F487751

General Info

Members Datasets Scaffolds Average Seq Length
995 341 995 283

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0139200|Ga0395899_0139200_471_1502
Length 326
Sequence MTHPTPYNSEPAQAGTPRADVPSTARPSGRVWPLLSRDGRARFGLAVVVLLILGALLAPFIARHDPTTIDLTNTLAAPSGVHWLGTDVQGRDVWARLVYGARVSLTVGVVSQALSLILGVAAGLVAGFYGKWVDDVVMRLADITLAFPTLLLLIAMAAALQPSLGTVMLTIGVVGWAGMARLVRGQVLVVRQTEYVQAERALGAGDLRIMLRHVLPNVIAPVVIAATLGVAGAIMAEAALSFLGLGVQPPTPSWGAMIADGRDLSQLRGAPWTSLFPGLAIGAAVLGFNLLGDALRDALDPRAAGLRKMRRGDLPTEAGPSRTAAR

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
204 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
205 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
209 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
210 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
228 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
231 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
232 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
233 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
234 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
235 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
236 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
237 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
238 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
239 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
240 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
241 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
242 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
243 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
244 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
245 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
246 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
247 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
248 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
249 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
250 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
251 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
257 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
258 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
259 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
260 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
261 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
262 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
263 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
264 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
265 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
266 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
267 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
268 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
269 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
270 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
271 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
272 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
275 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
276 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
282 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
283 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
284 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
285 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
286 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
287 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
296 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
297 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
298 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
299 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
300 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
301 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
302 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
303 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
304 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
305 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
306 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
307 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
308 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
309 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
310 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
311 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
312 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
313 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
314 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
315 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
316 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
317 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
318 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
319 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
320 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
321 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
322 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
323 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
324 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
325 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
326 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
327 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
328 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
329 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
330 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
331 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
332 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
333 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
334 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
335 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
336 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
337 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
338 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
339 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
340 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
341 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.41
Nodule 0
Rhizoplane 0.8
Rhizosphere 96.98
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10045853 3300001990 Bacteria 1335
2 Ga0065715_10112103 3300005293 Unclassified 2544
3 Ga0065715_10133990 3300005293 Bacteria 1960
4 Ga0070658_10002348 3300005327 Bacteria 15866
5 Ga0070658_10005003 3300005327 Bacteria 10792
6 Ga0070658_10008504 3300005327 Bacteria 8252
7 Ga0070658_10042391 3300005327 Bacteria 3676
8 Ga0070676_10000594 3300005328 Bacteria 17557
9 Ga0070676_10005710 3300005328 Bacteria 6632
10 Ga0070676_10025027 3300005328 Bacteria 3370
11 Ga0070683_100002955 3300005329 Bacteria 13630
12 Ga0070683_100003955 3300005329 Bacteria 12129
13 Ga0070683_100012277 3300005329 Bacteria 7439
14 Ga0070683_100017298 3300005329 Bacteria 6371
15 Ga0070683_100020501 3300005329 Bacteria 5883
16 Ga0070683_100021469 3300005329 Bacteria 5765
17 Ga0070683_100022431 3300005329 Bacteria 5642
18 Ga0070683_100033167 3300005329 Bacteria 4707
19 Ga0070683_100055122 3300005329 Bacteria 3688
20 Ga0070683_100119482 3300005329 Bacteria 2489
21 Ga0070683_100143167 3300005329 Bacteria 2265
22 Ga0070683_100160905 3300005329 Bacteria 2130
23 Ga0070690_100046687 3300005330 Bacteria 2754
24 Ga0070690_100049665 3300005330 Bacteria 2675
25 Ga0070690_100053908 3300005330 Bacteria 2573
26 Ga0070690_100081471 3300005330 Bacteria 2118
27 Ga0070670_100001303 3300005331 Bacteria 19876
28 Ga0070670_100078471 3300005331 Bacteria 2836
29 Ga0070670_100251892 3300005331 Bacteria 1539
30 Ga0070677_10058231 3300005333 Bacteria 1586
31 Ga0070677_10089112 3300005333 Bacteria 1338
32 Ga0068869_100000208 3300005334 Bacteria 30490
33 Ga0068869_100013618 3300005334 Bacteria 5414
34 Ga0068869_100259928 3300005334 Bacteria 1390
35 Ga0070680_100001422 3300005336 Bacteria 17316
36 Ga0070680_100001898 3300005336 Bacteria 15333
37 Ga0070680_100004865 3300005336 Bacteria 10109
38 Ga0070680_100005138 3300005336 Bacteria 9889
39 Ga0070680_100008729 3300005336 Bacteria 7771
40 Ga0070680_100008911 3300005336 Bacteria 7693
41 Ga0070680_100010446 3300005336 Bacteria 7159
42 Ga0070680_100017506 3300005336 Bacteria 5652
43 Ga0070680_100018865 3300005336 Bacteria 5456
44 Ga0070680_100024838 3300005336 Bacteria 4789
45 Ga0070680_100046351 3300005336 Bacteria 3536
46 Ga0070680_100046586 3300005336 Bacteria 3528
47 Ga0070680_100055367 3300005336 Bacteria 3241
48 Ga0070680_100090426 3300005336 Bacteria 2534
49 Ga0070680_100170521 3300005336 Bacteria 1831
50 Ga0070680_100352744 3300005336 Bacteria 1251
51 Ga0070682_100008289 3300005337 Bacteria 5859
52 Ga0070682_100012299 3300005337 Unclassified 4904
53 Ga0068868_100008939 3300005338 Bacteria 7187
54 Ga0068868_100010299 3300005338 Bacteria 6762
55 Ga0068868_100021943 3300005338 Bacteria 4813
56 Ga0068868_100050462 3300005338 Bacteria 3268
57 Ga0070660_100010448 3300005339 Bacteria 6561
58 Ga0070660_100246983 3300005339 Bacteria 1454
59 Ga0070689_100025722 3300005340 Bacteria 4424
60 Ga0070689_100037528 3300005340 Bacteria 3704
61 Ga0070689_100118829 3300005340 Bacteria 2110
62 Ga0070691_10014505 3300005341 Bacteria 3617
63 Ga0070687_100006707 3300005343 Bacteria 4739
64 Ga0070687_100027850 3300005343 Bacteria 2735
65 Ga0070687_100047189 3300005343 Bacteria 2208
66 Ga0070687_100067045 3300005343 Bacteria 1914
67 Ga0070687_100088804 3300005343 Bacteria 1705
68 Ga0070661_100001777 3300005344 Bacteria 14949
69 Ga0070661_100002926 3300005344 Bacteria 11773
70 Ga0070661_100004545 3300005344 Bacteria 9548
71 Ga0070661_100004756 3300005344 Bacteria 9346
72 Ga0070661_100011227 3300005344 Bacteria 6241
73 Ga0070661_100022638 3300005344 Bacteria 4500
74 Ga0070661_100032234 3300005344 Bacteria 3792
75 Ga0070661_100096601 3300005344 Bacteria 2193
76 Ga0070661_100214431 3300005344 Bacteria 1475
77 Ga0070661_100234470 3300005344 Bacteria 1411
78 Ga0070661_100355838 3300005344 Bacteria 1150
79 Ga0070692_10063497 3300005345 Bacteria 1951
80 Ga0070668_100002959 3300005347 Bacteria 12557
81 Ga0070668_100004148 3300005347 Bacteria 10732
82 Ga0070669_100001830 3300005353 Bacteria 15332
83 Ga0070669_100004381 3300005353 Bacteria 10180
84 Ga0070669_100004515 3300005353 Bacteria 10044
85 Ga0070669_100341920 3300005353 Bacteria 1213
86 Ga0070675_100001698 3300005354 Bacteria 16257
87 Ga0070675_100009924 3300005354 Bacteria 7424
88 Ga0070675_100010529 3300005354 Bacteria 7224
89 Ga0070675_100049365 3300005354 Bacteria 3454
90 Ga0070675_100161727 3300005354 Bacteria 1926
91 Ga0070675_100177423 3300005354 Bacteria 1840
92 Ga0070675_100222849 3300005354 Bacteria 1643
93 Ga0070671_100013858 3300005355 Bacteria 6504
94 Ga0070671_100057861 3300005355 Bacteria 3227
95 Ga0070671_100070816 3300005355 Bacteria 2909
96 Ga0070671_100116767 3300005355 Bacteria 2244
97 Ga0070674_100021188 3300005356 Bacteria 4168
98 Ga0070674_100027133 3300005356 Bacteria 3750
99 Ga0070674_100040541 3300005356 Bacteria 3151
100 Ga0070674_100155304 3300005356 Bacteria 1731
101 Ga0070674_100407927 3300005356 Bacteria 1112
102 Ga0070673_100024423 3300005364 Bacteria 4432
103 Ga0070688_100005984 3300005365 Bacteria 6448
104 Ga0070688_100040545 3300005365 Bacteria 2854
105 Ga0070688_100281943 3300005365 Bacteria 1194
106 Ga0070659_100002094 3300005366 Bacteria 14221
107 Ga0070659_100003038 3300005366 Bacteria 11935
108 Ga0070659_100015628 3300005366 Bacteria 5685
109 Ga0070659_100051452 3300005366 Bacteria 3239
110 Ga0070659_100270211 3300005366 Bacteria 1412
111 Ga0070667_100002826 3300005367 Bacteria 14988
112 Ga0070667_100263491 3300005367 Bacteria 1544
113 Ga0070667_100287293 3300005367 Bacteria 1478
114 Ga0070703_10002559 3300005406 Bacteria 5240
115 Ga0070709_10007289 3300005434 Bacteria 6061
116 Ga0070709_10019736 3300005434 Bacteria 3901
117 Ga0070709_10027454 3300005434 Bacteria 3385
118 Ga0070709_10115238 3300005434 Bacteria 1812
119 Ga0070709_10150408 3300005434 Bacteria 1608
120 Ga0070709_10183594 3300005434 Bacteria 1471
121 Ga0070714_100024675 3300005435 Bacteria 4954
122 Ga0070714_100052772 3300005435 Bacteria 3469
123 Ga0070714_100053038 3300005435 Bacteria 3460
124 Ga0070714_100237005 3300005435 Bacteria 1683
125 Ga0070714_100273807 3300005435 Bacteria 1566
126 Ga0070713_100000103 3300005436 Bacteria 54646
127 Ga0070713_100015755 3300005436 Bacteria 5664
128 Ga0070713_100026926 3300005436 Bacteria 4520
129 Ga0070713_100046169 3300005436 Bacteria 3573
130 Ga0070713_100202567 3300005436 Bacteria 1793
131 Ga0070710_10008519 3300005437 Bacteria 4992
132 Ga0070710_10065461 3300005437 Bacteria 2082
133 Ga0070710_10155163 3300005437 Bacteria 1415
134 Ga0070701_10001273 3300005438 Bacteria 9254
135 Ga0070701_10008731 3300005438 Bacteria 4401
136 Ga0070711_100000333 3300005439 Bacteria 24273
137 Ga0070711_100070640 3300005439 Bacteria 2459
138 Ga0070711_100079697 3300005439 Bacteria 2330
139 Ga0070711_100239853 3300005439 Bacteria 1417
140 Ga0070705_100007921 3300005440 Bacteria 5249
141 Ga0070705_100153140 3300005440 Bacteria 1532
142 Ga0070700_100011072 3300005441 Bacteria 4988
143 Ga0070700_100015648 3300005441 Bacteria 4306
144 Ga0070694_100000139 3300005444 Bacteria 36599
145 Ga0070694_100014198 3300005444 Bacteria 4984
146 Ga0070694_100095098 3300005444 Bacteria 2097
147 Ga0070694_100184438 3300005444 Bacteria 1545
148 Ga0070708_100000005 3300005445 Bacteria 159112
149 Ga0070708_100002584 3300005445 Bacteria 14012
150 Ga0070708_100005774 3300005445 Bacteria 9821
151 Ga0070708_100096499 3300005445 Bacteria 2701
152 Ga0070708_100213849 3300005445 Bacteria 1807
153 Ga0070708_100280671 3300005445 Bacteria 1568
154 Ga0070708_100301283 3300005445 Bacteria 1509
155 Ga0070663_100022798 3300005455 Bacteria 4190
156 Ga0070662_100001636 3300005457 Bacteria 13829
157 Ga0070662_100024286 3300005457 Bacteria 4174
158 Ga0070662_100199638 3300005457 Bacteria 1586
159 Ga0070662_100271142 3300005457 Bacteria 1370
160 Ga0070662_100484493 3300005457 Bacteria 1030
161 Ga0070681_10000349 3300005458 Bacteria 37198
162 Ga0070681_10001031 3300005458 Bacteria 23626
163 Ga0070681_10008058 3300005458 Bacteria 10310
164 Ga0070681_10012906 3300005458 Bacteria 8297
165 Ga0070681_10018547 3300005458 Bacteria 6956
166 Ga0070681_10045857 3300005458 Bacteria 4371
167 Ga0070681_10052545 3300005458 Bacteria 4064
168 Ga0070681_10094410 3300005458 Bacteria 2940
169 Ga0068867_100018520 3300005459 Bacteria 4949
170 Ga0070685_10027877 3300005466 Bacteria 3125
171 Ga0070685_10100498 3300005466 Bacteria 1766
172 Ga0070685_10134757 3300005466 Bacteria 1548
173 Ga0070706_100012945 3300005467 Bacteria 7722
174 Ga0070706_100230398 3300005467 Bacteria 1729
175 Ga0070706_100260335 3300005467 Bacteria 1619
176 Ga0070706_100402985 3300005467 Bacteria 1273
177 Ga0070706_100489927 3300005467 Bacteria 1144
178 Ga0070706_100563943 3300005467 Bacteria 1059
179 Ga0070707_100001035 3300005468 Bacteria 27552
180 Ga0070707_100017848 3300005468 Bacteria 6672
181 Ga0070707_100090717 3300005468 Bacteria 2958
182 Ga0070707_100312839 3300005468 Bacteria 1526
183 Ga0070698_100012669 3300005471 Bacteria 8927
184 Ga0070698_100037988 3300005471 Bacteria 4963
185 Ga0070698_100121865 3300005471 Bacteria 2567
186 Ga0070698_100405704 3300005471 Bacteria 1296
187 Ga0070699_100006598 3300005518 Bacteria 10088
188 Ga0070699_100011295 3300005518 Bacteria 7715
189 Ga0070699_100054612 3300005518 Bacteria 3457
190 Ga0070699_100186548 3300005518 Bacteria 1842
191 Ga0070699_100190601 3300005518 Bacteria 1821
192 Ga0070699_100315242 3300005518 Bacteria 1405
193 Ga0070679_100000151 3300005530 Bacteria 56102
194 Ga0070679_100000574 3300005530 Bacteria 31165
195 Ga0070679_100005661 3300005530 Bacteria 11581
196 Ga0070679_100011629 3300005530 Bacteria 8387
197 Ga0070679_100012388 3300005530 Bacteria 8148
198 Ga0070679_100023739 3300005530 Bacteria 6008
199 Ga0070679_100058235 3300005530 Bacteria 3850
200 Ga0070679_100136478 3300005530 Bacteria 2434
201 Ga0070679_100197173 3300005530 Bacteria 1980
202 Ga0070684_100000453 3300005535 Bacteria 28005
203 Ga0070684_100006943 3300005535 Bacteria 8793
204 Ga0070684_100035061 3300005535 Bacteria 4292
205 Ga0070684_100041560 3300005535 Bacteria 3964
206 Ga0070684_100045753 3300005535 Bacteria 3790
207 Ga0070684_100053571 3300005535 Bacteria 3513
208 Ga0070684_100071884 3300005535 Bacteria 3044
209 Ga0070684_100128686 3300005535 Bacteria 2283
210 Ga0070684_100169336 3300005535 Bacteria 1984
211 Ga0070684_100334588 3300005535 Bacteria 1392
212 Ga0070684_100451797 3300005535 Bacteria 1188
213 Ga0070697_100024628 3300005536 Bacteria 4793
214 Ga0070697_100084591 3300005536 Bacteria 2616
215 Ga0070697_100109057 3300005536 Bacteria 2305
216 Ga0070697_100206139 3300005536 Bacteria 1672
217 Ga0070697_100235551 3300005536 Bacteria 1562
218 Ga0068853_100007984 3300005539 Bacteria 8487
219 Ga0068853_100048124 3300005539 Bacteria 3661
220 Ga0068853_100397052 3300005539 Bacteria 1290
221 Ga0070672_100001009 3300005543 Bacteria 17082
222 Ga0070686_100037060 3300005544 Bacteria 3023
223 Ga0070686_100102797 3300005544 Bacteria 1933
224 Ga0070695_100004425 3300005545 Bacteria 8246
225 Ga0070695_100008847 3300005545 Bacteria 5982
226 Ga0070695_100025183 3300005545 Bacteria 3672
227 Ga0070695_100026367 3300005545 Bacteria 3595
228 Ga0070695_100050264 3300005545 Bacteria 2671
229 Ga0070695_100060097 3300005545 Bacteria 2462
230 Ga0070695_100094612 3300005545 Bacteria 2001
231 Ga0070696_100021028 3300005546 Bacteria 4422
232 Ga0070696_100036167 3300005546 Bacteria 3403
233 Ga0070696_100150548 3300005546 Bacteria 1707
234 Ga0070696_100191124 3300005546 Bacteria 1524
235 Ga0070693_100004287 3300005547 Bacteria 6733
236 Ga0070693_100004554 3300005547 Bacteria 6573
237 Ga0070704_100012319 3300005549 Bacteria 5280
238 Ga0070704_100012483 3300005549 Bacteria 5247
239 Ga0070704_100067816 3300005549 Bacteria 2578
240 Ga0068855_100007696 3300005563 Bacteria 13011
241 Ga0068855_100016881 3300005563 Bacteria 8778
242 Ga0068855_100075852 3300005563 Bacteria 3903
243 Ga0068855_100168240 3300005563 Bacteria 2483
244 Ga0068855_100260033 3300005563 Bacteria 1934
245 Ga0068855_100459220 3300005563 Bacteria 1389
246 Ga0070664_100001011 3300005564 Bacteria 22087
247 Ga0070664_100005563 3300005564 Bacteria 10121
248 Ga0070664_100013240 3300005564 Bacteria 6719
249 Ga0070664_100024837 3300005564 Bacteria 4963
250 Ga0070664_100056936 3300005564 Bacteria 3322
251 Ga0070664_100061089 3300005564 Bacteria 3211
252 Ga0070664_100087111 3300005564 Bacteria 2699
253 Ga0070664_100291730 3300005564 Bacteria 1473
254 Ga0068857_100001942 3300005577 Bacteria 16681
255 Ga0068857_100003270 3300005577 Bacteria 13465
256 Ga0068857_100009359 3300005577 Bacteria 8506
257 Ga0068857_100185383 3300005577 Bacteria 1894
258 Ga0068857_100190178 3300005577 Bacteria 1869
259 Ga0068857_100296647 3300005577 Bacteria 1490
260 Ga0068854_100010711 3300005578 Bacteria 5952
261 Ga0068854_100027498 3300005578 Bacteria 3920
262 Ga0068854_100060335 3300005578 Bacteria 2743
263 Ga0068854_100164962 3300005578 Bacteria 1719
264 Ga0068854_100370753 3300005578 Bacteria 1177
265 Ga0068854_100465460 3300005578 Bacteria 1059
266 Ga0068856_100019865 3300005614 Bacteria 6522
267 Ga0068856_100121165 3300005614 Bacteria 2617
268 Ga0068856_100201431 3300005614 Unclassified 2005
269 Ga0068856_100225134 3300005614 Bacteria 1891
270 Ga0068856_100281053 3300005614 Bacteria 1681
271 Ga0070702_100001473 3300005615 Bacteria 9659
272 Ga0068852_100000642 3300005616 Bacteria 22866
273 Ga0068852_100015929 3300005616 Bacteria 5850
274 Ga0068852_100022605 3300005616 Bacteria 5046
275 Ga0068852_100063084 3300005616 Bacteria 3225
276 Ga0068859_100067117 3300005617 Bacteria 3621
277 Ga0068859_100119078 3300005617 Bacteria 2706
278 Ga0068859_100167452 3300005617 Bacteria 2277
279 Ga0068859_100670379 3300005617 Bacteria 1129
280 Ga0068864_100006923 3300005618 Bacteria 9300
281 Ga0068864_100221460 3300005618 Bacteria 1746
282 Ga0068866_10038891 3300005718 Bacteria 2346
283 Ga0068861_100001041 3300005719 Bacteria 17023
284 Ga0068861_100009433 3300005719 Bacteria 6737
285 Ga0068861_100035340 3300005719 Bacteria 3701
286 Ga0068861_100417196 3300005719 Bacteria 1195
287 Ga0068851_10026626 3300005834 Bacteria 2844
288 Ga0068851_10179411 3300005834 Bacteria 1172
289 Ga0068870_10002369 3300005840 Bacteria 7839
290 Ga0068863_100008965 3300005841 Bacteria 9768
291 Ga0068863_100031045 3300005841 Bacteria 5102
292 Ga0068858_100010522 3300005842 Bacteria 8761
293 Ga0068858_100151623 3300005842 Bacteria 2180
294 Ga0068858_100276650 3300005842 Bacteria 1598
295 Ga0068860_100010610 3300005843 Bacteria 9098
296 Ga0068860_100019902 3300005843 Bacteria 6508
297 Ga0068862_100000266 3300005844 Bacteria 58197
298 Ga0068862_100003004 3300005844 Bacteria 14715
299 Ga0068862_100116261 3300005844 Bacteria 2353
300 Ga0081539_10000354 3300005985 Bacteria 100885
301 Ga0081539_10013437 3300005985 Bacteria 6167
302 Ga0070717_10008217 3300006028 Bacteria 7796
303 Ga0070716_100000659 3300006173 Bacteria 14660
304 Ga0070712_100004829 3300006175 Bacteria 8332
305 Ga0070712_100159803 3300006175 Bacteria 1739
306 Ga0097621_100142147 3300006237 Bacteria 2051
307 Ga0075428_100035486 3300006844 Bacteria 5497
308 Ga0075428_100433064 3300006844 Bacteria 1409
309 Ga0075430_100001226 3300006846 Bacteria 20638
310 Ga0075430_100001947 3300006846 Bacteria 16959
311 Ga0075430_100006661 3300006846 Bacteria 9744
312 Ga0075430_100036046 3300006846 Bacteria 4194
313 Ga0075430_100064871 3300006846 Bacteria 3069
314 Ga0075431_100109428 3300006847 Bacteria 2852
315 Ga0075431_100183837 3300006847 Bacteria 2144
316 Ga0075431_100497977 3300006847 Bacteria 1210
317 Ga0075433_10001420 3300006852 Bacteria 17644
318 Ga0075433_10006048 3300006852 Bacteria 9533
319 Ga0075433_10185586 3300006852 Bacteria 1850
320 Ga0075434_100001773 3300006871 Bacteria 18589
321 Ga0075434_100002916 3300006871 Bacteria 15193
322 Ga0075434_100022446 3300006871 Bacteria 6146
323 Ga0075434_100036436 3300006871 Bacteria 4866
324 Ga0075434_100070881 3300006871 Bacteria 3476
325 Ga0075434_100091254 3300006871 Bacteria 3048
326 Ga0075429_100170786 3300006880 Bacteria 1905
327 Ga0068865_100010488 3300006881 Bacteria 5767
328 Ga0068865_100020556 3300006881 Bacteria 4282
329 Ga0068865_100055990 3300006881 Bacteria 2746
330 Ga0068865_100188936 3300006881 Bacteria 1591
331 Ga0068865_100231851 3300006881 Bacteria 1449
332 Ga0075436_100004747 3300006914 Bacteria 9326
333 Ga0075436_100010941 3300006914 Bacteria 6228
334 Ga0075436_100017435 3300006914 Bacteria 4917
335 Ga0075436_100064559 3300006914 Bacteria 2531
336 Ga0075436_100136101 3300006914 Bacteria 1725
337 Ga0097620_100067112 3300006931 Bacteria 3621
338 Ga0097620_100119073 3300006931 Bacteria 2706
339 Ga0097620_100167443 3300006931 Bacteria 2277
340 Ga0097620_100670345 3300006931 Bacteria 1129
341 Ga0075435_100006252 3300007076 Bacteria 8409
342 Ga0099794_10025551 3300007265 Unclassified 2722
343 Ga0105240_10034830 3300009093 Bacteria 6491
344 Ga0105240_10242719 3300009093 Bacteria 2088
345 Ga0105240_10291716 3300009093 Bacteria 1869
346 Ga0105240_10310155 3300009093 Bacteria 1802
347 Ga0111539_10042573 3300009094 Bacteria 5451
348 Ga0111539_10052529 3300009094 Unclassified 4851
349 Ga0111539_10370993 3300009094 Bacteria 1666
350 Ga0111539_10420958 3300009094 Bacteria 1556
351 Ga0105245_10004990 3300009098 Bacteria 11666
352 Ga0105245_10005211 3300009098 Bacteria 11416
353 Ga0105245_10041918 3300009098 Bacteria 4082
354 Ga0105245_10093486 3300009098 Bacteria 2771
355 Ga0105245_10313529 3300009098 Bacteria 1543
356 Ga0105247_10195420 3300009101 Bacteria 1356
357 Ga0114129_10009159 3300009147 Bacteria 14112
358 Ga0114129_10043062 3300009147 Bacteria 6354
359 Ga0114129_10098561 3300009147 Bacteria 4046
360 Ga0114129_10098928 3300009147 Bacteria 4037
361 Ga0114129_10199121 3300009147 Unclassified 2714
362 Ga0105243_10594958 3300009148 Bacteria 1064
363 Ga0105241_10023408 3300009174 Bacteria 4580
364 Ga0105241_10030751 3300009174 Bacteria 4016
365 Ga0105241_10111404 3300009174 Bacteria 2191
366 Ga0105241_10209701 3300009174 Unclassified 1632
367 Ga0105242_10002448 3300009176 Bacteria 14564
368 Ga0105242_10004910 3300009176 Bacteria 10350
369 Ga0105242_10023587 3300009176 Bacteria 4849
370 Ga0105242_10066539 3300009176 Bacteria 2976
371 Ga0105248_10028017 3300009177 Bacteria 6274
372 Ga0105248_10039502 3300009177 Bacteria 5286
373 Ga0105248_10104779 3300009177 Bacteria 3189
374 Ga0105248_10107095 3300009177 Bacteria 3152
375 Ga0105248_10310254 3300009177 Bacteria 1777
376 Ga0105237_10015361 3300009545 Bacteria 7972
377 Ga0105237_10031661 3300009545 Bacteria 5357
378 Ga0105238_10059384 3300009551 Bacteria 3831
379 Ga0105238_10173281 3300009551 Bacteria 2134
380 Ga0105238_10180109 3300009551 Bacteria 2090
381 Ga0105238_10297021 3300009551 Bacteria 1598
382 Ga0105249_10000027 3300009553 Bacteria 231352
383 Ga0105249_10000199 3300009553 Bacteria 68792
384 Ga0105249_10004256 3300009553 Bacteria 12379
385 Ga0105246_10019636 3300011119 Bacteria 4322
386 Ga0105246_10155844 3300011119 Bacteria 1734
387 Ga0157373_10019572 3300013100 Bacteria 4924
388 Ga0157373_10069481 3300013100 Bacteria 2490
389 Ga0157373_10160740 3300013100 Bacteria 1580
390 Ga0157371_10004178 3300013102 Bacteria 12725
391 Ga0157370_10003374 3300013104 Bacteria 18778
392 Ga0157370_10129410 3300013104 Bacteria 2355
393 Ga0157370_10153783 3300013104 Bacteria 2140
394 Ga0157369_10011996 3300013105 Bacteria 9843
395 Ga0157369_10036257 3300013105 Bacteria 5404
396 Ga0157369_10092570 3300013105 Bacteria 3226
397 Ga0157369_10110825 3300013105 Bacteria 2917
398 Ga0157369_10120069 3300013105 Bacteria 2789
399 Ga0157369_10207290 3300013105 Bacteria 2056
400 Ga0157369_10611204 3300013105 Bacteria 1125
401 Ga0157374_10040816 3300013296 Bacteria 4274
402 Ga0157374_10538283 3300013296 Bacteria 1175
403 Ga0157378_10022647 3300013297 Bacteria 5530
404 Ga0157378_10053317 3300013297 Bacteria 3601
405 Ga0157378_10064791 3300013297 Bacteria 3270
406 Ga0157378_10110325 3300013297 Bacteria 2521
407 Ga0157378_10144818 3300013297 Bacteria 2209
408 Ga0163162_10004093 3300013306 Bacteria 13996
409 Ga0163162_10466005 3300013306 Bacteria 1395
410 Ga0157372_10014261 3300013307 Bacteria 8496
411 Ga0157372_10023309 3300013307 Bacteria 6710
412 Ga0157372_10024867 3300013307 Bacteria 6509
413 Ga0157372_10026183 3300013307 Bacteria 6346
414 Ga0157372_10030056 3300013307 Bacteria 5940
415 Ga0157372_10035730 3300013307 Bacteria 5472
416 Ga0157372_10044758 3300013307 Bacteria 4905
417 Ga0157372_10046700 3300013307 Bacteria 4808
418 Ga0157372_10102005 3300013307 Bacteria 3277
419 Ga0157372_10175957 3300013307 Bacteria 2477
420 Ga0157372_10748863 3300013307 Bacteria 1136
421 Ga0157375_10007469 3300013308 Bacteria 9560
422 Ga0157375_10011017 3300013308 Bacteria 7974
423 Ga0157375_10045419 3300013308 Bacteria 4275
424 Ga0157375_10061968 3300013308 Bacteria 3715
425 Ga0157375_10076719 3300013308 Bacteria 3370
426 Ga0157375_10135902 3300013308 Bacteria 2582
427 Ga0157375_10152055 3300013308 Bacteria 2451
428 Ga0157375_10200002 3300013308 Bacteria 2154
429 Ga0163163_10211900 3300014325 Bacteria 1987
430 Ga0163163_10360460 3300014325 Bacteria 1510
431 Ga0157380_10004094 3300014326 Bacteria 10075
432 Ga0157380_10260898 3300014326 Bacteria 1574
433 Ga0157377_10001055 3300014745 Bacteria 11667
434 Ga0157377_10022270 3300014745 Bacteria 3343
435 Ga0157377_10070668 3300014745 Bacteria 2017
436 Ga0157379_10037929 3300014968 Bacteria 4298
437 Ga0157379_10217315 3300014968 Bacteria 1731
438 Ga0163161_10082717 3300017792 Bacteria 2366
439 Ga0206353_10828394 3300020082 Bacteria 2039
440 Ga0207697_10015529 3300025315 Bacteria 3145
441 Ga0207697_10030392 3300025315 Bacteria 2210
442 Ga0207656_10012547 3300025321 Bacteria 3225
443 Ga0207653_10017710 3300025885 Bacteria 2243
444 Ga0207653_10070395 3300025885 Bacteria 1195
445 Ga0207682_10022884 3300025893 Bacteria 2465
446 Ga0207682_10031167 3300025893 Bacteria 2139
447 Ga0207692_10019122 3300025898 Bacteria 3090
448 Ga0207692_10131294 3300025898 Bacteria 1415
449 Ga0207642_10002177 3300025899 Bacteria 6073
450 Ga0207642_10011144 3300025899 Bacteria 3197
451 Ga0207680_10087365 3300025903 Bacteria 1974
452 Ga0207647_10132557 3300025904 Bacteria 1464
453 Ga0207699_10001761 3300025906 Bacteria 10219
454 Ga0207699_10005475 3300025906 Bacteria 6080
455 Ga0207699_10029412 3300025906 Bacteria 3064
456 Ga0207645_10000183 3300025907 Bacteria 50122
457 Ga0207645_10005330 3300025907 Bacteria 9348
458 Ga0207645_10062268 3300025907 Bacteria 2383
459 Ga0207643_10002421 3300025908 Bacteria 10106
460 Ga0207643_10005312 3300025908 Bacteria 6890
461 Ga0207705_10004929 3300025909 Bacteria 10020
462 Ga0207705_10006304 3300025909 Bacteria 8803
463 Ga0207705_10121188 3300025909 Bacteria 1941
464 Ga0207705_10180236 3300025909 Bacteria 1594
465 Ga0207705_10335480 3300025909 Bacteria 1163
466 Ga0207684_10027860 3300025910 Bacteria 4812
467 Ga0207684_10093160 3300025910 Bacteria 2568
468 Ga0207684_10198622 3300025910 Bacteria 1730
469 Ga0207684_10267356 3300025910 Bacteria 1475
470 Ga0207684_10485249 3300025910 Bacteria 1060
471 Ga0207654_10029460 3300025911 Bacteria 3006
472 Ga0207654_10156662 3300025911 Bacteria 1467
473 Ga0207707_10001523 3300025912 Bacteria 21375
474 Ga0207707_10001531 3300025912 Bacteria 21338
475 Ga0207707_10003709 3300025912 Bacteria 13529
476 Ga0207707_10005648 3300025912 Bacteria 10948
477 Ga0207707_10006778 3300025912 Bacteria 9994
478 Ga0207707_10008968 3300025912 Bacteria 8690
479 Ga0207707_10032600 3300025912 Bacteria 4560
480 Ga0207707_10046041 3300025912 Bacteria 3799
481 Ga0207707_10047730 3300025912 Bacteria 3729
482 Ga0207707_10071471 3300025912 Bacteria 3024
483 Ga0207707_10084499 3300025912 Bacteria 2772
484 Ga0207707_10089949 3300025912 Bacteria 2683
485 Ga0207707_10107381 3300025912 Bacteria 2440
486 Ga0207695_10027235 3300025913 Bacteria 6368
487 Ga0207695_10093795 3300025913 Bacteria 3011
488 Ga0207695_10108432 3300025913 Bacteria 2761
489 Ga0207695_10238242 3300025913 Bacteria 1722
490 Ga0207671_10268965 3300025914 Bacteria 1343
491 Ga0207693_10008875 3300025915 Bacteria 8212
492 Ga0207693_10058873 3300025915 Bacteria 3010
493 Ga0207693_10089337 3300025915 Bacteria 2414
494 Ga0207663_10007936 3300025916 Bacteria 5536
495 Ga0207660_10000238 3300025917 Bacteria 35589
496 Ga0207660_10006330 3300025917 Bacteria 7674
497 Ga0207660_10016979 3300025917 Bacteria 4828
498 Ga0207660_10019765 3300025917 Bacteria 4509
499 Ga0207660_10023147 3300025917 Bacteria 4192
500 Ga0207660_10025238 3300025917 Bacteria 4033
501 Ga0207660_10031718 3300025917 Bacteria 3643
502 Ga0207660_10037523 3300025917 Bacteria 3377
503 Ga0207660_10037713 3300025917 Bacteria 3370
504 Ga0207660_10051088 3300025917 Bacteria 2938
505 Ga0207660_10058997 3300025917 Bacteria 2753
506 Ga0207660_10067709 3300025917 Bacteria 2587
507 Ga0207660_10068293 3300025917 Bacteria 2577
508 Ga0207660_10079499 3300025917 Bacteria 2405
509 Ga0207660_10109672 3300025917 Unclassified 2075
510 Ga0207660_10116102 3300025917 Bacteria 2021
511 Ga0207660_10144496 3300025917 Bacteria 1821
512 Ga0207662_10002047 3300025918 Bacteria 9984
513 Ga0207662_10003481 3300025918 Bacteria 8105
514 Ga0207662_10007365 3300025918 Bacteria 5988
515 Ga0207662_10019240 3300025918 Bacteria 3883
516 Ga0207657_10000921 3300025919 Bacteria 31122
517 Ga0207657_10090121 3300025919 Bacteria 2560
518 Ga0207657_10236139 3300025919 Bacteria 1461
519 Ga0207657_10270933 3300025919 Bacteria 1349
520 Ga0207657_10393338 3300025919 Bacteria 1091
521 Ga0207649_10003545 3300025920 Bacteria 8531
522 Ga0207649_10009676 3300025920 Bacteria 5278
523 Ga0207649_10022935 3300025920 Bacteria 3609
524 Ga0207649_10029678 3300025920 Bacteria 3231
525 Ga0207652_10001245 3300025921 Bacteria 22724
526 Ga0207652_10001643 3300025921 Bacteria 19623
527 Ga0207652_10002295 3300025921 Bacteria 16214
528 Ga0207652_10014440 3300025921 Bacteria 6398
529 Ga0207652_10026525 3300025921 Bacteria 4827
530 Ga0207652_10038493 3300025921 Bacteria 4054
531 Ga0207652_10047160 3300025921 Bacteria 3680
532 Ga0207652_10056887 3300025921 Unclassified 3367
533 Ga0207652_10061052 3300025921 Bacteria 3254
534 Ga0207652_10078565 3300025921 Bacteria 2882
535 Ga0207652_10108319 3300025921 Bacteria 2462
536 Ga0207652_10149336 3300025921 Bacteria 2092
537 Ga0207646_10003899 3300025922 Bacteria 16559
538 Ga0207646_10007505 3300025922 Bacteria 11066
539 Ga0207646_10009684 3300025922 Bacteria 9498
540 Ga0207646_10076584 3300025922 Bacteria 2989
541 Ga0207646_10112165 3300025922 Bacteria 2447
542 Ga0207646_10270378 3300025922 Bacteria 1536
543 Ga0207681_10001947 3300025923 Bacteria 13251
544 Ga0207681_10003688 3300025923 Bacteria 9518
545 Ga0207681_10004290 3300025923 Bacteria 8801
546 Ga0207694_10096477 3300025924 Bacteria 2338
547 Ga0207650_10005530 3300025925 Bacteria 8622
548 Ga0207650_10037877 3300025925 Bacteria 3517
549 Ga0207659_10004586 3300025926 Bacteria 8359
550 Ga0207659_10112473 3300025926 Bacteria 2072
551 Ga0207659_10125112 3300025926 Bacteria 1976
552 Ga0207687_10152998 3300025927 Bacteria 1762
553 Ga0207687_10154017 3300025927 Bacteria 1757
554 Ga0207687_10207072 3300025927 Bacteria 1537
555 Ga0207687_10209355 3300025927 Bacteria 1529
556 Ga0207700_10000127 3300025928 Bacteria 45226
557 Ga0207664_10002343 3300025929 Bacteria 12524
558 Ga0207664_10048994 3300025929 Bacteria 3324
559 Ga0207664_10071817 3300025929 Bacteria 2789
560 Ga0207664_10175470 3300025929 Bacteria 1837
561 Ga0207644_10058056 3300025931 Bacteria 2796
562 Ga0207690_10003280 3300025932 Bacteria 9695
563 Ga0207690_10006373 3300025932 Bacteria 6994
564 Ga0207690_10258604 3300025932 Bacteria 1348
565 Ga0207706_10000565 3300025933 Bacteria 39296
566 Ga0207706_10012191 3300025933 Bacteria 7833
567 Ga0207706_10026259 3300025933 Bacteria 5213
568 Ga0207706_10076139 3300025933 Bacteria 2951
569 Ga0207706_10124707 3300025933 Bacteria 2266
570 Ga0207686_10069814 3300025934 Bacteria 2255
571 Ga0207686_10078807 3300025934 Bacteria 2143
572 Ga0207670_10034304 3300025936 Bacteria 3278
573 Ga0207670_10076266 3300025936 Bacteria 2332
574 Ga0207669_10046568 3300025937 Bacteria 2564
575 Ga0207669_10049180 3300025937 Bacteria 2511
576 Ga0207669_10090436 3300025937 Bacteria 1991
577 Ga0207669_10120272 3300025937 Unclassified 1781
578 Ga0207669_10279220 3300025937 Bacteria 1259
579 Ga0207704_10042122 3300025938 Bacteria 2685
580 Ga0207704_10090078 3300025938 Bacteria 2012
581 Ga0207704_10326947 3300025938 Bacteria 1185
582 Ga0207665_10000392 3300025939 Bacteria 29995
583 Ga0207665_10005957 3300025939 Bacteria 8111
584 Ga0207665_10041641 3300025939 Bacteria 3068
585 Ga0207665_10081536 3300025939 Bacteria 2228
586 Ga0207691_10000109 3300025940 Bacteria 73421
587 Ga0207691_10000685 3300025940 Bacteria 33454
588 Ga0207691_10023055 3300025940 Bacteria 5864
589 Ga0207691_10048148 3300025940 Bacteria 3909
590 Ga0207691_10075624 3300025940 Bacteria 3036
591 Ga0207691_10172390 3300025940 Bacteria 1894
592 Ga0207691_10466690 3300025940 Bacteria 1073
593 Ga0207711_10047435 3300025941 Bacteria 3672
594 Ga0207711_10073206 3300025941 Bacteria 2977
595 Ga0207689_10000181 3300025942 Bacteria 54883
596 Ga0207689_10005513 3300025942 Bacteria 11311
597 Ga0207689_10097526 3300025942 Bacteria 2414
598 Ga0207661_10002310 3300025944 Bacteria 13131
599 Ga0207661_10004772 3300025944 Bacteria 9492
600 Ga0207661_10008163 3300025944 Bacteria 7472
601 Ga0207661_10011578 3300025944 Bacteria 6398
602 Ga0207661_10014723 3300025944 Bacteria 5738
603 Ga0207661_10015259 3300025944 Bacteria 5649
604 Ga0207661_10104946 3300025944 Bacteria 2380
605 Ga0207661_10169874 3300025944 Bacteria 1898
606 Ga0207679_10001098 3300025945 Bacteria 17220
607 Ga0207679_10005409 3300025945 Bacteria 8000
608 Ga0207679_10018167 3300025945 Bacteria 4706
609 Ga0207679_10024147 3300025945 Bacteria 4165
610 Ga0207679_10030240 3300025945 Bacteria 3779
611 Ga0207679_10048097 3300025945 Bacteria 3103
612 Ga0207679_10056344 3300025945 Unclassified 2902
613 Ga0207679_10071013 3300025945 Bacteria 2625
614 Ga0207679_10131480 3300025945 Bacteria 2009
615 Ga0207679_10282857 3300025945 Bacteria 1423
616 Ga0207679_10343488 3300025945 Bacteria 1299
617 Ga0207667_10034655 3300025949 Bacteria 5419
618 Ga0207667_10126476 3300025949 Bacteria 2632
619 Ga0207667_10447943 3300025949 Bacteria 1312
620 Ga0207651_10135618 3300025960 Bacteria 1892
621 Ga0207712_10000276 3300025961 Bacteria 49078
622 Ga0207712_10000353 3300025961 Bacteria 40832
623 Ga0207712_10036346 3300025961 Bacteria 3354
624 Ga0207668_10019075 3300025972 Bacteria 4328
625 Ga0207668_10025365 3300025972 Bacteria 3836
626 Ga0207640_10098307 3300025981 Bacteria 2046
627 Ga0207640_10106130 3300025981 Bacteria 1981
628 Ga0207640_10283511 3300025981 Bacteria 1302
629 Ga0207658_10022743 3300025986 Bacteria 4367
630 Ga0207658_10023602 3300025986 Bacteria 4295
631 Ga0207658_10124765 3300025986 Bacteria 2059
632 Ga0207658_10278163 3300025986 Bacteria 1434
633 Ga0207677_10012998 3300026023 Bacteria 4810
634 Ga0207677_10039299 3300026023 Bacteria 3110
635 Ga0207703_10092608 3300026035 Bacteria 2544
636 Ga0207639_10041304 3300026041 Bacteria 3449
637 Ga0207639_10045201 3300026041 Bacteria 3316
638 Ga0207639_10163107 3300026041 Bacteria 1880
639 Ga0207678_10022886 3300026067 Bacteria 5470
640 Ga0207678_10111572 3300026067 Bacteria 2333
641 Ga0207708_10009211 3300026075 Bacteria 7307
642 Ga0207708_10024580 3300026075 Bacteria 4557
643 Ga0207708_10032892 3300026075 Bacteria 3937
644 Ga0207708_10114605 3300026075 Bacteria 2095
645 Ga0207702_10126990 3300026078 Bacteria 2291
646 Ga0207702_10156467 3300026078 Bacteria 2078
647 Ga0207702_10270524 3300026078 Bacteria 1602
648 Ga0207702_10275392 3300026078 Bacteria 1589
649 Ga0207641_10117873 3300026088 Bacteria 2364
650 Ga0207641_10166383 3300026088 Bacteria 2009
651 Ga0207641_10254050 3300026088 Bacteria 1643
652 Ga0207648_10006701 3300026089 Bacteria 11424
653 Ga0207648_10032327 3300026089 Bacteria 4620
654 Ga0207648_10089318 3300026089 Bacteria 2692
655 Ga0207648_10167413 3300026089 Bacteria 1942
656 Ga0207676_10002114 3300026095 Bacteria 14397
657 Ga0207674_10000081 3300026116 Bacteria 101724
658 Ga0207674_10000388 3300026116 Bacteria 57168
659 Ga0207674_10000888 3300026116 Bacteria 39092
660 Ga0207674_10007250 3300026116 Bacteria 12931
661 Ga0207674_10048782 3300026116 Bacteria 4332
662 Ga0207674_10187885 3300026116 Bacteria 2016
663 Ga0207674_10281048 3300026116 Unclassified 1612
664 Ga0207675_100000650 3300026118 Bacteria 34209
665 Ga0207675_100003901 3300026118 Bacteria 14502
666 Ga0207675_100083549 3300026118 Bacteria 2995
667 Ga0207683_10020695 3300026121 Bacteria 5628
668 Ga0207698_10000888 3300026142 Bacteria 17346
669 Ga0207698_10014306 3300026142 Bacteria 5271
670 Ga0207698_10095935 3300026142 Bacteria 2443
671 Ga0207698_10585541 3300026142 Bacteria 1098
672 Ga0209969_1001717 3300027360 Bacteria 3020
673 Ga0209999_1004276 3300027543 Unclassified 2571
674 Ga0209970_1014421 3300027614 Bacteria 1313
675 Ga0209966_1000923 3300027695 Bacteria 5561
676 Ga0209998_10003473 3300027717 Bacteria 3443
677 Ga0209974_10026274 3300027876 Bacteria 1928
678 Ga0268265_10001227 3300028380 Bacteria 22225
679 Ga0268265_10072678 3300028380 Bacteria 2683
680 Ga0268265_10150856 3300028380 Bacteria 1960
681 Ga0268264_10080970 3300028381 Bacteria 2774
682 Ga0307408_100016250 3300031548 Bacteria 4964
683 Ga0307408_100019018 3300031548 Bacteria 4620
684 Ga0307408_100048028 3300031548 Bacteria 3060
685 Ga0307408_100051921 3300031548 Bacteria 2956
686 Ga0307408_100094821 3300031548 Bacteria 2261
687 Ga0307408_100170777 3300031548 Bacteria 1736
688 Ga0307408_100421756 3300031548 Bacteria 1151
689 Ga0307405_10009469 3300031731 Bacteria 4995
690 Ga0307405_10019818 3300031731 Bacteria 3746
691 Ga0307405_10090158 3300031731 Bacteria 2027
692 Ga0307405_10152914 3300031731 Bacteria 1625
693 Ga0307413_10026970 3300031824 Bacteria 3175
694 Ga0307413_10059196 3300031824 Bacteria 2352
695 Ga0307413_10103937 3300031824 Bacteria 1884
696 Ga0307413_10118703 3300031824 Bacteria 1786
697 Ga0307413_10181091 3300031824 Bacteria 1502
698 Ga0307413_10339251 3300031824 Bacteria 1155
699 Ga0307410_10001361 3300031852 Bacteria 10977
700 Ga0307410_10004326 3300031852 Bacteria 7323
701 Ga0307410_10005792 3300031852 Bacteria 6588
702 Ga0307410_10013670 3300031852 Bacteria 4745
703 Ga0307410_10199764 3300031852 Bacteria 1526
704 Ga0307410_10264618 3300031852 Bacteria 1342
705 Ga0307406_10011369 3300031901 Bacteria 5050
706 Ga0307406_10022122 3300031901 Bacteria 3770
707 Ga0307406_10040555 3300031901 Bacteria 2895
708 Ga0307406_10061576 3300031901 Bacteria 2424
709 Ga0307406_10120515 3300031901 Bacteria 1823
710 Ga0307407_10009235 3300031903 Bacteria 4580
711 Ga0307407_10069875 3300031903 Bacteria 2086
712 Ga0307407_10088662 3300031903 Bacteria 1890
713 Ga0307407_10107271 3300031903 Bacteria 1746
714 Ga0307407_10127181 3300031903 Bacteria 1625
715 Ga0307412_10066778 3300031911 Bacteria 2439
716 Ga0307412_10257824 3300031911 Bacteria 1357
717 Ga0307409_100002214 3300031995 Bacteria 10050
718 Ga0307409_100029486 3300031995 Bacteria 3928
719 Ga0307409_100030207 3300031995 Bacteria 3890
720 Ga0307409_100036578 3300031995 Bacteria 3610
721 Ga0307409_100052141 3300031995 Bacteria 3134
722 Ga0307409_100058840 3300031995 Bacteria 2987
723 Ga0307409_100079531 3300031995 Bacteria 2642
724 Ga0307409_100325405 3300031995 Bacteria 1440
725 Ga0307416_100011387 3300032002 Bacteria 5927
726 Ga0307416_100019225 3300032002 Bacteria 4837
727 Ga0307416_100030151 3300032002 Bacteria 4066
728 Ga0307416_100088318 3300032002 Bacteria 2650
729 Ga0307416_100088768 3300032002 Bacteria 2645
730 Ga0307416_100136057 3300032002 Bacteria 2223
731 Ga0307416_100224601 3300032002 Bacteria 1804
732 Ga0307416_100331676 3300032002 Bacteria 1529
733 Ga0307416_100348198 3300032002 Bacteria 1498
734 Ga0307416_100411324 3300032002 Bacteria 1393
735 Ga0307416_100576451 3300032002 Bacteria 1202
736 Ga0307414_10023391 3300032004 Bacteria 3918
737 Ga0307414_10116253 3300032004 Bacteria 2047
738 Ga0307414_10142580 3300032004 Bacteria 1878
739 Ga0307414_10203710 3300032004 Bacteria 1611
740 Ga0307411_10001049 3300032005 Bacteria 10707
741 Ga0307411_10006072 3300032005 Bacteria 6005
742 Ga0307411_10011050 3300032005 Bacteria 4850
743 Ga0307411_10021823 3300032005 Bacteria 3756
744 Ga0307411_10035785 3300032005 Bacteria 3105
745 Ga0307415_100013989 3300032126 Bacteria 4702
746 Ga0307415_100035168 3300032126 Bacteria 3270
747 Ga0307415_100117382 3300032126 Bacteria 1987
748 Ga0307415_100189021 3300032126 Bacteria 1623
749 Ga0307415_100297284 3300032126 Bacteria 1336
750 Ga0373959_0008506 3300034820 Bacteria 1748
751 Ga0373934_0003818 3300035086 Bacteria 5547
752 Ga0373934_0006027 3300035086 Bacteria 4485
753 Ga0373934_0148798 3300035086 Bacteria 958
754 Ga0373923_0009261 3300035111 Bacteria 3549
755 Ga0373956_0001092 3300035119 Bacteria 11166
756 Ga0373943_0000516 3300035170 Bacteria 16651
757 Ga0373943_0118972 3300035170 Bacteria 1402
758 Ga0373946_0006578 3300035171 Bacteria 4218
759 Ga0373946_0030047 3300035171 Bacteria 2167
760 Ga0373955_0018484 3300035172 Bacteria 3468
761 Ga0373955_0068087 3300035172 Bacteria 1983
762 Ga0373924_0002810 3300035410 Bacteria 5889
763 Ga0373931_0007349 3300035691 Bacteria 5185
764 Ga0373935_0025123 3300035692 Bacteria 3671
765 Ga0373935_0360972 3300035692 Bacteria 1037
766 Ga0373927_0003119 3300035695 Bacteria 11988
767 Ga0373927_0028708 3300035695 Bacteria 3629
768 Ga0373933_0002359 3300035724 Bacteria 10678
769 Ga0373933_0065419 3300035724 Bacteria 2201
770 Ga0373947_0000354 3300035725 Bacteria 26002
771 Ga0373947_0322747 3300035725 Bacteria 1033
772 Ga0373937_0017443 3300036401 Bacteria 6396
773 Ga0373937_0058346 3300036401 Bacteria 3545
774 Ga0373937_0186683 3300036401 Bacteria 1947
775 Ga0373925_0002130 3300037068 Bacteria 16185
776 Ga0373925_0095142 3300037068 Bacteria 2281
777 Ga0373925_0260117 3300037068 Bacteria 1394
778 Ga0395899_0139200 3300037312 Bacteria 1728
779 Ga0395905_0029800 3300037471 Bacteria 5143
780 Ga0395901_0051868 3300038443 Bacteria 4264
781 Ga0242420_004405 3300038996 Bacteria 2128
782 Ga0436365_0471460 3300039437 Bacteria 5484
783 Ga0450914_003019 3300042118 Bacteria 1260
784 Ga0466957_0155083 3300044842 Bacteria 1484
785 Ga0451576_0009816 3300045051 Bacteria 11062
786 Ga0451576_0013711 3300045051 Bacteria 9055
787 Ga0451576_0015434 3300045051 Bacteria 8461
788 Ga0451576_0077197 3300045051 Bacteria 3466
789 Ga0451576_0105344 3300045051 Bacteria 2934
790 Ga0451576_0185422 3300045051 Bacteria 2173
791 Ga0451576_0692240 3300045051 Bacteria 1071
792 Ga0466967_0194357 3300045976 Bacteria 1919
793 Ga0466967_0282435 3300045976 Bacteria 1593
794 Ga0466967_0469431 3300045976 Bacteria 1232
795 Ga0495592_0042023 3300046454 Bacteria 3424
796 Ga0495603_0000907 3300046455 Bacteria 17036
797 Ga0495629_0154052 3300046459 Bacteria 1597
798 Ga0495651_0002183 3300046462 Bacteria 15113
799 Ga0495653_0000803 3300046463 Bacteria 24108
800 Ga0495580_0000095 3300046472 Bacteria 58325
801 Ga0495580_0003270 3300046472 Bacteria 13867
802 Ga0495580_0089168 3300046472 Bacteria 2147
803 Ga0495580_0172059 3300046472 Bacteria 1497
804 Ga0495582_0000169 3300046473 Bacteria 35465
805 Ga0495582_0046920 3300046473 Bacteria 2379
806 Ga0495639_0000541 3300046475 Bacteria 17684
807 Ga0495639_0061606 3300046475 Bacteria 1720
808 Ga0495664_0008560 3300046477 Bacteria 5706
809 Ga0495664_0095075 3300046477 Bacteria 1794
810 Ga0495594_0052848 3300046499 Bacteria 2237
811 Ga0495607_0004612 3300046501 Bacteria 10093
812 Ga0495608_0023535 3300046511 Bacteria 4222
813 Ga0495608_0093254 3300046511 Bacteria 1945
814 Ga0495610_0065923 3300046512 Bacteria 1707
815 Ga0495616_0018415 3300046513 Bacteria 3834
816 Ga0495618_0065767 3300046514 Bacteria 2304
817 Ga0495628_0005994 3300046516 Bacteria 10632
818 Ga0495628_0026006 3300046516 Bacteria 4779
819 Ga0495630_0013056 3300046517 Bacteria 6037
820 Ga0495630_0013921 3300046517 Bacteria 5851
821 Ga0495630_0014681 3300046517 Bacteria 5710
822 Ga0495630_0051344 3300046517 Bacteria 3087
823 Ga0495631_0035528 3300046518 Bacteria 2229
824 Ga0495648_0008854 3300046524 Bacteria 7874
825 Ga0495663_0010091 3300046525 Bacteria 2623
826 Ga0495663_0029911 3300046525 Bacteria 1611
827 Ga0495642_0108803 3300046528 Bacteria 1184
828 Ga0495652_0003633 3300046529 Bacteria 15103
829 Ga0495652_0006831 3300046529 Bacteria 10577
830 Ga0495652_0200419 3300046529 Bacteria 1515
831 Ga0495654_0011768 3300046530 Bacteria 4724
832 Ga0495665_0000198 3300046531 Bacteria 31095
833 Ga0495665_0027592 3300046531 Bacteria 3047
834 Ga0495586_0004729 3300046535 Bacteria 7278
835 Ga0495586_0011789 3300046535 Bacteria 4647
836 Ga0495586_0207189 3300046535 Bacteria 1112
837 Ga0495587_0000740 3300046536 Bacteria 21858
838 Ga0495587_0003356 3300046536 Bacteria 10676
839 Ga0495587_0012376 3300046536 Bacteria 5373
840 Ga0495645_0000080 3300046543 Bacteria 66039
841 Ga0495645_0004074 3300046543 Bacteria 9981
842 Ga0495645_0018109 3300046543 Bacteria 5055
843 Ga0495667_0003463 3300046559 Bacteria 10577
844 Ga0495667_0010614 3300046559 Bacteria 6232
845 Ga0495667_0012238 3300046559 Bacteria 5814
846 Ga0495635_0002493 3300046663 Bacteria 12569
847 Ga0495635_0106824 3300046663 Bacteria 1912
848 Ga0495661_0002757 3300046665 Bacteria 13344
849 Ga0495588_0001099 3300046674 Bacteria 11676
850 Ga0495588_0053078 3300046674 Bacteria 2090
851 Ga0495657_0014513 3300046675 Bacteria 5780
852 Ga0495599_0000259 3300046678 Bacteria 33415
853 Ga0495599_0005276 3300046678 Bacteria 7710
854 Ga0495599_0031490 3300046678 Bacteria 3329
855 Ga0495623_0000628 3300046679 Bacteria 23503
856 Ga0495647_0034734 3300046681 Bacteria 1890
857 Ga0495647_0069786 3300046681 Bacteria 1404
858 Ga0495658_0000753 3300046683 Bacteria 17480
859 Ga0495613_0022565 3300046689 Bacteria 4688
860 Ga0495613_0338907 3300046689 Bacteria 1035
861 Ga0495670_0000775 3300046691 Bacteria 15311
862 Ga0495670_0158758 3300046691 Bacteria 1187
863 Ga0495671_0002449 3300046692 Bacteria 11719
864 Ga0495600_0000138 3300046809 Bacteria 41481
865 Ga0495600_0045236 3300046809 Bacteria 2872
866 Ga0495660_0145328 3300046810 Bacteria 1176
867 Ga0495581_0000266 3300047315 Bacteria 25207
868 Ga0495581_0009007 3300047315 Bacteria 5777
869 Ga0495581_0044307 3300047315 Bacteria 2573
870 Ga0495581_0084419 3300047315 Bacteria 1840
871 Ga0495604_0000690 3300047317 Bacteria 28643
872 Ga0495604_0037050 3300047317 Bacteria 3842
873 Ga0495674_0010685 3300047319 Bacteria 8687
874 Ga0495674_0013484 3300047319 Bacteria 7686
875 Ga0495674_0081375 3300047319 Bacteria 2778
876 Ga0495680_0003192 3300047322 Bacteria 16306
877 Ga0495680_0130843 3300047322 Bacteria 1844
878 Ga0495675_0003980 3300047444 Bacteria 8956
879 Ga0495675_0013254 3300047444 Bacteria 5202
880 Ga0495675_0091852 3300047444 Bacteria 1905
881 Ga0495675_0109152 3300047444 Bacteria 1728
882 Ga0495675_0117623 3300047444 Bacteria 1656
883 Ga0495684_0006342 3300047471 Bacteria 9193
884 Ga0495684_0043142 3300047471 Bacteria 3453
885 Ga0495684_0049402 3300047471 Bacteria 3214
886 Ga0495684_0067607 3300047471 Bacteria 2717
887 Ga0495593_0000838 3300047673 Bacteria 17855
888 Ga0495602_0027969 3300048088 Bacteria 5407
889 Ga0495602_0030928 3300048088 Bacteria 5068
890 Ga0495614_0000001 3300048089 Bacteria 137656
891 Ga0496105_0202435 3300048908 Bacteria 1620
892 Ga0496109_0069678 3300048912 Bacteria 3226
893 Ga0496109_0180774 3300048912 Bacteria 1981
894 Ga0496112_0000769 3300048915 Bacteria 22559
895 Ga0496112_0002473 3300048915 Bacteria 14909
896 Ga0496112_0300094 3300048915 Bacteria 1552
897 Ga0496115_0127923 3300048918 Bacteria 2093
898 Ga0496115_0390179 3300048918 Bacteria 1131
899 Ga0496117_0075139 3300048920 Bacteria 2246
900 Ga0496121_0142264 3300048924 Bacteria 1777
901 Ga0496122_0032524 3300048925 Bacteria 4311
902 Ga0496123_0036097 3300048926 Bacteria 3511
903 Ga0496125_0009208 3300048928 Bacteria 10201
904 Ga0496126_0004544 3300048929 Bacteria 16498
905 Ga0496126_0005435 3300048929 Bacteria 14527
906 Ga0501033_0011764 3300049570 Bacteria 6689
907 Ga0501034_0108656 3300049571 Bacteria 2765
908 Ga0501034_0208494 3300049571 Bacteria 1910
909 Ga0501036_0054450 3300049572 Bacteria 3389
910 Ga0501036_0267553 3300049572 Bacteria 1432
911 Ga0501037_0234591 3300049573 Bacteria 1287
912 Ga0501038_0065186 3300049574 Bacteria 3104
913 Ga0501039_0288588 3300049575 Bacteria 1290
914 Ga0501043_0125328 3300049579 Bacteria 2014
915 Ga0501047_0005886 3300049581 Bacteria 11539
916 Ga0501047_0007961 3300049581 Bacteria 9994
917 Ga0501047_0091641 3300049581 Bacteria 2918
918 Ga0501069_0268727 3300049585 Unclassified 997
919 Ga0501070_0048962 3300049586 Bacteria 3509
920 Ga0501076_0343527 3300049592 Bacteria 1225
921 Ga0501209_011589 3300049656 Bacteria 1852
922 Ga0501216_003108 3300049660 Bacteria 2402
923 Ga0501230_008883 3300049667 Bacteria 1532
924 Ga0501233_002078 3300049668 Bacteria 3492
925 Ga0501235_004423 3300049669 Bacteria 3035
926 Ga0501249_003491 3300049679 Bacteria 3156
927 Ga0501249_008461 3300049679 Bacteria 2135
928 Ga0501252_004389 3300049682 Bacteria 1502
929 Ga0501257_015602 3300049686 Bacteria 1756
930 Ga0501221_000957 3300049704 Bacteria 4725
931 Ga0501225_0002626 3300049705 Bacteria 5518
932 Ga0501245_002533 3300049708 Bacteria 2443
933 Ga0501079_0061533 3300049741 Bacteria 2896
934 Ga0501079_0416913 3300049741 Unclassified 1054
935 Ga0501080_0050878 3300049742 Bacteria 3855
936 Ga0501081_0033028 3300049743 Bacteria 3514
937 Ga0501232_002076 3300049757 Bacteria 1695
938 Ga0501266_002543 3300049763 Bacteria 2295
939 Ga0501268_000853 3300049765 Bacteria 3546
940 Ga0501044_0350543 3300049823 Bacteria 1396
941 nmdc:mga05p37_90284_c1 3300050507 Bacteria 3776
942 nmdc:mga05p37_9827_c1 3300050507 Bacteria 11354
943 nmdc:mga0qj67_1547_c1 3300050509 Bacteria 16140
944 nmdc:mga0qj67_23498_c1 3300050509 Bacteria 4744
945 nmdc:mga0qj67_24511_c1 3300050509 Bacteria 4651
946 nmdc:mga0qj67_336642_c1 3300050509 Bacteria 1221
947 nmdc:mga0qj67_3800_c1 3300050509 Bacteria 10905
948 nmdc:mga06r32_32666_c1 3300050510 Bacteria 4898
949 nmdc:mga06r32_481487_c1 3300050510 Bacteria 1219
950 nmdc:mga06r32_509114_c1 3300050510 Bacteria 1180
951 nmdc:mga06r32_8011_c1 3300050510 Bacteria 9500
952 nmdc:mga08y16_203482_c1 3300050511 Bacteria 2051
953 nmdc:mga08y16_207005_c1 3300050511 Bacteria 2032
954 nmdc:mga08y16_65794_c1 3300050511 Bacteria 3783
955 nmdc:mga0n895_19151_c1 3300050512 Bacteria 6355
956 nmdc:mga0n895_240_c1 3300050512 Bacteria 34829
957 nmdc:mga0n895_4329_c1 3300050512 Bacteria 11640
958 nmdc:mga0n895_49634_c1 3300050512 Bacteria 4113
959 nmdc:mga0rr50_348328_c1 3300050513 Bacteria 1245
960 nmdc:mga0rr50_42071_c1 3300050513 Bacteria 3334
961 nmdc:mga0rr50_457449_c1 3300050513 Bacteria 1082
962 nmdc:mga08x19_143798_c1 3300050514 Bacteria 1612
963 nmdc:mga08x19_24665_c1 3300050514 Bacteria 3741
964 nmdc:mga08x19_39522_c1 3300050514 Bacteria 2999
965 nmdc:mga08x19_39745_c1 3300050514 Bacteria 2991
966 nmdc:mga08x19_4050_c1 3300050514 Bacteria 8705
967 nmdc:mga0a205_114988_c1 3300050515 Bacteria 2589
968 nmdc:mga0a205_216169_c1 3300050515 Bacteria 1804
969 nmdc:mga0a205_24941_c2 3300050515 Bacteria 4516
970 nmdc:mga0a205_312296_c1 3300050515 Bacteria 1444
971 nmdc:mga0a205_390433_c1 3300050515 Bacteria 1256
972 nmdc:mga0a205_74226_c1 3300050515 Bacteria 3287
973 nmdc:mga0a205_93548_c1 3300050515 Bacteria 2904
974 Ga0495601_0004802 3300053077 Bacteria 7834
975 Ga0495601_0183568 3300053077 Bacteria 1367
976 Ga0495612_0001912 3300053078 Bacteria 8570
977 Ga0495612_0033278 3300053078 Bacteria 2085
978 Ga0495595_0191954 3300053084 Bacteria 1015
979 Ga0495619_0004030 3300053085 Bacteria 9407
980 Ga0500644_0000490 3300053088 Bacteria 17289
981 Ga0500641_0014770 3300053096 Bacteria 2886
982 Ga0500650_0021685 3300053098 Bacteria 2833
983 Ga0500556_0000267 3300053104 Bacteria 41211
984 Ga0500562_000277 3300053108 Bacteria 12620
985 Ga0500618_017394 3300053125 Bacteria 1789
986 Ga0500642_0000005 3300053130 Bacteria 422725
987 Ga0500658_0000786 3300053134 Bacteria 13133
988 Ga0500616_0000197 3300053153 Bacteria 98372
989 Ga0500622_0038030 3300053156 Bacteria 2512
990 Ga0500627_0001135 3300053158 Bacteria 7294
991 Ga0500627_0007012 3300053158 Bacteria 3888
992 Ga0500633_0026242 3300053160 Bacteria 1832
993 Ga0500636_0006534 3300053177 Bacteria 6694
994 Ga0501084_0292526 3300054114 Bacteria 1376
995 Ga0501084_0492423 3300054114 Bacteria 1036

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0009816 Ga0451576_0009816_918_1721 225
2 3300005343 Ga0070687_100047189 Ga0070687_1000471892 228
3 3300005545 Ga0070695_100060097 Ga0070695_1000600973 228
4 3300013297 Ga0157378_10053317 Ga0157378_100533174 228
5 3300026075 Ga0207708_10114605 Ga0207708_101146052 228
6 3300005344 Ga0070661_100234470 Ga0070661_1002344702 229
7 3300005564 Ga0070664_100013240 Ga0070664_1000132405 229
8 3300025945 Ga0207679_10048097 Ga0207679_100480973 229
9 3300009147 Ga0114129_10098561 Ga0114129_100985613 232
10 3300050512 nmdc:mga0n895_4329_c1 nmdc:mga0n895_4329_c1_3486_4310 232
11 3300050514 nmdc:mga08x19_39522_c1 nmdc:mga08x19_39522_c1_439_1281 234
12 3300045051 Ga0451576_0692240 Ga0451576_0692240_125_925 236
13 3300005406 Ga0070703_10002559 Ga0070703_100025594 238
14 3300005444 Ga0070694_100095098 Ga0070694_1000950982 238
15 3300005445 Ga0070708_100005774 Ga0070708_1000057744 238
16 3300005445 Ga0070708_100280671 Ga0070708_1002806712 238
17 3300005467 Ga0070706_100012945 Ga0070706_1000129453 238
18 3300005467 Ga0070706_100260335 Ga0070706_1002603352 238
19 3300005518 Ga0070699_100011295 Ga0070699_1000112953 238
20 3300005518 Ga0070699_100054612 Ga0070699_1000546123 238
21 3300005536 Ga0070697_100235551 Ga0070697_1002355512 238
22 3300025885 Ga0207653_10017710 Ga0207653_100177102 238
23 3300025939 Ga0207665_10005957 Ga0207665_100059572 238
24 3300005444 Ga0070694_100000139 Ga0070694_1000001395 240
25 3300005468 Ga0070707_100017848 Ga0070707_1000178482 240
26 3300005518 Ga0070699_100186548 Ga0070699_1001865483 240
27 3300005536 Ga0070697_100024628 Ga0070697_1000246281 240
28 3300005545 Ga0070695_100004425 Ga0070695_1000044253 240
29 3300005546 Ga0070696_100150548 Ga0070696_1001505482 240
30 3300025922 Ga0207646_10112165 Ga0207646_101121652 240
31 3300005440 Ga0070705_100007921 Ga0070705_1000079213 243
32 3300005545 Ga0070695_100026367 Ga0070695_1000263673 245
33 3300005546 Ga0070696_100036167 Ga0070696_1000361672 245
34 3300005549 Ga0070704_100012319 Ga0070704_1000123193 245
35 3300006852 Ga0075433_10001420 Ga0075433_100014208 245
36 3300006871 Ga0075434_100001773 Ga0075434_10000177312 245
37 3300006871 Ga0075434_100036436 Ga0075434_1000364364 245
38 3300025910 Ga0207684_10027860 Ga0207684_100278602 245
39 3300025922 Ga0207646_10007505 Ga0207646_100075054 245
40 3300050512 nmdc:mga0n895_240_c1 nmdc:mga0n895_240_c1_5638_6501 245
41 3300050515 nmdc:mga0a205_93548_c1 nmdc:mga0a205_93548_c1_1075_1938 245
42 3300006871 Ga0075434_100070881 Ga0075434_1000708813 247
43 3300031548 Ga0307408_100048028 Ga0307408_1000480282 247
44 3300031852 Ga0307410_10013670 Ga0307410_100136702 247
45 3300031903 Ga0307407_10107271 Ga0307407_101072711 247
46 3300031995 Ga0307409_100325405 Ga0307409_1003254052 247
47 3300032004 Ga0307414_10023391 Ga0307414_100233912 247
48 3300050512 nmdc:mga0n895_49634_c1 nmdc:mga0n895_49634_c1_2642_3487 247
49 3300050513 nmdc:mga0rr50_42071_c1 nmdc:mga0rr50_42071_c1_324_1169 247
50 3300050514 nmdc:mga08x19_24665_c1 nmdc:mga08x19_24665_c1_2165_3010 247
51 3300050515 nmdc:mga0a205_74226_c1 nmdc:mga0a205_74226_c1_754_1599 247
52 3300053125 Ga0500618_017394 Ga0500618_017394_292_1182 249
53 3300053177 Ga0500636_0006534 Ga0500636_0006534_324_1214 249
54 3300005336 Ga0070680_100001898 Ga0070680_1000018985 251
55 3300005536 Ga0070697_100206139 Ga0070697_1002061392 251
56 3300006844 Ga0075428_100035486 Ga0075428_1000354863 251
57 3300006914 Ga0075436_100010941 Ga0075436_1000109414 251
58 3300006914 Ga0075436_100017435 Ga0075436_1000174353 251
59 3300009094 Ga0111539_10052529 Ga0111539_100525293 251
60 3300025885 Ga0207653_10070395 Ga0207653_100703952 251
61 3300025917 Ga0207660_10144496 Ga0207660_101444961 251
62 3300005434 Ga0070709_10150408 Ga0070709_101504081 252
63 3300005439 Ga0070711_100000333 Ga0070711_10000033320 252
64 3300025916 Ga0207663_10007936 Ga0207663_100079362 252
65 3300025939 Ga0207665_10041641 Ga0207665_100416413 252
66 3300005471 Ga0070698_100012669 Ga0070698_1000126695 253
67 3300005545 Ga0070695_100050264 Ga0070695_1000502642 253
68 3300005549 Ga0070704_100012483 Ga0070704_1000124835 253
69 3300005578 Ga0068854_100465460 Ga0068854_1004654601 253
70 3300025922 Ga0207646_10009684 Ga0207646_100096847 253
71 3300048920 Ga0496117_0075139 Ga0496117_0075139_1312_2202 254
72 3300048928 Ga0496125_0009208 Ga0496125_0009208_5281_6171 254
73 3300053160 Ga0500633_0026242 Ga0500633_0026242_13_903 254
74 3300026089 Ga0207648_10167413 Ga0207648_101674131 255
75 3300046810 Ga0495660_0145328 Ga0495660_0145328_38_844 255
76 3300053104 Ga0500556_0000267 Ga0500556_0000267_18151_19041 255
77 3300046525 Ga0495663_0010091 Ga0495663_0010091_499_1344 256
78 3300048929 Ga0496126_0004544 Ga0496126_0004544_10985_11875 256
79 3300053153 Ga0500616_0000197 Ga0500616_0000197_79374_80264 256
80 3300053158 Ga0500627_0007012 Ga0500627_0007012_2825_3715 256
81 3300005336 Ga0070680_100055367 Ga0070680_1000553673 257
82 3300005344 Ga0070661_100214431 Ga0070661_1002144312 257
83 3300005435 Ga0070714_100024675 Ga0070714_1000246751 257
84 3300005563 Ga0068855_100168240 Ga0068855_1001682401 257
85 3300005578 Ga0068854_100027498 Ga0068854_1000274983 257
86 3300006914 Ga0075436_100064559 Ga0075436_1000645593 257
87 3300009174 Ga0105241_10030751 Ga0105241_100307514 257
88 3300025912 Ga0207707_10003709 Ga0207707_100037093 257
89 3300025913 Ga0207695_10027235 Ga0207695_100272353 257
90 3300025914 Ga0207671_10268965 Ga0207671_102689651 257
91 3300025917 Ga0207660_10023147 Ga0207660_100231475 257
92 3300025921 Ga0207652_10061052 Ga0207652_100610522 257
93 3300025981 Ga0207640_10283511 Ga0207640_102835112 257
94 3300026116 Ga0207674_10187885 Ga0207674_101878851 257
95 3300005445 Ga0070708_100213849 Ga0070708_1002138492 258
96 3300005329 Ga0070683_100017298 Ga0070683_1000172985 259
97 3300005344 Ga0070661_100032234 Ga0070661_1000322343 259
98 3300005353 Ga0070669_100341920 Ga0070669_1003419202 259
99 3300005445 Ga0070708_100096499 Ga0070708_1000964992 259
100 3300005564 Ga0070664_100024837 Ga0070664_1000248374 259
101 3300005577 Ga0068857_100009359 Ga0068857_1000093596 259
102 3300006846 Ga0075430_100001226 Ga0075430_1000012261 259
103 3300013105 Ga0157369_10036257 Ga0157369_100362572 259
104 3300013307 Ga0157372_10044758 Ga0157372_100447584 259
105 3300014325 Ga0163163_10360460 Ga0163163_103604602 259
106 3300014968 Ga0157379_10217315 Ga0157379_102173152 259
107 3300025917 Ga0207660_10109672 Ga0207660_101096722 259
108 3300054114 Ga0501084_0492423 Ga0501084_0492423_41_934 259
109 3300005328 Ga0070676_10005710 Ga0070676_100057107 260
110 3300005330 Ga0070690_100049665 Ga0070690_1000496653 260
111 3300005338 Ga0068868_100050462 Ga0068868_1000504622 260
112 3300005341 Ga0070691_10014505 Ga0070691_100145054 260
113 3300005356 Ga0070674_100040541 Ga0070674_1000405413 260
114 3300005459 Ga0068867_100018520 Ga0068867_1000185202 260
115 3300005578 Ga0068854_100164962 Ga0068854_1001649622 260
116 3300006881 Ga0068865_100010488 Ga0068865_1000104883 260
117 3300009098 Ga0105245_10313529 Ga0105245_103135292 260
118 3300013297 Ga0157378_10144818 Ga0157378_101448183 260
119 3300025899 Ga0207642_10002177 Ga0207642_100021773 260
120 3300025907 Ga0207645_10005330 Ga0207645_100053304 260
121 3300025918 Ga0207662_10007365 Ga0207662_100073652 260
122 3300025927 Ga0207687_10207072 Ga0207687_102070722 260
123 3300025933 Ga0207706_10026259 Ga0207706_100262593 260
124 3300025937 Ga0207669_10120272 Ga0207669_101202721 260
125 3300025940 Ga0207691_10023055 Ga0207691_100230552 260
126 3300026023 Ga0207677_10039299 Ga0207677_100392993 260
127 3300026075 Ga0207708_10032892 Ga0207708_100328922 260
128 3300026088 Ga0207641_10166383 Ga0207641_101663832 260
129 3300026089 Ga0207648_10089318 Ga0207648_100893182 260
130 3300005329 Ga0070683_100002955 Ga0070683_1000029558 261
131 3300005336 Ga0070680_100008911 Ga0070680_1000089116 261
132 3300005336 Ga0070680_100010446 Ga0070680_1000104462 261
133 3300005337 Ga0070682_100012299 Ga0070682_1000122993 261
134 3300005344 Ga0070661_100004756 Ga0070661_1000047568 261
135 3300005356 Ga0070674_100021188 Ga0070674_1000211884 261
136 3300005435 Ga0070714_100052772 Ga0070714_1000527723 261
137 3300005458 Ga0070681_10008058 Ga0070681_100080583 261
138 3300005535 Ga0070684_100000453 Ga0070684_10000045311 261
139 3300005547 Ga0070693_100004287 Ga0070693_1000042876 261
140 3300005563 Ga0068855_100007696 Ga0068855_10000769613 261
141 3300005564 Ga0070664_100001011 Ga0070664_10000101126 261
142 3300005577 Ga0068857_100003270 Ga0068857_1000032708 261
143 3300005578 Ga0068854_100010711 Ga0068854_1000107115 261
144 3300005614 Ga0068856_100201431 Ga0068856_1002014312 261
145 3300006881 Ga0068865_100188936 Ga0068865_1001889362 261
146 3300009176 Ga0105242_10004910 Ga0105242_100049102 261
147 3300025912 Ga0207707_10006778 Ga0207707_100067783 261
148 3300025913 Ga0207695_10108432 Ga0207695_101084323 261
149 3300025917 Ga0207660_10037523 Ga0207660_100375234 261
150 3300025917 Ga0207660_10051088 Ga0207660_100510882 261
151 3300025920 Ga0207649_10009676 Ga0207649_100096765 261
152 3300025921 Ga0207652_10056887 Ga0207652_100568872 261
153 3300025937 Ga0207669_10046568 Ga0207669_100465683 261
154 3300025944 Ga0207661_10008163 Ga0207661_100081634 261
155 3300025945 Ga0207679_10056344 Ga0207679_100563442 261
156 3300026089 Ga0207648_10006701 Ga0207648_100067016 261
157 3300026116 Ga0207674_10007250 Ga0207674_100072504 261
158 3300026121 Ga0207683_10020695 Ga0207683_100206954 261
159 3300005336 Ga0070680_100352744 Ga0070680_1003527442 262
160 3300005530 Ga0070679_100005661 Ga0070679_10000566112 262
161 3300006847 Ga0075431_100109428 Ga0075431_1001094282 262
162 3300025921 Ga0207652_10026525 Ga0207652_100265252 262
163 3300035086 Ga0373934_0148798 Ga0373934_0148798_13_804 262
164 3300048925 Ga0496122_0032524 Ga0496122_0032524_3142_4029 262
165 3300048926 Ga0496123_0036097 Ga0496123_0036097_2459_3346 262
166 3300049592 Ga0501076_0343527 Ga0501076_0343527_114_950 262
167 3300049741 Ga0501079_0061533 Ga0501079_0061533_1869_2705 262
168 3300049743 Ga0501081_0033028 Ga0501081_0033028_123_959 262
169 3300050509 nmdc:mga0qj67_336642_c1 nmdc:mga0qj67_336642_c1_271_1104 262
170 3300054114 Ga0501084_0292526 Ga0501084_0292526_45_881 262
171 3300050513 nmdc:mga0rr50_348328_c1 nmdc:mga0rr50_348328_c1_421_1218 263
172 3300014326 Ga0157380_10260898 Ga0157380_102608982 264
173 3300025893 Ga0207682_10022884 Ga0207682_100228843 264
174 3300025926 Ga0207659_10112473 Ga0207659_101124732 264
175 3300025937 Ga0207669_10090436 Ga0207669_100904361 264
176 3300048918 Ga0496115_0390179 Ga0496115_0390179_14_811 264
177 3300005518 Ga0070699_100006598 Ga0070699_1000065984 265
178 3300006871 Ga0075434_100022446 Ga0075434_1000224464 265
179 3300006914 Ga0075436_100136101 Ga0075436_1001361012 265
180 3300007076 Ga0075435_100006252 Ga0075435_1000062525 265
181 3300009545 Ga0105237_10015361 Ga0105237_100153612 265
182 3300031548 Ga0307408_100019018 Ga0307408_1000190181 265
183 3300031824 Ga0307413_10103937 Ga0307413_101039372 265
184 3300031852 Ga0307410_10005792 Ga0307410_100057925 265
185 3300031901 Ga0307406_10040555 Ga0307406_100405552 265
186 3300031903 Ga0307407_10088662 Ga0307407_100886622 265
187 3300031911 Ga0307412_10257824 Ga0307412_102578242 265
188 3300031995 Ga0307409_100002214 Ga0307409_1000022142 265
189 3300032002 Ga0307416_100411324 Ga0307416_1004113242 265
190 3300032004 Ga0307414_10203710 Ga0307414_102037102 265
191 3300032005 Ga0307411_10006072 Ga0307411_100060724 265
192 3300045051 Ga0451576_0015434 Ga0451576_0015434_1318_2163 265
193 3300045976 Ga0466967_0194357 Ga0466967_0194357_45_926 265
194 3300050512 nmdc:mga0n895_19151_c1 nmdc:mga0n895_19151_c1_4839_5684 265
195 3300050514 nmdc:mga08x19_143798_c1 nmdc:mga08x19_143798_c1_257_1102 265
196 3300005327 Ga0070658_10008504 Ga0070658_100085043 266
197 3300005339 Ga0070660_100010448 Ga0070660_1000104483 266
198 3300005366 Ga0070659_100051452 Ga0070659_1000514522 266
199 3300005440 Ga0070705_100153140 Ga0070705_1001531402 266
200 3300005444 Ga0070694_100014198 Ga0070694_1000141983 266
201 3300005467 Ga0070706_100489927 Ga0070706_1004899272 266
202 3300005530 Ga0070679_100058235 Ga0070679_1000582353 266
203 3300005545 Ga0070695_100025183 Ga0070695_1000251833 266
204 3300005546 Ga0070696_100021028 Ga0070696_1000210284 266
205 3300005549 Ga0070704_100067816 Ga0070704_1000678162 266
206 3300006852 Ga0075433_10185586 Ga0075433_101855862 266
207 3300007265 Ga0099794_10025551 Ga0099794_100255512 266
208 3300013307 Ga0157372_10024867 Ga0157372_100248673 266
209 3300013307 Ga0157372_10046700 Ga0157372_100467004 266
210 3300025909 Ga0207705_10006304 Ga0207705_100063043 266
211 3300025919 Ga0207657_10000921 Ga0207657_1000092111 266
212 3300045051 Ga0451576_0013711 Ga0451576_0013711_241_1083 266
213 3300050515 nmdc:mga0a205_312296_c1 nmdc:mga0a205_312296_c1_104_946 266
214 3300005336 Ga0070680_100004865 Ga0070680_1000048653 267
215 3300005344 Ga0070661_100022638 Ga0070661_1000226383 267
216 3300005458 Ga0070681_10052545 Ga0070681_100525452 267
217 3300005467 Ga0070706_100230398 Ga0070706_1002303982 267
218 3300005471 Ga0070698_100037988 Ga0070698_1000379882 267
219 3300009101 Ga0105247_10195420 Ga0105247_101954201 267
220 3300009177 Ga0105248_10028017 Ga0105248_100280172 267
221 3300013296 Ga0157374_10538283 Ga0157374_105382832 267
222 3300014325 Ga0163163_10211900 Ga0163163_102119002 267
223 3300025910 Ga0207684_10198622 Ga0207684_101986222 267
224 3300025912 Ga0207707_10107381 Ga0207707_101073812 267
225 3300025917 Ga0207660_10067709 Ga0207660_100677092 267
226 3300025921 Ga0207652_10108319 Ga0207652_101083192 267
227 3300045051 Ga0451576_0185422 Ga0451576_0185422_369_1250 267
228 3300048908 Ga0496105_0202435 Ga0496105_0202435_434_1315 267
229 3300048912 Ga0496109_0069678 Ga0496109_0069678_489_1370 267
230 3300048915 Ga0496112_0002473 Ga0496112_0002473_7131_8012 267
231 3300005366 Ga0070659_100270211 Ga0070659_1002702112 268
232 3300005436 Ga0070713_100202567 Ga0070713_1002025672 268
233 3300005439 Ga0070711_100239853 Ga0070711_1002398532 268
234 3300025929 Ga0207664_10002343 Ga0207664_100023434 268
235 3300009093 Ga0105240_10242719 Ga0105240_102427192 269
236 3300009177 Ga0105248_10039502 Ga0105248_100395023 269
237 3300026078 Ga0207702_10156467 Ga0207702_101564672 269
238 3300005293 Ga0065715_10133990 Ga0065715_101339902 270
239 3300005327 Ga0070658_10005003 Ga0070658_100050034 270
240 3300005327 Ga0070658_10042391 Ga0070658_100423912 270
241 3300005329 Ga0070683_100012277 Ga0070683_1000122773 270
242 3300005336 Ga0070680_100017506 Ga0070680_1000175063 270
243 3300005337 Ga0070682_100008289 Ga0070682_1000082892 270
244 3300005339 Ga0070660_100246983 Ga0070660_1002469832 270
245 3300005354 Ga0070675_100222849 Ga0070675_1002228492 270
246 3300005445 Ga0070708_100301283 Ga0070708_1003012832 270
247 3300005458 Ga0070681_10045857 Ga0070681_100458573 270
248 3300005458 Ga0070681_10094410 Ga0070681_100944102 270
249 3300005468 Ga0070707_100312839 Ga0070707_1003128392 270
250 3300005471 Ga0070698_100405704 Ga0070698_1004057042 270
251 3300005518 Ga0070699_100190601 Ga0070699_1001906012 270
252 3300005535 Ga0070684_100035061 Ga0070684_1000350614 270
253 3300005539 Ga0068853_100397052 Ga0068853_1003970522 270
254 3300005545 Ga0070695_100008847 Ga0070695_1000088475 270
255 3300005563 Ga0068855_100016881 Ga0068855_1000168817 270
256 3300005563 Ga0068855_100459220 Ga0068855_1004592202 270
257 3300005614 Ga0068856_100281053 Ga0068856_1002810532 270
258 3300009093 Ga0105240_10034830 Ga0105240_100348302 270
259 3300009093 Ga0105240_10291716 Ga0105240_102917162 270
260 3300009098 Ga0105245_10041918 Ga0105245_100419182 270
261 3300013104 Ga0157370_10003374 Ga0157370_100033742 270
262 3300013105 Ga0157369_10011996 Ga0157369_100119962 270
263 3300013105 Ga0157369_10110825 Ga0157369_101108253 270
264 3300013307 Ga0157372_10014261 Ga0157372_100142618 270
265 3300013307 Ga0157372_10026183 Ga0157372_100261835 270
266 3300013307 Ga0157372_10175957 Ga0157372_101759572 270
267 3300020082 Ga0206353_10828394 Ga0206353_108283942 270
268 3300025909 Ga0207705_10004929 Ga0207705_100049294 270
269 3300025909 Ga0207705_10121188 Ga0207705_101211882 270
270 3300025910 Ga0207684_10267356 Ga0207684_102673561 270
271 3300025912 Ga0207707_10047730 Ga0207707_100477302 270
272 3300025912 Ga0207707_10071471 Ga0207707_100714713 270
273 3300025913 Ga0207695_10238242 Ga0207695_102382422 270
274 3300025917 Ga0207660_10031718 Ga0207660_100317183 270
275 3300025919 Ga0207657_10236139 Ga0207657_102361392 270
276 3300025922 Ga0207646_10270378 Ga0207646_102703782 270
277 3300025927 Ga0207687_10154017 Ga0207687_101540172 270
278 3300025932 Ga0207690_10258604 Ga0207690_102586042 270
279 3300025949 Ga0207667_10034655 Ga0207667_100346553 270
280 3300026078 Ga0207702_10275392 Ga0207702_102753922 270
281 3300026142 Ga0207698_10585541 Ga0207698_105855412 270
282 3300046525 Ga0495663_0029911 Ga0495663_0029911_462_1340 270
283 3300009147 Ga0114129_10098928 Ga0114129_100989283 271
284 3300025909 Ga0207705_10335480 Ga0207705_103354802 271
285 3300005355 Ga0070671_100116767 Ga0070671_1001167672 272
286 3300005457 Ga0070662_100199638 Ga0070662_1001996382 272
287 3300005563 Ga0068855_100075852 Ga0068855_1000758524 272
288 3300005578 Ga0068854_100370753 Ga0068854_1003707532 272
289 3300005616 Ga0068852_100022605 Ga0068852_1000226054 272
290 3300009545 Ga0105237_10031661 Ga0105237_100316613 272
291 3300009551 Ga0105238_10173281 Ga0105238_101732812 272
292 3300011119 Ga0105246_10155844 Ga0105246_101558442 272
293 3300013105 Ga0157369_10611204 Ga0157369_106112041 272
294 3300013297 Ga0157378_10064791 Ga0157378_100647912 272
295 3300013308 Ga0157375_10135902 Ga0157375_101359022 272
296 3300025931 Ga0207644_10058056 Ga0207644_100580563 272
297 3300025938 Ga0207704_10090078 Ga0207704_100900782 272
298 3300025940 Ga0207691_10075624 Ga0207691_100756242 272
299 3300025945 Ga0207679_10131480 Ga0207679_101314802 272
300 3300026142 Ga0207698_10014306 Ga0207698_100143064 272
301 3300031824 Ga0307413_10181091 Ga0307413_101810912 272
302 3300050514 nmdc:mga08x19_39745_c1 nmdc:mga08x19_39745_c1_710_1585 272
303 3300005328 Ga0070676_10025027 Ga0070676_100250273 273
304 3300005539 Ga0068853_100048124 Ga0068853_1000481242 273
305 3300005719 Ga0068861_100035340 Ga0068861_1000353402 273
306 3300009174 Ga0105241_10209701 Ga0105241_102097012 273
307 3300009551 Ga0105238_10059384 Ga0105238_100593843 273
308 3300013100 Ga0157373_10160740 Ga0157373_101607402 273
309 3300013307 Ga0157372_10102005 Ga0157372_101020052 273
310 3300025911 Ga0207654_10156662 Ga0207654_101566622 273
311 3300025912 Ga0207707_10089949 Ga0207707_100899492 273
312 3300025921 Ga0207652_10038493 Ga0207652_100384933 273
313 3300025921 Ga0207652_10149336 Ga0207652_101493362 273
314 3300025929 Ga0207664_10071817 Ga0207664_100718172 273
315 3300025949 Ga0207667_10126476 Ga0207667_101264762 273
316 3300025981 Ga0207640_10098307 Ga0207640_100983073 273
317 3300026041 Ga0207639_10041304 Ga0207639_100413043 273
318 3300026067 Ga0207678_10111572 Ga0207678_101115723 273
319 3300026118 Ga0207675_100083549 Ga0207675_1000835492 273
320 3300031824 Ga0307413_10339251 Ga0307413_103392512 273
321 3300035692 Ga0373935_0025123 Ga0373935_0025123_1052_1918 273
322 3300046501 Ga0495607_0004612 Ga0495607_0004612_3139_4026 273
323 3300046512 Ga0495610_0065923 Ga0495610_0065923_552_1439 273
324 3300046513 Ga0495616_0018415 Ga0495616_0018415_1639_2526 273
325 3300046518 Ga0495631_0035528 Ga0495631_0035528_255_1142 273
326 3300046524 Ga0495648_0008854 Ga0495648_0008854_5640_6527 273
327 3300046530 Ga0495654_0011768 Ga0495654_0011768_2810_3697 273
328 3300046665 Ga0495661_0002757 Ga0495661_0002757_3963_4850 273
329 3300046691 Ga0495670_0000775 Ga0495670_0000775_6705_7592 273
330 3300046692 Ga0495671_0002449 Ga0495671_0002449_9981_10868 273
331 3300048924 Ga0496121_0142264 Ga0496121_0142264_802_1689 273
332 3300048929 Ga0496126_0005435 Ga0496126_0005435_6712_7599 273
333 3300049579 Ga0501043_0125328 Ga0501043_0125328_102_956 273
334 3300049581 Ga0501047_0091641 Ga0501047_0091641_1889_2743 273
335 3300053088 Ga0500644_0000490 Ga0500644_0000490_7215_8102 273
336 3300053096 Ga0500641_0014770 Ga0500641_0014770_1747_2634 273
337 3300053098 Ga0500650_0021685 Ga0500650_0021685_494_1381 273
338 3300053108 Ga0500562_000277 Ga0500562_000277_10153_11040 273
339 3300053130 Ga0500642_0000005 Ga0500642_0000005_321293_322180 273
340 3300053134 Ga0500658_0000786 Ga0500658_0000786_3958_4845 273
341 3300053156 Ga0500622_0038030 Ga0500622_0038030_1178_2065 273
342 3300053158 Ga0500627_0001135 Ga0500627_0001135_5970_6857 273
343 3300005327 Ga0070658_10002348 Ga0070658_100023488 274
344 3300005985 Ga0081539_10000354 Ga0081539_1000035431 274
345 3300009553 Ga0105249_10000027 Ga0105249_10000027166 274
346 3300025919 Ga0207657_10393338 Ga0207657_103933381 274
347 3300025945 Ga0207679_10018167 Ga0207679_100181674 274
348 3300025961 Ga0207712_10000353 Ga0207712_1000035314 274
349 3300035119 Ga0373956_0001092 Ga0373956_0001092_6911_7798 274
350 3300035172 Ga0373955_0068087 Ga0373955_0068087_1069_1956 274
351 3300035410 Ga0373924_0002810 Ga0373924_0002810_3673_4560 274
352 3300035724 Ga0373933_0002359 Ga0373933_0002359_4457_5344 274
353 3300036401 Ga0373937_0058346 Ga0373937_0058346_2258_3145 274
354 3300046454 Ga0495592_0042023 Ga0495592_0042023_2498_3385 274
355 3300046463 Ga0495653_0000803 Ga0495653_0000803_21782_22669 274
356 3300046477 Ga0495664_0095075 Ga0495664_0095075_753_1640 274
357 3300046516 Ga0495628_0005994 Ga0495628_0005994_6141_7028 274
358 3300046517 Ga0495630_0013056 Ga0495630_0013056_254_1141 274
359 3300046529 Ga0495652_0003633 Ga0495652_0003633_5643_6530 274
360 3300046535 Ga0495586_0207189 Ga0495586_0207189_178_1065 274
361 3300046536 Ga0495587_0003356 Ga0495587_0003356_6834_7721 274
362 3300046543 Ga0495645_0004074 Ga0495645_0004074_1799_2686 274
363 3300046559 Ga0495667_0010614 Ga0495667_0010614_2104_2991 274
364 3300046663 Ga0495635_0002493 Ga0495635_0002493_2432_3319 274
365 3300046675 Ga0495657_0014513 Ga0495657_0014513_457_1344 274
366 3300046678 Ga0495599_0005276 Ga0495599_0005276_3996_4883 274
367 3300046679 Ga0495623_0000628 Ga0495623_0000628_20656_21543 274
368 3300046809 Ga0495600_0000138 Ga0495600_0000138_8535_9422 274
369 3300047315 Ga0495581_0044307 Ga0495581_0044307_1096_1983 274
370 3300047317 Ga0495604_0000690 Ga0495604_0000690_13632_14519 274
371 3300047319 Ga0495674_0010685 Ga0495674_0010685_2745_3632 274
372 3300047322 Ga0495680_0003192 Ga0495680_0003192_11900_12787 274
373 3300047444 Ga0495675_0003980 Ga0495675_0003980_274_1161 274
374 3300047471 Ga0495684_0006342 Ga0495684_0006342_3369_4256 274
375 3300048088 Ga0495602_0030928 Ga0495602_0030928_1802_2689 274
376 3300053077 Ga0495601_0004802 Ga0495601_0004802_569_1456 274
377 3300053078 Ga0495612_0001912 Ga0495612_0001912_2605_3492 274
378 3300053085 Ga0495619_0004030 Ga0495619_0004030_1805_2692 274
379 3300005329 Ga0070683_100055122 Ga0070683_1000551222 275
380 3300005344 Ga0070661_100355838 Ga0070661_1003558381 275
381 3300005354 Ga0070675_100161727 Ga0070675_1001617272 275
382 3300005535 Ga0070684_100334588 Ga0070684_1003345881 275
383 3300005564 Ga0070664_100061089 Ga0070664_1000610893 275
384 3300025939 Ga0207665_10081536 Ga0207665_100815362 275
385 3300025944 Ga0207661_10104946 Ga0207661_101049463 275
386 3300025945 Ga0207679_10071013 Ga0207679_100710132 275
387 3300045976 Ga0466967_0469431 Ga0466967_0469431_198_1085 275
388 3300049585 Ga0501069_0268727 Ga0501069_0268727_18_851 275
389 3300049823 Ga0501044_0350543 Ga0501044_0350543_534_1361 275
390 3300005330 Ga0070690_100081471 Ga0070690_1000814712 276
391 3300005336 Ga0070680_100046586 Ga0070680_1000465863 276
392 3300005343 Ga0070687_100067045 Ga0070687_1000670452 276
393 3300005344 Ga0070661_100096601 Ga0070661_1000966012 276
394 3300005353 Ga0070669_100001830 Ga0070669_1000018308 276
395 3300005354 Ga0070675_100049365 Ga0070675_1000493652 276
396 3300005355 Ga0070671_100013858 Ga0070671_1000138583 276
397 3300005356 Ga0070674_100407927 Ga0070674_1004079271 276
398 3300005364 Ga0070673_100024423 Ga0070673_1000244233 276
399 3300005367 Ga0070667_100263491 Ga0070667_1002634912 276
400 3300005466 Ga0070685_10100498 Ga0070685_101004982 276
401 3300005577 Ga0068857_100296647 Ga0068857_1002966472 276
402 3300013100 Ga0157373_10019572 Ga0157373_100195724 276
403 3300013296 Ga0157374_10040816 Ga0157374_100408164 276
404 3300013308 Ga0157375_10061968 Ga0157375_100619684 276
405 3300014745 Ga0157377_10070668 Ga0157377_100706682 276
406 3300025315 Ga0207697_10030392 Ga0207697_100303922 276
407 3300025904 Ga0207647_10132557 Ga0207647_101325572 276
408 3300025908 Ga0207643_10002421 Ga0207643_100024218 276
409 3300025917 Ga0207660_10025238 Ga0207660_100252383 276
410 3300025918 Ga0207662_10002047 Ga0207662_100020477 276
411 3300025921 Ga0207652_10047160 Ga0207652_100471602 276
412 3300025923 Ga0207681_10001947 Ga0207681_1000194710 276
413 3300025933 Ga0207706_10012191 Ga0207706_100121914 276
414 3300025937 Ga0207669_10279220 Ga0207669_102792202 276
415 3300025940 Ga0207691_10048148 Ga0207691_100481482 276
416 3300025960 Ga0207651_10135618 Ga0207651_101356182 276
417 3300025986 Ga0207658_10022743 Ga0207658_100227433 276
418 3300026116 Ga0207674_10048782 Ga0207674_100487822 276
419 3300049571 Ga0501034_0208494 Ga0501034_0208494_277_1155 276
420 3300049572 Ga0501036_0267553 Ga0501036_0267553_447_1325 276
421 3300049573 Ga0501037_0234591 Ga0501037_0234591_389_1267 276
422 3300049581 Ga0501047_0005886 Ga0501047_0005886_933_1811 276
423 3300049586 Ga0501070_0048962 Ga0501070_0048962_43_921 276
424 3300005336 Ga0070680_100005138 Ga0070680_1000051386 277
425 3300005345 Ga0070692_10063497 Ga0070692_100634972 277
426 3300005434 Ga0070709_10007289 Ga0070709_100072894 277
427 3300005435 Ga0070714_100053038 Ga0070714_1000530382 277
428 3300005436 Ga0070713_100000103 Ga0070713_10000010329 277
429 3300005437 Ga0070710_10065461 Ga0070710_100654612 277
430 3300005458 Ga0070681_10018547 Ga0070681_100185475 277
431 3300005530 Ga0070679_100011629 Ga0070679_1000116298 277
432 3300005535 Ga0070684_100053571 Ga0070684_1000535714 277
433 3300006028 Ga0070717_10008217 Ga0070717_100082175 277
434 3300006175 Ga0070712_100004829 Ga0070712_1000048293 277
435 3300025898 Ga0207692_10019122 Ga0207692_100191223 277
436 3300025906 Ga0207699_10005475 Ga0207699_100054752 277
437 3300025912 Ga0207707_10001531 Ga0207707_1000153116 277
438 3300025915 Ga0207693_10008875 Ga0207693_100088755 277
439 3300025917 Ga0207660_10006330 Ga0207660_100063304 277
440 3300025921 Ga0207652_10002295 Ga0207652_100022952 277
441 3300025928 Ga0207700_10000127 Ga0207700_1000012714 277
442 3300025929 Ga0207664_10048994 Ga0207664_100489943 277
443 3300026041 Ga0207639_10163107 Ga0207639_101631072 277
444 3300005336 Ga0070680_100018865 Ga0070680_1000188653 278
445 3300005365 Ga0070688_100040545 Ga0070688_1000405453 278
446 3300005467 Ga0070706_100402985 Ga0070706_1004029852 278
447 3300005535 Ga0070684_100451797 Ga0070684_1004517971 278
448 3300005536 Ga0070697_100084591 Ga0070697_1000845912 278
449 3300025909 Ga0207705_10180236 Ga0207705_101802362 278
450 3300025910 Ga0207684_10093160 Ga0207684_100931603 278
451 3300025917 Ga0207660_10000238 Ga0207660_1000023818 278
452 3300049679 Ga0501249_003491 Ga0501249_003491_696_1538 278
453 3300050510 nmdc:mga06r32_509114_c1 nmdc:mga06r32_509114_c1_54_890 278
454 3300005445 Ga0070708_100000005 Ga0070708_10000000594 279
455 3300005467 Ga0070706_100563943 Ga0070706_1005639432 279
456 3300005468 Ga0070707_100090717 Ga0070707_1000907173 279
457 3300025910 Ga0207684_10485249 Ga0207684_104852491 279
458 3300025922 Ga0207646_10076584 Ga0207646_100765842 279
459 3300026116 Ga0207674_10281048 Ga0207674_102810482 279
460 3300045051 Ga0451576_0105344 Ga0451576_0105344_703_1545 279
461 3300050515 nmdc:mga0a205_390433_c1 nmdc:mga0a205_390433_c1_116_958 279
462 3300005435 Ga0070714_100237005 Ga0070714_1002370052 280
463 3300005436 Ga0070713_100026926 Ga0070713_1000269262 280
464 3300013307 Ga0157372_10748863 Ga0157372_107488632 280
465 3300025929 Ga0207664_10175470 Ga0207664_101754702 280
466 3300031995 Ga0307409_100029486 Ga0307409_1000294863 280
467 3300049742 Ga0501080_0050878 Ga0501080_0050878_1666_2538 280
468 3300005329 Ga0070683_100021469 Ga0070683_1000214693 281
469 3300005336 Ga0070680_100024838 Ga0070680_1000248385 281
470 3300005344 Ga0070661_100004545 Ga0070661_1000045459 281
471 3300005434 Ga0070709_10183594 Ga0070709_101835942 281
472 3300005435 Ga0070714_100273807 Ga0070714_1002738072 281
473 3300005530 Ga0070679_100197173 Ga0070679_1001971732 281
474 3300005544 Ga0070686_100102797 Ga0070686_1001027972 281
475 3300025912 Ga0207707_10084499 Ga0207707_100844993 281
476 3300025917 Ga0207660_10068293 Ga0207660_100682932 281
477 3300025917 Ga0207660_10079499 Ga0207660_100794992 281
478 3300025921 Ga0207652_10014440 Ga0207652_100144404 281
479 3300025944 Ga0207661_10004772 Ga0207661_100047725 281
480 3300042118 Ga0450914_003019 Ga0450914_003019_78_956 281
481 3300005329 Ga0070683_100119482 Ga0070683_1001194823 282
482 3300005444 Ga0070694_100184438 Ga0070694_1001844381 282
483 3300005530 Ga0070679_100136478 Ga0070679_1001364781 282
484 3300005535 Ga0070684_100071884 Ga0070684_1000718842 282
485 3300006871 Ga0075434_100091254 Ga0075434_1000912542 282
486 3300013104 Ga0157370_10129410 Ga0157370_101294102 282
487 3300013104 Ga0157370_10153783 Ga0157370_101537832 282
488 3300013105 Ga0157369_10092570 Ga0157369_100925703 282
489 3300013307 Ga0157372_10035730 Ga0157372_100357305 282
490 3300025913 Ga0207695_10093795 Ga0207695_100937952 282
491 3300025949 Ga0207667_10447943 Ga0207667_104479432 282
492 3300031548 Ga0307408_100170777 Ga0307408_1001707772 282
493 3300031731 Ga0307405_10152914 Ga0307405_101529141 282
494 3300031824 Ga0307413_10118703 Ga0307413_101187032 282
495 3300031852 Ga0307410_10264618 Ga0307410_102646182 282
496 3300031901 Ga0307406_10022122 Ga0307406_100221222 282
497 3300032002 Ga0307416_100331676 Ga0307416_1003316762 282
498 3300032004 Ga0307414_10116253 Ga0307414_101162532 282
499 3300032126 Ga0307415_100189021 Ga0307415_1001890212 282
500 3300038996 Ga0242420_004405 Ga0242420_004405_34_930 282
501 3300046473 Ga0495582_0046920 Ga0495582_0046920_240_1121 282
502 3300046535 Ga0495586_0004729 Ga0495586_0004729_3067_3948 282
503 3300047319 Ga0495674_0081375 Ga0495674_0081375_1622_2503 282
504 3300048915 Ga0496112_0000769 Ga0496112_0000769_1235_2131 282
505 3300048915 Ga0496112_0300094 Ga0496112_0300094_450_1331 282
506 3300005293 Ga0065715_10112103 Ga0065715_101121032 283
507 3300025915 Ga0207693_10089337 Ga0207693_100893373 283
508 3300025933 Ga0207706_10124707 Ga0207706_101247073 283
509 3300025945 Ga0207679_10343488 Ga0207679_103434882 283
510 3300039437 Ga0436365_0471460 Ga0436365_0471460_2905_3762 283
511 3300045976 Ga0466967_0282435 Ga0466967_0282435_217_1074 283
512 3300046499 Ga0495594_0052848 Ga0495594_0052848_687_1541 283
513 3300049741 Ga0501079_0416913 Ga0501079_0416913_91_981 283
514 3300005336 Ga0070680_100008729 Ga0070680_1000087296 284
515 3300025944 Ga0207661_10169874 Ga0207661_101698742 284
516 3300027360 Ga0209969_1001717 Ga0209969_10017172 284
517 3300027543 Ga0209999_1004276 Ga0209999_10042762 284
518 3300027614 Ga0209970_1014421 Ga0209970_10144212 284
519 3300027695 Ga0209966_1000923 Ga0209966_10009235 284
520 3300027717 Ga0209998_10003473 Ga0209998_100034734 284
521 3300027876 Ga0209974_10026274 Ga0209974_100262742 284
522 3300031548 Ga0307408_100094821 Ga0307408_1000948212 284
523 3300031731 Ga0307405_10019818 Ga0307405_100198182 284
524 3300031901 Ga0307406_10061576 Ga0307406_100615762 284
525 3300031901 Ga0307406_10120515 Ga0307406_101205152 284
526 3300031903 Ga0307407_10069875 Ga0307407_100698752 284
527 3300031903 Ga0307407_10127181 Ga0307407_101271812 284
528 3300031995 Ga0307409_100079531 Ga0307409_1000795312 284
529 3300032002 Ga0307416_100224601 Ga0307416_1002246012 284
530 3300032004 Ga0307414_10142580 Ga0307414_101425802 284
531 3300032005 Ga0307411_10035785 Ga0307411_100357853 284
532 3300032126 Ga0307415_100117382 Ga0307415_1001173822 284
533 3300032126 Ga0307415_100297284 Ga0307415_1002972841 284
534 3300049570 Ga0501033_0011764 Ga0501033_0011764_4951_5811 284
535 3300049571 Ga0501034_0108656 Ga0501034_0108656_1694_2554 284
536 3300049572 Ga0501036_0054450 Ga0501036_0054450_817_1677 284
537 3300049574 Ga0501038_0065186 Ga0501038_0065186_817_1677 284
538 3300049575 Ga0501039_0288588 Ga0501039_0288588_100_960 284
539 3300049581 Ga0501047_0007961 Ga0501047_0007961_9059_9919 284
540 3300049656 Ga0501209_011589 Ga0501209_011589_125_985 284
541 3300049660 Ga0501216_003108 Ga0501216_003108_817_1677 284
542 3300049667 Ga0501230_008883 Ga0501230_008883_38_898 284
543 3300049668 Ga0501233_002078 Ga0501233_002078_1778_2638 284
544 3300049669 Ga0501235_004423 Ga0501235_004423_1777_2637 284
545 3300049682 Ga0501252_004389 Ga0501252_004389_53_913 284
546 3300049686 Ga0501257_015602 Ga0501257_015602_654_1514 284
547 3300049704 Ga0501221_000957 Ga0501221_000957_1860_2720 284
548 3300049705 Ga0501225_0002626 Ga0501225_0002626_597_1457 284
549 3300049708 Ga0501245_002533 Ga0501245_002533_300_1160 284
550 3300049757 Ga0501232_002076 Ga0501232_002076_164_1024 284
551 3300049763 Ga0501266_002543 Ga0501266_002543_86_946 284
552 3300049765 Ga0501268_000853 Ga0501268_000853_1228_2088 284
553 3300005336 Ga0070680_100170521 Ga0070680_1001705212 285
554 3300005536 Ga0070697_100109057 Ga0070697_1001090572 285
555 3300044842 Ga0466957_0155083 Ga0466957_0155083_110_970 285
556 3300005530 Ga0070679_100023739 Ga0070679_1000237392 286
557 3300005546 Ga0070696_100191124 Ga0070696_1001911242 286
558 3300005985 Ga0081539_10013437 Ga0081539_100134373 286
559 3300006881 Ga0068865_100231851 Ga0068865_1002318512 286
560 3300013105 Ga0157369_10207290 Ga0157369_102072902 286
561 3300013297 Ga0157378_10022647 Ga0157378_100226472 286
562 3300013307 Ga0157372_10030056 Ga0157372_100300564 286
563 3300031548 Ga0307408_100421756 Ga0307408_1004217561 286
564 3300050507 nmdc:mga05p37_90284_c1 nmdc:mga05p37_90284_c1_2402_3268 286
565 3300005563 Ga0068855_100260033 Ga0068855_1002600331 287
566 3300031995 Ga0307409_100058840 Ga0307409_1000588403 287
567 3300032126 Ga0307415_100013989 Ga0307415_1000139893 287
568 3300005338 Ga0068868_100008939 Ga0068868_1000089395 288
569 3300005436 Ga0070713_100046169 Ga0070713_1000461693 288
570 3300005445 Ga0070708_100002584 Ga0070708_1000025845 288
571 3300005466 Ga0070685_10134757 Ga0070685_101347572 288
572 3300005468 Ga0070707_100001035 Ga0070707_10000103518 288
573 3300005719 Ga0068861_100417196 Ga0068861_1004171961 288
574 3300009098 Ga0105245_10093486 Ga0105245_100934863 288
575 3300025922 Ga0207646_10003899 Ga0207646_1000389912 288
576 3300005434 Ga0070709_10027454 Ga0070709_100274542 289
577 3300005437 Ga0070710_10008519 Ga0070710_100085194 289
578 3300006173 Ga0070716_100000659 Ga0070716_1000006597 289
579 3300006175 Ga0070712_100159803 Ga0070712_1001598032 289
580 3300006914 Ga0075436_100004747 Ga0075436_1000047477 289
581 3300009174 Ga0105241_10111404 Ga0105241_101114042 289
582 3300025906 Ga0207699_10001761 Ga0207699_100017619 289
583 3300025939 Ga0207665_10000392 Ga0207665_1000039223 289
584 3300031731 Ga0307405_10090158 Ga0307405_100901582 289
585 3300031824 Ga0307413_10059196 Ga0307413_100591962 289
586 3300031852 Ga0307410_10004326 Ga0307410_100043265 289
587 3300031911 Ga0307412_10066778 Ga0307412_100667782 289
588 3300031995 Ga0307409_100036578 Ga0307409_1000365782 289
589 3300032002 Ga0307416_100011387 Ga0307416_1000113874 289
590 3300032005 Ga0307411_10011050 Ga0307411_100110502 289
591 3300034820 Ga0373959_0008506 Ga0373959_0008506_822_1721 289
592 3300050509 nmdc:mga0qj67_3800_c1 nmdc:mga0qj67_3800_c1_7571_8443 289
593 3300050510 nmdc:mga06r32_32666_c1 nmdc:mga06r32_32666_c1_3962_4834 289
594 3300050513 nmdc:mga0rr50_457449_c1 nmdc:mga0rr50_457449_c1_73_972 289
595 3300050514 nmdc:mga08x19_4050_c1 nmdc:mga08x19_4050_c1_6427_7326 289
596 3300005439 Ga0070711_100079697 Ga0070711_1000796972 290
597 3300005535 Ga0070684_100045753 Ga0070684_1000457533 290
598 3300005614 Ga0068856_100225134 Ga0068856_1002251342 290
599 3300009177 Ga0105248_10104779 Ga0105248_101047792 290
600 3300009551 Ga0105238_10297021 Ga0105238_102970212 290
601 3300013307 Ga0157372_10023309 Ga0157372_100233094 290
602 3300013308 Ga0157375_10076719 Ga0157375_100767192 290
603 3300025915 Ga0207693_10058873 Ga0207693_100588733 290
604 3300025924 Ga0207694_10096477 Ga0207694_100964772 290
605 3300025945 Ga0207679_10282857 Ga0207679_102828572 290
606 3300026078 Ga0207702_10126990 Ga0207702_101269902 290
607 3300035086 Ga0373934_0006027 Ga0373934_0006027_709_1584 290
608 3300035111 Ga0373923_0009261 Ga0373923_0009261_2278_3153 290
609 3300035172 Ga0373955_0018484 Ga0373955_0018484_537_1412 290
610 3300035724 Ga0373933_0065419 Ga0373933_0065419_314_1189 290
611 3300036401 Ga0373937_0017443 Ga0373937_0017443_3526_4401 290
612 3300037068 Ga0373925_0260117 Ga0373925_0260117_88_963 290
613 3300046459 Ga0495629_0154052 Ga0495629_0154052_626_1501 290
614 3300046462 Ga0495651_0002183 Ga0495651_0002183_12336_13211 290
615 3300046472 Ga0495580_0003270 Ga0495580_0003270_5897_6772 290
616 3300046477 Ga0495664_0008560 Ga0495664_0008560_2183_3058 290
617 3300046511 Ga0495608_0023535 Ga0495608_0023535_1903_2778 290
618 3300046511 Ga0495608_0093254 Ga0495608_0093254_141_1016 290
619 3300046514 Ga0495618_0065767 Ga0495618_0065767_549_1424 290
620 3300046516 Ga0495628_0026006 Ga0495628_0026006_1280_2155 290
621 3300046517 Ga0495630_0051344 Ga0495630_0051344_1188_2063 290
622 3300046528 Ga0495642_0108803 Ga0495642_0108803_201_1073 290
623 3300046529 Ga0495652_0006831 Ga0495652_0006831_157_1032 290
624 3300046531 Ga0495665_0027592 Ga0495665_0027592_590_1465 290
625 3300046536 Ga0495587_0012376 Ga0495587_0012376_2459_3334 290
626 3300046543 Ga0495645_0018109 Ga0495645_0018109_1315_2190 290
627 3300046559 Ga0495667_0012238 Ga0495667_0012238_389_1264 290
628 3300046663 Ga0495635_0106824 Ga0495635_0106824_945_1820 290
629 3300046678 Ga0495599_0000259 Ga0495599_0000259_21220_22095 290
630 3300046689 Ga0495613_0338907 Ga0495613_0338907_136_1011 290
631 3300046691 Ga0495670_0158758 Ga0495670_0158758_262_1134 290
632 3300047317 Ga0495604_0037050 Ga0495604_0037050_2581_3456 290
633 3300047322 Ga0495680_0130843 Ga0495680_0130843_199_1074 290
634 3300047444 Ga0495675_0013254 Ga0495675_0013254_973_1848 290
635 3300047444 Ga0495675_0117623 Ga0495675_0117623_120_995 290
636 3300047471 Ga0495684_0043142 Ga0495684_0043142_759_1634 290
637 3300047471 Ga0495684_0067607 Ga0495684_0067607_1760_2635 290
638 3300048088 Ga0495602_0027969 Ga0495602_0027969_3600_4475 290
639 3300053077 Ga0495601_0183568 Ga0495601_0183568_284_1159 290
640 3300053078 Ga0495612_0033278 Ga0495612_0033278_759_1634 290
641 3300005436 Ga0070713_100015755 Ga0070713_1000157553 291
642 3300032002 Ga0307416_100136057 Ga0307416_1001360572 291
643 3300046809 Ga0495600_0045236 Ga0495600_0045236_1854_2732 291
644 3300047315 Ga0495581_0084419 Ga0495581_0084419_523_1401 291
645 3300047444 Ga0495675_0109152 Ga0495675_0109152_125_1003 291
646 3300048918 Ga0496115_0127923 Ga0496115_0127923_960_1838 291
647 3300005329 Ga0070683_100003955 Ga0070683_1000039555 292
648 3300005329 Ga0070683_100020501 Ga0070683_1000205015 292
649 3300005329 Ga0070683_100022431 Ga0070683_1000224314 292
650 3300005329 Ga0070683_100143167 Ga0070683_1001431672 292
651 3300005329 Ga0070683_100160905 Ga0070683_1001609052 292
652 3300005330 Ga0070690_100046687 Ga0070690_1000466872 292
653 3300005330 Ga0070690_100053908 Ga0070690_1000539083 292
654 3300005331 Ga0070670_100078471 Ga0070670_1000784713 292
655 3300005333 Ga0070677_10058231 Ga0070677_100582311 292
656 3300005334 Ga0068869_100000208 Ga0068869_1000002084 292
657 3300005334 Ga0068869_100259928 Ga0068869_1002599282 292
658 3300005336 Ga0070680_100001422 Ga0070680_1000014223 292
659 3300005336 Ga0070680_100046351 Ga0070680_1000463512 292
660 3300005336 Ga0070680_100090426 Ga0070680_1000904262 292
661 3300005338 Ga0068868_100021943 Ga0068868_1000219432 292
662 3300005340 Ga0070689_100025722 Ga0070689_1000257223 292
663 3300005340 Ga0070689_100118829 Ga0070689_1001188292 292
664 3300005343 Ga0070687_100027850 Ga0070687_1000278502 292
665 3300005343 Ga0070687_100088804 Ga0070687_1000888042 292
666 3300005344 Ga0070661_100011227 Ga0070661_1000112274 292
667 3300005354 Ga0070675_100010529 Ga0070675_1000105292 292
668 3300005354 Ga0070675_100177423 Ga0070675_1001774232 292
669 3300005365 Ga0070688_100281943 Ga0070688_1002819431 292
670 3300005366 Ga0070659_100002094 Ga0070659_1000020942 292
671 3300005367 Ga0070667_100287293 Ga0070667_1002872932 292
672 3300005434 Ga0070709_10019736 Ga0070709_100197364 292
673 3300005457 Ga0070662_100024286 Ga0070662_1000242862 292
674 3300005457 Ga0070662_100271142 Ga0070662_1002711421 292
675 3300005457 Ga0070662_100484493 Ga0070662_1004844931 292
676 3300005458 Ga0070681_10001031 Ga0070681_1000103114 292
677 3300005458 Ga0070681_10012906 Ga0070681_100129065 292
678 3300005530 Ga0070679_100000151 Ga0070679_10000015126 292
679 3300005530 Ga0070679_100000574 Ga0070679_10000057422 292
680 3300005530 Ga0070679_100012388 Ga0070679_1000123885 292
681 3300005535 Ga0070684_100041560 Ga0070684_1000415602 292
682 3300005535 Ga0070684_100128686 Ga0070684_1001286862 292
683 3300005535 Ga0070684_100169336 Ga0070684_1001693362 292
684 3300005545 Ga0070695_100094612 Ga0070695_1000946122 292
685 3300005564 Ga0070664_100087111 Ga0070664_1000871112 292
686 3300005577 Ga0068857_100190178 Ga0068857_1001901782 292
687 3300005614 Ga0068856_100019865 Ga0068856_1000198653 292
688 3300005614 Ga0068856_100121165 Ga0068856_1001211652 292
689 3300005615 Ga0070702_100001473 Ga0070702_1000014734 292
690 3300005616 Ga0068852_100063084 Ga0068852_1000630843 292
691 3300005617 Ga0068859_100119078 Ga0068859_1001190783 292
692 3300005617 Ga0068859_100167452 Ga0068859_1001674522 292
693 3300005617 Ga0068859_100670379 Ga0068859_1006703792 292
694 3300005618 Ga0068864_100006923 Ga0068864_1000069237 292
695 3300005618 Ga0068864_100221460 Ga0068864_1002214602 292
696 3300005834 Ga0068851_10179411 Ga0068851_101794111 292
697 3300005841 Ga0068863_100031045 Ga0068863_1000310452 292
698 3300005842 Ga0068858_100151623 Ga0068858_1001516232 292
699 3300005842 Ga0068858_100276650 Ga0068858_1002766502 292
700 3300005843 Ga0068860_100019902 Ga0068860_1000199025 292
701 3300006237 Ga0097621_100142147 Ga0097621_1001421472 292
702 3300006880 Ga0075429_100170786 Ga0075429_1001707862 292
703 3300006931 Ga0097620_100119073 Ga0097620_1001190733 292
704 3300006931 Ga0097620_100167443 Ga0097620_1001674432 292
705 3300006931 Ga0097620_100670345 Ga0097620_1006703452 292
706 3300009098 Ga0105245_10004990 Ga0105245_100049902 292
707 3300009098 Ga0105245_10005211 Ga0105245_100052112 292
708 3300009148 Ga0105243_10594958 Ga0105243_105949582 292
709 3300009174 Ga0105241_10023408 Ga0105241_100234084 292
710 3300009176 Ga0105242_10002448 Ga0105242_100024489 292
711 3300009176 Ga0105242_10066539 Ga0105242_100665392 292
712 3300009177 Ga0105248_10310254 Ga0105248_103102542 292
713 3300009551 Ga0105238_10180109 Ga0105238_101801092 292
714 3300011119 Ga0105246_10019636 Ga0105246_100196362 292
715 3300013100 Ga0157373_10069481 Ga0157373_100694812 292
716 3300013105 Ga0157369_10120069 Ga0157369_101200692 292
717 3300013308 Ga0157375_10007469 Ga0157375_100074695 292
718 3300013308 Ga0157375_10045419 Ga0157375_100454194 292
719 3300013308 Ga0157375_10200002 Ga0157375_102000022 292
720 3300014745 Ga0157377_10001055 Ga0157377_100010553 292
721 3300025906 Ga0207699_10029412 Ga0207699_100294122 292
722 3300025907 Ga0207645_10062268 Ga0207645_100622682 292
723 3300025911 Ga0207654_10029460 Ga0207654_100294602 292
724 3300025912 Ga0207707_10001523 Ga0207707_100015239 292
725 3300025912 Ga0207707_10008968 Ga0207707_100089685 292
726 3300025912 Ga0207707_10032600 Ga0207707_100326004 292
727 3300025917 Ga0207660_10019765 Ga0207660_100197652 292
728 3300025917 Ga0207660_10037713 Ga0207660_100377132 292
729 3300025917 Ga0207660_10058997 Ga0207660_100589972 292
730 3300025918 Ga0207662_10019240 Ga0207662_100192403 292
731 3300025919 Ga0207657_10270933 Ga0207657_102709332 292
732 3300025920 Ga0207649_10029678 Ga0207649_100296783 292
733 3300025921 Ga0207652_10001245 Ga0207652_1000124513 292
734 3300025921 Ga0207652_10001643 Ga0207652_1000164317 292
735 3300025921 Ga0207652_10078565 Ga0207652_100785652 292
736 3300025927 Ga0207687_10209355 Ga0207687_102093552 292
737 3300025933 Ga0207706_10076139 Ga0207706_100761392 292
738 3300025934 Ga0207686_10069814 Ga0207686_100698141 292
739 3300025936 Ga0207670_10076266 Ga0207670_100762662 292
740 3300025940 Ga0207691_10172390 Ga0207691_101723902 292
741 3300025940 Ga0207691_10466690 Ga0207691_104666901 292
742 3300025941 Ga0207711_10047435 Ga0207711_100474352 292
743 3300025942 Ga0207689_10000181 Ga0207689_1000018128 292
744 3300025942 Ga0207689_10097526 Ga0207689_100975263 292
745 3300025944 Ga0207661_10002310 Ga0207661_100023102 292
746 3300025944 Ga0207661_10011578 Ga0207661_100115783 292
747 3300025944 Ga0207661_10015259 Ga0207661_100152594 292
748 3300025945 Ga0207679_10024147 Ga0207679_100241473 292
749 3300025986 Ga0207658_10278163 Ga0207658_102781632 292
750 3300026023 Ga0207677_10012998 Ga0207677_100129984 292
751 3300026078 Ga0207702_10270524 Ga0207702_102705242 292
752 3300026088 Ga0207641_10117873 Ga0207641_101178732 292
753 3300026088 Ga0207641_10254050 Ga0207641_102540502 292
754 3300026095 Ga0207676_10002114 Ga0207676_100021143 292
755 3300026116 Ga0207674_10000081 Ga0207674_1000008138 292
756 3300028380 Ga0268265_10150856 Ga0268265_101508562 292
757 3300032002 Ga0307416_100088768 Ga0307416_1000887682 292
758 3300035086 Ga0373934_0003818 Ga0373934_0003818_79_960 292
759 3300035171 Ga0373946_0030047 Ga0373946_0030047_159_1040 292
760 3300035691 Ga0373931_0007349 Ga0373931_0007349_580_1461 292
761 3300035695 Ga0373927_0028708 Ga0373927_0028708_218_1099 292
762 3300036401 Ga0373937_0186683 Ga0373937_0186683_253_1134 292
763 3300037068 Ga0373925_0095142 Ga0373925_0095142_878_1759 292
764 3300045051 Ga0451576_0077197 Ga0451576_0077197_2294_3175 292
765 3300046472 Ga0495580_0172059 Ga0495580_0172059_475_1356 292
766 3300046475 Ga0495639_0061606 Ga0495639_0061606_375_1256 292
767 3300046517 Ga0495630_0014681 Ga0495630_0014681_3317_4198 292
768 3300046529 Ga0495652_0200419 Ga0495652_0200419_553_1434 292
769 3300046535 Ga0495586_0011789 Ga0495586_0011789_3427_4308 292
770 3300046536 Ga0495587_0000740 Ga0495587_0000740_16234_17115 292
771 3300046543 Ga0495645_0000080 Ga0495645_0000080_49400_50281 292
772 3300046559 Ga0495667_0003463 Ga0495667_0003463_5943_6824 292
773 3300046674 Ga0495588_0053078 Ga0495588_0053078_817_1698 292
774 3300046678 Ga0495599_0031490 Ga0495599_0031490_863_1744 292
775 3300046681 Ga0495647_0069786 Ga0495647_0069786_266_1147 292
776 3300047315 Ga0495581_0009007 Ga0495581_0009007_4833_5714 292
777 3300047319 Ga0495674_0013484 Ga0495674_0013484_191_1072 292
778 3300047444 Ga0495675_0091852 Ga0495675_0091852_302_1183 292
779 3300047471 Ga0495684_0049402 Ga0495684_0049402_777_1658 292
780 3300050511 nmdc:mga08y16_203482_c1 nmdc:mga08y16_203482_c1_253_1134 292
781 3300053084 Ga0495595_0191954 Ga0495595_0191954_86_967 292
782 3300005718 Ga0068866_10038891 Ga0068866_100388912 293
783 3300006852 Ga0075433_10006048 Ga0075433_100060484 293
784 3300006871 Ga0075434_100002916 Ga0075434_1000029163 293
785 3300009094 Ga0111539_10370993 Ga0111539_103709932 293
786 3300009147 Ga0114129_10009159 Ga0114129_100091598 293
787 3300009176 Ga0105242_10023587 Ga0105242_100235874 293
788 3300025934 Ga0207686_10078807 Ga0207686_100788072 293
789 3300026089 Ga0207648_10032327 Ga0207648_100323273 293
790 3300032002 Ga0307416_100576451 Ga0307416_1005764512 293
791 3300050507 nmdc:mga05p37_9827_c1 nmdc:mga05p37_9827_c1_9688_10587 293
792 3300050511 nmdc:mga08y16_65794_c1 nmdc:mga08y16_65794_c1_394_1293 293
793 3300050515 nmdc:mga0a205_114988_c1 nmdc:mga0a205_114988_c1_811_1710 293
794 3300005333 Ga0070677_10089112 Ga0070677_100891121 294
795 3300005354 Ga0070675_100009924 Ga0070675_1000099245 294
796 3300005434 Ga0070709_10115238 Ga0070709_101152382 294
797 3300005547 Ga0070693_100004554 Ga0070693_1000045544 294
798 3300005844 Ga0068862_100116261 Ga0068862_1001162612 294
799 3300006881 Ga0068865_100055990 Ga0068865_1000559902 294
800 3300025912 Ga0207707_10046041 Ga0207707_100460412 294
801 3300025917 Ga0207660_10116102 Ga0207660_101161022 294
802 3300025926 Ga0207659_10125112 Ga0207659_101251122 294
803 3300025938 Ga0207704_10042122 Ga0207704_100421222 294
804 3300025940 Ga0207691_10000685 Ga0207691_100006858 294
805 3300025986 Ga0207658_10124765 Ga0207658_101247652 294
806 3300031548 Ga0307408_100051921 Ga0307408_1000519212 294
807 3300031824 Ga0307413_10026970 Ga0307413_100269702 294
808 3300031995 Ga0307409_100052141 Ga0307409_1000521412 294
809 3300032002 Ga0307416_100030151 Ga0307416_1000301514 294
810 3300032005 Ga0307411_10021823 Ga0307411_100218232 294
811 3300032126 Ga0307415_100035168 Ga0307415_1000351683 294
812 3300035170 Ga0373943_0000516 Ga0373943_0000516_8254_9141 294
813 3300035171 Ga0373946_0006578 Ga0373946_0006578_2624_3511 294
814 3300035695 Ga0373927_0003119 Ga0373927_0003119_326_1213 294
815 3300035725 Ga0373947_0000354 Ga0373947_0000354_5345_6232 294
816 3300037068 Ga0373925_0002130 Ga0373925_0002130_2399_3286 294
817 3300046455 Ga0495603_0000907 Ga0495603_0000907_14930_15817 294
818 3300046472 Ga0495580_0000095 Ga0495580_0000095_29619_30506 294
819 3300046473 Ga0495582_0000169 Ga0495582_0000169_32717_33604 294
820 3300046475 Ga0495639_0000541 Ga0495639_0000541_6255_7142 294
821 3300046517 Ga0495630_0013921 Ga0495630_0013921_522_1409 294
822 3300046531 Ga0495665_0000198 Ga0495665_0000198_10310_11197 294
823 3300046674 Ga0495588_0001099 Ga0495588_0001099_4435_5322 294
824 3300046681 Ga0495647_0034734 Ga0495647_0034734_963_1850 294
825 3300046683 Ga0495658_0000753 Ga0495658_0000753_10301_11188 294
826 3300046689 Ga0495613_0022565 Ga0495613_0022565_1540_2427 294
827 3300047315 Ga0495581_0000266 Ga0495581_0000266_19899_20786 294
828 3300047673 Ga0495593_0000838 Ga0495593_0000838_6345_7232 294
829 3300048089 Ga0495614_0000001 Ga0495614_0000001_38303_39190 294
830 3300037312 Ga0395899_0139200 Ga0395899_0139200_471_1502 297
831 3300037471 Ga0395905_0029800 Ga0395905_0029800_769_1800 297
832 3300038443 Ga0395901_0051868 Ga0395901_0051868_420_1451 297
833 3300005437 Ga0070710_10155163 Ga0070710_101551631 298
834 3300005439 Ga0070711_100070640 Ga0070711_1000706401 298
835 3300005471 Ga0070698_100121865 Ga0070698_1001218652 298
836 3300005518 Ga0070699_100315242 Ga0070699_1003152422 298
837 3300006844 Ga0075428_100433064 Ga0075428_1004330642 298
838 3300006846 Ga0075430_100001947 Ga0075430_10000194715 298
839 3300006846 Ga0075430_100036046 Ga0075430_1000360465 298
840 3300006847 Ga0075431_100183837 Ga0075431_1001838372 298
841 3300025898 Ga0207692_10131294 Ga0207692_101312941 298
842 3300035170 Ga0373943_0118972 Ga0373943_0118972_56_952 298
843 3300035692 Ga0373935_0360972 Ga0373935_0360972_99_995 298
844 3300035725 Ga0373947_0322747 Ga0373947_0322747_74_970 298
845 3300046472 Ga0495580_0089168 Ga0495580_0089168_332_1228 298
846 3300050509 nmdc:mga0qj67_1547_c1 nmdc:mga0qj67_1547_c1_612_1511 298
847 3300001990 JGI24737J22298_10045853 JGI24737J22298_100458531 299
848 3300005328 Ga0070676_10000594 Ga0070676_1000059411 299
849 3300005329 Ga0070683_100033167 Ga0070683_1000331673 299
850 3300005331 Ga0070670_100001303 Ga0070670_10000130310 299
851 3300005331 Ga0070670_100251892 Ga0070670_1002518922 299
852 3300005334 Ga0068869_100013618 Ga0068869_1000136182 299
853 3300005338 Ga0068868_100010299 Ga0068868_1000102995 299
854 3300005340 Ga0070689_100037528 Ga0070689_1000375282 299
855 3300005343 Ga0070687_100006707 Ga0070687_1000067073 299
856 3300005344 Ga0070661_100001777 Ga0070661_1000017779 299
857 3300005344 Ga0070661_100002926 Ga0070661_1000029264 299
858 3300005347 Ga0070668_100002959 Ga0070668_1000029599 299
859 3300005347 Ga0070668_100004148 Ga0070668_1000041489 299
860 3300005353 Ga0070669_100004381 Ga0070669_1000043818 299
861 3300005353 Ga0070669_100004515 Ga0070669_1000045155 299
862 3300005354 Ga0070675_100001698 Ga0070675_10000169810 299
863 3300005355 Ga0070671_100057861 Ga0070671_1000578612 299
864 3300005355 Ga0070671_100070816 Ga0070671_1000708163 299
865 3300005356 Ga0070674_100027133 Ga0070674_1000271332 299
866 3300005356 Ga0070674_100155304 Ga0070674_1001553041 299
867 3300005365 Ga0070688_100005984 Ga0070688_1000059843 299
868 3300005366 Ga0070659_100003038 Ga0070659_1000030388 299
869 3300005366 Ga0070659_100015628 Ga0070659_1000156284 299
870 3300005367 Ga0070667_100002826 Ga0070667_1000028267 299
871 3300005438 Ga0070701_10001273 Ga0070701_100012736 299
872 3300005438 Ga0070701_10008731 Ga0070701_100087312 299
873 3300005441 Ga0070700_100011072 Ga0070700_1000110722 299
874 3300005441 Ga0070700_100015648 Ga0070700_1000156483 299
875 3300005455 Ga0070663_100022798 Ga0070663_1000227984 299
876 3300005457 Ga0070662_100001636 Ga0070662_10000163611 299
877 3300005458 Ga0070681_10000349 Ga0070681_1000034930 299
878 3300005466 Ga0070685_10027877 Ga0070685_100278773 299
879 3300005535 Ga0070684_100006943 Ga0070684_1000069432 299
880 3300005539 Ga0068853_100007984 Ga0068853_1000079843 299
881 3300005543 Ga0070672_100001009 Ga0070672_1000010099 299
882 3300005544 Ga0070686_100037060 Ga0070686_1000370603 299
883 3300005564 Ga0070664_100005563 Ga0070664_1000055637 299
884 3300005564 Ga0070664_100056936 Ga0070664_1000569363 299
885 3300005564 Ga0070664_100291730 Ga0070664_1002917301 299
886 3300005577 Ga0068857_100001942 Ga0068857_1000019427 299
887 3300005577 Ga0068857_100185383 Ga0068857_1001853831 299
888 3300005578 Ga0068854_100060335 Ga0068854_1000603352 299
889 3300005616 Ga0068852_100000642 Ga0068852_10000064212 299
890 3300005616 Ga0068852_100015929 Ga0068852_1000159295 299
891 3300005617 Ga0068859_100067117 Ga0068859_1000671172 299
892 3300005719 Ga0068861_100001041 Ga0068861_1000010412 299
893 3300005719 Ga0068861_100009433 Ga0068861_1000094335 299
894 3300005834 Ga0068851_10026626 Ga0068851_100266262 299
895 3300005840 Ga0068870_10002369 Ga0068870_100023696 299
896 3300005841 Ga0068863_100008965 Ga0068863_1000089652 299
897 3300005842 Ga0068858_100010522 Ga0068858_1000105222 299
898 3300005843 Ga0068860_100010610 Ga0068860_1000106106 299
899 3300005844 Ga0068862_100000266 Ga0068862_10000026634 299
900 3300005844 Ga0068862_100003004 Ga0068862_1000030045 299
901 3300006846 Ga0075430_100006661 Ga0075430_1000066614 299
902 3300006846 Ga0075430_100064871 Ga0075430_1000648712 299
903 3300006847 Ga0075431_100497977 Ga0075431_1004979772 299
904 3300006881 Ga0068865_100020556 Ga0068865_1000205563 299
905 3300006931 Ga0097620_100067112 Ga0097620_1000671122 299
906 3300009093 Ga0105240_10310155 Ga0105240_103101552 299
907 3300009094 Ga0111539_10042573 Ga0111539_100425735 299
908 3300009094 Ga0111539_10420958 Ga0111539_104209582 299
909 3300009147 Ga0114129_10043062 Ga0114129_100430625 299
910 3300009147 Ga0114129_10199121 Ga0114129_101991212 299
911 3300009177 Ga0105248_10107095 Ga0105248_101070952 299
912 3300009553 Ga0105249_10000199 Ga0105249_1000019932 299
913 3300009553 Ga0105249_10004256 Ga0105249_100042562 299
914 3300013102 Ga0157371_10004178 Ga0157371_1000417810 299
915 3300013297 Ga0157378_10110325 Ga0157378_101103253 299
916 3300013306 Ga0163162_10004093 Ga0163162_100040934 299
917 3300013306 Ga0163162_10466005 Ga0163162_104660052 299
918 3300013308 Ga0157375_10011017 Ga0157375_100110172 299
919 3300013308 Ga0157375_10152055 Ga0157375_101520552 299
920 3300014326 Ga0157380_10004094 Ga0157380_100040945 299
921 3300014745 Ga0157377_10022270 Ga0157377_100222703 299
922 3300014968 Ga0157379_10037929 Ga0157379_100379292 299
923 3300017792 Ga0163161_10082717 Ga0163161_100827172 299
924 3300025315 Ga0207697_10015529 Ga0207697_100155294 299
925 3300025321 Ga0207656_10012547 Ga0207656_100125472 299
926 3300025893 Ga0207682_10031167 Ga0207682_100311672 299
927 3300025899 Ga0207642_10011144 Ga0207642_100111442 299
928 3300025903 Ga0207680_10087365 Ga0207680_100873652 299
929 3300025907 Ga0207645_10000183 Ga0207645_1000018311 299
930 3300025908 Ga0207643_10005312 Ga0207643_100053124 299
931 3300025912 Ga0207707_10005648 Ga0207707_100056483 299
932 3300025917 Ga0207660_10016979 Ga0207660_100169793 299
933 3300025918 Ga0207662_10003481 Ga0207662_100034813 299
934 3300025919 Ga0207657_10090121 Ga0207657_100901212 299
935 3300025920 Ga0207649_10003545 Ga0207649_100035456 299
936 3300025920 Ga0207649_10022935 Ga0207649_100229353 299
937 3300025923 Ga0207681_10003688 Ga0207681_100036882 299
938 3300025923 Ga0207681_10004290 Ga0207681_100042906 299
939 3300025925 Ga0207650_10005530 Ga0207650_100055305 299
940 3300025925 Ga0207650_10037877 Ga0207650_100378774 299
941 3300025926 Ga0207659_10004586 Ga0207659_100045868 299
942 3300025927 Ga0207687_10152998 Ga0207687_101529981 299
943 3300025932 Ga0207690_10003280 Ga0207690_100032802 299
944 3300025932 Ga0207690_10006373 Ga0207690_100063733 299
945 3300025933 Ga0207706_10000565 Ga0207706_1000056521 299
946 3300025936 Ga0207670_10034304 Ga0207670_100343042 299
947 3300025937 Ga0207669_10049180 Ga0207669_100491802 299
948 3300025938 Ga0207704_10326947 Ga0207704_103269471 299
949 3300025940 Ga0207691_10000109 Ga0207691_1000010935 299
950 3300025941 Ga0207711_10073206 Ga0207711_100732062 299
951 3300025942 Ga0207689_10005513 Ga0207689_100055137 299
952 3300025944 Ga0207661_10014723 Ga0207661_100147232 299
953 3300025945 Ga0207679_10001098 Ga0207679_100010986 299
954 3300025945 Ga0207679_10005409 Ga0207679_100054095 299
955 3300025945 Ga0207679_10030240 Ga0207679_100302402 299
956 3300025961 Ga0207712_10000276 Ga0207712_1000027632 299
957 3300025961 Ga0207712_10036346 Ga0207712_100363462 299
958 3300025972 Ga0207668_10019075 Ga0207668_100190752 299
959 3300025972 Ga0207668_10025365 Ga0207668_100253654 299
960 3300025981 Ga0207640_10106130 Ga0207640_101061302 299
961 3300025986 Ga0207658_10023602 Ga0207658_100236024 299
962 3300026035 Ga0207703_10092608 Ga0207703_100926083 299
963 3300026041 Ga0207639_10045201 Ga0207639_100452014 299
964 3300026067 Ga0207678_10022886 Ga0207678_100228862 299
965 3300026075 Ga0207708_10009211 Ga0207708_100092113 299
966 3300026075 Ga0207708_10024580 Ga0207708_100245802 299
967 3300026116 Ga0207674_10000388 Ga0207674_1000038835 299
968 3300026116 Ga0207674_10000888 Ga0207674_1000088816 299
969 3300026118 Ga0207675_100000650 Ga0207675_10000065013 299
970 3300026118 Ga0207675_100003901 Ga0207675_10000390113 299
971 3300026142 Ga0207698_10000888 Ga0207698_100008889 299
972 3300026142 Ga0207698_10095935 Ga0207698_100959352 299
973 3300028380 Ga0268265_10001227 Ga0268265_100012276 299
974 3300028380 Ga0268265_10072678 Ga0268265_100726782 299
975 3300028381 Ga0268264_10080970 Ga0268264_100809702 299
976 3300031548 Ga0307408_100016250 Ga0307408_1000162502 299
977 3300031731 Ga0307405_10009469 Ga0307405_100094694 299
978 3300031852 Ga0307410_10001361 Ga0307410_1000136110 299
979 3300031852 Ga0307410_10199764 Ga0307410_101997642 299
980 3300031901 Ga0307406_10011369 Ga0307406_100113695 299
981 3300031903 Ga0307407_10009235 Ga0307407_100092353 299
982 3300031995 Ga0307409_100030207 Ga0307409_1000302073 299
983 3300032002 Ga0307416_100019225 Ga0307416_1000192253 299
984 3300032002 Ga0307416_100088318 Ga0307416_1000883183 299
985 3300032002 Ga0307416_100348198 Ga0307416_1003481982 299
986 3300032005 Ga0307411_10001049 Ga0307411_100010495 299
987 3300048912 Ga0496109_0180774 Ga0496109_0180774_1042_1941 299
988 3300049679 Ga0501249_008461 Ga0501249_008461_124_1026 299
989 3300050509 nmdc:mga0qj67_23498_c1 nmdc:mga0qj67_23498_c1_2362_3267 299
990 3300050509 nmdc:mga0qj67_24511_c1 nmdc:mga0qj67_24511_c1_3567_4472 299
991 3300050510 nmdc:mga06r32_481487_c1 nmdc:mga06r32_481487_c1_120_1025 299
992 3300050510 nmdc:mga06r32_8011_c1 nmdc:mga06r32_8011_c1_6686_7591 299
993 3300050511 nmdc:mga08y16_207005_c1 nmdc:mga08y16_207005_c1_920_1819 299
994 3300050515 nmdc:mga0a205_216169_c1 nmdc:mga0a205_216169_c1_186_1085 299
995 3300050515 nmdc:mga0a205_24941_c2 nmdc:mga0a205_24941_c2_2556_3458 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

119

305

0.97

PF12911

OppC_N

N-terminal TM domain of oligopeptide transport permease C

27

78

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7839 72 279
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7544 72 279
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7206 75 279
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.7185 83 279
3rlf-assembly1.cif.gz_F crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.7072 72 262
ID Description Score Start End Superfamily
af_Q2FZQ8_74_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9451 73 276 1.10.3720.10
af_P33915_131_335_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9426 71 277 1.10.3720.10
af_Q2G1F6_179_383_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9397 73 279 1.10.3720.10
af_P33915_131_335_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9338 71 277 1.10.3720.10
af_Q2FVE9_63_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9332 70 278 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7V9HMT0-F1-model_v4 ABC transporter permease 0.9616 2 281 GO:0005886
GO:0055085
AF-A0A484RC28-F1-model_v4 Dipeptide transport system permease protein DppC (TC 3.A.1.5.2) 0.9596 7 282 GO:0005886
GO:0055085
AF-A0A3D2NVU1-F1-model_v4 deleted 0.9586 16 281
AF-A0A3D9QUC2-F1-model_v4 Peptide/nickel transport system permease protein 0.9583 5 281 GO:0005886
GO:0055085
AF-A0A847G5B4-F1-model_v4 ABC transporter permease 0.9577 7 285 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
82.03 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map