria 1553
832 Ga0495593_0142220 3300047673 Bacteria 1215
833 Ga0495602_0137879 3300048088 Bacteria 1935
834 Ga0495614_0001046 3300048089 Bacteria 11813
835 Ga0495614_0006118 3300048089 Bacteria 5411
836 Ga0495614_0084384 3300048089 Bacteria 1378
837 Ga0495614_0356484 3300048089 Bacteria 682
838 Ga0495615_0042496 3300048090 Bacteria 1140
839 Ga0495626_0000036 3300048091 Bacteria 180464
840 Ga0495626_0000044 3300048091 Bacteria 165533
841 Ga0495626_0000940 3300048091 Bacteria 25330
842 Ga0495626_0002024 3300048091 Bacteria 14888
843 Ga0495626_0002143 3300048091 Bacteria 14276
844 Ga0495626_0003100 3300048091 Bacteria 10887
845 Ga0495626_0005913 3300048091 Bacteria 7043
846 Ga0495626_0007360 3300048091 Bacteria 6131
847 Ga0495626_0011841 3300048091 Bacteria 4593
848 Ga0495626_0012685 3300048091 Bacteria 4408
849 Ga0495626_0018622 3300048091 Bacteria 3482
850 Ga0495626_0027796 3300048091 Bacteria 2747
851 Ga0495626_0036485 3300048091 Bacteria 2341
852 Ga0495626_0044451 3300048091 Bacteria 2078
853 Ga0495626_0051883 3300048091 Bacteria 1891
854 Ga0495626_0093527 3300048091 Bacteria 1319
855 Ga0495626_0251043 3300048091 Bacteria 709
856 Ga0495626_0272404 3300048091 Bacteria 674
857 Ga0495626_0434103 3300048091 Bacteria 505
858 Ga0496100_0019643 3300048903 Bacteria 4034
859 Ga0496100_0803768 3300048903 Bacteria 737
860 Ga0496101_0028499 3300048904 Bacteria 3898
861 Ga0496101_0935348 3300048904 Bacteria 682
862 Ga0496102_0000192 3300048905 Bacteria 83166
863 Ga0496102_0083043 3300048905 Bacteria 2955
864 Ga0496102_0104910 3300048905 Bacteria 2629
865 Ga0496102_0182348 3300048905 Bacteria 1978
866 Ga0496102_0395099 3300048905 Bacteria 1300
867 Ga0496102_0500237 3300048905 Bacteria 1137
868 Ga0496102_0561234 3300048905 Bacteria 1064
869 Ga0496102_0738547 3300048905 Bacteria 907
870 Ga0496102_0854954 3300048905 Bacteria 832
871 Ga0496102_0861117 3300048905 Bacteria 828
872 Ga0496103_0001678 3300048906 Bacteria 14484
873 Ga0496103_0019332 3300048906 Bacteria 4090
874 Ga0496103_0027421 3300048906 Bacteria 3452
875 Ga0496103_0057623 3300048906 Bacteria 2412
876 Ga0496103_0146609 3300048906 Bacteria 1511
877 Ga0496103_0457550 3300048906 Bacteria 818
878 Ga0496104_0061486 3300048907 Bacteria 3561
879 Ga0496104_0151474 3300048907 Bacteria 2226
880 Ga0496105_0160942 3300048908 Bacteria 1843
881 Ga0496105_0236962 3300048908 Bacteria 1482
882 Ga0496105_1033188 3300048908 Bacteria 613
883 Ga0496106_0003007 3300048909 Bacteria 12560
884 Ga0496106_0257690 3300048909 Bacteria 1395
885 Ga0496107_0004798 3300048910 Bacteria 9181
886 Ga0496107_0021763 3300048910 Bacteria 4531
887 Ga0496107_0038719 3300048910 Bacteria 3419
888 Ga0496107_0365684 3300048910 Bacteria 1073
889 Ga0496107_0620761 3300048910 Bacteria 798
890 Ga0496107_0920751 3300048910 Bacteria 637
891 Ga0496108_1698953 3300048911 Bacteria 520
892 Ga0496109_0302126 3300048912 Bacteria 1509
893 Ga0496109_0332845 3300048912 Bacteria 1434
894 Ga0496110_0000719 3300048913 Bacteria 22855
895 Ga0496110_0069742 3300048913 Bacteria 3114
896 Ga0496110_0249977 3300048913 Bacteria 1614
897 Ga0496110_0574067 3300048913 Bacteria 1024
898 Ga0496111_0200790 3300048914 Bacteria 1482
899 Ga0496111_0328805 3300048914 Bacteria 1132
900 Ga0496112_0398214 3300048915 Bacteria 1317
901 Ga0496112_0493788 3300048915 Bacteria 1160
902 Ga0496112_1279499 3300048915 Bacteria 649
903 Ga0496113_0003074 3300048916 Bacteria 9905
904 Ga0496113_0091181 3300048916 Bacteria 2349
905 Ga0496113_0194716 3300048916 Bacteria 1610
906 Ga0496114_1779192 3300048917 Bacteria 504
907 Ga0496115_0020797 3300048918 Bacteria 5064
908 Ga0496115_0029084 3300048918 Bacteria 4337
909 Ga0496115_0052586 3300048918 Bacteria 3268
910 Ga0496115_0215548 3300048918 Bacteria 1585
911 Ga0496115_0483084 3300048918 Bacteria 997
912 Ga0496116_0076406 3300048919 Bacteria 2098
913 Ga0496117_0000010 3300048920 Bacteria 611954
914 Ga0496118_0000009 3300048921 Bacteria 611954
915 Ga0496121_0007758 3300048924 Bacteria 12857
916 Ga0496121_0176350 3300048924 Bacteria 1547
917 Ga0496121_0397975 3300048924 Bacteria 903
918 Ga0496122_0000337 3300048925 Bacteria 101830
919 Ga0496122_0006555 3300048925 Bacteria 13310
920 Ga0496122_0008617 3300048925 Bacteria 10947
921 Ga0496122_0066798 3300048925 Bacteria 2595
922 Ga0496122_0593418 3300048925 Bacteria 519
923 Ga0496123_0000905 3300048926 Bacteria 46722
924 Ga0496123_0007410 3300048926 Bacteria 10346
925 Ga0496123_0007817 3300048926 Bacteria 9954
926 Ga0496124_0014308 3300048927 Bacteria 7678
927 Ga0496124_0049671 3300048927 Bacteria 3577
928 Ga0496124_0076299 3300048927 Bacteria 2767
929 Ga0496124_0084214 3300048927 Bacteria 2608
930 Ga0496124_0119507 3300048927 Bacteria 2108
931 Ga0496124_0123275 3300048927 Bacteria 2068
932 Ga0496124_0124825 3300048927 Bacteria 2052
933 Ga0496125_0000917 3300048928 Bacteria 46397
934 Ga0496125_0129558 3300048928 Bacteria 1779
935 Ga0496125_0200511 3300048928 Bacteria 1307
936 Ga0496125_0212034 3300048928 Bacteria 1257
937 Ga0496126_0082691 3300048929 Bacteria 2836
938 Ga0496126_0325294 3300048929 Bacteria 1263
939 Ga0501306_070554 3300049127 Bacteria 589
940 Ga0501306_081508 3300049127 Bacteria 559
941 Ga0501309_099010 3300049129 Bacteria 504
942 Ga0501310_059326 3300049130 Bacteria 568
943 Ga0501304_043476 3300049160 Bacteria 507
944 Ga0501305_118689 3300049161 Bacteria 506
945 Ga0495678_000174 3300049459 Bacteria 74631
946 Ga0495678_000175 3300049459 Bacteria 73523
947 Ga0495678_000466 3300049459 Bacteria 40200
948 Ga0495678_012905 3300049459 Bacteria 3940
949 Ga0495678_014968 3300049459 Bacteria 3587
950 Ga0495678_105709 3300049459 Bacteria 968
951 Ga0495678_152242 3300049459 Bacteria 746
952 Ga0495678_156409 3300049459 Bacteria 732
953 Ga0495682_0001432 3300049460 Bacteria 12899
954 Ga0495682_0001749 3300049460 Bacteria 11005
955 Ga0495682_0004560 3300049460 Bacteria 5903
956 Ga0495682_0060783 3300049460 Bacteria 1364
957 Ga0495682_0095937 3300049460 Bacteria 1064
958 Ga0495682_0108360 3300049460 Bacteria 995
959 Ga0495682_0177410 3300049460 Bacteria 757
960 Ga0501311_038720 3300049527 Bacteria 716
961 Ga0501312_113215 3300049528 Bacteria 519
962 Ga0501315_017760 3300049531 Bacteria 933
963 Ga0501315_072345 3300049531 Bacteria 574
964 Ga0501316_052492 3300049532 Bacteria 590
965 Ga0501323_024794 3300049539 Bacteria 813
966 Ga0501036_0599565 3300049572 Bacteria 914
967 Ga0501047_0451979 3300049581 Bacteria 1114
968 Ga0501222_017359 3300049662 Bacteria 954
969 Ga0501233_243548 3300049668 Bacteria 538
970 Ga0501282_033085 3300049778 Bacteria 597
971 Ga0501044_1499218 3300049823 Bacteria 539
972 nmdc:mga0k408_363709_c1 3300050493 Bacteria 862
973 nmdc:mga07m45_105819_c1 3300050496 Bacteria 1618
974 Ga0500562_165077 3300053108 Bacteria 602
975 Ga0500594_0242853 3300053118 Bacteria 598
976 Ga0500559_0116876 3300053136 Bacteria 1238
977 Ga0500586_003592 3300053145 Bacteria 3689
978 Ga0587084_072783 3300059477 Bacteria 652
979 Ga0587070_137630 3300059491 Bacteria 600
980 Ga0587083_0022198 3300059505 Bacteria 1186
981 Ga0587085_154515 3300059506 Bacteria 532
982 Ga0587088_018667 3300059508 Bacteria 1132
983 Ga0587089_026298 3300059509 Bacteria 835
984 Ga0587090_017830 3300059510 Eukaryota 1078
985 Ga0587106_120575 3300059605 Bacteria 556
986 Ga0587109_116023 3300059624 Bacteria 631
987 Ga0587062_062807 3300059639 Bacteria 656
988 Ga0587068_135478 3300059641 Bacteria 546
989 Ga0587076_184353 3300059645 Bacteria 527
990 Ga0587078_046229 3300059646 Bacteria 628
991 Ga0587078_059930 3300059646 Bacteria 575
992 Ga0587102_004697 3300059649 Bacteria 1178
993 Ga0587105_003398 3300059651 Bacteria 968
994 Ga0587108_022323 3300059653 Bacteria 608
995 Ga0466962_0029405 3300061719 Bacteria 2630
996 Ga0466962_0168978 3300061719 Bacteria 1064
997 Ga0105248_12473134
998 JGI25154J39366_1000670
999 JGI25159J45721_1001532
1000 rootL2_10103899
1001 Ga0055525_1000081
1002 Ga0055526_1000230
1003 Ga0055537_1002246
1004 Ga0055524_1022761
1005 Ga0055540_1085896
1006 Ga0055531_10030970
1007 Ga0055543_1006879
1008 Ga0065165_1000067
1009 Ga0065165_1000557
1010 Ga0065165_1071080
1011 Ga0065165_1078656
1012 Ga0070658_10654407
1013 Ga0070680_100130528
1014 Ga0068868_101777527
1015 Ga0070660_100002678
1016 Ga0070660_100037924
1017 Ga0070660_100197004
1018 Ga0070661_100024888
1019 Ga0070661_100326985
1020 Ga0070675_100780860
1021 Ga0070674_101764873
1022 Ga0070659_100049279
1023 Ga0070659_100207689
1024 Ga0070659_100938602
1025 Ga0070662_100136589
1026 Ga0070662_100302664
1027 Ga0068867_100277967
1028 Ga0070679_100702778
1029 Ga0070684_101611066
1030 Ga0068853_101627186
1031 Ga0070693_100875937
1032 Ga0068855_100098692
1033 Ga0070664_100053810
1034 Ga0070664_100133849
1035 Ga0070664_100298015
1036 Ga0068857_100509089
1037 Ga0068854_100697696
1038 Ga0068852_101560614
1039 Ga0068863_101542008
1040 Ga0070717_10211944
1041 Ga0097621_100128970
1042 Ga0075370_10062548
1043 Ga0075370_11018165
1044 Ga0068871_100174241
1045 Ga0068865_100068813
1046 Ga0099826_10000003
1047 Ga0105244_10157532
1048 Ga0105244_10333189
1049 Ga0105240_10705832
1050 Ga0105240_11918637
1051 Ga0105240_12608007
1052 Ga0105245_10132626
1053 Ga0105243_10007534
1054 Ga0105241_10048117
1055 Ga0105242_12434121
1056 Ga0105248_12598280
1057 Ga0105237_10381823
1058 Ga0105238_10145680
1059 Ga0105239_10678609
1060 Ga0105239_12854368
1061 Ga0105246_10095690
1062 Ga0157313_1015373
1063 Ga0157369_11761853
1064 Ga0157374_10119669
1065 Ga0157378_10346035
1066 Ga0157372_11034194
1067 Ga0157375_11616591
1068 Ga0182008_10000139
1069 Ga0182008_10019020
1070 Ga0182006_1000010
1071 Ga0182006_1054510
1072 Ga0182007_10000021
1073 Ga0182007_10043573
1074 Ga0182007_10055714
1075 Ga0182005_1000009
1076 Ga0163161_10060584
1077 Ga0213872_10000631
1078 Ga0213872_10040113
1079 Ga0213872_10089450
1080 Ga0213872_10094764
1081 Ga0209563_100015
1082 Ga0209437_130671
1083 Ga0209646_1000114
1084 Ga0209677_109519
1085 Ga0209148_1000413
1086 Ga0209130_1000223
1087 Ga0209564_1000006
1088 Ga0207426_1056332
1089 Ga0207655_1093819
1090 Ga0207655_1224041
1091 Ga0207647_10774210
1092 Ga0207705_10053088
1093 Ga0207705_10182820
1094 Ga0207705_10220572
1095 Ga0207684_10749475
1096 Ga0207654_10079673
1097 Ga0207657_10056935
1098 Ga0207657_10847649
1099 Ga0207649_10156874
1100 Ga0207652_10278993
1101 Ga0207659_10719861
1102 Ga0207687_10887543
1103 Ga0207690_10016637
1104 Ga0207690_10586051
1105 Ga0207690_10780919
1106 Ga0207706_10285732
1107 Ga0207706_11092913
1108 Ga0207686_10239719
1109 Ga0207704_10808736
1110 Ga0207679_10186908
1111 Ga0207679_10213615
1112 Ga0207667_10316869
1113 Ga0207667_10371129
1114 Ga0207658_11499474
1115 Ga0207639_10481805
1116 Ga0207678_10104642
1117 Ga0207702_10699159
1118 Ga0207702_10869980
1119 Ga0207674_10038432
1120 Ga0207674_10135688
1121 Ga0207698_10243948
1122 Ga0316177_1093954
1123 Ga0316177_1181207
1124 Ga0316177_1198479
1125 Ga0316176_1157183
1126 Ga0314311_1037978
1127 Ga0316178_1149861
1128 Ga0316180_1108186
1129 Ga0316183_1151597
1130 Ga0316181_1035950
1131 Ga0316182_1210702
1132 Ga0316182_1215090
1133 Ga0316182_1316829
1134 Ga0316182_1425935
1135 Ga0307408_100750721
1136 Ga0307406_11861903
1137 Ga0307406_11887745
1138 Ga0307414_10085640
1139 Ga0307411_10888988
1140 Ga0395899_0004849
1141 Ga0395899_0034614
1142 Ga0395899_0043951
1143 Ga0395899_0158889
1144 Ga0395899_0173002
1145 Ga0395899_0542578
1146 Ga0395899_0601278
1147 Ga0395899_0869102
1148 Ga0395899_0908777
1149 Ga0395900_0000532
1150 Ga0395900_0030801
1151 Ga0395900_0066428
1152 Ga0395900_0185201
1153 Ga0395900_0372910
1154 Ga0395900_0400222
1155 Ga0395900_0418299
1156 Ga0395900_1157780
1157 Ga0395900_1524864
1158 Ga0395900_1677174
1159 Ga0395898_0036108
1160 Ga0395898_0080917
1161 Ga0395898_0187300
1162 Ga0395898_0422945
1163 Ga0395898_0546268
1164 Ga0395898_0546651
1165 Ga0395898_0653997
1166 Ga0395898_0670284
1167 Ga0395898_1018450
1168 Ga0395898_1213125
1169 Ga0395905_0040026
1170 Ga0395905_0105375
1171 Ga0395905_0149502
1172 Ga0395905_0158974
1173 Ga0395905_0250477
1174 Ga0395905_0268362
1175 Ga0395905_1121319
1176 Ga0395905_1871796
1177 Ga0395905_1888248
1178 Ga0395901_0000765
1179 Ga0395901_0009241
1180 Ga0395901_0020645
1181 Ga0395901_0155762
1182 Ga0395901_0212222
1183 Ga0395901_0323745
1184 Ga0395901_0373063
1185 Ga0395901_0430149
1186 Ga0395901_1044422
1187 Ga0395901_1192588
1188 Ga0395901_1864630
1189 Ga0436361_0026947
1190 Ga0436361_0364508
1191 Ga0436361_0480035
1192 Ga0436361_0525833
1193 Ga0439453_0132070
1194 Ga0439433_0155683
1195 Ga0439442_061264
1196 Ga0439448_0032882
1197 Ga0439448_0066760
1198 Ga0439449_0011417
1199 Ga0439450_033309
1200 Ga0439450_056493
1201 Ga0439455_0007800
1202 Ga0439455_0029378
1203 Ga0450911_015539
1204 Ga0450904_000273
1205 Ga0439458_0016928
1206 Ga0439458_0024670
1207 Ga0466969_0019637
1208 Ga0466969_0112450
1209 Ga0466969_0469260
1210 Ga0466972_0042771
1211 Ga0466972_0043057
1212 Ga0466972_0067582
1213 Ga0466965_0014877
1214 Ga0466965_0015290
1215 Ga0466965_0018107
1216 Ga0466965_0087902
1217 Ga0466966_0128693
1218 Ga0466961_0045669
1219 Ga0466961_0114585
1220 Ga0466961_0634889
1221 Ga0466963_0410003
1222 Ga0466964_0001539
1223 Ga0466964_0043165
1224 Ga0466964_0288039
1225 Ga0466971_0162201
1226 Ga0466971_0263913
1227 Ga0466971_0296000
1228 Ga0466971_0369581
1229 Ga0466968_0000926
1230 Ga0466968_0074261
1231 Ga0466970_0173759
1232 Ga0466970_0406328
1233 Ga0466957_0027060
1234 Ga0466957_0032135
1235 Ga0466957_0086991
1236 Ga0466957_0180543
1237 Ga0466957_0914744
1238 Ga0466960_0294118
1239 Ga0466959_0007759
1240 Ga0466959_0050262
1241 Ga0466959_0053562
1242 Ga0466959_0126403
1243 Ga0466958_0079662
1244 Ga0466958_0088891
1245 Ga0466958_0201244
1246 Ga0466958_0554829
1247 Ga0466967_0006502
1248 Ga0466967_0032371
1249 Ga0466967_0073003
1250 Ga0495617_000043
1251 Ga0495617_001071
1252 Ga0495617_009397
1253 Ga0495617_024277
1254 Ga0495617_051608
1255 Ga0495617_239981
1256 Ga0495627_000247
1257 Ga0495627_008129
1258 Ga0495627_038526
1259 Ga0495627_159839
1260 Ga0495603_0017688
1261 Ga0495603_0157400
1262 Ga0495590_0000049
1263 Ga0495590_0005451
1264 Ga0495590_0055219
1265 Ga0495590_0124301
1266 Ga0495590_0171652
1267 Ga0495591_010480
1268 Ga0495591_028765
1269 Ga0495591_102543
1270 Ga0495629_0014104
1271 Ga0495629_0219969
1272 Ga0495629_0485070
1273 Ga0495629_1086774
1274 Ga0495638_0010816
1275 Ga0495638_0090429
1276 Ga0495638_0131883
1277 Ga0495638_0168882
1278 Ga0495638_0230433
1279 Ga0495653_0072921
1280 Ga0495653_0158980
1281 Ga0495650_0000712
1282 Ga0495650_0006967
1283 Ga0495580_0184082
1284 Ga0495582_0030535
1285 Ga0495582_0189328
1286 Ga0495605_0000005
1287 Ga0495605_0000307
1288 Ga0495605_0000369
1289 Ga0495605_0011689
1290 Ga0495605_0023305
1291 Ga0495605_0064086
1292 Ga0495605_0080493
1293 Ga0495605_0081088
1294 Ga0495605_0119836
1295 Ga0495605_0148907
1296 Ga0495605_0155623
1297 Ga0495605_0444720
1298 Ga0495639_0045734
1299 Ga0495662_0202742
1300 Ga0495584_0000189
1301 Ga0495584_0000381
1302 Ga0495584_0001010
1303 Ga0495584_0004702
1304 Ga0495584_0006729
1305 Ga0495584_0007292
1306 Ga0495584_0010624
1307 Ga0495584_0028409
1308 Ga0495584_0029554
1309 Ga0495584_0029963
1310 Ga0495584_0037345
1311 Ga0495584_0042591
1312 Ga0495584_0054695
1313 Ga0495584_0064368
1314 Ga0495584_0283117
1315 Ga0495584_0442060
1316 Ga0495585_0002729
1317 Ga0495585_0002966
1318 Ga0495585_0002967
1319 Ga0495585_0013180
1320 Ga0495585_0014484
1321 Ga0495585_0016080
1322 Ga0495585_0026008
1323 Ga0495585_0044194
1324 Ga0495585_0049365
1325 Ga0495585_0058941
1326 Ga0495585_0060694
1327 Ga0495585_0069116
1328 Ga0495585_0069781
1329 Ga0495585_0082095
1330 Ga0495585_0109751
1331 Ga0495585_0115701
1332 Ga0495585_0119865
1333 Ga0495585_0133857
1334 Ga0495585_0161285
1335 Ga0495585_0162341
1336 Ga0495585_0199799
1337 Ga0495594_0003033
1338 Ga0495594_0005448
1339 Ga0495594_0030723
1340 Ga0495594_0094886
1341 Ga0495594_0187952
1342 Ga0495596_0001586
1343 Ga0495596_0003904
1344 Ga0495596_0008294
1345 Ga0495596_0033173
1346 Ga0495596_0039326
1347 Ga0495596_0042244
1348 Ga0495596_0061797
1349 Ga0495596_0071555
1350 Ga0495596_0094808
1351 Ga0495596_0227910
1352 Ga0495607_0002398
1353 Ga0495607_0002581
1354 Ga0495607_0003606
1355 Ga0495607_0003921
1356 Ga0495607_0006947
1357 Ga0495607_0008891
1358 Ga0495607_0033283
1359 Ga0495607_0050978
1360 Ga0495607_0119637
1361 Ga0495607_0253241
1362 Ga0495607_0279554
1363 Ga0495607_0287526
1364 Ga0495607_0332690
1365 Ga0495607_0485610
1366 Ga0495583_0000264
1367 Ga0495583_0000268
1368 Ga0495583_0001992
1369 Ga0495583_0002656
1370 Ga0495583_0002775
1371 Ga0495583_0006408
1372 Ga0495583_0007531
1373 Ga0495583_0013012
1374 Ga0495583_0014634
1375 Ga0495583_0028526
1376 Ga0495583_0030850
1377 Ga0495583_0053516
1378 Ga0495583_0106699
1379 Ga0495583_0164305
1380 Ga0495583_0236810
1381 Ga0495606_0001344
1382 Ga0495606_0002788
1383 Ga0495606_0021485
1384 Ga0495606_0023123
1385 Ga0495606_0041922
1386 Ga0495606_0056915
1387 Ga0495606_0083690
1388 Ga0495606_0121870
1389 Ga0495606_0125002
1390 Ga0495606_0168908
1391 Ga0495606_0364156
1392 Ga0495606_0377303
1393 Ga0495610_0000442
1394 Ga0495610_0018215
1395 Ga0495610_0160194
1396 Ga0495610_0319523
1397 Ga0495616_0000155
1398 Ga0495616_0003502
1399 Ga0495616_0005558
1400 Ga0495616_0006493
1401 Ga0495616_0012092
1402 Ga0495616_0013934
1403 Ga0495616_0017378
1404 Ga0495616_0017852
1405 Ga0495616_0032791
1406 Ga0495616_0047018
1407 Ga0495616_0047793
1408 Ga0495616_0058720
1409 Ga0495616_0064010
1410 Ga0495616_0078093
1411 Ga0495616_0159256
1412 Ga0495616_0162811
1413 Ga0495616_0212734
1414 Ga0495616_0310614
1415 Ga0495620_0009009
1416 Ga0495620_0185955
1417 Ga0495630_0237102
1418 Ga0495631_0001564
1419 Ga0495631_0003970
1420 Ga0495631_0005601
1421 Ga0495631_0006371
1422 Ga0495631_0010210
1423 Ga0495631_0014678
1424 Ga0495631_0017046
1425 Ga0495631_0034411
1426 Ga0495631_0040247
1427 Ga0495631_0051121
1428 Ga0495631_0053313
1429 Ga0495631_0054982
1430 Ga0495631_0067631
1431 Ga0495631_0093272
1432 Ga0495631_0117710
1433 Ga0495631_0199501
1434 Ga0495631_0470594
1435 Ga0495632_0000946
1436 Ga0495632_0001552
1437 Ga0495632_0001767
1438 Ga0495632_0002020
1439 Ga0495632_0011623
1440 Ga0495632_0014069
1441 Ga0495632_0016352
1442 Ga0495632_0062317
1443 Ga0495632_0079215
1444 Ga0495632_0300295
1445 Ga0495637_0000014
1446 Ga0495637_0010148
1447 Ga0495637_0020087
1448 Ga0495637_0042967
1449 Ga0495637_0296286
1450 Ga0495643_0000079
1451 Ga0495643_0000983
1452 Ga0495643_0001644
1453 Ga0495643_0008318
1454 Ga0495643_0028868
1455 Ga0495643_0042374
1456 Ga0495643_0173775
1457 Ga0495643_0347806
1458 Ga0495643_0378633
1459 Ga0495644_0009149
1460 Ga0495644_0017153
1461 Ga0495644_0029032
1462 Ga0495644_0032688
1463 Ga0495644_0033555
1464 Ga0495644_0038429
1465 Ga0495644_0039930
1466 Ga0495644_0048988
1467 Ga0495644_0078073
1468 Ga0495644_0078781
1469 Ga0495644_0086730
1470 Ga0495644_0229824
1471 Ga0495644_0263590
1472 Ga0495648_0000117
1473 Ga0495648_0002578
1474 Ga0495648_0014773
1475 Ga0495648_0029226
1476 Ga0495648_0031415
1477 Ga0495648_0038675
1478 Ga0495648_0052537
1479 Ga0495648_0053280
1480 Ga0495648_0056796
1481 Ga0495648_0285641
1482 Ga0495663_0008073
1483 Ga0495663_0242935
1484 Ga0495666_0004728
1485 Ga0495666_0032133
1486 Ga0495666_0079358
1487 Ga0495642_0000152
1488 Ga0495642_0000298
1489 Ga0495642_0004112
1490 Ga0495642_0005232
1491 Ga0495642_0005678
1492 Ga0495642_0008277
1493 Ga0495642_0013667
1494 Ga0495642_0017204
1495 Ga0495642_0024026
1496 Ga0495642_0024632
1497 Ga0495642_0057479
1498 Ga0495642_0063887
1499 Ga0495642_0129619
1500 Ga0495642_0166344
1501 Ga0495642_0184000
1502 Ga0495642_0225603
1503 Ga0495654_0012094
1504 Ga0495654_0014969
1505 Ga0495654_0019223
1506 Ga0495654_0070936
1507 Ga0495654_0111161
1508 Ga0495654_0153174
1509 Ga0495654_0173002
1510 Ga0495654_0399047
1511 Ga0495654_0444142
1512 Ga0495665_0110378
1513 Ga0495665_0134824
1514 Ga0495665_0185090
1515 Ga0495665_0498466
1516 Ga0495640_0077092
1517 Ga0495586_0004963
1518 Ga0495586_0039299
1519 Ga0495586_0068334
1520 Ga0495586_0096343
1521 Ga0495586_0923943
1522 Ga0495587_0030352
1523 Ga0495587_0073957
1524 Ga0495587_0239538
1525 Ga0495609_0000028
1526 Ga0495609_0001580
1527 Ga0495609_0004136
1528 Ga0495609_0023329
1529 Ga0495609_0047620
1530 Ga0495609_0070237
1531 Ga0495609_0073998
1532 Ga0495609_0094463
1533 Ga0495609_0102485
1534 Ga0495609_0153894
1535 Ga0495609_0235806
1536 Ga0495597_0001289
1537 Ga0495597_0004948
1538 Ga0495597_0006602
1539 Ga0495597_0006753
1540 Ga0495597_0009390
1541 Ga0495597_0016069
1542 Ga0495597_0016877
1543 Ga0495597_0034651
1544 Ga0495597_0056673
1545 Ga0495597_0073618
1546 Ga0495597_0078135
1547 Ga0495597_0094352
1548 Ga0495597_0113121
1549 Ga0495597_0168357
1550 Ga0495597_0249382
1551 Ga0495645_0375222
1552 Ga0495622_0000129
1553 Ga0495622_0038565
1554 Ga0495622_0041520
1555 Ga0495622_0098440
1556 Ga0495633_0001828
1557 Ga0495633_0002477
1558 Ga0495633_0003852
1559 Ga0495633_0006874
1560 Ga0495633_0009269
1561 Ga0495633_0011544
1562 Ga0495633_0014477
1563 Ga0495633_0015075
1564 Ga0495633_0019197
1565 Ga0495633_0019807
1566 Ga0495633_0027462
1567 Ga0495633_0172796
1568 Ga0495633_0191132
1569 Ga0495633_0244924
1570 Ga0495633_0274949
1571 Ga0495633_0359277
1572 Ga0495656_0036388
1573 Ga0495656_0038818
1574 Ga0495656_0070233
1575 Ga0495656_0111450
1576 Ga0495656_0124075
1577 Ga0495656_0273909
1578 Ga0495656_0337412
1579 Ga0495656_0798923
1580 Ga0495668_0003037
1581 Ga0495668_0004927
1582 Ga0495668_0009985
1583 Ga0495668_0011636
1584 Ga0495668_0014305
1585 Ga0495668_0022333
1586 Ga0495668_0022766
1587 Ga0495668_0024141
1588 Ga0495668_0068838
1589 Ga0495668_0083093
1590 Ga0495668_0112299
1591 Ga0495668_0140926
1592 Ga0495668_0172030
1593 Ga0495611_0000131
1594 Ga0495611_0005435
1595 Ga0495611_0015727
1596 Ga0495611_0027550
1597 Ga0495611_0045613
1598 Ga0495611_0065320
1599 Ga0495611_0112695
1600 Ga0495611_0128829
1601 Ga0495611_0133464
1602 Ga0495611_0197718
1603 Ga0495611_0250306
1604 Ga0495625_0006244
1605 Ga0495625_0026584
1606 Ga0495625_0043330
1607 Ga0495625_0069573
1608 Ga0495625_0071783
1609 Ga0495625_0155367
1610 Ga0495625_0349823
1611 Ga0495625_0349895
1612 Ga0495625_0390430
1613 Ga0495625_0398439
1614 Ga0495635_0873241
1615 Ga0495659_0294119
1616 Ga0495659_0321532
1617 Ga0495661_0000157
1618 Ga0495661_0001565
1619 Ga0495661_0001646
1620 Ga0495661_0012412
1621 Ga0495661_0013674
1622 Ga0495661_0020350
1623 Ga0495661_0020967
1624 Ga0495661_0026806
1625 Ga0495661_0033074
1626 Ga0495661_0040547
1627 Ga0495661_0044499
1628 Ga0495661_0052997
1629 Ga0495661_0054123
1630 Ga0495661_0055376
1631 Ga0495661_0066865
1632 Ga0495661_0072921
1633 Ga0495661_0085415
1634 Ga0495661_0094752
1635 Ga0495661_0096569
1636 Ga0495661_0121407
1637 Ga0495661_0161292
1638 Ga0495661_0165696
1639 Ga0495661_0212805
1640 Ga0495661_0250686
1641 Ga0495661_0286113
1642 Ga0495661_0527733
1643 Ga0495588_0000113
1644 Ga0495588_0009087
1645 Ga0495588_0014784
1646 Ga0495588_0032606
1647 Ga0495588_0058969
1648 Ga0495588_0075627
1649 Ga0495588_0123966
1650 Ga0495588_0171498
1651 Ga0495588_0186869
1652 Ga0495588_0214786
1653 Ga0495588_0235441
1654 Ga0495588_0255491
1655 Ga0495588_0428200
1656 Ga0495588_0665837
1657 Ga0495599_0455564
1658 Ga0495623_0043478
1659 Ga0495623_0100948
1660 Ga0495623_0109730
1661 Ga0495646_0252129
1662 Ga0495669_0000218
1663 Ga0495669_0000610
1664 Ga0495669_0001479
1665 Ga0495669_0013774
1666 Ga0495669_0015377
1667 Ga0495669_0032719
1668 Ga0495669_0067264
1669 Ga0495669_0083026
1670 Ga0495669_0460603
1671 Ga0495613_0128655
1672 Ga0495613_0511722
1673 Ga0495670_0000426
1674 Ga0495670_0004836
1675 Ga0495670_0005025
1676 Ga0495670_0011083
1677 Ga0495670_0014012
1678 Ga0495670_0014508
1679 Ga0495670_0018887
1680 Ga0495670_0020336
1681 Ga0495670_0027730
1682 Ga0495670_0033824
1683 Ga0495670_0094580
1684 Ga0495670_0365571
1685 Ga0495670_0437087
1686 Ga0495671_0000358
1687 Ga0495671_0008900
1688 Ga0495671_0016277
1689 Ga0495671_0018643
1690 Ga0495671_0096387
1691 Ga0495671_0119107
1692 Ga0495671_0163778
1693 Ga0495649_0000255
1694 Ga0495649_0001872
1695 Ga0495649_0022145
1696 Ga0495649_0041618
1697 Ga0495649_0044506
1698 Ga0495649_0054416
1699 Ga0495649_0099647
1700 Ga0495649_0113971
1701 Ga0495649_0135756
1702 Ga0495649_0184448
1703 Ga0495589_0000098
1704 Ga0495589_0000117
1705 Ga0495589_0001281
1706 Ga0495589_0001522
1707 Ga0495589_0011124
1708 Ga0495589_0012107
1709 Ga0495589_0017704
1710 Ga0495589_0021858
1711 Ga0495589_0064812
1712 Ga0495589_0118464
1713 Ga0495589_0144094
1714 Ga0495589_0307105
1715 Ga0495589_0329866
1716 Ga0495589_0515914
1717 Ga0495600_0011562
1718 Ga0495600_0194387
1719 Ga0495660_0004572
1720 Ga0495660_0008234
1721 Ga0495660_0011157
1722 Ga0495660_0020372
1723 Ga0495660_0029108
1724 Ga0495660_0037327
1725 Ga0495660_0039018
1726 Ga0495660_0041768
1727 Ga0495660_0068479
1728 Ga0495660_0101822
1729 Ga0495660_0171376
1730 Ga0495581_0035332
1731 Ga0495581_0037032
1732 Ga0495581_0238063
1733 Ga0495604_0006846
1734 Ga0495604_0104126
1735 Ga0495604_0221152
1736 Ga0495604_0331850
1737 Ga0495604_0369989
1738 Ga0495636_0029858
1739 Ga0495636_0338582
1740 Ga0495674_0001330
1741 Ga0495672_0000014
1742 Ga0495672_0000102
1743 Ga0495672_0000423
1744 Ga0495672_0002778
1745 Ga0495672_0105527
1746 Ga0495672_0119694
1747 Ga0495672_0249388
1748 Ga0495672_0250640
1749 Ga0495672_0427237
1750 Ga0495676_0000034
1751 Ga0495676_0050121
1752 Ga0495676_0124730
1753 Ga0495676_0331743
1754 Ga0495680_0013628
1755 Ga0495680_0215200
1756 Ga0495680_0396937
1757 Ga0495683_0000275
1758 Ga0495683_0001409
1759 Ga0495683_0029791
1760 Ga0495683_0036650
1761 Ga0495683_0065165
1762 Ga0495683_0070930
1763 Ga0495683_0079804
1764 Ga0495683_0088567
1765 Ga0495683_0165346
1766 Ga0495683_0169640
1767 Ga0495683_0256594
1768 Ga0495687_000054
1769 Ga0495687_000060
1770 Ga0495687_000410
1771 Ga0495687_001444
1772 Ga0495687_002747
1773 Ga0495687_005962
1774 Ga0495687_156750
1775 Ga0495687_267729
1776 Ga0495675_0030447
1777 Ga0495675_0591930
1778 Ga0495677_0000012
1779 Ga0495677_0000859
1780 Ga0495677_0002585
1781 Ga0495677_0004679
1782 Ga0495677_0005010
1783 Ga0495677_0006469
1784 Ga0495677_0007792
1785 Ga0495677_0012634
1786 Ga0495677_0041736
1787 Ga0495677_0046639
1788 Ga0495677_0048879
1789 Ga0495677_0050428
1790 Ga0495677_0074954
1791 Ga0495677_0112917
1792 Ga0495677_0240189
1793 Ga0495677_0357488
1794 Ga0495679_005625
1795 Ga0495679_007572
1796 Ga0495679_012477
1797 Ga0495679_038474
1798 Ga0495679_042792
1799 Ga0495685_018405
1800 Ga0495685_035909
1801 Ga0495685_041677
1802 Ga0495685_130701
1803 Ga0495685_234484
1804 Ga0495673_0000033
1805 Ga0495673_0000034
1806 Ga0495673_0204443
1807 Ga0495673_0223368
1808 Ga0495681_0002251
1809 Ga0495681_0011061
1810 Ga0495681_0012525
1811 Ga0495681_0022450
1812 Ga0495681_0045527
1813 Ga0495681_0064791
1814 Ga0495681_0065592
1815 Ga0495681_0104984
1816 Ga0495681_0157349
1817 Ga0495681_0214120
1818 Ga0495686_0000219
1819 Ga0495686_0004323
1820 Ga0495686_0018074
1821 Ga0495686_0059219
1822 Ga0495686_0125391
1823 Ga0495686_0170863
1824 Ga0495593_0004749
1825 Ga0495593_0029350
1826 Ga0495593_0041852
1827 Ga0495593_0092920
1828 Ga0495593_0142220
1829 Ga0495602_0137879
1830 Ga0495614_0001046
1831 Ga0495614_0006118
1832 Ga0495614_0084384
1833 Ga0495614_0356484
1834 Ga0495615_0042496
1835 Ga0495626_0000036
1836 Ga0495626_0000044
1837 Ga0495626_0000940
1838 Ga0495626_0002024
1839 Ga0495626_0002143
1840 Ga0495626_0003100
1841 Ga0495626_0005913
1842 Ga0495626_0007360
1843 Ga0495626_0011841
1844 Ga0495626_0012685
1845 Ga0495626_0018622
1846 Ga0495626_0027796
1847 Ga0495626_0036485
1848 Ga0495626_0044451
1849 Ga0495626_0051883
1850 Ga0495626_0093527
1851 Ga0495626_0251043
1852 Ga0495626_0272404
1853 Ga0495626_0434103
1854 Ga0496100_0019643
1855 Ga0496100_0803768
1856 Ga0496101_0028499
1857 Ga0496101_0935348
1858 Ga0496102_0000192
1859 Ga0496102_0083043
1860 Ga0496102_0104910
1861 Ga0496102_0182348
1862 Ga0496102_0395099
1863 Ga0496102_0500237
1864 Ga0496102_0561234
1865 Ga0496102_0738547
1866 Ga0496102_0854954
1867 Ga0496102_0861117
1868 Ga0496103_0001678
1869 Ga0496103_0019332
1870 Ga0496103_0027421
1871 Ga0496103_0057623
1872 Ga0496103_0146609
1873 Ga0496103_0457550
1874 Ga0496104_0061486
1875 Ga0496104_0151474
1876 Ga0496105_0160942
1877 Ga0496105_0236962
1878 Ga0496105_1033188
1879 Ga0496106_0003007
1880 Ga0496106_0257690
1881 Ga0496107_0004798
1882 Ga0496107_0021763
1883 Ga0496107_0038719
1884 Ga0496107_0365684
1885 Ga0496107_0620761
1886 Ga0496107_0920751
1887 Ga0496108_1698953
1888 Ga0496109_0302126
1889 Ga0496109_0332845
1890 Ga0496110_0000719
1891 Ga0496110_0069742
1892 Ga0496110_0249977
1893 Ga0496110_0574067
1894 Ga0496111_0200790
1895 Ga0496111_0328805
1896 Ga0496112_0398214
1897 Ga0496112_0493788
1898 Ga0496112_1279499
1899 Ga0496113_0003074
1900 Ga0496113_0091181
1901 Ga0496113_0194716
1902 Ga0496114_1779192
1903 Ga0496115_0020797
1904 Ga0496115_0029084
1905 Ga0496115_0052586
1906 Ga0496115_0215548
1907 Ga0496115_0483084
1908 Ga0496116_0076406
1909 Ga0496117_0000010
1910 Ga0496118_0000009
1911 Ga0496121_0007758
1912 Ga0496121_0176350
1913 Ga0496121_0397975
1914 Ga0496122_0000337
1915 Ga0496122_0006555
1916 Ga0496122_0008617
1917 Ga0496122_0066798
1918 Ga0496122_0593418
1919 Ga0496123_0000905
1920 Ga0496123_0007410
1921 Ga0496123_0007817
1922 Ga0496124_0014308
1923 Ga0496124_0049671
1924 Ga0496124_0076299
1925 Ga0496124_0084214
1926 Ga0496124_0119507
1927 Ga0496124_0123275
1928 Ga0496124_0124825
1929 Ga0496125_0000917
1930 Ga0496125_0129558
1931 Ga0496125_0200511
1932 Ga0496125_0212034
1933 Ga0496126_0082691
1934 Ga0496126_0325294
1935 Ga0501306_070554
1936 Ga0501306_081508
1937 Ga0501309_099010
1938 Ga0501310_059326
1939 Ga0501304_043476
1940 Ga0501305_118689
1941 Ga0495678_000174
1942 Ga0495678_000175
1943 Ga0495678_000466
1944 Ga0495678_012905
1945 Ga0495678_014968
1946 Ga0495678_105709
1947 Ga0495678_152242
1948 Ga0495678_156409
1949 Ga0495682_0001432
1950 Ga0495682_0001749
1951 Ga0495682_0004560
1952 Ga0495682_0060783
1953 Ga0495682_0095937
1954 Ga0495682_0108360
1955 Ga0495682_0177410
1956 Ga0501311_038720
1957 Ga0501312_113215
1958 Ga0501315_017760
1959 Ga0501315_072345
1960 Ga0501316_052492
1961 Ga0501323_024794
1962 Ga0501036_0599565
1963 Ga0501047_0451979
1964 Ga0501222_017359
1965 Ga0501233_243548
1966 Ga0501282_033085
1967 Ga0501044_1499218
1968 nmdc:mga0k408_363709_c1
1969 nmdc:mga07m45_105819_c1
1970 Ga0500562_165077
1971 Ga0500594_0242853
1972 Ga0500559_0116876
1973 Ga0500586_003592
1974 Ga0587084_072783
1975 Ga0587070_137630
1976 Ga0587083_0022198
1977 Ga0587085_154515
1978 Ga0587088_018667
1979 Ga0587089_026298
1980 Ga0587090_017830
1981 Ga0587106_120575
1982 Ga0587109_116023
1983 Ga0587062_062807
1984 Ga0587068_135478
1985 Ga0587076_184353
1986 Ga0587078_046229
1987 Ga0587078_059930
1988 Ga0587102_004697
1989 Ga0587105_003398
1990 Ga0587108_022323
1991 Ga0466962_0029405
1992 Ga0466962_0168978

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04324

Fer2_BFD

BFD-like [2Fe-2S] binding domain

16

65

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6e6r-assembly1.cif.gz_A 1.50 a resolution structure of the c-terminally truncated [2fe-2s] ferredoxin (bfd) r26e mutant from pseudomonas aeruginosa 0.9892 1 55
4e6k-assembly1.cif.gz_G 2.0 a resolution structure of pseudomonas aeruginosa bacterioferritin (bfrb) in complex with bacterioferritin associated ferredoxin (bfd) 0.9793 1 56
6e6s-assembly2.cif.gz_B 1.45 a resolution structure of the c-terminally truncated [2fe-2s] ferredoxin (bfd) r26e/k46y mutant from pseudomonas aeruginosa 0.9559 1 55
6e6r-assembly1.cif.gz_A 1.50 a resolution structure of the c-terminally truncated [2fe-2s] ferredoxin (bfd) r26e mutant from pseudomonas aeruginosa 0.955 1 55
4e6k-assembly1.cif.gz_G 2.0 a resolution structure of pseudomonas aeruginosa bacterioferritin (bfrb) in complex with bacterioferritin associated ferredoxin (bfd) 0.9464 1 56
ID Description Score Start End Superfamily
6e6qA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;BFD-like [2Fe-2S]-binding domain 0.9697 1 55 1.10.10.1100
af_P0AE56_1_57_1.10.10.1100 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;BFD-like [2Fe-2S]-binding domain 0.9508 1 55 1.10.10.1100
6e6qA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;BFD-like [2Fe-2S]-binding domain 0.9369 1 55 1.10.10.1100
af_P0AE56_1_57_1.10.10.1100 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;BFD-like [2Fe-2S]-binding domain 0.9038 1 55 1.10.10.1100
af_P0A9C0_420_492_1.10.10.1100 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;BFD-like [2Fe-2S]-binding domain 0.8762 1 53 1.10.10.1100
ID Description Score Start End GO Terms
AF-A0A430HPQ2-F1-model_v4 Bacterioferritin-associated ferredoxin 1.01 1 61 GO:0051537
AF-A0A318KEN6-F1-model_v4 Bacterioferritin-associated ferredoxin 1.006 1 61 GO:0051537
AF-A0A2S5T7C3-F1-model_v4 Bacterioferritin-associated ferredoxin 1.004 1 54 GO:0051537
AF-A0A841GBM8-F1-model_v4 Bacterioferritin-associated ferredoxin 1.004 1 57 GO:0051537
AF-A0A2E6UTR3-F1-model_v4 Bacterioferritin-associated ferredoxin 1.004 1 57 GO:0051537

Map