F487751
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 995 | 341 | 995 | 283 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0139200|Ga0395899_0139200_471_1502 |
| Length | 326 |
| Sequence | MTHPTPYNSEPAQAGTPRADVPSTARPSGRVWPLLSRDGRARFGLAVVVLLILGALLAPFIARHDPTTIDLTNTLAAPSGVHWLGTDVQGRDVWARLVYGARVSLTVGVVSQALSLILGVAAGLVAGFYGKWVDDVVMRLADITLAFPTLLLLIAMAAALQPSLGTVMLTIGVVGWAGMARLVRGQVLVVRQTEYVQAERALGAGDLRIMLRHVLPNVIAPVVIAATLGVAGAIMAEAALSFLGLGVQPPTPSWGAMIADGRDLSQLRGAPWTSLFPGLAIGAAVLGFNLLGDALRDALDPRAAGLRKMRRGDLPTEAGPSRTAAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 194 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 195 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 196 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 197 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 199 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 200 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 201 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 202 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 203 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 211 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 214 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 215 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 216 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 219 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 222 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 223 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 224 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 225 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 226 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 227 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 278 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 280 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 281 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 282 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 283 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 284 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 285 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 286 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 287 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 299 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 300 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 301 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 302 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 303 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 304 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 305 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 306 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 307 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 308 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 309 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 313 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 314 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 315 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 329 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 330 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 331 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 332 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 333 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 334 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 335 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 336 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 337 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 338 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 339 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 340 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 341 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.9 |
| Metatranscriptomes | 0.1 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.41 |
| Nodule | 0 |
| Rhizoplane | 0.8 |
| Rhizosphere | 96.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10045853 | 3300001990 | Bacteria | 1335 |
| 2 | Ga0065715_10112103 | 3300005293 | Unclassified | 2544 |
| 3 | Ga0065715_10133990 | 3300005293 | Bacteria | 1960 |
| 4 | Ga0070658_10002348 | 3300005327 | Bacteria | 15866 |
| 5 | Ga0070658_10005003 | 3300005327 | Bacteria | 10792 |
| 6 | Ga0070658_10008504 | 3300005327 | Bacteria | 8252 |
| 7 | Ga0070658_10042391 | 3300005327 | Bacteria | 3676 |
| 8 | Ga0070676_10000594 | 3300005328 | Bacteria | 17557 |
| 9 | Ga0070676_10005710 | 3300005328 | Bacteria | 6632 |
| 10 | Ga0070676_10025027 | 3300005328 | Bacteria | 3370 |
| 11 | Ga0070683_100002955 | 3300005329 | Bacteria | 13630 |
| 12 | Ga0070683_100003955 | 3300005329 | Bacteria | 12129 |
| 13 | Ga0070683_100012277 | 3300005329 | Bacteria | 7439 |
| 14 | Ga0070683_100017298 | 3300005329 | Bacteria | 6371 |
| 15 | Ga0070683_100020501 | 3300005329 | Bacteria | 5883 |
| 16 | Ga0070683_100021469 | 3300005329 | Bacteria | 5765 |
| 17 | Ga0070683_100022431 | 3300005329 | Bacteria | 5642 |
| 18 | Ga0070683_100033167 | 3300005329 | Bacteria | 4707 |
| 19 | Ga0070683_100055122 | 3300005329 | Bacteria | 3688 |
| 20 | Ga0070683_100119482 | 3300005329 | Bacteria | 2489 |
| 21 | Ga0070683_100143167 | 3300005329 | Bacteria | 2265 |
| 22 | Ga0070683_100160905 | 3300005329 | Bacteria | 2130 |
| 23 | Ga0070690_100046687 | 3300005330 | Bacteria | 2754 |
| 24 | Ga0070690_100049665 | 3300005330 | Bacteria | 2675 |
| 25 | Ga0070690_100053908 | 3300005330 | Bacteria | 2573 |
| 26 | Ga0070690_100081471 | 3300005330 | Bacteria | 2118 |
| 27 | Ga0070670_100001303 | 3300005331 | Bacteria | 19876 |
| 28 | Ga0070670_100078471 | 3300005331 | Bacteria | 2836 |
| 29 | Ga0070670_100251892 | 3300005331 | Bacteria | 1539 |
| 30 | Ga0070677_10058231 | 3300005333 | Bacteria | 1586 |
| 31 | Ga0070677_10089112 | 3300005333 | Bacteria | 1338 |
| 32 | Ga0068869_100000208 | 3300005334 | Bacteria | 30490 |
| 33 | Ga0068869_100013618 | 3300005334 | Bacteria | 5414 |
| 34 | Ga0068869_100259928 | 3300005334 | Bacteria | 1390 |
| 35 | Ga0070680_100001422 | 3300005336 | Bacteria | 17316 |
| 36 | Ga0070680_100001898 | 3300005336 | Bacteria | 15333 |
| 37 | Ga0070680_100004865 | 3300005336 | Bacteria | 10109 |
| 38 | Ga0070680_100005138 | 3300005336 | Bacteria | 9889 |
| 39 | Ga0070680_100008729 | 3300005336 | Bacteria | 7771 |
| 40 | Ga0070680_100008911 | 3300005336 | Bacteria | 7693 |
| 41 | Ga0070680_100010446 | 3300005336 | Bacteria | 7159 |
| 42 | Ga0070680_100017506 | 3300005336 | Bacteria | 5652 |
| 43 | Ga0070680_100018865 | 3300005336 | Bacteria | 5456 |
| 44 | Ga0070680_100024838 | 3300005336 | Bacteria | 4789 |
| 45 | Ga0070680_100046351 | 3300005336 | Bacteria | 3536 |
| 46 | Ga0070680_100046586 | 3300005336 | Bacteria | 3528 |
| 47 | Ga0070680_100055367 | 3300005336 | Bacteria | 3241 |
| 48 | Ga0070680_100090426 | 3300005336 | Bacteria | 2534 |
| 49 | Ga0070680_100170521 | 3300005336 | Bacteria | 1831 |
| 50 | Ga0070680_100352744 | 3300005336 | Bacteria | 1251 |
| 51 | Ga0070682_100008289 | 3300005337 | Bacteria | 5859 |
| 52 | Ga0070682_100012299 | 3300005337 | Unclassified | 4904 |
| 53 | Ga0068868_100008939 | 3300005338 | Bacteria | 7187 |
| 54 | Ga0068868_100010299 | 3300005338 | Bacteria | 6762 |
| 55 | Ga0068868_100021943 | 3300005338 | Bacteria | 4813 |
| 56 | Ga0068868_100050462 | 3300005338 | Bacteria | 3268 |
| 57 | Ga0070660_100010448 | 3300005339 | Bacteria | 6561 |
| 58 | Ga0070660_100246983 | 3300005339 | Bacteria | 1454 |
| 59 | Ga0070689_100025722 | 3300005340 | Bacteria | 4424 |
| 60 | Ga0070689_100037528 | 3300005340 | Bacteria | 3704 |
| 61 | Ga0070689_100118829 | 3300005340 | Bacteria | 2110 |
| 62 | Ga0070691_10014505 | 3300005341 | Bacteria | 3617 |
| 63 | Ga0070687_100006707 | 3300005343 | Bacteria | 4739 |
| 64 | Ga0070687_100027850 | 3300005343 | Bacteria | 2735 |
| 65 | Ga0070687_100047189 | 3300005343 | Bacteria | 2208 |
| 66 | Ga0070687_100067045 | 3300005343 | Bacteria | 1914 |
| 67 | Ga0070687_100088804 | 3300005343 | Bacteria | 1705 |
| 68 | Ga0070661_100001777 | 3300005344 | Bacteria | 14949 |
| 69 | Ga0070661_100002926 | 3300005344 | Bacteria | 11773 |
| 70 | Ga0070661_100004545 | 3300005344 | Bacteria | 9548 |
| 71 | Ga0070661_100004756 | 3300005344 | Bacteria | 9346 |
| 72 | Ga0070661_100011227 | 3300005344 | Bacteria | 6241 |
| 73 | Ga0070661_100022638 | 3300005344 | Bacteria | 4500 |
| 74 | Ga0070661_100032234 | 3300005344 | Bacteria | 3792 |
| 75 | Ga0070661_100096601 | 3300005344 | Bacteria | 2193 |
| 76 | Ga0070661_100214431 | 3300005344 | Bacteria | 1475 |
| 77 | Ga0070661_100234470 | 3300005344 | Bacteria | 1411 |
| 78 | Ga0070661_100355838 | 3300005344 | Bacteria | 1150 |
| 79 | Ga0070692_10063497 | 3300005345 | Bacteria | 1951 |
| 80 | Ga0070668_100002959 | 3300005347 | Bacteria | 12557 |
| 81 | Ga0070668_100004148 | 3300005347 | Bacteria | 10732 |
| 82 | Ga0070669_100001830 | 3300005353 | Bacteria | 15332 |
| 83 | Ga0070669_100004381 | 3300005353 | Bacteria | 10180 |
| 84 | Ga0070669_100004515 | 3300005353 | Bacteria | 10044 |
| 85 | Ga0070669_100341920 | 3300005353 | Bacteria | 1213 |
| 86 | Ga0070675_100001698 | 3300005354 | Bacteria | 16257 |
| 87 | Ga0070675_100009924 | 3300005354 | Bacteria | 7424 |
| 88 | Ga0070675_100010529 | 3300005354 | Bacteria | 7224 |
| 89 | Ga0070675_100049365 | 3300005354 | Bacteria | 3454 |
| 90 | Ga0070675_100161727 | 3300005354 | Bacteria | 1926 |
| 91 | Ga0070675_100177423 | 3300005354 | Bacteria | 1840 |
| 92 | Ga0070675_100222849 | 3300005354 | Bacteria | 1643 |
| 93 | Ga0070671_100013858 | 3300005355 | Bacteria | 6504 |
| 94 | Ga0070671_100057861 | 3300005355 | Bacteria | 3227 |
| 95 | Ga0070671_100070816 | 3300005355 | Bacteria | 2909 |
| 96 | Ga0070671_100116767 | 3300005355 | Bacteria | 2244 |
| 97 | Ga0070674_100021188 | 3300005356 | Bacteria | 4168 |
| 98 | Ga0070674_100027133 | 3300005356 | Bacteria | 3750 |
| 99 | Ga0070674_100040541 | 3300005356 | Bacteria | 3151 |
| 100 | Ga0070674_100155304 | 3300005356 | Bacteria | 1731 |
| 101 | Ga0070674_100407927 | 3300005356 | Bacteria | 1112 |
| 102 | Ga0070673_100024423 | 3300005364 | Bacteria | 4432 |
| 103 | Ga0070688_100005984 | 3300005365 | Bacteria | 6448 |
| 104 | Ga0070688_100040545 | 3300005365 | Bacteria | 2854 |
| 105 | Ga0070688_100281943 | 3300005365 | Bacteria | 1194 |
| 106 | Ga0070659_100002094 | 3300005366 | Bacteria | 14221 |
| 107 | Ga0070659_100003038 | 3300005366 | Bacteria | 11935 |
| 108 | Ga0070659_100015628 | 3300005366 | Bacteria | 5685 |
| 109 | Ga0070659_100051452 | 3300005366 | Bacteria | 3239 |
| 110 | Ga0070659_100270211 | 3300005366 | Bacteria | 1412 |
| 111 | Ga0070667_100002826 | 3300005367 | Bacteria | 14988 |
| 112 | Ga0070667_100263491 | 3300005367 | Bacteria | 1544 |
| 113 | Ga0070667_100287293 | 3300005367 | Bacteria | 1478 |
| 114 | Ga0070703_10002559 | 3300005406 | Bacteria | 5240 |
| 115 | Ga0070709_10007289 | 3300005434 | Bacteria | 6061 |
| 116 | Ga0070709_10019736 | 3300005434 | Bacteria | 3901 |
| 117 | Ga0070709_10027454 | 3300005434 | Bacteria | 3385 |
| 118 | Ga0070709_10115238 | 3300005434 | Bacteria | 1812 |
| 119 | Ga0070709_10150408 | 3300005434 | Bacteria | 1608 |
| 120 | Ga0070709_10183594 | 3300005434 | Bacteria | 1471 |
| 121 | Ga0070714_100024675 | 3300005435 | Bacteria | 4954 |
| 122 | Ga0070714_100052772 | 3300005435 | Bacteria | 3469 |
| 123 | Ga0070714_100053038 | 3300005435 | Bacteria | 3460 |
| 124 | Ga0070714_100237005 | 3300005435 | Bacteria | 1683 |
| 125 | Ga0070714_100273807 | 3300005435 | Bacteria | 1566 |
| 126 | Ga0070713_100000103 | 3300005436 | Bacteria | 54646 |
| 127 | Ga0070713_100015755 | 3300005436 | Bacteria | 5664 |
| 128 | Ga0070713_100026926 | 3300005436 | Bacteria | 4520 |
| 129 | Ga0070713_100046169 | 3300005436 | Bacteria | 3573 |
| 130 | Ga0070713_100202567 | 3300005436 | Bacteria | 1793 |
| 131 | Ga0070710_10008519 | 3300005437 | Bacteria | 4992 |
| 132 | Ga0070710_10065461 | 3300005437 | Bacteria | 2082 |
| 133 | Ga0070710_10155163 | 3300005437 | Bacteria | 1415 |
| 134 | Ga0070701_10001273 | 3300005438 | Bacteria | 9254 |
| 135 | Ga0070701_10008731 | 3300005438 | Bacteria | 4401 |
| 136 | Ga0070711_100000333 | 3300005439 | Bacteria | 24273 |
| 137 | Ga0070711_100070640 | 3300005439 | Bacteria | 2459 |
| 138 | Ga0070711_100079697 | 3300005439 | Bacteria | 2330 |
| 139 | Ga0070711_100239853 | 3300005439 | Bacteria | 1417 |
| 140 | Ga0070705_100007921 | 3300005440 | Bacteria | 5249 |
| 141 | Ga0070705_100153140 | 3300005440 | Bacteria | 1532 |
| 142 | Ga0070700_100011072 | 3300005441 | Bacteria | 4988 |
| 143 | Ga0070700_100015648 | 3300005441 | Bacteria | 4306 |
| 144 | Ga0070694_100000139 | 3300005444 | Bacteria | 36599 |
| 145 | Ga0070694_100014198 | 3300005444 | Bacteria | 4984 |
| 146 | Ga0070694_100095098 | 3300005444 | Bacteria | 2097 |
| 147 | Ga0070694_100184438 | 3300005444 | Bacteria | 1545 |
| 148 | Ga0070708_100000005 | 3300005445 | Bacteria | 159112 |
| 149 | Ga0070708_100002584 | 3300005445 | Bacteria | 14012 |
| 150 | Ga0070708_100005774 | 3300005445 | Bacteria | 9821 |
| 151 | Ga0070708_100096499 | 3300005445 | Bacteria | 2701 |
| 152 | Ga0070708_100213849 | 3300005445 | Bacteria | 1807 |
| 153 | Ga0070708_100280671 | 3300005445 | Bacteria | 1568 |
| 154 | Ga0070708_100301283 | 3300005445 | Bacteria | 1509 |
| 155 | Ga0070663_100022798 | 3300005455 | Bacteria | 4190 |
| 156 | Ga0070662_100001636 | 3300005457 | Bacteria | 13829 |
| 157 | Ga0070662_100024286 | 3300005457 | Bacteria | 4174 |
| 158 | Ga0070662_100199638 | 3300005457 | Bacteria | 1586 |
| 159 | Ga0070662_100271142 | 3300005457 | Bacteria | 1370 |
| 160 | Ga0070662_100484493 | 3300005457 | Bacteria | 1030 |
| 161 | Ga0070681_10000349 | 3300005458 | Bacteria | 37198 |
| 162 | Ga0070681_10001031 | 3300005458 | Bacteria | 23626 |
| 163 | Ga0070681_10008058 | 3300005458 | Bacteria | 10310 |
| 164 | Ga0070681_10012906 | 3300005458 | Bacteria | 8297 |
| 165 | Ga0070681_10018547 | 3300005458 | Bacteria | 6956 |
| 166 | Ga0070681_10045857 | 3300005458 | Bacteria | 4371 |
| 167 | Ga0070681_10052545 | 3300005458 | Bacteria | 4064 |
| 168 | Ga0070681_10094410 | 3300005458 | Bacteria | 2940 |
| 169 | Ga0068867_100018520 | 3300005459 | Bacteria | 4949 |
| 170 | Ga0070685_10027877 | 3300005466 | Bacteria | 3125 |
| 171 | Ga0070685_10100498 | 3300005466 | Bacteria | 1766 |
| 172 | Ga0070685_10134757 | 3300005466 | Bacteria | 1548 |
| 173 | Ga0070706_100012945 | 3300005467 | Bacteria | 7722 |
| 174 | Ga0070706_100230398 | 3300005467 | Bacteria | 1729 |
| 175 | Ga0070706_100260335 | 3300005467 | Bacteria | 1619 |
| 176 | Ga0070706_100402985 | 3300005467 | Bacteria | 1273 |
| 177 | Ga0070706_100489927 | 3300005467 | Bacteria | 1144 |
| 178 | Ga0070706_100563943 | 3300005467 | Bacteria | 1059 |
| 179 | Ga0070707_100001035 | 3300005468 | Bacteria | 27552 |
| 180 | Ga0070707_100017848 | 3300005468 | Bacteria | 6672 |
| 181 | Ga0070707_100090717 | 3300005468 | Bacteria | 2958 |
| 182 | Ga0070707_100312839 | 3300005468 | Bacteria | 1526 |
| 183 | Ga0070698_100012669 | 3300005471 | Bacteria | 8927 |
| 184 | Ga0070698_100037988 | 3300005471 | Bacteria | 4963 |
| 185 | Ga0070698_100121865 | 3300005471 | Bacteria | 2567 |
| 186 | Ga0070698_100405704 | 3300005471 | Bacteria | 1296 |
| 187 | Ga0070699_100006598 | 3300005518 | Bacteria | 10088 |
| 188 | Ga0070699_100011295 | 3300005518 | Bacteria | 7715 |
| 189 | Ga0070699_100054612 | 3300005518 | Bacteria | 3457 |
| 190 | Ga0070699_100186548 | 3300005518 | Bacteria | 1842 |
| 191 | Ga0070699_100190601 | 3300005518 | Bacteria | 1821 |
| 192 | Ga0070699_100315242 | 3300005518 | Bacteria | 1405 |
| 193 | Ga0070679_100000151 | 3300005530 | Bacteria | 56102 |
| 194 | Ga0070679_100000574 | 3300005530 | Bacteria | 31165 |
| 195 | Ga0070679_100005661 | 3300005530 | Bacteria | 11581 |
| 196 | Ga0070679_100011629 | 3300005530 | Bacteria | 8387 |
| 197 | Ga0070679_100012388 | 3300005530 | Bacteria | 8148 |
| 198 | Ga0070679_100023739 | 3300005530 | Bacteria | 6008 |
| 199 | Ga0070679_100058235 | 3300005530 | Bacteria | 3850 |
| 200 | Ga0070679_100136478 | 3300005530 | Bacteria | 2434 |
| 201 | Ga0070679_100197173 | 3300005530 | Bacteria | 1980 |
| 202 | Ga0070684_100000453 | 3300005535 | Bacteria | 28005 |
| 203 | Ga0070684_100006943 | 3300005535 | Bacteria | 8793 |
| 204 | Ga0070684_100035061 | 3300005535 | Bacteria | 4292 |
| 205 | Ga0070684_100041560 | 3300005535 | Bacteria | 3964 |
| 206 | Ga0070684_100045753 | 3300005535 | Bacteria | 3790 |
| 207 | Ga0070684_100053571 | 3300005535 | Bacteria | 3513 |
| 208 | Ga0070684_100071884 | 3300005535 | Bacteria | 3044 |
| 209 | Ga0070684_100128686 | 3300005535 | Bacteria | 2283 |
| 210 | Ga0070684_100169336 | 3300005535 | Bacteria | 1984 |
| 211 | Ga0070684_100334588 | 3300005535 | Bacteria | 1392 |
| 212 | Ga0070684_100451797 | 3300005535 | Bacteria | 1188 |
| 213 | Ga0070697_100024628 | 3300005536 | Bacteria | 4793 |
| 214 | Ga0070697_100084591 | 3300005536 | Bacteria | 2616 |
| 215 | Ga0070697_100109057 | 3300005536 | Bacteria | 2305 |
| 216 | Ga0070697_100206139 | 3300005536 | Bacteria | 1672 |
| 217 | Ga0070697_100235551 | 3300005536 | Bacteria | 1562 |
| 218 | Ga0068853_100007984 | 3300005539 | Bacteria | 8487 |
| 219 | Ga0068853_100048124 | 3300005539 | Bacteria | 3661 |
| 220 | Ga0068853_100397052 | 3300005539 | Bacteria | 1290 |
| 221 | Ga0070672_100001009 | 3300005543 | Bacteria | 17082 |
| 222 | Ga0070686_100037060 | 3300005544 | Bacteria | 3023 |
| 223 | Ga0070686_100102797 | 3300005544 | Bacteria | 1933 |
| 224 | Ga0070695_100004425 | 3300005545 | Bacteria | 8246 |
| 225 | Ga0070695_100008847 | 3300005545 | Bacteria | 5982 |
| 226 | Ga0070695_100025183 | 3300005545 | Bacteria | 3672 |
| 227 | Ga0070695_100026367 | 3300005545 | Bacteria | 3595 |
| 228 | Ga0070695_100050264 | 3300005545 | Bacteria | 2671 |
| 229 | Ga0070695_100060097 | 3300005545 | Bacteria | 2462 |
| 230 | Ga0070695_100094612 | 3300005545 | Bacteria | 2001 |
| 231 | Ga0070696_100021028 | 3300005546 | Bacteria | 4422 |
| 232 | Ga0070696_100036167 | 3300005546 | Bacteria | 3403 |
| 233 | Ga0070696_100150548 | 3300005546 | Bacteria | 1707 |
| 234 | Ga0070696_100191124 | 3300005546 | Bacteria | 1524 |
| 235 | Ga0070693_100004287 | 3300005547 | Bacteria | 6733 |
| 236 | Ga0070693_100004554 | 3300005547 | Bacteria | 6573 |
| 237 | Ga0070704_100012319 | 3300005549 | Bacteria | 5280 |
| 238 | Ga0070704_100012483 | 3300005549 | Bacteria | 5247 |
| 239 | Ga0070704_100067816 | 3300005549 | Bacteria | 2578 |
| 240 | Ga0068855_100007696 | 3300005563 | Bacteria | 13011 |
| 241 | Ga0068855_100016881 | 3300005563 | Bacteria | 8778 |
| 242 | Ga0068855_100075852 | 3300005563 | Bacteria | 3903 |
| 243 | Ga0068855_100168240 | 3300005563 | Bacteria | 2483 |
| 244 | Ga0068855_100260033 | 3300005563 | Bacteria | 1934 |
| 245 | Ga0068855_100459220 | 3300005563 | Bacteria | 1389 |
| 246 | Ga0070664_100001011 | 3300005564 | Bacteria | 22087 |
| 247 | Ga0070664_100005563 | 3300005564 | Bacteria | 10121 |
| 248 | Ga0070664_100013240 | 3300005564 | Bacteria | 6719 |
| 249 | Ga0070664_100024837 | 3300005564 | Bacteria | 4963 |
| 250 | Ga0070664_100056936 | 3300005564 | Bacteria | 3322 |
| 251 | Ga0070664_100061089 | 3300005564 | Bacteria | 3211 |
| 252 | Ga0070664_100087111 | 3300005564 | Bacteria | 2699 |
| 253 | Ga0070664_100291730 | 3300005564 | Bacteria | 1473 |
| 254 | Ga0068857_100001942 | 3300005577 | Bacteria | 16681 |
| 255 | Ga0068857_100003270 | 3300005577 | Bacteria | 13465 |
| 256 | Ga0068857_100009359 | 3300005577 | Bacteria | 8506 |
| 257 | Ga0068857_100185383 | 3300005577 | Bacteria | 1894 |
| 258 | Ga0068857_100190178 | 3300005577 | Bacteria | 1869 |
| 259 | Ga0068857_100296647 | 3300005577 | Bacteria | 1490 |
| 260 | Ga0068854_100010711 | 3300005578 | Bacteria | 5952 |
| 261 | Ga0068854_100027498 | 3300005578 | Bacteria | 3920 |
| 262 | Ga0068854_100060335 | 3300005578 | Bacteria | 2743 |
| 263 | Ga0068854_100164962 | 3300005578 | Bacteria | 1719 |
| 264 | Ga0068854_100370753 | 3300005578 | Bacteria | 1177 |
| 265 | Ga0068854_100465460 | 3300005578 | Bacteria | 1059 |
| 266 | Ga0068856_100019865 | 3300005614 | Bacteria | 6522 |
| 267 | Ga0068856_100121165 | 3300005614 | Bacteria | 2617 |
| 268 | Ga0068856_100201431 | 3300005614 | Unclassified | 2005 |
| 269 | Ga0068856_100225134 | 3300005614 | Bacteria | 1891 |
| 270 | Ga0068856_100281053 | 3300005614 | Bacteria | 1681 |
| 271 | Ga0070702_100001473 | 3300005615 | Bacteria | 9659 |
| 272 | Ga0068852_100000642 | 3300005616 | Bacteria | 22866 |
| 273 | Ga0068852_100015929 | 3300005616 | Bacteria | 5850 |
| 274 | Ga0068852_100022605 | 3300005616 | Bacteria | 5046 |
| 275 | Ga0068852_100063084 | 3300005616 | Bacteria | 3225 |
| 276 | Ga0068859_100067117 | 3300005617 | Bacteria | 3621 |
| 277 | Ga0068859_100119078 | 3300005617 | Bacteria | 2706 |
| 278 | Ga0068859_100167452 | 3300005617 | Bacteria | 2277 |
| 279 | Ga0068859_100670379 | 3300005617 | Bacteria | 1129 |
| 280 | Ga0068864_100006923 | 3300005618 | Bacteria | 9300 |
| 281 | Ga0068864_100221460 | 3300005618 | Bacteria | 1746 |
| 282 | Ga0068866_10038891 | 3300005718 | Bacteria | 2346 |
| 283 | Ga0068861_100001041 | 3300005719 | Bacteria | 17023 |
| 284 | Ga0068861_100009433 | 3300005719 | Bacteria | 6737 |
| 285 | Ga0068861_100035340 | 3300005719 | Bacteria | 3701 |
| 286 | Ga0068861_100417196 | 3300005719 | Bacteria | 1195 |
| 287 | Ga0068851_10026626 | 3300005834 | Bacteria | 2844 |
| 288 | Ga0068851_10179411 | 3300005834 | Bacteria | 1172 |
| 289 | Ga0068870_10002369 | 3300005840 | Bacteria | 7839 |
| 290 | Ga0068863_100008965 | 3300005841 | Bacteria | 9768 |
| 291 | Ga0068863_100031045 | 3300005841 | Bacteria | 5102 |
| 292 | Ga0068858_100010522 | 3300005842 | Bacteria | 8761 |
| 293 | Ga0068858_100151623 | 3300005842 | Bacteria | 2180 |
| 294 | Ga0068858_100276650 | 3300005842 | Bacteria | 1598 |
| 295 | Ga0068860_100010610 | 3300005843 | Bacteria | 9098 |
| 296 | Ga0068860_100019902 | 3300005843 | Bacteria | 6508 |
| 297 | Ga0068862_100000266 | 3300005844 | Bacteria | 58197 |
| 298 | Ga0068862_100003004 | 3300005844 | Bacteria | 14715 |
| 299 | Ga0068862_100116261 | 3300005844 | Bacteria | 2353 |
| 300 | Ga0081539_10000354 | 3300005985 | Bacteria | 100885 |
| 301 | Ga0081539_10013437 | 3300005985 | Bacteria | 6167 |
| 302 | Ga0070717_10008217 | 3300006028 | Bacteria | 7796 |
| 303 | Ga0070716_100000659 | 3300006173 | Bacteria | 14660 |
| 304 | Ga0070712_100004829 | 3300006175 | Bacteria | 8332 |
| 305 | Ga0070712_100159803 | 3300006175 | Bacteria | 1739 |
| 306 | Ga0097621_100142147 | 3300006237 | Bacteria | 2051 |
| 307 | Ga0075428_100035486 | 3300006844 | Bacteria | 5497 |
| 308 | Ga0075428_100433064 | 3300006844 | Bacteria | 1409 |
| 309 | Ga0075430_100001226 | 3300006846 | Bacteria | 20638 |
| 310 | Ga0075430_100001947 | 3300006846 | Bacteria | 16959 |
| 311 | Ga0075430_100006661 | 3300006846 | Bacteria | 9744 |
| 312 | Ga0075430_100036046 | 3300006846 | Bacteria | 4194 |
| 313 | Ga0075430_100064871 | 3300006846 | Bacteria | 3069 |
| 314 | Ga0075431_100109428 | 3300006847 | Bacteria | 2852 |
| 315 | Ga0075431_100183837 | 3300006847 | Bacteria | 2144 |
| 316 | Ga0075431_100497977 | 3300006847 | Bacteria | 1210 |
| 317 | Ga0075433_10001420 | 3300006852 | Bacteria | 17644 |
| 318 | Ga0075433_10006048 | 3300006852 | Bacteria | 9533 |
| 319 | Ga0075433_10185586 | 3300006852 | Bacteria | 1850 |
| 320 | Ga0075434_100001773 | 3300006871 | Bacteria | 18589 |
| 321 | Ga0075434_100002916 | 3300006871 | Bacteria | 15193 |
| 322 | Ga0075434_100022446 | 3300006871 | Bacteria | 6146 |
| 323 | Ga0075434_100036436 | 3300006871 | Bacteria | 4866 |
| 324 | Ga0075434_100070881 | 3300006871 | Bacteria | 3476 |
| 325 | Ga0075434_100091254 | 3300006871 | Bacteria | 3048 |
| 326 | Ga0075429_100170786 | 3300006880 | Bacteria | 1905 |
| 327 | Ga0068865_100010488 | 3300006881 | Bacteria | 5767 |
| 328 | Ga0068865_100020556 | 3300006881 | Bacteria | 4282 |
| 329 | Ga0068865_100055990 | 3300006881 | Bacteria | 2746 |
| 330 | Ga0068865_100188936 | 3300006881 | Bacteria | 1591 |
| 331 | Ga0068865_100231851 | 3300006881 | Bacteria | 1449 |
| 332 | Ga0075436_100004747 | 3300006914 | Bacteria | 9326 |
| 333 | Ga0075436_100010941 | 3300006914 | Bacteria | 6228 |
| 334 | Ga0075436_100017435 | 3300006914 | Bacteria | 4917 |
| 335 | Ga0075436_100064559 | 3300006914 | Bacteria | 2531 |
| 336 | Ga0075436_100136101 | 3300006914 | Bacteria | 1725 |
| 337 | Ga0097620_100067112 | 3300006931 | Bacteria | 3621 |
| 338 | Ga0097620_100119073 | 3300006931 | Bacteria | 2706 |
| 339 | Ga0097620_100167443 | 3300006931 | Bacteria | 2277 |
| 340 | Ga0097620_100670345 | 3300006931 | Bacteria | 1129 |
| 341 | Ga0075435_100006252 | 3300007076 | Bacteria | 8409 |
| 342 | Ga0099794_10025551 | 3300007265 | Unclassified | 2722 |
| 343 | Ga0105240_10034830 | 3300009093 | Bacteria | 6491 |
| 344 | Ga0105240_10242719 | 3300009093 | Bacteria | 2088 |
| 345 | Ga0105240_10291716 | 3300009093 | Bacteria | 1869 |
| 346 | Ga0105240_10310155 | 3300009093 | Bacteria | 1802 |
| 347 | Ga0111539_10042573 | 3300009094 | Bacteria | 5451 |
| 348 | Ga0111539_10052529 | 3300009094 | Unclassified | 4851 |
| 349 | Ga0111539_10370993 | 3300009094 | Bacteria | 1666 |
| 350 | Ga0111539_10420958 | 3300009094 | Bacteria | 1556 |
| 351 | Ga0105245_10004990 | 3300009098 | Bacteria | 11666 |
| 352 | Ga0105245_10005211 | 3300009098 | Bacteria | 11416 |
| 353 | Ga0105245_10041918 | 3300009098 | Bacteria | 4082 |
| 354 | Ga0105245_10093486 | 3300009098 | Bacteria | 2771 |
| 355 | Ga0105245_10313529 | 3300009098 | Bacteria | 1543 |
| 356 | Ga0105247_10195420 | 3300009101 | Bacteria | 1356 |
| 357 | Ga0114129_10009159 | 3300009147 | Bacteria | 14112 |
| 358 | Ga0114129_10043062 | 3300009147 | Bacteria | 6354 |
| 359 | Ga0114129_10098561 | 3300009147 | Bacteria | 4046 |
| 360 | Ga0114129_10098928 | 3300009147 | Bacteria | 4037 |
| 361 | Ga0114129_10199121 | 3300009147 | Unclassified | 2714 |
| 362 | Ga0105243_10594958 | 3300009148 | Bacteria | 1064 |
| 363 | Ga0105241_10023408 | 3300009174 | Bacteria | 4580 |
| 364 | Ga0105241_10030751 | 3300009174 | Bacteria | 4016 |
| 365 | Ga0105241_10111404 | 3300009174 | Bacteria | 2191 |
| 366 | Ga0105241_10209701 | 3300009174 | Unclassified | 1632 |
| 367 | Ga0105242_10002448 | 3300009176 | Bacteria | 14564 |
| 368 | Ga0105242_10004910 | 3300009176 | Bacteria | 10350 |
| 369 | Ga0105242_10023587 | 3300009176 | Bacteria | 4849 |
| 370 | Ga0105242_10066539 | 3300009176 | Bacteria | 2976 |
| 371 | Ga0105248_10028017 | 3300009177 | Bacteria | 6274 |
| 372 | Ga0105248_10039502 | 3300009177 | Bacteria | 5286 |
| 373 | Ga0105248_10104779 | 3300009177 | Bacteria | 3189 |
| 374 | Ga0105248_10107095 | 3300009177 | Bacteria | 3152 |
| 375 | Ga0105248_10310254 | 3300009177 | Bacteria | 1777 |
| 376 | Ga0105237_10015361 | 3300009545 | Bacteria | 7972 |
| 377 | Ga0105237_10031661 | 3300009545 | Bacteria | 5357 |
| 378 | Ga0105238_10059384 | 3300009551 | Bacteria | 3831 |
| 379 | Ga0105238_10173281 | 3300009551 | Bacteria | 2134 |
| 380 | Ga0105238_10180109 | 3300009551 | Bacteria | 2090 |
| 381 | Ga0105238_10297021 | 3300009551 | Bacteria | 1598 |
| 382 | Ga0105249_10000027 | 3300009553 | Bacteria | 231352 |
| 383 | Ga0105249_10000199 | 3300009553 | Bacteria | 68792 |
| 384 | Ga0105249_10004256 | 3300009553 | Bacteria | 12379 |
| 385 | Ga0105246_10019636 | 3300011119 | Bacteria | 4322 |
| 386 | Ga0105246_10155844 | 3300011119 | Bacteria | 1734 |
| 387 | Ga0157373_10019572 | 3300013100 | Bacteria | 4924 |
| 388 | Ga0157373_10069481 | 3300013100 | Bacteria | 2490 |
| 389 | Ga0157373_10160740 | 3300013100 | Bacteria | 1580 |
| 390 | Ga0157371_10004178 | 3300013102 | Bacteria | 12725 |
| 391 | Ga0157370_10003374 | 3300013104 | Bacteria | 18778 |
| 392 | Ga0157370_10129410 | 3300013104 | Bacteria | 2355 |
| 393 | Ga0157370_10153783 | 3300013104 | Bacteria | 2140 |
| 394 | Ga0157369_10011996 | 3300013105 | Bacteria | 9843 |
| 395 | Ga0157369_10036257 | 3300013105 | Bacteria | 5404 |
| 396 | Ga0157369_10092570 | 3300013105 | Bacteria | 3226 |
| 397 | Ga0157369_10110825 | 3300013105 | Bacteria | 2917 |
| 398 | Ga0157369_10120069 | 3300013105 | Bacteria | 2789 |
| 399 | Ga0157369_10207290 | 3300013105 | Bacteria | 2056 |
| 400 | Ga0157369_10611204 | 3300013105 | Bacteria | 1125 |
| 401 | Ga0157374_10040816 | 3300013296 | Bacteria | 4274 |
| 402 | Ga0157374_10538283 | 3300013296 | Bacteria | 1175 |
| 403 | Ga0157378_10022647 | 3300013297 | Bacteria | 5530 |
| 404 | Ga0157378_10053317 | 3300013297 | Bacteria | 3601 |
| 405 | Ga0157378_10064791 | 3300013297 | Bacteria | 3270 |
| 406 | Ga0157378_10110325 | 3300013297 | Bacteria | 2521 |
| 407 | Ga0157378_10144818 | 3300013297 | Bacteria | 2209 |
| 408 | Ga0163162_10004093 | 3300013306 | Bacteria | 13996 |
| 409 | Ga0163162_10466005 | 3300013306 | Bacteria | 1395 |
| 410 | Ga0157372_10014261 | 3300013307 | Bacteria | 8496 |
| 411 | Ga0157372_10023309 | 3300013307 | Bacteria | 6710 |
| 412 | Ga0157372_10024867 | 3300013307 | Bacteria | 6509 |
| 413 | Ga0157372_10026183 | 3300013307 | Bacteria | 6346 |
| 414 | Ga0157372_10030056 | 3300013307 | Bacteria | 5940 |
| 415 | Ga0157372_10035730 | 3300013307 | Bacteria | 5472 |
| 416 | Ga0157372_10044758 | 3300013307 | Bacteria | 4905 |
| 417 | Ga0157372_10046700 | 3300013307 | Bacteria | 4808 |
| 418 | Ga0157372_10102005 | 3300013307 | Bacteria | 3277 |
| 419 | Ga0157372_10175957 | 3300013307 | Bacteria | 2477 |
| 420 | Ga0157372_10748863 | 3300013307 | Bacteria | 1136 |
| 421 | Ga0157375_10007469 | 3300013308 | Bacteria | 9560 |
| 422 | Ga0157375_10011017 | 3300013308 | Bacteria | 7974 |
| 423 | Ga0157375_10045419 | 3300013308 | Bacteria | 4275 |
| 424 | Ga0157375_10061968 | 3300013308 | Bacteria | 3715 |
| 425 | Ga0157375_10076719 | 3300013308 | Bacteria | 3370 |
| 426 | Ga0157375_10135902 | 3300013308 | Bacteria | 2582 |
| 427 | Ga0157375_10152055 | 3300013308 | Bacteria | 2451 |
| 428 | Ga0157375_10200002 | 3300013308 | Bacteria | 2154 |
| 429 | Ga0163163_10211900 | 3300014325 | Bacteria | 1987 |
| 430 | Ga0163163_10360460 | 3300014325 | Bacteria | 1510 |
| 431 | Ga0157380_10004094 | 3300014326 | Bacteria | 10075 |
| 432 | Ga0157380_10260898 | 3300014326 | Bacteria | 1574 |
| 433 | Ga0157377_10001055 | 3300014745 | Bacteria | 11667 |
| 434 | Ga0157377_10022270 | 3300014745 | Bacteria | 3343 |
| 435 | Ga0157377_10070668 | 3300014745 | Bacteria | 2017 |
| 436 | Ga0157379_10037929 | 3300014968 | Bacteria | 4298 |
| 437 | Ga0157379_10217315 | 3300014968 | Bacteria | 1731 |
| 438 | Ga0163161_10082717 | 3300017792 | Bacteria | 2366 |
| 439 | Ga0206353_10828394 | 3300020082 | Bacteria | 2039 |
| 440 | Ga0207697_10015529 | 3300025315 | Bacteria | 3145 |
| 441 | Ga0207697_10030392 | 3300025315 | Bacteria | 2210 |
| 442 | Ga0207656_10012547 | 3300025321 | Bacteria | 3225 |
| 443 | Ga0207653_10017710 | 3300025885 | Bacteria | 2243 |
| 444 | Ga0207653_10070395 | 3300025885 | Bacteria | 1195 |
| 445 | Ga0207682_10022884 | 3300025893 | Bacteria | 2465 |
| 446 | Ga0207682_10031167 | 3300025893 | Bacteria | 2139 |
| 447 | Ga0207692_10019122 | 3300025898 | Bacteria | 3090 |
| 448 | Ga0207692_10131294 | 3300025898 | Bacteria | 1415 |
| 449 | Ga0207642_10002177 | 3300025899 | Bacteria | 6073 |
| 450 | Ga0207642_10011144 | 3300025899 | Bacteria | 3197 |
| 451 | Ga0207680_10087365 | 3300025903 | Bacteria | 1974 |
| 452 | Ga0207647_10132557 | 3300025904 | Bacteria | 1464 |
| 453 | Ga0207699_10001761 | 3300025906 | Bacteria | 10219 |
| 454 | Ga0207699_10005475 | 3300025906 | Bacteria | 6080 |
| 455 | Ga0207699_10029412 | 3300025906 | Bacteria | 3064 |
| 456 | Ga0207645_10000183 | 3300025907 | Bacteria | 50122 |
| 457 | Ga0207645_10005330 | 3300025907 | Bacteria | 9348 |
| 458 | Ga0207645_10062268 | 3300025907 | Bacteria | 2383 |
| 459 | Ga0207643_10002421 | 3300025908 | Bacteria | 10106 |
| 460 | Ga0207643_10005312 | 3300025908 | Bacteria | 6890 |
| 461 | Ga0207705_10004929 | 3300025909 | Bacteria | 10020 |
| 462 | Ga0207705_10006304 | 3300025909 | Bacteria | 8803 |
| 463 | Ga0207705_10121188 | 3300025909 | Bacteria | 1941 |
| 464 | Ga0207705_10180236 | 3300025909 | Bacteria | 1594 |
| 465 | Ga0207705_10335480 | 3300025909 | Bacteria | 1163 |
| 466 | Ga0207684_10027860 | 3300025910 | Bacteria | 4812 |
| 467 | Ga0207684_10093160 | 3300025910 | Bacteria | 2568 |
| 468 | Ga0207684_10198622 | 3300025910 | Bacteria | 1730 |
| 469 | Ga0207684_10267356 | 3300025910 | Bacteria | 1475 |
| 470 | Ga0207684_10485249 | 3300025910 | Bacteria | 1060 |
| 471 | Ga0207654_10029460 | 3300025911 | Bacteria | 3006 |
| 472 | Ga0207654_10156662 | 3300025911 | Bacteria | 1467 |
| 473 | Ga0207707_10001523 | 3300025912 | Bacteria | 21375 |
| 474 | Ga0207707_10001531 | 3300025912 | Bacteria | 21338 |
| 475 | Ga0207707_10003709 | 3300025912 | Bacteria | 13529 |
| 476 | Ga0207707_10005648 | 3300025912 | Bacteria | 10948 |
| 477 | Ga0207707_10006778 | 3300025912 | Bacteria | 9994 |
| 478 | Ga0207707_10008968 | 3300025912 | Bacteria | 8690 |
| 479 | Ga0207707_10032600 | 3300025912 | Bacteria | 4560 |
| 480 | Ga0207707_10046041 | 3300025912 | Bacteria | 3799 |
| 481 | Ga0207707_10047730 | 3300025912 | Bacteria | 3729 |
| 482 | Ga0207707_10071471 | 3300025912 | Bacteria | 3024 |
| 483 | Ga0207707_10084499 | 3300025912 | Bacteria | 2772 |
| 484 | Ga0207707_10089949 | 3300025912 | Bacteria | 2683 |
| 485 | Ga0207707_10107381 | 3300025912 | Bacteria | 2440 |
| 486 | Ga0207695_10027235 | 3300025913 | Bacteria | 6368 |
| 487 | Ga0207695_10093795 | 3300025913 | Bacteria | 3011 |
| 488 | Ga0207695_10108432 | 3300025913 | Bacteria | 2761 |
| 489 | Ga0207695_10238242 | 3300025913 | Bacteria | 1722 |
| 490 | Ga0207671_10268965 | 3300025914 | Bacteria | 1343 |
| 491 | Ga0207693_10008875 | 3300025915 | Bacteria | 8212 |
| 492 | Ga0207693_10058873 | 3300025915 | Bacteria | 3010 |
| 493 | Ga0207693_10089337 | 3300025915 | Bacteria | 2414 |
| 494 | Ga0207663_10007936 | 3300025916 | Bacteria | 5536 |
| 495 | Ga0207660_10000238 | 3300025917 | Bacteria | 35589 |
| 496 | Ga0207660_10006330 | 3300025917 | Bacteria | 7674 |
| 497 | Ga0207660_10016979 | 3300025917 | Bacteria | 4828 |
| 498 | Ga0207660_10019765 | 3300025917 | Bacteria | 4509 |
| 499 | Ga0207660_10023147 | 3300025917 | Bacteria | 4192 |
| 500 | Ga0207660_10025238 | 3300025917 | Bacteria | 4033 |
| 501 | Ga0207660_10031718 | 3300025917 | Bacteria | 3643 |
| 502 | Ga0207660_10037523 | 3300025917 | Bacteria | 3377 |
| 503 | Ga0207660_10037713 | 3300025917 | Bacteria | 3370 |
| 504 | Ga0207660_10051088 | 3300025917 | Bacteria | 2938 |
| 505 | Ga0207660_10058997 | 3300025917 | Bacteria | 2753 |
| 506 | Ga0207660_10067709 | 3300025917 | Bacteria | 2587 |
| 507 | Ga0207660_10068293 | 3300025917 | Bacteria | 2577 |
| 508 | Ga0207660_10079499 | 3300025917 | Bacteria | 2405 |
| 509 | Ga0207660_10109672 | 3300025917 | Unclassified | 2075 |
| 510 | Ga0207660_10116102 | 3300025917 | Bacteria | 2021 |
| 511 | Ga0207660_10144496 | 3300025917 | Bacteria | 1821 |
| 512 | Ga0207662_10002047 | 3300025918 | Bacteria | 9984 |
| 513 | Ga0207662_10003481 | 3300025918 | Bacteria | 8105 |
| 514 | Ga0207662_10007365 | 3300025918 | Bacteria | 5988 |
| 515 | Ga0207662_10019240 | 3300025918 | Bacteria | 3883 |
| 516 | Ga0207657_10000921 | 3300025919 | Bacteria | 31122 |
| 517 | Ga0207657_10090121 | 3300025919 | Bacteria | 2560 |
| 518 | Ga0207657_10236139 | 3300025919 | Bacteria | 1461 |
| 519 | Ga0207657_10270933 | 3300025919 | Bacteria | 1349 |
| 520 | Ga0207657_10393338 | 3300025919 | Bacteria | 1091 |
| 521 | Ga0207649_10003545 | 3300025920 | Bacteria | 8531 |
| 522 | Ga0207649_10009676 | 3300025920 | Bacteria | 5278 |
| 523 | Ga0207649_10022935 | 3300025920 | Bacteria | 3609 |
| 524 | Ga0207649_10029678 | 3300025920 | Bacteria | 3231 |
| 525 | Ga0207652_10001245 | 3300025921 | Bacteria | 22724 |
| 526 | Ga0207652_10001643 | 3300025921 | Bacteria | 19623 |
| 527 | Ga0207652_10002295 | 3300025921 | Bacteria | 16214 |
| 528 | Ga0207652_10014440 | 3300025921 | Bacteria | 6398 |
| 529 | Ga0207652_10026525 | 3300025921 | Bacteria | 4827 |
| 530 | Ga0207652_10038493 | 3300025921 | Bacteria | 4054 |
| 531 | Ga0207652_10047160 | 3300025921 | Bacteria | 3680 |
| 532 | Ga0207652_10056887 | 3300025921 | Unclassified | 3367 |
| 533 | Ga0207652_10061052 | 3300025921 | Bacteria | 3254 |
| 534 | Ga0207652_10078565 | 3300025921 | Bacteria | 2882 |
| 535 | Ga0207652_10108319 | 3300025921 | Bacteria | 2462 |
| 536 | Ga0207652_10149336 | 3300025921 | Bacteria | 2092 |
| 537 | Ga0207646_10003899 | 3300025922 | Bacteria | 16559 |
| 538 | Ga0207646_10007505 | 3300025922 | Bacteria | 11066 |
| 539 | Ga0207646_10009684 | 3300025922 | Bacteria | 9498 |
| 540 | Ga0207646_10076584 | 3300025922 | Bacteria | 2989 |
| 541 | Ga0207646_10112165 | 3300025922 | Bacteria | 2447 |
| 542 | Ga0207646_10270378 | 3300025922 | Bacteria | 1536 |
| 543 | Ga0207681_10001947 | 3300025923 | Bacteria | 13251 |
| 544 | Ga0207681_10003688 | 3300025923 | Bacteria | 9518 |
| 545 | Ga0207681_10004290 | 3300025923 | Bacteria | 8801 |
| 546 | Ga0207694_10096477 | 3300025924 | Bacteria | 2338 |
| 547 | Ga0207650_10005530 | 3300025925 | Bacteria | 8622 |
| 548 | Ga0207650_10037877 | 3300025925 | Bacteria | 3517 |
| 549 | Ga0207659_10004586 | 3300025926 | Bacteria | 8359 |
| 550 | Ga0207659_10112473 | 3300025926 | Bacteria | 2072 |
| 551 | Ga0207659_10125112 | 3300025926 | Bacteria | 1976 |
| 552 | Ga0207687_10152998 | 3300025927 | Bacteria | 1762 |
| 553 | Ga0207687_10154017 | 3300025927 | Bacteria | 1757 |
| 554 | Ga0207687_10207072 | 3300025927 | Bacteria | 1537 |
| 555 | Ga0207687_10209355 | 3300025927 | Bacteria | 1529 |
| 556 | Ga0207700_10000127 | 3300025928 | Bacteria | 45226 |
| 557 | Ga0207664_10002343 | 3300025929 | Bacteria | 12524 |
| 558 | Ga0207664_10048994 | 3300025929 | Bacteria | 3324 |
| 559 | Ga0207664_10071817 | 3300025929 | Bacteria | 2789 |
| 560 | Ga0207664_10175470 | 3300025929 | Bacteria | 1837 |
| 561 | Ga0207644_10058056 | 3300025931 | Bacteria | 2796 |
| 562 | Ga0207690_10003280 | 3300025932 | Bacteria | 9695 |
| 563 | Ga0207690_10006373 | 3300025932 | Bacteria | 6994 |
| 564 | Ga0207690_10258604 | 3300025932 | Bacteria | 1348 |
| 565 | Ga0207706_10000565 | 3300025933 | Bacteria | 39296 |
| 566 | Ga0207706_10012191 | 3300025933 | Bacteria | 7833 |
| 567 | Ga0207706_10026259 | 3300025933 | Bacteria | 5213 |
| 568 | Ga0207706_10076139 | 3300025933 | Bacteria | 2951 |
| 569 | Ga0207706_10124707 | 3300025933 | Bacteria | 2266 |
| 570 | Ga0207686_10069814 | 3300025934 | Bacteria | 2255 |
| 571 | Ga0207686_10078807 | 3300025934 | Bacteria | 2143 |
| 572 | Ga0207670_10034304 | 3300025936 | Bacteria | 3278 |
| 573 | Ga0207670_10076266 | 3300025936 | Bacteria | 2332 |
| 574 | Ga0207669_10046568 | 3300025937 | Bacteria | 2564 |
| 575 | Ga0207669_10049180 | 3300025937 | Bacteria | 2511 |
| 576 | Ga0207669_10090436 | 3300025937 | Bacteria | 1991 |
| 577 | Ga0207669_10120272 | 3300025937 | Unclassified | 1781 |
| 578 | Ga0207669_10279220 | 3300025937 | Bacteria | 1259 |
| 579 | Ga0207704_10042122 | 3300025938 | Bacteria | 2685 |
| 580 | Ga0207704_10090078 | 3300025938 | Bacteria | 2012 |
| 581 | Ga0207704_10326947 | 3300025938 | Bacteria | 1185 |
| 582 | Ga0207665_10000392 | 3300025939 | Bacteria | 29995 |
| 583 | Ga0207665_10005957 | 3300025939 | Bacteria | 8111 |
| 584 | Ga0207665_10041641 | 3300025939 | Bacteria | 3068 |
| 585 | Ga0207665_10081536 | 3300025939 | Bacteria | 2228 |
| 586 | Ga0207691_10000109 | 3300025940 | Bacteria | 73421 |
| 587 | Ga0207691_10000685 | 3300025940 | Bacteria | 33454 |
| 588 | Ga0207691_10023055 | 3300025940 | Bacteria | 5864 |
| 589 | Ga0207691_10048148 | 3300025940 | Bacteria | 3909 |
| 590 | Ga0207691_10075624 | 3300025940 | Bacteria | 3036 |
| 591 | Ga0207691_10172390 | 3300025940 | Bacteria | 1894 |
| 592 | Ga0207691_10466690 | 3300025940 | Bacteria | 1073 |
| 593 | Ga0207711_10047435 | 3300025941 | Bacteria | 3672 |
| 594 | Ga0207711_10073206 | 3300025941 | Bacteria | 2977 |
| 595 | Ga0207689_10000181 | 3300025942 | Bacteria | 54883 |
| 596 | Ga0207689_10005513 | 3300025942 | Bacteria | 11311 |
| 597 | Ga0207689_10097526 | 3300025942 | Bacteria | 2414 |
| 598 | Ga0207661_10002310 | 3300025944 | Bacteria | 13131 |
| 599 | Ga0207661_10004772 | 3300025944 | Bacteria | 9492 |
| 600 | Ga0207661_10008163 | 3300025944 | Bacteria | 7472 |
| 601 | Ga0207661_10011578 | 3300025944 | Bacteria | 6398 |
| 602 | Ga0207661_10014723 | 3300025944 | Bacteria | 5738 |
| 603 | Ga0207661_10015259 | 3300025944 | Bacteria | 5649 |
| 604 | Ga0207661_10104946 | 3300025944 | Bacteria | 2380 |
| 605 | Ga0207661_10169874 | 3300025944 | Bacteria | 1898 |
| 606 | Ga0207679_10001098 | 3300025945 | Bacteria | 17220 |
| 607 | Ga0207679_10005409 | 3300025945 | Bacteria | 8000 |
| 608 | Ga0207679_10018167 | 3300025945 | Bacteria | 4706 |
| 609 | Ga0207679_10024147 | 3300025945 | Bacteria | 4165 |
| 610 | Ga0207679_10030240 | 3300025945 | Bacteria | 3779 |
| 611 | Ga0207679_10048097 | 3300025945 | Bacteria | 3103 |
| 612 | Ga0207679_10056344 | 3300025945 | Unclassified | 2902 |
| 613 | Ga0207679_10071013 | 3300025945 | Bacteria | 2625 |
| 614 | Ga0207679_10131480 | 3300025945 | Bacteria | 2009 |
| 615 | Ga0207679_10282857 | 3300025945 | Bacteria | 1423 |
| 616 | Ga0207679_10343488 | 3300025945 | Bacteria | 1299 |
| 617 | Ga0207667_10034655 | 3300025949 | Bacteria | 5419 |
| 618 | Ga0207667_10126476 | 3300025949 | Bacteria | 2632 |
| 619 | Ga0207667_10447943 | 3300025949 | Bacteria | 1312 |
| 620 | Ga0207651_10135618 | 3300025960 | Bacteria | 1892 |
| 621 | Ga0207712_10000276 | 3300025961 | Bacteria | 49078 |
| 622 | Ga0207712_10000353 | 3300025961 | Bacteria | 40832 |
| 623 | Ga0207712_10036346 | 3300025961 | Bacteria | 3354 |
| 624 | Ga0207668_10019075 | 3300025972 | Bacteria | 4328 |
| 625 | Ga0207668_10025365 | 3300025972 | Bacteria | 3836 |
| 626 | Ga0207640_10098307 | 3300025981 | Bacteria | 2046 |
| 627 | Ga0207640_10106130 | 3300025981 | Bacteria | 1981 |
| 628 | Ga0207640_10283511 | 3300025981 | Bacteria | 1302 |
| 629 | Ga0207658_10022743 | 3300025986 | Bacteria | 4367 |
| 630 | Ga0207658_10023602 | 3300025986 | Bacteria | 4295 |
| 631 | Ga0207658_10124765 | 3300025986 | Bacteria | 2059 |
| 632 | Ga0207658_10278163 | 3300025986 | Bacteria | 1434 |
| 633 | Ga0207677_10012998 | 3300026023 | Bacteria | 4810 |
| 634 | Ga0207677_10039299 | 3300026023 | Bacteria | 3110 |
| 635 | Ga0207703_10092608 | 3300026035 | Bacteria | 2544 |
| 636 | Ga0207639_10041304 | 3300026041 | Bacteria | 3449 |
| 637 | Ga0207639_10045201 | 3300026041 | Bacteria | 3316 |
| 638 | Ga0207639_10163107 | 3300026041 | Bacteria | 1880 |
| 639 | Ga0207678_10022886 | 3300026067 | Bacteria | 5470 |
| 640 | Ga0207678_10111572 | 3300026067 | Bacteria | 2333 |
| 641 | Ga0207708_10009211 | 3300026075 | Bacteria | 7307 |
| 642 | Ga0207708_10024580 | 3300026075 | Bacteria | 4557 |
| 643 | Ga0207708_10032892 | 3300026075 | Bacteria | 3937 |
| 644 | Ga0207708_10114605 | 3300026075 | Bacteria | 2095 |
| 645 | Ga0207702_10126990 | 3300026078 | Bacteria | 2291 |
| 646 | Ga0207702_10156467 | 3300026078 | Bacteria | 2078 |
| 647 | Ga0207702_10270524 | 3300026078 | Bacteria | 1602 |
| 648 | Ga0207702_10275392 | 3300026078 | Bacteria | 1589 |
| 649 | Ga0207641_10117873 | 3300026088 | Bacteria | 2364 |
| 650 | Ga0207641_10166383 | 3300026088 | Bacteria | 2009 |
| 651 | Ga0207641_10254050 | 3300026088 | Bacteria | 1643 |
| 652 | Ga0207648_10006701 | 3300026089 | Bacteria | 11424 |
| 653 | Ga0207648_10032327 | 3300026089 | Bacteria | 4620 |
| 654 | Ga0207648_10089318 | 3300026089 | Bacteria | 2692 |
| 655 | Ga0207648_10167413 | 3300026089 | Bacteria | 1942 |
| 656 | Ga0207676_10002114 | 3300026095 | Bacteria | 14397 |
| 657 | Ga0207674_10000081 | 3300026116 | Bacteria | 101724 |
| 658 | Ga0207674_10000388 | 3300026116 | Bacteria | 57168 |
| 659 | Ga0207674_10000888 | 3300026116 | Bacteria | 39092 |
| 660 | Ga0207674_10007250 | 3300026116 | Bacteria | 12931 |
| 661 | Ga0207674_10048782 | 3300026116 | Bacteria | 4332 |
| 662 | Ga0207674_10187885 | 3300026116 | Bacteria | 2016 |
| 663 | Ga0207674_10281048 | 3300026116 | Unclassified | 1612 |
| 664 | Ga0207675_100000650 | 3300026118 | Bacteria | 34209 |
| 665 | Ga0207675_100003901 | 3300026118 | Bacteria | 14502 |
| 666 | Ga0207675_100083549 | 3300026118 | Bacteria | 2995 |
| 667 | Ga0207683_10020695 | 3300026121 | Bacteria | 5628 |
| 668 | Ga0207698_10000888 | 3300026142 | Bacteria | 17346 |
| 669 | Ga0207698_10014306 | 3300026142 | Bacteria | 5271 |
| 670 | Ga0207698_10095935 | 3300026142 | Bacteria | 2443 |
| 671 | Ga0207698_10585541 | 3300026142 | Bacteria | 1098 |
| 672 | Ga0209969_1001717 | 3300027360 | Bacteria | 3020 |
| 673 | Ga0209999_1004276 | 3300027543 | Unclassified | 2571 |
| 674 | Ga0209970_1014421 | 3300027614 | Bacteria | 1313 |
| 675 | Ga0209966_1000923 | 3300027695 | Bacteria | 5561 |
| 676 | Ga0209998_10003473 | 3300027717 | Bacteria | 3443 |
| 677 | Ga0209974_10026274 | 3300027876 | Bacteria | 1928 |
| 678 | Ga0268265_10001227 | 3300028380 | Bacteria | 22225 |
| 679 | Ga0268265_10072678 | 3300028380 | Bacteria | 2683 |
| 680 | Ga0268265_10150856 | 3300028380 | Bacteria | 1960 |
| 681 | Ga0268264_10080970 | 3300028381 | Bacteria | 2774 |
| 682 | Ga0307408_100016250 | 3300031548 | Bacteria | 4964 |
| 683 | Ga0307408_100019018 | 3300031548 | Bacteria | 4620 |
| 684 | Ga0307408_100048028 | 3300031548 | Bacteria | 3060 |
| 685 | Ga0307408_100051921 | 3300031548 | Bacteria | 2956 |
| 686 | Ga0307408_100094821 | 3300031548 | Bacteria | 2261 |
| 687 | Ga0307408_100170777 | 3300031548 | Bacteria | 1736 |
| 688 | Ga0307408_100421756 | 3300031548 | Bacteria | 1151 |
| 689 | Ga0307405_10009469 | 3300031731 | Bacteria | 4995 |
| 690 | Ga0307405_10019818 | 3300031731 | Bacteria | 3746 |
| 691 | Ga0307405_10090158 | 3300031731 | Bacteria | 2027 |
| 692 | Ga0307405_10152914 | 3300031731 | Bacteria | 1625 |
| 693 | Ga0307413_10026970 | 3300031824 | Bacteria | 3175 |
| 694 | Ga0307413_10059196 | 3300031824 | Bacteria | 2352 |
| 695 | Ga0307413_10103937 | 3300031824 | Bacteria | 1884 |
| 696 | Ga0307413_10118703 | 3300031824 | Bacteria | 1786 |
| 697 | Ga0307413_10181091 | 3300031824 | Bacteria | 1502 |
| 698 | Ga0307413_10339251 | 3300031824 | Bacteria | 1155 |
| 699 | Ga0307410_10001361 | 3300031852 | Bacteria | 10977 |
| 700 | Ga0307410_10004326 | 3300031852 | Bacteria | 7323 |
| 701 | Ga0307410_10005792 | 3300031852 | Bacteria | 6588 |
| 702 | Ga0307410_10013670 | 3300031852 | Bacteria | 4745 |
| 703 | Ga0307410_10199764 | 3300031852 | Bacteria | 1526 |
| 704 | Ga0307410_10264618 | 3300031852 | Bacteria | 1342 |
| 705 | Ga0307406_10011369 | 3300031901 | Bacteria | 5050 |
| 706 | Ga0307406_10022122 | 3300031901 | Bacteria | 3770 |
| 707 | Ga0307406_10040555 | 3300031901 | Bacteria | 2895 |
| 708 | Ga0307406_10061576 | 3300031901 | Bacteria | 2424 |
| 709 | Ga0307406_10120515 | 3300031901 | Bacteria | 1823 |
| 710 | Ga0307407_10009235 | 3300031903 | Bacteria | 4580 |
| 711 | Ga0307407_10069875 | 3300031903 | Bacteria | 2086 |
| 712 | Ga0307407_10088662 | 3300031903 | Bacteria | 1890 |
| 713 | Ga0307407_10107271 | 3300031903 | Bacteria | 1746 |
| 714 | Ga0307407_10127181 | 3300031903 | Bacteria | 1625 |
| 715 | Ga0307412_10066778 | 3300031911 | Bacteria | 2439 |
| 716 | Ga0307412_10257824 | 3300031911 | Bacteria | 1357 |
| 717 | Ga0307409_100002214 | 3300031995 | Bacteria | 10050 |
| 718 | Ga0307409_100029486 | 3300031995 | Bacteria | 3928 |
| 719 | Ga0307409_100030207 | 3300031995 | Bacteria | 3890 |
| 720 | Ga0307409_100036578 | 3300031995 | Bacteria | 3610 |
| 721 | Ga0307409_100052141 | 3300031995 | Bacteria | 3134 |
| 722 | Ga0307409_100058840 | 3300031995 | Bacteria | 2987 |
| 723 | Ga0307409_100079531 | 3300031995 | Bacteria | 2642 |
| 724 | Ga0307409_100325405 | 3300031995 | Bacteria | 1440 |
| 725 | Ga0307416_100011387 | 3300032002 | Bacteria | 5927 |
| 726 | Ga0307416_100019225 | 3300032002 | Bacteria | 4837 |
| 727 | Ga0307416_100030151 | 3300032002 | Bacteria | 4066 |
| 728 | Ga0307416_100088318 | 3300032002 | Bacteria | 2650 |
| 729 | Ga0307416_100088768 | 3300032002 | Bacteria | 2645 |
| 730 | Ga0307416_100136057 | 3300032002 | Bacteria | 2223 |
| 731 | Ga0307416_100224601 | 3300032002 | Bacteria | 1804 |
| 732 | Ga0307416_100331676 | 3300032002 | Bacteria | 1529 |
| 733 | Ga0307416_100348198 | 3300032002 | Bacteria | 1498 |
| 734 | Ga0307416_100411324 | 3300032002 | Bacteria | 1393 |
| 735 | Ga0307416_100576451 | 3300032002 | Bacteria | 1202 |
| 736 | Ga0307414_10023391 | 3300032004 | Bacteria | 3918 |
| 737 | Ga0307414_10116253 | 3300032004 | Bacteria | 2047 |
| 738 | Ga0307414_10142580 | 3300032004 | Bacteria | 1878 |
| 739 | Ga0307414_10203710 | 3300032004 | Bacteria | 1611 |
| 740 | Ga0307411_10001049 | 3300032005 | Bacteria | 10707 |
| 741 | Ga0307411_10006072 | 3300032005 | Bacteria | 6005 |
| 742 | Ga0307411_10011050 | 3300032005 | Bacteria | 4850 |
| 743 | Ga0307411_10021823 | 3300032005 | Bacteria | 3756 |
| 744 | Ga0307411_10035785 | 3300032005 | Bacteria | 3105 |
| 745 | Ga0307415_100013989 | 3300032126 | Bacteria | 4702 |
| 746 | Ga0307415_100035168 | 3300032126 | Bacteria | 3270 |
| 747 | Ga0307415_100117382 | 3300032126 | Bacteria | 1987 |
| 748 | Ga0307415_100189021 | 3300032126 | Bacteria | 1623 |
| 749 | Ga0307415_100297284 | 3300032126 | Bacteria | 1336 |
| 750 | Ga0373959_0008506 | 3300034820 | Bacteria | 1748 |
| 751 | Ga0373934_0003818 | 3300035086 | Bacteria | 5547 |
| 752 | Ga0373934_0006027 | 3300035086 | Bacteria | 4485 |
| 753 | Ga0373934_0148798 | 3300035086 | Bacteria | 958 |
| 754 | Ga0373923_0009261 | 3300035111 | Bacteria | 3549 |
| 755 | Ga0373956_0001092 | 3300035119 | Bacteria | 11166 |
| 756 | Ga0373943_0000516 | 3300035170 | Bacteria | 16651 |
| 757 | Ga0373943_0118972 | 3300035170 | Bacteria | 1402 |
| 758 | Ga0373946_0006578 | 3300035171 | Bacteria | 4218 |
| 759 | Ga0373946_0030047 | 3300035171 | Bacteria | 2167 |
| 760 | Ga0373955_0018484 | 3300035172 | Bacteria | 3468 |
| 761 | Ga0373955_0068087 | 3300035172 | Bacteria | 1983 |
| 762 | Ga0373924_0002810 | 3300035410 | Bacteria | 5889 |
| 763 | Ga0373931_0007349 | 3300035691 | Bacteria | 5185 |
| 764 | Ga0373935_0025123 | 3300035692 | Bacteria | 3671 |
| 765 | Ga0373935_0360972 | 3300035692 | Bacteria | 1037 |
| 766 | Ga0373927_0003119 | 3300035695 | Bacteria | 11988 |
| 767 | Ga0373927_0028708 | 3300035695 | Bacteria | 3629 |
| 768 | Ga0373933_0002359 | 3300035724 | Bacteria | 10678 |
| 769 | Ga0373933_0065419 | 3300035724 | Bacteria | 2201 |
| 770 | Ga0373947_0000354 | 3300035725 | Bacteria | 26002 |
| 771 | Ga0373947_0322747 | 3300035725 | Bacteria | 1033 |
| 772 | Ga0373937_0017443 | 3300036401 | Bacteria | 6396 |
| 773 | Ga0373937_0058346 | 3300036401 | Bacteria | 3545 |
| 774 | Ga0373937_0186683 | 3300036401 | Bacteria | 1947 |
| 775 | Ga0373925_0002130 | 3300037068 | Bacteria | 16185 |
| 776 | Ga0373925_0095142 | 3300037068 | Bacteria | 2281 |
| 777 | Ga0373925_0260117 | 3300037068 | Bacteria | 1394 |
| 778 | Ga0395899_0139200 | 3300037312 | Bacteria | 1728 |
| 779 | Ga0395905_0029800 | 3300037471 | Bacteria | 5143 |
| 780 | Ga0395901_0051868 | 3300038443 | Bacteria | 4264 |
| 781 | Ga0242420_004405 | 3300038996 | Bacteria | 2128 |
| 782 | Ga0436365_0471460 | 3300039437 | Bacteria | 5484 |
| 783 | Ga0450914_003019 | 3300042118 | Bacteria | 1260 |
| 784 | Ga0466957_0155083 | 3300044842 | Bacteria | 1484 |
| 785 | Ga0451576_0009816 | 3300045051 | Bacteria | 11062 |
| 786 | Ga0451576_0013711 | 3300045051 | Bacteria | 9055 |
| 787 | Ga0451576_0015434 | 3300045051 | Bacteria | 8461 |
| 788 | Ga0451576_0077197 | 3300045051 | Bacteria | 3466 |
| 789 | Ga0451576_0105344 | 3300045051 | Bacteria | 2934 |
| 790 | Ga0451576_0185422 | 3300045051 | Bacteria | 2173 |
| 791 | Ga0451576_0692240 | 3300045051 | Bacteria | 1071 |
| 792 | Ga0466967_0194357 | 3300045976 | Bacteria | 1919 |
| 793 | Ga0466967_0282435 | 3300045976 | Bacteria | 1593 |
| 794 | Ga0466967_0469431 | 3300045976 | Bacteria | 1232 |
| 795 | Ga0495592_0042023 | 3300046454 | Bacteria | 3424 |
| 796 | Ga0495603_0000907 | 3300046455 | Bacteria | 17036 |
| 797 | Ga0495629_0154052 | 3300046459 | Bacteria | 1597 |
| 798 | Ga0495651_0002183 | 3300046462 | Bacteria | 15113 |
| 799 | Ga0495653_0000803 | 3300046463 | Bacteria | 24108 |
| 800 | Ga0495580_0000095 | 3300046472 | Bacteria | 58325 |
| 801 | Ga0495580_0003270 | 3300046472 | Bacteria | 13867 |
| 802 | Ga0495580_0089168 | 3300046472 | Bacteria | 2147 |
| 803 | Ga0495580_0172059 | 3300046472 | Bacteria | 1497 |
| 804 | Ga0495582_0000169 | 3300046473 | Bacteria | 35465 |
| 805 | Ga0495582_0046920 | 3300046473 | Bacteria | 2379 |
| 806 | Ga0495639_0000541 | 3300046475 | Bacteria | 17684 |
| 807 | Ga0495639_0061606 | 3300046475 | Bacteria | 1720 |
| 808 | Ga0495664_0008560 | 3300046477 | Bacteria | 5706 |
| 809 | Ga0495664_0095075 | 3300046477 | Bacteria | 1794 |
| 810 | Ga0495594_0052848 | 3300046499 | Bacteria | 2237 |
| 811 | Ga0495607_0004612 | 3300046501 | Bacteria | 10093 |
| 812 | Ga0495608_0023535 | 3300046511 | Bacteria | 4222 |
| 813 | Ga0495608_0093254 | 3300046511 | Bacteria | 1945 |
| 814 | Ga0495610_0065923 | 3300046512 | Bacteria | 1707 |
| 815 | Ga0495616_0018415 | 3300046513 | Bacteria | 3834 |
| 816 | Ga0495618_0065767 | 3300046514 | Bacteria | 2304 |
| 817 | Ga0495628_0005994 | 3300046516 | Bacteria | 10632 |
| 818 | Ga0495628_0026006 | 3300046516 | Bacteria | 4779 |
| 819 | Ga0495630_0013056 | 3300046517 | Bacteria | 6037 |
| 820 | Ga0495630_0013921 | 3300046517 | Bacteria | 5851 |
| 821 | Ga0495630_0014681 | 3300046517 | Bacteria | 5710 |
| 822 | Ga0495630_0051344 | 3300046517 | Bacteria | 3087 |
| 823 | Ga0495631_0035528 | 3300046518 | Bacteria | 2229 |
| 824 | Ga0495648_0008854 | 3300046524 | Bacteria | 7874 |
| 825 | Ga0495663_0010091 | 3300046525 | Bacteria | 2623 |
| 826 | Ga0495663_0029911 | 3300046525 | Bacteria | 1611 |
| 827 | Ga0495642_0108803 | 3300046528 | Bacteria | 1184 |
| 828 | Ga0495652_0003633 | 3300046529 | Bacteria | 15103 |
| 829 | Ga0495652_0006831 | 3300046529 | Bacteria | 10577 |
| 830 | Ga0495652_0200419 | 3300046529 | Bacteria | 1515 |
| 831 | Ga0495654_0011768 | 3300046530 | Bacteria | 4724 |
| 832 | Ga0495665_0000198 | 3300046531 | Bacteria | 31095 |
| 833 | Ga0495665_0027592 | 3300046531 | Bacteria | 3047 |
| 834 | Ga0495586_0004729 | 3300046535 | Bacteria | 7278 |
| 835 | Ga0495586_0011789 | 3300046535 | Bacteria | 4647 |
| 836 | Ga0495586_0207189 | 3300046535 | Bacteria | 1112 |
| 837 | Ga0495587_0000740 | 3300046536 | Bacteria | 21858 |
| 838 | Ga0495587_0003356 | 3300046536 | Bacteria | 10676 |
| 839 | Ga0495587_0012376 | 3300046536 | Bacteria | 5373 |
| 840 | Ga0495645_0000080 | 3300046543 | Bacteria | 66039 |
| 841 | Ga0495645_0004074 | 3300046543 | Bacteria | 9981 |
| 842 | Ga0495645_0018109 | 3300046543 | Bacteria | 5055 |
| 843 | Ga0495667_0003463 | 3300046559 | Bacteria | 10577 |
| 844 | Ga0495667_0010614 | 3300046559 | Bacteria | 6232 |
| 845 | Ga0495667_0012238 | 3300046559 | Bacteria | 5814 |
| 846 | Ga0495635_0002493 | 3300046663 | Bacteria | 12569 |
| 847 | Ga0495635_0106824 | 3300046663 | Bacteria | 1912 |
| 848 | Ga0495661_0002757 | 3300046665 | Bacteria | 13344 |
| 849 | Ga0495588_0001099 | 3300046674 | Bacteria | 11676 |
| 850 | Ga0495588_0053078 | 3300046674 | Bacteria | 2090 |
| 851 | Ga0495657_0014513 | 3300046675 | Bacteria | 5780 |
| 852 | Ga0495599_0000259 | 3300046678 | Bacteria | 33415 |
| 853 | Ga0495599_0005276 | 3300046678 | Bacteria | 7710 |
| 854 | Ga0495599_0031490 | 3300046678 | Bacteria | 3329 |
| 855 | Ga0495623_0000628 | 3300046679 | Bacteria | 23503 |
| 856 | Ga0495647_0034734 | 3300046681 | Bacteria | 1890 |
| 857 | Ga0495647_0069786 | 3300046681 | Bacteria | 1404 |
| 858 | Ga0495658_0000753 | 3300046683 | Bacteria | 17480 |
| 859 | Ga0495613_0022565 | 3300046689 | Bacteria | 4688 |
| 860 | Ga0495613_0338907 | 3300046689 | Bacteria | 1035 |
| 861 | Ga0495670_0000775 | 3300046691 | Bacteria | 15311 |
| 862 | Ga0495670_0158758 | 3300046691 | Bacteria | 1187 |
| 863 | Ga0495671_0002449 | 3300046692 | Bacteria | 11719 |
| 864 | Ga0495600_0000138 | 3300046809 | Bacteria | 41481 |
| 865 | Ga0495600_0045236 | 3300046809 | Bacteria | 2872 |
| 866 | Ga0495660_0145328 | 3300046810 | Bacteria | 1176 |
| 867 | Ga0495581_0000266 | 3300047315 | Bacteria | 25207 |
| 868 | Ga0495581_0009007 | 3300047315 | Bacteria | 5777 |
| 869 | Ga0495581_0044307 | 3300047315 | Bacteria | 2573 |
| 870 | Ga0495581_0084419 | 3300047315 | Bacteria | 1840 |
| 871 | Ga0495604_0000690 | 3300047317 | Bacteria | 28643 |
| 872 | Ga0495604_0037050 | 3300047317 | Bacteria | 3842 |
| 873 | Ga0495674_0010685 | 3300047319 | Bacteria | 8687 |
| 874 | Ga0495674_0013484 | 3300047319 | Bacteria | 7686 |
| 875 | Ga0495674_0081375 | 3300047319 | Bacteria | 2778 |
| 876 | Ga0495680_0003192 | 3300047322 | Bacteria | 16306 |
| 877 | Ga0495680_0130843 | 3300047322 | Bacteria | 1844 |
| 878 | Ga0495675_0003980 | 3300047444 | Bacteria | 8956 |
| 879 | Ga0495675_0013254 | 3300047444 | Bacteria | 5202 |
| 880 | Ga0495675_0091852 | 3300047444 | Bacteria | 1905 |
| 881 | Ga0495675_0109152 | 3300047444 | Bacteria | 1728 |
| 882 | Ga0495675_0117623 | 3300047444 | Bacteria | 1656 |
| 883 | Ga0495684_0006342 | 3300047471 | Bacteria | 9193 |
| 884 | Ga0495684_0043142 | 3300047471 | Bacteria | 3453 |
| 885 | Ga0495684_0049402 | 3300047471 | Bacteria | 3214 |
| 886 | Ga0495684_0067607 | 3300047471 | Bacteria | 2717 |
| 887 | Ga0495593_0000838 | 3300047673 | Bacteria | 17855 |
| 888 | Ga0495602_0027969 | 3300048088 | Bacteria | 5407 |
| 889 | Ga0495602_0030928 | 3300048088 | Bacteria | 5068 |
| 890 | Ga0495614_0000001 | 3300048089 | Bacteria | 137656 |
| 891 | Ga0496105_0202435 | 3300048908 | Bacteria | 1620 |
| 892 | Ga0496109_0069678 | 3300048912 | Bacteria | 3226 |
| 893 | Ga0496109_0180774 | 3300048912 | Bacteria | 1981 |
| 894 | Ga0496112_0000769 | 3300048915 | Bacteria | 22559 |
| 895 | Ga0496112_0002473 | 3300048915 | Bacteria | 14909 |
| 896 | Ga0496112_0300094 | 3300048915 | Bacteria | 1552 |
| 897 | Ga0496115_0127923 | 3300048918 | Bacteria | 2093 |
| 898 | Ga0496115_0390179 | 3300048918 | Bacteria | 1131 |
| 899 | Ga0496117_0075139 | 3300048920 | Bacteria | 2246 |
| 900 | Ga0496121_0142264 | 3300048924 | Bacteria | 1777 |
| 901 | Ga0496122_0032524 | 3300048925 | Bacteria | 4311 |
| 902 | Ga0496123_0036097 | 3300048926 | Bacteria | 3511 |
| 903 | Ga0496125_0009208 | 3300048928 | Bacteria | 10201 |
| 904 | Ga0496126_0004544 | 3300048929 | Bacteria | 16498 |
| 905 | Ga0496126_0005435 | 3300048929 | Bacteria | 14527 |
| 906 | Ga0501033_0011764 | 3300049570 | Bacteria | 6689 |
| 907 | Ga0501034_0108656 | 3300049571 | Bacteria | 2765 |
| 908 | Ga0501034_0208494 | 3300049571 | Bacteria | 1910 |
| 909 | Ga0501036_0054450 | 3300049572 | Bacteria | 3389 |
| 910 | Ga0501036_0267553 | 3300049572 | Bacteria | 1432 |
| 911 | Ga0501037_0234591 | 3300049573 | Bacteria | 1287 |
| 912 | Ga0501038_0065186 | 3300049574 | Bacteria | 3104 |
| 913 | Ga0501039_0288588 | 3300049575 | Bacteria | 1290 |
| 914 | Ga0501043_0125328 | 3300049579 | Bacteria | 2014 |
| 915 | Ga0501047_0005886 | 3300049581 | Bacteria | 11539 |
| 916 | Ga0501047_0007961 | 3300049581 | Bacteria | 9994 |
| 917 | Ga0501047_0091641 | 3300049581 | Bacteria | 2918 |
| 918 | Ga0501069_0268727 | 3300049585 | Unclassified | 997 |
| 919 | Ga0501070_0048962 | 3300049586 | Bacteria | 3509 |
| 920 | Ga0501076_0343527 | 3300049592 | Bacteria | 1225 |
| 921 | Ga0501209_011589 | 3300049656 | Bacteria | 1852 |
| 922 | Ga0501216_003108 | 3300049660 | Bacteria | 2402 |
| 923 | Ga0501230_008883 | 3300049667 | Bacteria | 1532 |
| 924 | Ga0501233_002078 | 3300049668 | Bacteria | 3492 |
| 925 | Ga0501235_004423 | 3300049669 | Bacteria | 3035 |
| 926 | Ga0501249_003491 | 3300049679 | Bacteria | 3156 |
| 927 | Ga0501249_008461 | 3300049679 | Bacteria | 2135 |
| 928 | Ga0501252_004389 | 3300049682 | Bacteria | 1502 |
| 929 | Ga0501257_015602 | 3300049686 | Bacteria | 1756 |
| 930 | Ga0501221_000957 | 3300049704 | Bacteria | 4725 |
| 931 | Ga0501225_0002626 | 3300049705 | Bacteria | 5518 |
| 932 | Ga0501245_002533 | 3300049708 | Bacteria | 2443 |
| 933 | Ga0501079_0061533 | 3300049741 | Bacteria | 2896 |
| 934 | Ga0501079_0416913 | 3300049741 | Unclassified | 1054 |
| 935 | Ga0501080_0050878 | 3300049742 | Bacteria | 3855 |
| 936 | Ga0501081_0033028 | 3300049743 | Bacteria | 3514 |
| 937 | Ga0501232_002076 | 3300049757 | Bacteria | 1695 |
| 938 | Ga0501266_002543 | 3300049763 | Bacteria | 2295 |
| 939 | Ga0501268_000853 | 3300049765 | Bacteria | 3546 |
| 940 | Ga0501044_0350543 | 3300049823 | Bacteria | 1396 |
| 941 | nmdc:mga05p37_90284_c1 | 3300050507 | Bacteria | 3776 |
| 942 | nmdc:mga05p37_9827_c1 | 3300050507 | Bacteria | 11354 |
| 943 | nmdc:mga0qj67_1547_c1 | 3300050509 | Bacteria | 16140 |
| 944 | nmdc:mga0qj67_23498_c1 | 3300050509 | Bacteria | 4744 |
| 945 | nmdc:mga0qj67_24511_c1 | 3300050509 | Bacteria | 4651 |
| 946 | nmdc:mga0qj67_336642_c1 | 3300050509 | Bacteria | 1221 |
| 947 | nmdc:mga0qj67_3800_c1 | 3300050509 | Bacteria | 10905 |
| 948 | nmdc:mga06r32_32666_c1 | 3300050510 | Bacteria | 4898 |
| 949 | nmdc:mga06r32_481487_c1 | 3300050510 | Bacteria | 1219 |
| 950 | nmdc:mga06r32_509114_c1 | 3300050510 | Bacteria | 1180 |
| 951 | nmdc:mga06r32_8011_c1 | 3300050510 | Bacteria | 9500 |
| 952 | nmdc:mga08y16_203482_c1 | 3300050511 | Bacteria | 2051 |
| 953 | nmdc:mga08y16_207005_c1 | 3300050511 | Bacteria | 2032 |
| 954 | nmdc:mga08y16_65794_c1 | 3300050511 | Bacteria | 3783 |
| 955 | nmdc:mga0n895_19151_c1 | 3300050512 | Bacteria | 6355 |
| 956 | nmdc:mga0n895_240_c1 | 3300050512 | Bacteria | 34829 |
| 957 | nmdc:mga0n895_4329_c1 | 3300050512 | Bacteria | 11640 |
| 958 | nmdc:mga0n895_49634_c1 | 3300050512 | Bacteria | 4113 |
| 959 | nmdc:mga0rr50_348328_c1 | 3300050513 | Bacteria | 1245 |
| 960 | nmdc:mga0rr50_42071_c1 | 3300050513 | Bacteria | 3334 |
| 961 | nmdc:mga0rr50_457449_c1 | 3300050513 | Bacteria | 1082 |
| 962 | nmdc:mga08x19_143798_c1 | 3300050514 | Bacteria | 1612 |
| 963 | nmdc:mga08x19_24665_c1 | 3300050514 | Bacteria | 3741 |
| 964 | nmdc:mga08x19_39522_c1 | 3300050514 | Bacteria | 2999 |
| 965 | nmdc:mga08x19_39745_c1 | 3300050514 | Bacteria | 2991 |
| 966 | nmdc:mga08x19_4050_c1 | 3300050514 | Bacteria | 8705 |
| 967 | nmdc:mga0a205_114988_c1 | 3300050515 | Bacteria | 2589 |
| 968 | nmdc:mga0a205_216169_c1 | 3300050515 | Bacteria | 1804 |
| 969 | nmdc:mga0a205_24941_c2 | 3300050515 | Bacteria | 4516 |
| 970 | nmdc:mga0a205_312296_c1 | 3300050515 | Bacteria | 1444 |
| 971 | nmdc:mga0a205_390433_c1 | 3300050515 | Bacteria | 1256 |
| 972 | nmdc:mga0a205_74226_c1 | 3300050515 | Bacteria | 3287 |
| 973 | nmdc:mga0a205_93548_c1 | 3300050515 | Bacteria | 2904 |
| 974 | Ga0495601_0004802 | 3300053077 | Bacteria | 7834 |
| 975 | Ga0495601_0183568 | 3300053077 | Bacteria | 1367 |
| 976 | Ga0495612_0001912 | 3300053078 | Bacteria | 8570 |
| 977 | Ga0495612_0033278 | 3300053078 | Bacteria | 2085 |
| 978 | Ga0495595_0191954 | 3300053084 | Bacteria | 1015 |
| 979 | Ga0495619_0004030 | 3300053085 | Bacteria | 9407 |
| 980 | Ga0500644_0000490 | 3300053088 | Bacteria | 17289 |
| 981 | Ga0500641_0014770 | 3300053096 | Bacteria | 2886 |
| 982 | Ga0500650_0021685 | 3300053098 | Bacteria | 2833 |
| 983 | Ga0500556_0000267 | 3300053104 | Bacteria | 41211 |
| 984 | Ga0500562_000277 | 3300053108 | Bacteria | 12620 |
| 985 | Ga0500618_017394 | 3300053125 | Bacteria | 1789 |
| 986 | Ga0500642_0000005 | 3300053130 | Bacteria | 422725 |
| 987 | Ga0500658_0000786 | 3300053134 | Bacteria | 13133 |
| 988 | Ga0500616_0000197 | 3300053153 | Bacteria | 98372 |
| 989 | Ga0500622_0038030 | 3300053156 | Bacteria | 2512 |
| 990 | Ga0500627_0001135 | 3300053158 | Bacteria | 7294 |
| 991 | Ga0500627_0007012 | 3300053158 | Bacteria | 3888 |
| 992 | Ga0500633_0026242 | 3300053160 | Bacteria | 1832 |
| 993 | Ga0500636_0006534 | 3300053177 | Bacteria | 6694 |
| 994 | Ga0501084_0292526 | 3300054114 | Bacteria | 1376 |
| 995 | Ga0501084_0492423 | 3300054114 | Bacteria | 1036 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045051 | Ga0451576_0009816 | Ga0451576_0009816_918_1721 | 225 |
| 2 | 3300005343 | Ga0070687_100047189 | Ga0070687_1000471892 | 228 |
| 3 | 3300005545 | Ga0070695_100060097 | Ga0070695_1000600973 | 228 |
| 4 | 3300013297 | Ga0157378_10053317 | Ga0157378_100533174 | 228 |
| 5 | 3300026075 | Ga0207708_10114605 | Ga0207708_101146052 | 228 |
| 6 | 3300005344 | Ga0070661_100234470 | Ga0070661_1002344702 | 229 |
| 7 | 3300005564 | Ga0070664_100013240 | Ga0070664_1000132405 | 229 |
| 8 | 3300025945 | Ga0207679_10048097 | Ga0207679_100480973 | 229 |
| 9 | 3300009147 | Ga0114129_10098561 | Ga0114129_100985613 | 232 |
| 10 | 3300050512 | nmdc:mga0n895_4329_c1 | nmdc:mga0n895_4329_c1_3486_4310 | 232 |
| 11 | 3300050514 | nmdc:mga08x19_39522_c1 | nmdc:mga08x19_39522_c1_439_1281 | 234 |
| 12 | 3300045051 | Ga0451576_0692240 | Ga0451576_0692240_125_925 | 236 |
| 13 | 3300005406 | Ga0070703_10002559 | Ga0070703_100025594 | 238 |
| 14 | 3300005444 | Ga0070694_100095098 | Ga0070694_1000950982 | 238 |
| 15 | 3300005445 | Ga0070708_100005774 | Ga0070708_1000057744 | 238 |
| 16 | 3300005445 | Ga0070708_100280671 | Ga0070708_1002806712 | 238 |
| 17 | 3300005467 | Ga0070706_100012945 | Ga0070706_1000129453 | 238 |
| 18 | 3300005467 | Ga0070706_100260335 | Ga0070706_1002603352 | 238 |
| 19 | 3300005518 | Ga0070699_100011295 | Ga0070699_1000112953 | 238 |
| 20 | 3300005518 | Ga0070699_100054612 | Ga0070699_1000546123 | 238 |
| 21 | 3300005536 | Ga0070697_100235551 | Ga0070697_1002355512 | 238 |
| 22 | 3300025885 | Ga0207653_10017710 | Ga0207653_100177102 | 238 |
| 23 | 3300025939 | Ga0207665_10005957 | Ga0207665_100059572 | 238 |
| 24 | 3300005444 | Ga0070694_100000139 | Ga0070694_1000001395 | 240 |
| 25 | 3300005468 | Ga0070707_100017848 | Ga0070707_1000178482 | 240 |
| 26 | 3300005518 | Ga0070699_100186548 | Ga0070699_1001865483 | 240 |
| 27 | 3300005536 | Ga0070697_100024628 | Ga0070697_1000246281 | 240 |
| 28 | 3300005545 | Ga0070695_100004425 | Ga0070695_1000044253 | 240 |
| 29 | 3300005546 | Ga0070696_100150548 | Ga0070696_1001505482 | 240 |
| 30 | 3300025922 | Ga0207646_10112165 | Ga0207646_101121652 | 240 |
| 31 | 3300005440 | Ga0070705_100007921 | Ga0070705_1000079213 | 243 |
| 32 | 3300005545 | Ga0070695_100026367 | Ga0070695_1000263673 | 245 |
| 33 | 3300005546 | Ga0070696_100036167 | Ga0070696_1000361672 | 245 |
| 34 | 3300005549 | Ga0070704_100012319 | Ga0070704_1000123193 | 245 |
| 35 | 3300006852 | Ga0075433_10001420 | Ga0075433_100014208 | 245 |
| 36 | 3300006871 | Ga0075434_100001773 | Ga0075434_10000177312 | 245 |
| 37 | 3300006871 | Ga0075434_100036436 | Ga0075434_1000364364 | 245 |
| 38 | 3300025910 | Ga0207684_10027860 | Ga0207684_100278602 | 245 |
| 39 | 3300025922 | Ga0207646_10007505 | Ga0207646_100075054 | 245 |
| 40 | 3300050512 | nmdc:mga0n895_240_c1 | nmdc:mga0n895_240_c1_5638_6501 | 245 |
| 41 | 3300050515 | nmdc:mga0a205_93548_c1 | nmdc:mga0a205_93548_c1_1075_1938 | 245 |
| 42 | 3300006871 | Ga0075434_100070881 | Ga0075434_1000708813 | 247 |
| 43 | 3300031548 | Ga0307408_100048028 | Ga0307408_1000480282 | 247 |
| 44 | 3300031852 | Ga0307410_10013670 | Ga0307410_100136702 | 247 |
| 45 | 3300031903 | Ga0307407_10107271 | Ga0307407_101072711 | 247 |
| 46 | 3300031995 | Ga0307409_100325405 | Ga0307409_1003254052 | 247 |
| 47 | 3300032004 | Ga0307414_10023391 | Ga0307414_100233912 | 247 |
| 48 | 3300050512 | nmdc:mga0n895_49634_c1 | nmdc:mga0n895_49634_c1_2642_3487 | 247 |
| 49 | 3300050513 | nmdc:mga0rr50_42071_c1 | nmdc:mga0rr50_42071_c1_324_1169 | 247 |
| 50 | 3300050514 | nmdc:mga08x19_24665_c1 | nmdc:mga08x19_24665_c1_2165_3010 | 247 |
| 51 | 3300050515 | nmdc:mga0a205_74226_c1 | nmdc:mga0a205_74226_c1_754_1599 | 247 |
| 52 | 3300053125 | Ga0500618_017394 | Ga0500618_017394_292_1182 | 249 |
| 53 | 3300053177 | Ga0500636_0006534 | Ga0500636_0006534_324_1214 | 249 |
| 54 | 3300005336 | Ga0070680_100001898 | Ga0070680_1000018985 | 251 |
| 55 | 3300005536 | Ga0070697_100206139 | Ga0070697_1002061392 | 251 |
| 56 | 3300006844 | Ga0075428_100035486 | Ga0075428_1000354863 | 251 |
| 57 | 3300006914 | Ga0075436_100010941 | Ga0075436_1000109414 | 251 |
| 58 | 3300006914 | Ga0075436_100017435 | Ga0075436_1000174353 | 251 |
| 59 | 3300009094 | Ga0111539_10052529 | Ga0111539_100525293 | 251 |
| 60 | 3300025885 | Ga0207653_10070395 | Ga0207653_100703952 | 251 |
| 61 | 3300025917 | Ga0207660_10144496 | Ga0207660_101444961 | 251 |
| 62 | 3300005434 | Ga0070709_10150408 | Ga0070709_101504081 | 252 |
| 63 | 3300005439 | Ga0070711_100000333 | Ga0070711_10000033320 | 252 |
| 64 | 3300025916 | Ga0207663_10007936 | Ga0207663_100079362 | 252 |
| 65 | 3300025939 | Ga0207665_10041641 | Ga0207665_100416413 | 252 |
| 66 | 3300005471 | Ga0070698_100012669 | Ga0070698_1000126695 | 253 |
| 67 | 3300005545 | Ga0070695_100050264 | Ga0070695_1000502642 | 253 |
| 68 | 3300005549 | Ga0070704_100012483 | Ga0070704_1000124835 | 253 |
| 69 | 3300005578 | Ga0068854_100465460 | Ga0068854_1004654601 | 253 |
| 70 | 3300025922 | Ga0207646_10009684 | Ga0207646_100096847 | 253 |
| 71 | 3300048920 | Ga0496117_0075139 | Ga0496117_0075139_1312_2202 | 254 |
| 72 | 3300048928 | Ga0496125_0009208 | Ga0496125_0009208_5281_6171 | 254 |
| 73 | 3300053160 | Ga0500633_0026242 | Ga0500633_0026242_13_903 | 254 |
| 74 | 3300026089 | Ga0207648_10167413 | Ga0207648_101674131 | 255 |
| 75 | 3300046810 | Ga0495660_0145328 | Ga0495660_0145328_38_844 | 255 |
| 76 | 3300053104 | Ga0500556_0000267 | Ga0500556_0000267_18151_19041 | 255 |
| 77 | 3300046525 | Ga0495663_0010091 | Ga0495663_0010091_499_1344 | 256 |
| 78 | 3300048929 | Ga0496126_0004544 | Ga0496126_0004544_10985_11875 | 256 |
| 79 | 3300053153 | Ga0500616_0000197 | Ga0500616_0000197_79374_80264 | 256 |
| 80 | 3300053158 | Ga0500627_0007012 | Ga0500627_0007012_2825_3715 | 256 |
| 81 | 3300005336 | Ga0070680_100055367 | Ga0070680_1000553673 | 257 |
| 82 | 3300005344 | Ga0070661_100214431 | Ga0070661_1002144312 | 257 |
| 83 | 3300005435 | Ga0070714_100024675 | Ga0070714_1000246751 | 257 |
| 84 | 3300005563 | Ga0068855_100168240 | Ga0068855_1001682401 | 257 |
| 85 | 3300005578 | Ga0068854_100027498 | Ga0068854_1000274983 | 257 |
| 86 | 3300006914 | Ga0075436_100064559 | Ga0075436_1000645593 | 257 |
| 87 | 3300009174 | Ga0105241_10030751 | Ga0105241_100307514 | 257 |
| 88 | 3300025912 | Ga0207707_10003709 | Ga0207707_100037093 | 257 |
| 89 | 3300025913 | Ga0207695_10027235 | Ga0207695_100272353 | 257 |
| 90 | 3300025914 | Ga0207671_10268965 | Ga0207671_102689651 | 257 |
| 91 | 3300025917 | Ga0207660_10023147 | Ga0207660_100231475 | 257 |
| 92 | 3300025921 | Ga0207652_10061052 | Ga0207652_100610522 | 257 |
| 93 | 3300025981 | Ga0207640_10283511 | Ga0207640_102835112 | 257 |
| 94 | 3300026116 | Ga0207674_10187885 | Ga0207674_101878851 | 257 |
| 95 | 3300005445 | Ga0070708_100213849 | Ga0070708_1002138492 | 258 |
| 96 | 3300005329 | Ga0070683_100017298 | Ga0070683_1000172985 | 259 |
| 97 | 3300005344 | Ga0070661_100032234 | Ga0070661_1000322343 | 259 |
| 98 | 3300005353 | Ga0070669_100341920 | Ga0070669_1003419202 | 259 |
| 99 | 3300005445 | Ga0070708_100096499 | Ga0070708_1000964992 | 259 |
| 100 | 3300005564 | Ga0070664_100024837 | Ga0070664_1000248374 | 259 |
| 101 | 3300005577 | Ga0068857_100009359 | Ga0068857_1000093596 | 259 |
| 102 | 3300006846 | Ga0075430_100001226 | Ga0075430_1000012261 | 259 |
| 103 | 3300013105 | Ga0157369_10036257 | Ga0157369_100362572 | 259 |
| 104 | 3300013307 | Ga0157372_10044758 | Ga0157372_100447584 | 259 |
| 105 | 3300014325 | Ga0163163_10360460 | Ga0163163_103604602 | 259 |
| 106 | 3300014968 | Ga0157379_10217315 | Ga0157379_102173152 | 259 |
| 107 | 3300025917 | Ga0207660_10109672 | Ga0207660_101096722 | 259 |
| 108 | 3300054114 | Ga0501084_0492423 | Ga0501084_0492423_41_934 | 259 |
| 109 | 3300005328 | Ga0070676_10005710 | Ga0070676_100057107 | 260 |
| 110 | 3300005330 | Ga0070690_100049665 | Ga0070690_1000496653 | 260 |
| 111 | 3300005338 | Ga0068868_100050462 | Ga0068868_1000504622 | 260 |
| 112 | 3300005341 | Ga0070691_10014505 | Ga0070691_100145054 | 260 |
| 113 | 3300005356 | Ga0070674_100040541 | Ga0070674_1000405413 | 260 |
| 114 | 3300005459 | Ga0068867_100018520 | Ga0068867_1000185202 | 260 |
| 115 | 3300005578 | Ga0068854_100164962 | Ga0068854_1001649622 | 260 |
| 116 | 3300006881 | Ga0068865_100010488 | Ga0068865_1000104883 | 260 |
| 117 | 3300009098 | Ga0105245_10313529 | Ga0105245_103135292 | 260 |
| 118 | 3300013297 | Ga0157378_10144818 | Ga0157378_101448183 | 260 |
| 119 | 3300025899 | Ga0207642_10002177 | Ga0207642_100021773 | 260 |
| 120 | 3300025907 | Ga0207645_10005330 | Ga0207645_100053304 | 260 |
| 121 | 3300025918 | Ga0207662_10007365 | Ga0207662_100073652 | 260 |
| 122 | 3300025927 | Ga0207687_10207072 | Ga0207687_102070722 | 260 |
| 123 | 3300025933 | Ga0207706_10026259 | Ga0207706_100262593 | 260 |
| 124 | 3300025937 | Ga0207669_10120272 | Ga0207669_101202721 | 260 |
| 125 | 3300025940 | Ga0207691_10023055 | Ga0207691_100230552 | 260 |
| 126 | 3300026023 | Ga0207677_10039299 | Ga0207677_100392993 | 260 |
| 127 | 3300026075 | Ga0207708_10032892 | Ga0207708_100328922 | 260 |
| 128 | 3300026088 | Ga0207641_10166383 | Ga0207641_101663832 | 260 |
| 129 | 3300026089 | Ga0207648_10089318 | Ga0207648_100893182 | 260 |
| 130 | 3300005329 | Ga0070683_100002955 | Ga0070683_1000029558 | 261 |
| 131 | 3300005336 | Ga0070680_100008911 | Ga0070680_1000089116 | 261 |
| 132 | 3300005336 | Ga0070680_100010446 | Ga0070680_1000104462 | 261 |
| 133 | 3300005337 | Ga0070682_100012299 | Ga0070682_1000122993 | 261 |
| 134 | 3300005344 | Ga0070661_100004756 | Ga0070661_1000047568 | 261 |
| 135 | 3300005356 | Ga0070674_100021188 | Ga0070674_1000211884 | 261 |
| 136 | 3300005435 | Ga0070714_100052772 | Ga0070714_1000527723 | 261 |
| 137 | 3300005458 | Ga0070681_10008058 | Ga0070681_100080583 | 261 |
| 138 | 3300005535 | Ga0070684_100000453 | Ga0070684_10000045311 | 261 |
| 139 | 3300005547 | Ga0070693_100004287 | Ga0070693_1000042876 | 261 |
| 140 | 3300005563 | Ga0068855_100007696 | Ga0068855_10000769613 | 261 |
| 141 | 3300005564 | Ga0070664_100001011 | Ga0070664_10000101126 | 261 |
| 142 | 3300005577 | Ga0068857_100003270 | Ga0068857_1000032708 | 261 |
| 143 | 3300005578 | Ga0068854_100010711 | Ga0068854_1000107115 | 261 |
| 144 | 3300005614 | Ga0068856_100201431 | Ga0068856_1002014312 | 261 |
| 145 | 3300006881 | Ga0068865_100188936 | Ga0068865_1001889362 | 261 |
| 146 | 3300009176 | Ga0105242_10004910 | Ga0105242_100049102 | 261 |
| 147 | 3300025912 | Ga0207707_10006778 | Ga0207707_100067783 | 261 |
| 148 | 3300025913 | Ga0207695_10108432 | Ga0207695_101084323 | 261 |
| 149 | 3300025917 | Ga0207660_10037523 | Ga0207660_100375234 | 261 |
| 150 | 3300025917 | Ga0207660_10051088 | Ga0207660_100510882 | 261 |
| 151 | 3300025920 | Ga0207649_10009676 | Ga0207649_100096765 | 261 |
| 152 | 3300025921 | Ga0207652_10056887 | Ga0207652_100568872 | 261 |
| 153 | 3300025937 | Ga0207669_10046568 | Ga0207669_100465683 | 261 |
| 154 | 3300025944 | Ga0207661_10008163 | Ga0207661_100081634 | 261 |
| 155 | 3300025945 | Ga0207679_10056344 | Ga0207679_100563442 | 261 |
| 156 | 3300026089 | Ga0207648_10006701 | Ga0207648_100067016 | 261 |
| 157 | 3300026116 | Ga0207674_10007250 | Ga0207674_100072504 | 261 |
| 158 | 3300026121 | Ga0207683_10020695 | Ga0207683_100206954 | 261 |
| 159 | 3300005336 | Ga0070680_100352744 | Ga0070680_1003527442 | 262 |
| 160 | 3300005530 | Ga0070679_100005661 | Ga0070679_10000566112 | 262 |
| 161 | 3300006847 | Ga0075431_100109428 | Ga0075431_1001094282 | 262 |
| 162 | 3300025921 | Ga0207652_10026525 | Ga0207652_100265252 | 262 |
| 163 | 3300035086 | Ga0373934_0148798 | Ga0373934_0148798_13_804 | 262 |
| 164 | 3300048925 | Ga0496122_0032524 | Ga0496122_0032524_3142_4029 | 262 |
| 165 | 3300048926 | Ga0496123_0036097 | Ga0496123_0036097_2459_3346 | 262 |
| 166 | 3300049592 | Ga0501076_0343527 | Ga0501076_0343527_114_950 | 262 |
| 167 | 3300049741 | Ga0501079_0061533 | Ga0501079_0061533_1869_2705 | 262 |
| 168 | 3300049743 | Ga0501081_0033028 | Ga0501081_0033028_123_959 | 262 |
| 169 | 3300050509 | nmdc:mga0qj67_336642_c1 | nmdc:mga0qj67_336642_c1_271_1104 | 262 |
| 170 | 3300054114 | Ga0501084_0292526 | Ga0501084_0292526_45_881 | 262 |
| 171 | 3300050513 | nmdc:mga0rr50_348328_c1 | nmdc:mga0rr50_348328_c1_421_1218 | 263 |
| 172 | 3300014326 | Ga0157380_10260898 | Ga0157380_102608982 | 264 |
| 173 | 3300025893 | Ga0207682_10022884 | Ga0207682_100228843 | 264 |
| 174 | 3300025926 | Ga0207659_10112473 | Ga0207659_101124732 | 264 |
| 175 | 3300025937 | Ga0207669_10090436 | Ga0207669_100904361 | 264 |
| 176 | 3300048918 | Ga0496115_0390179 | Ga0496115_0390179_14_811 | 264 |
| 177 | 3300005518 | Ga0070699_100006598 | Ga0070699_1000065984 | 265 |
| 178 | 3300006871 | Ga0075434_100022446 | Ga0075434_1000224464 | 265 |
| 179 | 3300006914 | Ga0075436_100136101 | Ga0075436_1001361012 | 265 |
| 180 | 3300007076 | Ga0075435_100006252 | Ga0075435_1000062525 | 265 |
| 181 | 3300009545 | Ga0105237_10015361 | Ga0105237_100153612 | 265 |
| 182 | 3300031548 | Ga0307408_100019018 | Ga0307408_1000190181 | 265 |
| 183 | 3300031824 | Ga0307413_10103937 | Ga0307413_101039372 | 265 |
| 184 | 3300031852 | Ga0307410_10005792 | Ga0307410_100057925 | 265 |
| 185 | 3300031901 | Ga0307406_10040555 | Ga0307406_100405552 | 265 |
| 186 | 3300031903 | Ga0307407_10088662 | Ga0307407_100886622 | 265 |
| 187 | 3300031911 | Ga0307412_10257824 | Ga0307412_102578242 | 265 |
| 188 | 3300031995 | Ga0307409_100002214 | Ga0307409_1000022142 | 265 |
| 189 | 3300032002 | Ga0307416_100411324 | Ga0307416_1004113242 | 265 |
| 190 | 3300032004 | Ga0307414_10203710 | Ga0307414_102037102 | 265 |
| 191 | 3300032005 | Ga0307411_10006072 | Ga0307411_100060724 | 265 |
| 192 | 3300045051 | Ga0451576_0015434 | Ga0451576_0015434_1318_2163 | 265 |
| 193 | 3300045976 | Ga0466967_0194357 | Ga0466967_0194357_45_926 | 265 |
| 194 | 3300050512 | nmdc:mga0n895_19151_c1 | nmdc:mga0n895_19151_c1_4839_5684 | 265 |
| 195 | 3300050514 | nmdc:mga08x19_143798_c1 | nmdc:mga08x19_143798_c1_257_1102 | 265 |
| 196 | 3300005327 | Ga0070658_10008504 | Ga0070658_100085043 | 266 |
| 197 | 3300005339 | Ga0070660_100010448 | Ga0070660_1000104483 | 266 |
| 198 | 3300005366 | Ga0070659_100051452 | Ga0070659_1000514522 | 266 |
| 199 | 3300005440 | Ga0070705_100153140 | Ga0070705_1001531402 | 266 |
| 200 | 3300005444 | Ga0070694_100014198 | Ga0070694_1000141983 | 266 |
| 201 | 3300005467 | Ga0070706_100489927 | Ga0070706_1004899272 | 266 |
| 202 | 3300005530 | Ga0070679_100058235 | Ga0070679_1000582353 | 266 |
| 203 | 3300005545 | Ga0070695_100025183 | Ga0070695_1000251833 | 266 |
| 204 | 3300005546 | Ga0070696_100021028 | Ga0070696_1000210284 | 266 |
| 205 | 3300005549 | Ga0070704_100067816 | Ga0070704_1000678162 | 266 |
| 206 | 3300006852 | Ga0075433_10185586 | Ga0075433_101855862 | 266 |
| 207 | 3300007265 | Ga0099794_10025551 | Ga0099794_100255512 | 266 |
| 208 | 3300013307 | Ga0157372_10024867 | Ga0157372_100248673 | 266 |
| 209 | 3300013307 | Ga0157372_10046700 | Ga0157372_100467004 | 266 |
| 210 | 3300025909 | Ga0207705_10006304 | Ga0207705_100063043 | 266 |
| 211 | 3300025919 | Ga0207657_10000921 | Ga0207657_1000092111 | 266 |
| 212 | 3300045051 | Ga0451576_0013711 | Ga0451576_0013711_241_1083 | 266 |
| 213 | 3300050515 | nmdc:mga0a205_312296_c1 | nmdc:mga0a205_312296_c1_104_946 | 266 |
| 214 | 3300005336 | Ga0070680_100004865 | Ga0070680_1000048653 | 267 |
| 215 | 3300005344 | Ga0070661_100022638 | Ga0070661_1000226383 | 267 |
| 216 | 3300005458 | Ga0070681_10052545 | Ga0070681_100525452 | 267 |
| 217 | 3300005467 | Ga0070706_100230398 | Ga0070706_1002303982 | 267 |
| 218 | 3300005471 | Ga0070698_100037988 | Ga0070698_1000379882 | 267 |
| 219 | 3300009101 | Ga0105247_10195420 | Ga0105247_101954201 | 267 |
| 220 | 3300009177 | Ga0105248_10028017 | Ga0105248_100280172 | 267 |
| 221 | 3300013296 | Ga0157374_10538283 | Ga0157374_105382832 | 267 |
| 222 | 3300014325 | Ga0163163_10211900 | Ga0163163_102119002 | 267 |
| 223 | 3300025910 | Ga0207684_10198622 | Ga0207684_101986222 | 267 |
| 224 | 3300025912 | Ga0207707_10107381 | Ga0207707_101073812 | 267 |
| 225 | 3300025917 | Ga0207660_10067709 | Ga0207660_100677092 | 267 |
| 226 | 3300025921 | Ga0207652_10108319 | Ga0207652_101083192 | 267 |
| 227 | 3300045051 | Ga0451576_0185422 | Ga0451576_0185422_369_1250 | 267 |
| 228 | 3300048908 | Ga0496105_0202435 | Ga0496105_0202435_434_1315 | 267 |
| 229 | 3300048912 | Ga0496109_0069678 | Ga0496109_0069678_489_1370 | 267 |
| 230 | 3300048915 | Ga0496112_0002473 | Ga0496112_0002473_7131_8012 | 267 |
| 231 | 3300005366 | Ga0070659_100270211 | Ga0070659_1002702112 | 268 |
| 232 | 3300005436 | Ga0070713_100202567 | Ga0070713_1002025672 | 268 |
| 233 | 3300005439 | Ga0070711_100239853 | Ga0070711_1002398532 | 268 |
| 234 | 3300025929 | Ga0207664_10002343 | Ga0207664_100023434 | 268 |
| 235 | 3300009093 | Ga0105240_10242719 | Ga0105240_102427192 | 269 |
| 236 | 3300009177 | Ga0105248_10039502 | Ga0105248_100395023 | 269 |
| 237 | 3300026078 | Ga0207702_10156467 | Ga0207702_101564672 | 269 |
| 238 | 3300005293 | Ga0065715_10133990 | Ga0065715_101339902 | 270 |
| 239 | 3300005327 | Ga0070658_10005003 | Ga0070658_100050034 | 270 |
| 240 | 3300005327 | Ga0070658_10042391 | Ga0070658_100423912 | 270 |
| 241 | 3300005329 | Ga0070683_100012277 | Ga0070683_1000122773 | 270 |
| 242 | 3300005336 | Ga0070680_100017506 | Ga0070680_1000175063 | 270 |
| 243 | 3300005337 | Ga0070682_100008289 | Ga0070682_1000082892 | 270 |
| 244 | 3300005339 | Ga0070660_100246983 | Ga0070660_1002469832 | 270 |
| 245 | 3300005354 | Ga0070675_100222849 | Ga0070675_1002228492 | 270 |
| 246 | 3300005445 | Ga0070708_100301283 | Ga0070708_1003012832 | 270 |
| 247 | 3300005458 | Ga0070681_10045857 | Ga0070681_100458573 | 270 |
| 248 | 3300005458 | Ga0070681_10094410 | Ga0070681_100944102 | 270 |
| 249 | 3300005468 | Ga0070707_100312839 | Ga0070707_1003128392 | 270 |
| 250 | 3300005471 | Ga0070698_100405704 | Ga0070698_1004057042 | 270 |
| 251 | 3300005518 | Ga0070699_100190601 | Ga0070699_1001906012 | 270 |
| 252 | 3300005535 | Ga0070684_100035061 | Ga0070684_1000350614 | 270 |
| 253 | 3300005539 | Ga0068853_100397052 | Ga0068853_1003970522 | 270 |
| 254 | 3300005545 | Ga0070695_100008847 | Ga0070695_1000088475 | 270 |
| 255 | 3300005563 | Ga0068855_100016881 | Ga0068855_1000168817 | 270 |
| 256 | 3300005563 | Ga0068855_100459220 | Ga0068855_1004592202 | 270 |
| 257 | 3300005614 | Ga0068856_100281053 | Ga0068856_1002810532 | 270 |
| 258 | 3300009093 | Ga0105240_10034830 | Ga0105240_100348302 | 270 |
| 259 | 3300009093 | Ga0105240_10291716 | Ga0105240_102917162 | 270 |
| 260 | 3300009098 | Ga0105245_10041918 | Ga0105245_100419182 | 270 |
| 261 | 3300013104 | Ga0157370_10003374 | Ga0157370_100033742 | 270 |
| 262 | 3300013105 | Ga0157369_10011996 | Ga0157369_100119962 | 270 |
| 263 | 3300013105 | Ga0157369_10110825 | Ga0157369_101108253 | 270 |
| 264 | 3300013307 | Ga0157372_10014261 | Ga0157372_100142618 | 270 |
| 265 | 3300013307 | Ga0157372_10026183 | Ga0157372_100261835 | 270 |
| 266 | 3300013307 | Ga0157372_10175957 | Ga0157372_101759572 | 270 |
| 267 | 3300020082 | Ga0206353_10828394 | Ga0206353_108283942 | 270 |
| 268 | 3300025909 | Ga0207705_10004929 | Ga0207705_100049294 | 270 |
| 269 | 3300025909 | Ga0207705_10121188 | Ga0207705_101211882 | 270 |
| 270 | 3300025910 | Ga0207684_10267356 | Ga0207684_102673561 | 270 |
| 271 | 3300025912 | Ga0207707_10047730 | Ga0207707_100477302 | 270 |
| 272 | 3300025912 | Ga0207707_10071471 | Ga0207707_100714713 | 270 |
| 273 | 3300025913 | Ga0207695_10238242 | Ga0207695_102382422 | 270 |
| 274 | 3300025917 | Ga0207660_10031718 | Ga0207660_100317183 | 270 |
| 275 | 3300025919 | Ga0207657_10236139 | Ga0207657_102361392 | 270 |
| 276 | 3300025922 | Ga0207646_10270378 | Ga0207646_102703782 | 270 |
| 277 | 3300025927 | Ga0207687_10154017 | Ga0207687_101540172 | 270 |
| 278 | 3300025932 | Ga0207690_10258604 | Ga0207690_102586042 | 270 |
| 279 | 3300025949 | Ga0207667_10034655 | Ga0207667_100346553 | 270 |
| 280 | 3300026078 | Ga0207702_10275392 | Ga0207702_102753922 | 270 |
| 281 | 3300026142 | Ga0207698_10585541 | Ga0207698_105855412 | 270 |
| 282 | 3300046525 | Ga0495663_0029911 | Ga0495663_0029911_462_1340 | 270 |
| 283 | 3300009147 | Ga0114129_10098928 | Ga0114129_100989283 | 271 |
| 284 | 3300025909 | Ga0207705_10335480 | Ga0207705_103354802 | 271 |
| 285 | 3300005355 | Ga0070671_100116767 | Ga0070671_1001167672 | 272 |
| 286 | 3300005457 | Ga0070662_100199638 | Ga0070662_1001996382 | 272 |
| 287 | 3300005563 | Ga0068855_100075852 | Ga0068855_1000758524 | 272 |
| 288 | 3300005578 | Ga0068854_100370753 | Ga0068854_1003707532 | 272 |
| 289 | 3300005616 | Ga0068852_100022605 | Ga0068852_1000226054 | 272 |
| 290 | 3300009545 | Ga0105237_10031661 | Ga0105237_100316613 | 272 |
| 291 | 3300009551 | Ga0105238_10173281 | Ga0105238_101732812 | 272 |
| 292 | 3300011119 | Ga0105246_10155844 | Ga0105246_101558442 | 272 |
| 293 | 3300013105 | Ga0157369_10611204 | Ga0157369_106112041 | 272 |
| 294 | 3300013297 | Ga0157378_10064791 | Ga0157378_100647912 | 272 |
| 295 | 3300013308 | Ga0157375_10135902 | Ga0157375_101359022 | 272 |
| 296 | 3300025931 | Ga0207644_10058056 | Ga0207644_100580563 | 272 |
| 297 | 3300025938 | Ga0207704_10090078 | Ga0207704_100900782 | 272 |
| 298 | 3300025940 | Ga0207691_10075624 | Ga0207691_100756242 | 272 |
| 299 | 3300025945 | Ga0207679_10131480 | Ga0207679_101314802 | 272 |
| 300 | 3300026142 | Ga0207698_10014306 | Ga0207698_100143064 | 272 |
| 301 | 3300031824 | Ga0307413_10181091 | Ga0307413_101810912 | 272 |
| 302 | 3300050514 | nmdc:mga08x19_39745_c1 | nmdc:mga08x19_39745_c1_710_1585 | 272 |
| 303 | 3300005328 | Ga0070676_10025027 | Ga0070676_100250273 | 273 |
| 304 | 3300005539 | Ga0068853_100048124 | Ga0068853_1000481242 | 273 |
| 305 | 3300005719 | Ga0068861_100035340 | Ga0068861_1000353402 | 273 |
| 306 | 3300009174 | Ga0105241_10209701 | Ga0105241_102097012 | 273 |
| 307 | 3300009551 | Ga0105238_10059384 | Ga0105238_100593843 | 273 |
| 308 | 3300013100 | Ga0157373_10160740 | Ga0157373_101607402 | 273 |
| 309 | 3300013307 | Ga0157372_10102005 | Ga0157372_101020052 | 273 |
| 310 | 3300025911 | Ga0207654_10156662 | Ga0207654_101566622 | 273 |
| 311 | 3300025912 | Ga0207707_10089949 | Ga0207707_100899492 | 273 |
| 312 | 3300025921 | Ga0207652_10038493 | Ga0207652_100384933 | 273 |
| 313 | 3300025921 | Ga0207652_10149336 | Ga0207652_101493362 | 273 |
| 314 | 3300025929 | Ga0207664_10071817 | Ga0207664_100718172 | 273 |
| 315 | 3300025949 | Ga0207667_10126476 | Ga0207667_101264762 | 273 |
| 316 | 3300025981 | Ga0207640_10098307 | Ga0207640_100983073 | 273 |
| 317 | 3300026041 | Ga0207639_10041304 | Ga0207639_100413043 | 273 |
| 318 | 3300026067 | Ga0207678_10111572 | Ga0207678_101115723 | 273 |
| 319 | 3300026118 | Ga0207675_100083549 | Ga0207675_1000835492 | 273 |
| 320 | 3300031824 | Ga0307413_10339251 | Ga0307413_103392512 | 273 |
| 321 | 3300035692 | Ga0373935_0025123 | Ga0373935_0025123_1052_1918 | 273 |
| 322 | 3300046501 | Ga0495607_0004612 | Ga0495607_0004612_3139_4026 | 273 |
| 323 | 3300046512 | Ga0495610_0065923 | Ga0495610_0065923_552_1439 | 273 |
| 324 | 3300046513 | Ga0495616_0018415 | Ga0495616_0018415_1639_2526 | 273 |
| 325 | 3300046518 | Ga0495631_0035528 | Ga0495631_0035528_255_1142 | 273 |
| 326 | 3300046524 | Ga0495648_0008854 | Ga0495648_0008854_5640_6527 | 273 |
| 327 | 3300046530 | Ga0495654_0011768 | Ga0495654_0011768_2810_3697 | 273 |
| 328 | 3300046665 | Ga0495661_0002757 | Ga0495661_0002757_3963_4850 | 273 |
| 329 | 3300046691 | Ga0495670_0000775 | Ga0495670_0000775_6705_7592 | 273 |
| 330 | 3300046692 | Ga0495671_0002449 | Ga0495671_0002449_9981_10868 | 273 |
| 331 | 3300048924 | Ga0496121_0142264 | Ga0496121_0142264_802_1689 | 273 |
| 332 | 3300048929 | Ga0496126_0005435 | Ga0496126_0005435_6712_7599 | 273 |
| 333 | 3300049579 | Ga0501043_0125328 | Ga0501043_0125328_102_956 | 273 |
| 334 | 3300049581 | Ga0501047_0091641 | Ga0501047_0091641_1889_2743 | 273 |
| 335 | 3300053088 | Ga0500644_0000490 | Ga0500644_0000490_7215_8102 | 273 |
| 336 | 3300053096 | Ga0500641_0014770 | Ga0500641_0014770_1747_2634 | 273 |
| 337 | 3300053098 | Ga0500650_0021685 | Ga0500650_0021685_494_1381 | 273 |
| 338 | 3300053108 | Ga0500562_000277 | Ga0500562_000277_10153_11040 | 273 |
| 339 | 3300053130 | Ga0500642_0000005 | Ga0500642_0000005_321293_322180 | 273 |
| 340 | 3300053134 | Ga0500658_0000786 | Ga0500658_0000786_3958_4845 | 273 |
| 341 | 3300053156 | Ga0500622_0038030 | Ga0500622_0038030_1178_2065 | 273 |
| 342 | 3300053158 | Ga0500627_0001135 | Ga0500627_0001135_5970_6857 | 273 |
| 343 | 3300005327 | Ga0070658_10002348 | Ga0070658_100023488 | 274 |
| 344 | 3300005985 | Ga0081539_10000354 | Ga0081539_1000035431 | 274 |
| 345 | 3300009553 | Ga0105249_10000027 | Ga0105249_10000027166 | 274 |
| 346 | 3300025919 | Ga0207657_10393338 | Ga0207657_103933381 | 274 |
| 347 | 3300025945 | Ga0207679_10018167 | Ga0207679_100181674 | 274 |
| 348 | 3300025961 | Ga0207712_10000353 | Ga0207712_1000035314 | 274 |
| 349 | 3300035119 | Ga0373956_0001092 | Ga0373956_0001092_6911_7798 | 274 |
| 350 | 3300035172 | Ga0373955_0068087 | Ga0373955_0068087_1069_1956 | 274 |
| 351 | 3300035410 | Ga0373924_0002810 | Ga0373924_0002810_3673_4560 | 274 |
| 352 | 3300035724 | Ga0373933_0002359 | Ga0373933_0002359_4457_5344 | 274 |
| 353 | 3300036401 | Ga0373937_0058346 | Ga0373937_0058346_2258_3145 | 274 |
| 354 | 3300046454 | Ga0495592_0042023 | Ga0495592_0042023_2498_3385 | 274 |
| 355 | 3300046463 | Ga0495653_0000803 | Ga0495653_0000803_21782_22669 | 274 |
| 356 | 3300046477 | Ga0495664_0095075 | Ga0495664_0095075_753_1640 | 274 |
| 357 | 3300046516 | Ga0495628_0005994 | Ga0495628_0005994_6141_7028 | 274 |
| 358 | 3300046517 | Ga0495630_0013056 | Ga0495630_0013056_254_1141 | 274 |
| 359 | 3300046529 | Ga0495652_0003633 | Ga0495652_0003633_5643_6530 | 274 |
| 360 | 3300046535 | Ga0495586_0207189 | Ga0495586_0207189_178_1065 | 274 |
| 361 | 3300046536 | Ga0495587_0003356 | Ga0495587_0003356_6834_7721 | 274 |
| 362 | 3300046543 | Ga0495645_0004074 | Ga0495645_0004074_1799_2686 | 274 |
| 363 | 3300046559 | Ga0495667_0010614 | Ga0495667_0010614_2104_2991 | 274 |
| 364 | 3300046663 | Ga0495635_0002493 | Ga0495635_0002493_2432_3319 | 274 |
| 365 | 3300046675 | Ga0495657_0014513 | Ga0495657_0014513_457_1344 | 274 |
| 366 | 3300046678 | Ga0495599_0005276 | Ga0495599_0005276_3996_4883 | 274 |
| 367 | 3300046679 | Ga0495623_0000628 | Ga0495623_0000628_20656_21543 | 274 |
| 368 | 3300046809 | Ga0495600_0000138 | Ga0495600_0000138_8535_9422 | 274 |
| 369 | 3300047315 | Ga0495581_0044307 | Ga0495581_0044307_1096_1983 | 274 |
| 370 | 3300047317 | Ga0495604_0000690 | Ga0495604_0000690_13632_14519 | 274 |
| 371 | 3300047319 | Ga0495674_0010685 | Ga0495674_0010685_2745_3632 | 274 |
| 372 | 3300047322 | Ga0495680_0003192 | Ga0495680_0003192_11900_12787 | 274 |
| 373 | 3300047444 | Ga0495675_0003980 | Ga0495675_0003980_274_1161 | 274 |
| 374 | 3300047471 | Ga0495684_0006342 | Ga0495684_0006342_3369_4256 | 274 |
| 375 | 3300048088 | Ga0495602_0030928 | Ga0495602_0030928_1802_2689 | 274 |
| 376 | 3300053077 | Ga0495601_0004802 | Ga0495601_0004802_569_1456 | 274 |
| 377 | 3300053078 | Ga0495612_0001912 | Ga0495612_0001912_2605_3492 | 274 |
| 378 | 3300053085 | Ga0495619_0004030 | Ga0495619_0004030_1805_2692 | 274 |
| 379 | 3300005329 | Ga0070683_100055122 | Ga0070683_1000551222 | 275 |
| 380 | 3300005344 | Ga0070661_100355838 | Ga0070661_1003558381 | 275 |
| 381 | 3300005354 | Ga0070675_100161727 | Ga0070675_1001617272 | 275 |
| 382 | 3300005535 | Ga0070684_100334588 | Ga0070684_1003345881 | 275 |
| 383 | 3300005564 | Ga0070664_100061089 | Ga0070664_1000610893 | 275 |
| 384 | 3300025939 | Ga0207665_10081536 | Ga0207665_100815362 | 275 |
| 385 | 3300025944 | Ga0207661_10104946 | Ga0207661_101049463 | 275 |
| 386 | 3300025945 | Ga0207679_10071013 | Ga0207679_100710132 | 275 |
| 387 | 3300045976 | Ga0466967_0469431 | Ga0466967_0469431_198_1085 | 275 |
| 388 | 3300049585 | Ga0501069_0268727 | Ga0501069_0268727_18_851 | 275 |
| 389 | 3300049823 | Ga0501044_0350543 | Ga0501044_0350543_534_1361 | 275 |
| 390 | 3300005330 | Ga0070690_100081471 | Ga0070690_1000814712 | 276 |
| 391 | 3300005336 | Ga0070680_100046586 | Ga0070680_1000465863 | 276 |
| 392 | 3300005343 | Ga0070687_100067045 | Ga0070687_1000670452 | 276 |
| 393 | 3300005344 | Ga0070661_100096601 | Ga0070661_1000966012 | 276 |
| 394 | 3300005353 | Ga0070669_100001830 | Ga0070669_1000018308 | 276 |
| 395 | 3300005354 | Ga0070675_100049365 | Ga0070675_1000493652 | 276 |
| 396 | 3300005355 | Ga0070671_100013858 | Ga0070671_1000138583 | 276 |
| 397 | 3300005356 | Ga0070674_100407927 | Ga0070674_1004079271 | 276 |
| 398 | 3300005364 | Ga0070673_100024423 | Ga0070673_1000244233 | 276 |
| 399 | 3300005367 | Ga0070667_100263491 | Ga0070667_1002634912 | 276 |
| 400 | 3300005466 | Ga0070685_10100498 | Ga0070685_101004982 | 276 |
| 401 | 3300005577 | Ga0068857_100296647 | Ga0068857_1002966472 | 276 |
| 402 | 3300013100 | Ga0157373_10019572 | Ga0157373_100195724 | 276 |
| 403 | 3300013296 | Ga0157374_10040816 | Ga0157374_100408164 | 276 |
| 404 | 3300013308 | Ga0157375_10061968 | Ga0157375_100619684 | 276 |
| 405 | 3300014745 | Ga0157377_10070668 | Ga0157377_100706682 | 276 |
| 406 | 3300025315 | Ga0207697_10030392 | Ga0207697_100303922 | 276 |
| 407 | 3300025904 | Ga0207647_10132557 | Ga0207647_101325572 | 276 |
| 408 | 3300025908 | Ga0207643_10002421 | Ga0207643_100024218 | 276 |
| 409 | 3300025917 | Ga0207660_10025238 | Ga0207660_100252383 | 276 |
| 410 | 3300025918 | Ga0207662_10002047 | Ga0207662_100020477 | 276 |
| 411 | 3300025921 | Ga0207652_10047160 | Ga0207652_100471602 | 276 |
| 412 | 3300025923 | Ga0207681_10001947 | Ga0207681_1000194710 | 276 |
| 413 | 3300025933 | Ga0207706_10012191 | Ga0207706_100121914 | 276 |
| 414 | 3300025937 | Ga0207669_10279220 | Ga0207669_102792202 | 276 |
| 415 | 3300025940 | Ga0207691_10048148 | Ga0207691_100481482 | 276 |
| 416 | 3300025960 | Ga0207651_10135618 | Ga0207651_101356182 | 276 |
| 417 | 3300025986 | Ga0207658_10022743 | Ga0207658_100227433 | 276 |
| 418 | 3300026116 | Ga0207674_10048782 | Ga0207674_100487822 | 276 |
| 419 | 3300049571 | Ga0501034_0208494 | Ga0501034_0208494_277_1155 | 276 |
| 420 | 3300049572 | Ga0501036_0267553 | Ga0501036_0267553_447_1325 | 276 |
| 421 | 3300049573 | Ga0501037_0234591 | Ga0501037_0234591_389_1267 | 276 |
| 422 | 3300049581 | Ga0501047_0005886 | Ga0501047_0005886_933_1811 | 276 |
| 423 | 3300049586 | Ga0501070_0048962 | Ga0501070_0048962_43_921 | 276 |
| 424 | 3300005336 | Ga0070680_100005138 | Ga0070680_1000051386 | 277 |
| 425 | 3300005345 | Ga0070692_10063497 | Ga0070692_100634972 | 277 |
| 426 | 3300005434 | Ga0070709_10007289 | Ga0070709_100072894 | 277 |
| 427 | 3300005435 | Ga0070714_100053038 | Ga0070714_1000530382 | 277 |
| 428 | 3300005436 | Ga0070713_100000103 | Ga0070713_10000010329 | 277 |
| 429 | 3300005437 | Ga0070710_10065461 | Ga0070710_100654612 | 277 |
| 430 | 3300005458 | Ga0070681_10018547 | Ga0070681_100185475 | 277 |
| 431 | 3300005530 | Ga0070679_100011629 | Ga0070679_1000116298 | 277 |
| 432 | 3300005535 | Ga0070684_100053571 | Ga0070684_1000535714 | 277 |
| 433 | 3300006028 | Ga0070717_10008217 | Ga0070717_100082175 | 277 |
| 434 | 3300006175 | Ga0070712_100004829 | Ga0070712_1000048293 | 277 |
| 435 | 3300025898 | Ga0207692_10019122 | Ga0207692_100191223 | 277 |
| 436 | 3300025906 | Ga0207699_10005475 | Ga0207699_100054752 | 277 |
| 437 | 3300025912 | Ga0207707_10001531 | Ga0207707_1000153116 | 277 |
| 438 | 3300025915 | Ga0207693_10008875 | Ga0207693_100088755 | 277 |
| 439 | 3300025917 | Ga0207660_10006330 | Ga0207660_100063304 | 277 |
| 440 | 3300025921 | Ga0207652_10002295 | Ga0207652_100022952 | 277 |
| 441 | 3300025928 | Ga0207700_10000127 | Ga0207700_1000012714 | 277 |
| 442 | 3300025929 | Ga0207664_10048994 | Ga0207664_100489943 | 277 |
| 443 | 3300026041 | Ga0207639_10163107 | Ga0207639_101631072 | 277 |
| 444 | 3300005336 | Ga0070680_100018865 | Ga0070680_1000188653 | 278 |
| 445 | 3300005365 | Ga0070688_100040545 | Ga0070688_1000405453 | 278 |
| 446 | 3300005467 | Ga0070706_100402985 | Ga0070706_1004029852 | 278 |
| 447 | 3300005535 | Ga0070684_100451797 | Ga0070684_1004517971 | 278 |
| 448 | 3300005536 | Ga0070697_100084591 | Ga0070697_1000845912 | 278 |
| 449 | 3300025909 | Ga0207705_10180236 | Ga0207705_101802362 | 278 |
| 450 | 3300025910 | Ga0207684_10093160 | Ga0207684_100931603 | 278 |
| 451 | 3300025917 | Ga0207660_10000238 | Ga0207660_1000023818 | 278 |
| 452 | 3300049679 | Ga0501249_003491 | Ga0501249_003491_696_1538 | 278 |
| 453 | 3300050510 | nmdc:mga06r32_509114_c1 | nmdc:mga06r32_509114_c1_54_890 | 278 |
| 454 | 3300005445 | Ga0070708_100000005 | Ga0070708_10000000594 | 279 |
| 455 | 3300005467 | Ga0070706_100563943 | Ga0070706_1005639432 | 279 |
| 456 | 3300005468 | Ga0070707_100090717 | Ga0070707_1000907173 | 279 |
| 457 | 3300025910 | Ga0207684_10485249 | Ga0207684_104852491 | 279 |
| 458 | 3300025922 | Ga0207646_10076584 | Ga0207646_100765842 | 279 |
| 459 | 3300026116 | Ga0207674_10281048 | Ga0207674_102810482 | 279 |
| 460 | 3300045051 | Ga0451576_0105344 | Ga0451576_0105344_703_1545 | 279 |
| 461 | 3300050515 | nmdc:mga0a205_390433_c1 | nmdc:mga0a205_390433_c1_116_958 | 279 |
| 462 | 3300005435 | Ga0070714_100237005 | Ga0070714_1002370052 | 280 |
| 463 | 3300005436 | Ga0070713_100026926 | Ga0070713_1000269262 | 280 |
| 464 | 3300013307 | Ga0157372_10748863 | Ga0157372_107488632 | 280 |
| 465 | 3300025929 | Ga0207664_10175470 | Ga0207664_101754702 | 280 |
| 466 | 3300031995 | Ga0307409_100029486 | Ga0307409_1000294863 | 280 |
| 467 | 3300049742 | Ga0501080_0050878 | Ga0501080_0050878_1666_2538 | 280 |
| 468 | 3300005329 | Ga0070683_100021469 | Ga0070683_1000214693 | 281 |
| 469 | 3300005336 | Ga0070680_100024838 | Ga0070680_1000248385 | 281 |
| 470 | 3300005344 | Ga0070661_100004545 | Ga0070661_1000045459 | 281 |
| 471 | 3300005434 | Ga0070709_10183594 | Ga0070709_101835942 | 281 |
| 472 | 3300005435 | Ga0070714_100273807 | Ga0070714_1002738072 | 281 |
| 473 | 3300005530 | Ga0070679_100197173 | Ga0070679_1001971732 | 281 |
| 474 | 3300005544 | Ga0070686_100102797 | Ga0070686_1001027972 | 281 |
| 475 | 3300025912 | Ga0207707_10084499 | Ga0207707_100844993 | 281 |
| 476 | 3300025917 | Ga0207660_10068293 | Ga0207660_100682932 | 281 |
| 477 | 3300025917 | Ga0207660_10079499 | Ga0207660_100794992 | 281 |
| 478 | 3300025921 | Ga0207652_10014440 | Ga0207652_100144404 | 281 |
| 479 | 3300025944 | Ga0207661_10004772 | Ga0207661_100047725 | 281 |
| 480 | 3300042118 | Ga0450914_003019 | Ga0450914_003019_78_956 | 281 |
| 481 | 3300005329 | Ga0070683_100119482 | Ga0070683_1001194823 | 282 |
| 482 | 3300005444 | Ga0070694_100184438 | Ga0070694_1001844381 | 282 |
| 483 | 3300005530 | Ga0070679_100136478 | Ga0070679_1001364781 | 282 |
| 484 | 3300005535 | Ga0070684_100071884 | Ga0070684_1000718842 | 282 |
| 485 | 3300006871 | Ga0075434_100091254 | Ga0075434_1000912542 | 282 |
| 486 | 3300013104 | Ga0157370_10129410 | Ga0157370_101294102 | 282 |
| 487 | 3300013104 | Ga0157370_10153783 | Ga0157370_101537832 | 282 |
| 488 | 3300013105 | Ga0157369_10092570 | Ga0157369_100925703 | 282 |
| 489 | 3300013307 | Ga0157372_10035730 | Ga0157372_100357305 | 282 |
| 490 | 3300025913 | Ga0207695_10093795 | Ga0207695_100937952 | 282 |
| 491 | 3300025949 | Ga0207667_10447943 | Ga0207667_104479432 | 282 |
| 492 | 3300031548 | Ga0307408_100170777 | Ga0307408_1001707772 | 282 |
| 493 | 3300031731 | Ga0307405_10152914 | Ga0307405_101529141 | 282 |
| 494 | 3300031824 | Ga0307413_10118703 | Ga0307413_101187032 | 282 |
| 495 | 3300031852 | Ga0307410_10264618 | Ga0307410_102646182 | 282 |
| 496 | 3300031901 | Ga0307406_10022122 | Ga0307406_100221222 | 282 |
| 497 | 3300032002 | Ga0307416_100331676 | Ga0307416_1003316762 | 282 |
| 498 | 3300032004 | Ga0307414_10116253 | Ga0307414_101162532 | 282 |
| 499 | 3300032126 | Ga0307415_100189021 | Ga0307415_1001890212 | 282 |
| 500 | 3300038996 | Ga0242420_004405 | Ga0242420_004405_34_930 | 282 |
| 501 | 3300046473 | Ga0495582_0046920 | Ga0495582_0046920_240_1121 | 282 |
| 502 | 3300046535 | Ga0495586_0004729 | Ga0495586_0004729_3067_3948 | 282 |
| 503 | 3300047319 | Ga0495674_0081375 | Ga0495674_0081375_1622_2503 | 282 |
| 504 | 3300048915 | Ga0496112_0000769 | Ga0496112_0000769_1235_2131 | 282 |
| 505 | 3300048915 | Ga0496112_0300094 | Ga0496112_0300094_450_1331 | 282 |
| 506 | 3300005293 | Ga0065715_10112103 | Ga0065715_101121032 | 283 |
| 507 | 3300025915 | Ga0207693_10089337 | Ga0207693_100893373 | 283 |
| 508 | 3300025933 | Ga0207706_10124707 | Ga0207706_101247073 | 283 |
| 509 | 3300025945 | Ga0207679_10343488 | Ga0207679_103434882 | 283 |
| 510 | 3300039437 | Ga0436365_0471460 | Ga0436365_0471460_2905_3762 | 283 |
| 511 | 3300045976 | Ga0466967_0282435 | Ga0466967_0282435_217_1074 | 283 |
| 512 | 3300046499 | Ga0495594_0052848 | Ga0495594_0052848_687_1541 | 283 |
| 513 | 3300049741 | Ga0501079_0416913 | Ga0501079_0416913_91_981 | 283 |
| 514 | 3300005336 | Ga0070680_100008729 | Ga0070680_1000087296 | 284 |
| 515 | 3300025944 | Ga0207661_10169874 | Ga0207661_101698742 | 284 |
| 516 | 3300027360 | Ga0209969_1001717 | Ga0209969_10017172 | 284 |
| 517 | 3300027543 | Ga0209999_1004276 | Ga0209999_10042762 | 284 |
| 518 | 3300027614 | Ga0209970_1014421 | Ga0209970_10144212 | 284 |
| 519 | 3300027695 | Ga0209966_1000923 | Ga0209966_10009235 | 284 |
| 520 | 3300027717 | Ga0209998_10003473 | Ga0209998_100034734 | 284 |
| 521 | 3300027876 | Ga0209974_10026274 | Ga0209974_100262742 | 284 |
| 522 | 3300031548 | Ga0307408_100094821 | Ga0307408_1000948212 | 284 |
| 523 | 3300031731 | Ga0307405_10019818 | Ga0307405_100198182 | 284 |
| 524 | 3300031901 | Ga0307406_10061576 | Ga0307406_100615762 | 284 |
| 525 | 3300031901 | Ga0307406_10120515 | Ga0307406_101205152 | 284 |
| 526 | 3300031903 | Ga0307407_10069875 | Ga0307407_100698752 | 284 |
| 527 | 3300031903 | Ga0307407_10127181 | Ga0307407_101271812 | 284 |
| 528 | 3300031995 | Ga0307409_100079531 | Ga0307409_1000795312 | 284 |
| 529 | 3300032002 | Ga0307416_100224601 | Ga0307416_1002246012 | 284 |
| 530 | 3300032004 | Ga0307414_10142580 | Ga0307414_101425802 | 284 |
| 531 | 3300032005 | Ga0307411_10035785 | Ga0307411_100357853 | 284 |
| 532 | 3300032126 | Ga0307415_100117382 | Ga0307415_1001173822 | 284 |
| 533 | 3300032126 | Ga0307415_100297284 | Ga0307415_1002972841 | 284 |
| 534 | 3300049570 | Ga0501033_0011764 | Ga0501033_0011764_4951_5811 | 284 |
| 535 | 3300049571 | Ga0501034_0108656 | Ga0501034_0108656_1694_2554 | 284 |
| 536 | 3300049572 | Ga0501036_0054450 | Ga0501036_0054450_817_1677 | 284 |
| 537 | 3300049574 | Ga0501038_0065186 | Ga0501038_0065186_817_1677 | 284 |
| 538 | 3300049575 | Ga0501039_0288588 | Ga0501039_0288588_100_960 | 284 |
| 539 | 3300049581 | Ga0501047_0007961 | Ga0501047_0007961_9059_9919 | 284 |
| 540 | 3300049656 | Ga0501209_011589 | Ga0501209_011589_125_985 | 284 |
| 541 | 3300049660 | Ga0501216_003108 | Ga0501216_003108_817_1677 | 284 |
| 542 | 3300049667 | Ga0501230_008883 | Ga0501230_008883_38_898 | 284 |
| 543 | 3300049668 | Ga0501233_002078 | Ga0501233_002078_1778_2638 | 284 |
| 544 | 3300049669 | Ga0501235_004423 | Ga0501235_004423_1777_2637 | 284 |
| 545 | 3300049682 | Ga0501252_004389 | Ga0501252_004389_53_913 | 284 |
| 546 | 3300049686 | Ga0501257_015602 | Ga0501257_015602_654_1514 | 284 |
| 547 | 3300049704 | Ga0501221_000957 | Ga0501221_000957_1860_2720 | 284 |
| 548 | 3300049705 | Ga0501225_0002626 | Ga0501225_0002626_597_1457 | 284 |
| 549 | 3300049708 | Ga0501245_002533 | Ga0501245_002533_300_1160 | 284 |
| 550 | 3300049757 | Ga0501232_002076 | Ga0501232_002076_164_1024 | 284 |
| 551 | 3300049763 | Ga0501266_002543 | Ga0501266_002543_86_946 | 284 |
| 552 | 3300049765 | Ga0501268_000853 | Ga0501268_000853_1228_2088 | 284 |
| 553 | 3300005336 | Ga0070680_100170521 | Ga0070680_1001705212 | 285 |
| 554 | 3300005536 | Ga0070697_100109057 | Ga0070697_1001090572 | 285 |
| 555 | 3300044842 | Ga0466957_0155083 | Ga0466957_0155083_110_970 | 285 |
| 556 | 3300005530 | Ga0070679_100023739 | Ga0070679_1000237392 | 286 |
| 557 | 3300005546 | Ga0070696_100191124 | Ga0070696_1001911242 | 286 |
| 558 | 3300005985 | Ga0081539_10013437 | Ga0081539_100134373 | 286 |
| 559 | 3300006881 | Ga0068865_100231851 | Ga0068865_1002318512 | 286 |
| 560 | 3300013105 | Ga0157369_10207290 | Ga0157369_102072902 | 286 |
| 561 | 3300013297 | Ga0157378_10022647 | Ga0157378_100226472 | 286 |
| 562 | 3300013307 | Ga0157372_10030056 | Ga0157372_100300564 | 286 |
| 563 | 3300031548 | Ga0307408_100421756 | Ga0307408_1004217561 | 286 |
| 564 | 3300050507 | nmdc:mga05p37_90284_c1 | nmdc:mga05p37_90284_c1_2402_3268 | 286 |
| 565 | 3300005563 | Ga0068855_100260033 | Ga0068855_1002600331 | 287 |
| 566 | 3300031995 | Ga0307409_100058840 | Ga0307409_1000588403 | 287 |
| 567 | 3300032126 | Ga0307415_100013989 | Ga0307415_1000139893 | 287 |
| 568 | 3300005338 | Ga0068868_100008939 | Ga0068868_1000089395 | 288 |
| 569 | 3300005436 | Ga0070713_100046169 | Ga0070713_1000461693 | 288 |
| 570 | 3300005445 | Ga0070708_100002584 | Ga0070708_1000025845 | 288 |
| 571 | 3300005466 | Ga0070685_10134757 | Ga0070685_101347572 | 288 |
| 572 | 3300005468 | Ga0070707_100001035 | Ga0070707_10000103518 | 288 |
| 573 | 3300005719 | Ga0068861_100417196 | Ga0068861_1004171961 | 288 |
| 574 | 3300009098 | Ga0105245_10093486 | Ga0105245_100934863 | 288 |
| 575 | 3300025922 | Ga0207646_10003899 | Ga0207646_1000389912 | 288 |
| 576 | 3300005434 | Ga0070709_10027454 | Ga0070709_100274542 | 289 |
| 577 | 3300005437 | Ga0070710_10008519 | Ga0070710_100085194 | 289 |
| 578 | 3300006173 | Ga0070716_100000659 | Ga0070716_1000006597 | 289 |
| 579 | 3300006175 | Ga0070712_100159803 | Ga0070712_1001598032 | 289 |
| 580 | 3300006914 | Ga0075436_100004747 | Ga0075436_1000047477 | 289 |
| 581 | 3300009174 | Ga0105241_10111404 | Ga0105241_101114042 | 289 |
| 582 | 3300025906 | Ga0207699_10001761 | Ga0207699_100017619 | 289 |
| 583 | 3300025939 | Ga0207665_10000392 | Ga0207665_1000039223 | 289 |
| 584 | 3300031731 | Ga0307405_10090158 | Ga0307405_100901582 | 289 |
| 585 | 3300031824 | Ga0307413_10059196 | Ga0307413_100591962 | 289 |
| 586 | 3300031852 | Ga0307410_10004326 | Ga0307410_100043265 | 289 |
| 587 | 3300031911 | Ga0307412_10066778 | Ga0307412_100667782 | 289 |
| 588 | 3300031995 | Ga0307409_100036578 | Ga0307409_1000365782 | 289 |
| 589 | 3300032002 | Ga0307416_100011387 | Ga0307416_1000113874 | 289 |
| 590 | 3300032005 | Ga0307411_10011050 | Ga0307411_100110502 | 289 |
| 591 | 3300034820 | Ga0373959_0008506 | Ga0373959_0008506_822_1721 | 289 |
| 592 | 3300050509 | nmdc:mga0qj67_3800_c1 | nmdc:mga0qj67_3800_c1_7571_8443 | 289 |
| 593 | 3300050510 | nmdc:mga06r32_32666_c1 | nmdc:mga06r32_32666_c1_3962_4834 | 289 |
| 594 | 3300050513 | nmdc:mga0rr50_457449_c1 | nmdc:mga0rr50_457449_c1_73_972 | 289 |
| 595 | 3300050514 | nmdc:mga08x19_4050_c1 | nmdc:mga08x19_4050_c1_6427_7326 | 289 |
| 596 | 3300005439 | Ga0070711_100079697 | Ga0070711_1000796972 | 290 |
| 597 | 3300005535 | Ga0070684_100045753 | Ga0070684_1000457533 | 290 |
| 598 | 3300005614 | Ga0068856_100225134 | Ga0068856_1002251342 | 290 |
| 599 | 3300009177 | Ga0105248_10104779 | Ga0105248_101047792 | 290 |
| 600 | 3300009551 | Ga0105238_10297021 | Ga0105238_102970212 | 290 |
| 601 | 3300013307 | Ga0157372_10023309 | Ga0157372_100233094 | 290 |
| 602 | 3300013308 | Ga0157375_10076719 | Ga0157375_100767192 | 290 |
| 603 | 3300025915 | Ga0207693_10058873 | Ga0207693_100588733 | 290 |
| 604 | 3300025924 | Ga0207694_10096477 | Ga0207694_100964772 | 290 |
| 605 | 3300025945 | Ga0207679_10282857 | Ga0207679_102828572 | 290 |
| 606 | 3300026078 | Ga0207702_10126990 | Ga0207702_101269902 | 290 |
| 607 | 3300035086 | Ga0373934_0006027 | Ga0373934_0006027_709_1584 | 290 |
| 608 | 3300035111 | Ga0373923_0009261 | Ga0373923_0009261_2278_3153 | 290 |
| 609 | 3300035172 | Ga0373955_0018484 | Ga0373955_0018484_537_1412 | 290 |
| 610 | 3300035724 | Ga0373933_0065419 | Ga0373933_0065419_314_1189 | 290 |
| 611 | 3300036401 | Ga0373937_0017443 | Ga0373937_0017443_3526_4401 | 290 |
| 612 | 3300037068 | Ga0373925_0260117 | Ga0373925_0260117_88_963 | 290 |
| 613 | 3300046459 | Ga0495629_0154052 | Ga0495629_0154052_626_1501 | 290 |
| 614 | 3300046462 | Ga0495651_0002183 | Ga0495651_0002183_12336_13211 | 290 |
| 615 | 3300046472 | Ga0495580_0003270 | Ga0495580_0003270_5897_6772 | 290 |
| 616 | 3300046477 | Ga0495664_0008560 | Ga0495664_0008560_2183_3058 | 290 |
| 617 | 3300046511 | Ga0495608_0023535 | Ga0495608_0023535_1903_2778 | 290 |
| 618 | 3300046511 | Ga0495608_0093254 | Ga0495608_0093254_141_1016 | 290 |
| 619 | 3300046514 | Ga0495618_0065767 | Ga0495618_0065767_549_1424 | 290 |
| 620 | 3300046516 | Ga0495628_0026006 | Ga0495628_0026006_1280_2155 | 290 |
| 621 | 3300046517 | Ga0495630_0051344 | Ga0495630_0051344_1188_2063 | 290 |
| 622 | 3300046528 | Ga0495642_0108803 | Ga0495642_0108803_201_1073 | 290 |
| 623 | 3300046529 | Ga0495652_0006831 | Ga0495652_0006831_157_1032 | 290 |
| 624 | 3300046531 | Ga0495665_0027592 | Ga0495665_0027592_590_1465 | 290 |
| 625 | 3300046536 | Ga0495587_0012376 | Ga0495587_0012376_2459_3334 | 290 |
| 626 | 3300046543 | Ga0495645_0018109 | Ga0495645_0018109_1315_2190 | 290 |
| 627 | 3300046559 | Ga0495667_0012238 | Ga0495667_0012238_389_1264 | 290 |
| 628 | 3300046663 | Ga0495635_0106824 | Ga0495635_0106824_945_1820 | 290 |
| 629 | 3300046678 | Ga0495599_0000259 | Ga0495599_0000259_21220_22095 | 290 |
| 630 | 3300046689 | Ga0495613_0338907 | Ga0495613_0338907_136_1011 | 290 |
| 631 | 3300046691 | Ga0495670_0158758 | Ga0495670_0158758_262_1134 | 290 |
| 632 | 3300047317 | Ga0495604_0037050 | Ga0495604_0037050_2581_3456 | 290 |
| 633 | 3300047322 | Ga0495680_0130843 | Ga0495680_0130843_199_1074 | 290 |
| 634 | 3300047444 | Ga0495675_0013254 | Ga0495675_0013254_973_1848 | 290 |
| 635 | 3300047444 | Ga0495675_0117623 | Ga0495675_0117623_120_995 | 290 |
| 636 | 3300047471 | Ga0495684_0043142 | Ga0495684_0043142_759_1634 | 290 |
| 637 | 3300047471 | Ga0495684_0067607 | Ga0495684_0067607_1760_2635 | 290 |
| 638 | 3300048088 | Ga0495602_0027969 | Ga0495602_0027969_3600_4475 | 290 |
| 639 | 3300053077 | Ga0495601_0183568 | Ga0495601_0183568_284_1159 | 290 |
| 640 | 3300053078 | Ga0495612_0033278 | Ga0495612_0033278_759_1634 | 290 |
| 641 | 3300005436 | Ga0070713_100015755 | Ga0070713_1000157553 | 291 |
| 642 | 3300032002 | Ga0307416_100136057 | Ga0307416_1001360572 | 291 |
| 643 | 3300046809 | Ga0495600_0045236 | Ga0495600_0045236_1854_2732 | 291 |
| 644 | 3300047315 | Ga0495581_0084419 | Ga0495581_0084419_523_1401 | 291 |
| 645 | 3300047444 | Ga0495675_0109152 | Ga0495675_0109152_125_1003 | 291 |
| 646 | 3300048918 | Ga0496115_0127923 | Ga0496115_0127923_960_1838 | 291 |
| 647 | 3300005329 | Ga0070683_100003955 | Ga0070683_1000039555 | 292 |
| 648 | 3300005329 | Ga0070683_100020501 | Ga0070683_1000205015 | 292 |
| 649 | 3300005329 | Ga0070683_100022431 | Ga0070683_1000224314 | 292 |
| 650 | 3300005329 | Ga0070683_100143167 | Ga0070683_1001431672 | 292 |
| 651 | 3300005329 | Ga0070683_100160905 | Ga0070683_1001609052 | 292 |
| 652 | 3300005330 | Ga0070690_100046687 | Ga0070690_1000466872 | 292 |
| 653 | 3300005330 | Ga0070690_100053908 | Ga0070690_1000539083 | 292 |
| 654 | 3300005331 | Ga0070670_100078471 | Ga0070670_1000784713 | 292 |
| 655 | 3300005333 | Ga0070677_10058231 | Ga0070677_100582311 | 292 |
| 656 | 3300005334 | Ga0068869_100000208 | Ga0068869_1000002084 | 292 |
| 657 | 3300005334 | Ga0068869_100259928 | Ga0068869_1002599282 | 292 |
| 658 | 3300005336 | Ga0070680_100001422 | Ga0070680_1000014223 | 292 |
| 659 | 3300005336 | Ga0070680_100046351 | Ga0070680_1000463512 | 292 |
| 660 | 3300005336 | Ga0070680_100090426 | Ga0070680_1000904262 | 292 |
| 661 | 3300005338 | Ga0068868_100021943 | Ga0068868_1000219432 | 292 |
| 662 | 3300005340 | Ga0070689_100025722 | Ga0070689_1000257223 | 292 |
| 663 | 3300005340 | Ga0070689_100118829 | Ga0070689_1001188292 | 292 |
| 664 | 3300005343 | Ga0070687_100027850 | Ga0070687_1000278502 | 292 |
| 665 | 3300005343 | Ga0070687_100088804 | Ga0070687_1000888042 | 292 |
| 666 | 3300005344 | Ga0070661_100011227 | Ga0070661_1000112274 | 292 |
| 667 | 3300005354 | Ga0070675_100010529 | Ga0070675_1000105292 | 292 |
| 668 | 3300005354 | Ga0070675_100177423 | Ga0070675_1001774232 | 292 |
| 669 | 3300005365 | Ga0070688_100281943 | Ga0070688_1002819431 | 292 |
| 670 | 3300005366 | Ga0070659_100002094 | Ga0070659_1000020942 | 292 |
| 671 | 3300005367 | Ga0070667_100287293 | Ga0070667_1002872932 | 292 |
| 672 | 3300005434 | Ga0070709_10019736 | Ga0070709_100197364 | 292 |
| 673 | 3300005457 | Ga0070662_100024286 | Ga0070662_1000242862 | 292 |
| 674 | 3300005457 | Ga0070662_100271142 | Ga0070662_1002711421 | 292 |
| 675 | 3300005457 | Ga0070662_100484493 | Ga0070662_1004844931 | 292 |
| 676 | 3300005458 | Ga0070681_10001031 | Ga0070681_1000103114 | 292 |
| 677 | 3300005458 | Ga0070681_10012906 | Ga0070681_100129065 | 292 |
| 678 | 3300005530 | Ga0070679_100000151 | Ga0070679_10000015126 | 292 |
| 679 | 3300005530 | Ga0070679_100000574 | Ga0070679_10000057422 | 292 |
| 680 | 3300005530 | Ga0070679_100012388 | Ga0070679_1000123885 | 292 |
| 681 | 3300005535 | Ga0070684_100041560 | Ga0070684_1000415602 | 292 |
| 682 | 3300005535 | Ga0070684_100128686 | Ga0070684_1001286862 | 292 |
| 683 | 3300005535 | Ga0070684_100169336 | Ga0070684_1001693362 | 292 |
| 684 | 3300005545 | Ga0070695_100094612 | Ga0070695_1000946122 | 292 |
| 685 | 3300005564 | Ga0070664_100087111 | Ga0070664_1000871112 | 292 |
| 686 | 3300005577 | Ga0068857_100190178 | Ga0068857_1001901782 | 292 |
| 687 | 3300005614 | Ga0068856_100019865 | Ga0068856_1000198653 | 292 |
| 688 | 3300005614 | Ga0068856_100121165 | Ga0068856_1001211652 | 292 |
| 689 | 3300005615 | Ga0070702_100001473 | Ga0070702_1000014734 | 292 |
| 690 | 3300005616 | Ga0068852_100063084 | Ga0068852_1000630843 | 292 |
| 691 | 3300005617 | Ga0068859_100119078 | Ga0068859_1001190783 | 292 |
| 692 | 3300005617 | Ga0068859_100167452 | Ga0068859_1001674522 | 292 |
| 693 | 3300005617 | Ga0068859_100670379 | Ga0068859_1006703792 | 292 |
| 694 | 3300005618 | Ga0068864_100006923 | Ga0068864_1000069237 | 292 |
| 695 | 3300005618 | Ga0068864_100221460 | Ga0068864_1002214602 | 292 |
| 696 | 3300005834 | Ga0068851_10179411 | Ga0068851_101794111 | 292 |
| 697 | 3300005841 | Ga0068863_100031045 | Ga0068863_1000310452 | 292 |
| 698 | 3300005842 | Ga0068858_100151623 | Ga0068858_1001516232 | 292 |
| 699 | 3300005842 | Ga0068858_100276650 | Ga0068858_1002766502 | 292 |
| 700 | 3300005843 | Ga0068860_100019902 | Ga0068860_1000199025 | 292 |
| 701 | 3300006237 | Ga0097621_100142147 | Ga0097621_1001421472 | 292 |
| 702 | 3300006880 | Ga0075429_100170786 | Ga0075429_1001707862 | 292 |
| 703 | 3300006931 | Ga0097620_100119073 | Ga0097620_1001190733 | 292 |
| 704 | 3300006931 | Ga0097620_100167443 | Ga0097620_1001674432 | 292 |
| 705 | 3300006931 | Ga0097620_100670345 | Ga0097620_1006703452 | 292 |
| 706 | 3300009098 | Ga0105245_10004990 | Ga0105245_100049902 | 292 |
| 707 | 3300009098 | Ga0105245_10005211 | Ga0105245_100052112 | 292 |
| 708 | 3300009148 | Ga0105243_10594958 | Ga0105243_105949582 | 292 |
| 709 | 3300009174 | Ga0105241_10023408 | Ga0105241_100234084 | 292 |
| 710 | 3300009176 | Ga0105242_10002448 | Ga0105242_100024489 | 292 |
| 711 | 3300009176 | Ga0105242_10066539 | Ga0105242_100665392 | 292 |
| 712 | 3300009177 | Ga0105248_10310254 | Ga0105248_103102542 | 292 |
| 713 | 3300009551 | Ga0105238_10180109 | Ga0105238_101801092 | 292 |
| 714 | 3300011119 | Ga0105246_10019636 | Ga0105246_100196362 | 292 |
| 715 | 3300013100 | Ga0157373_10069481 | Ga0157373_100694812 | 292 |
| 716 | 3300013105 | Ga0157369_10120069 | Ga0157369_101200692 | 292 |
| 717 | 3300013308 | Ga0157375_10007469 | Ga0157375_100074695 | 292 |
| 718 | 3300013308 | Ga0157375_10045419 | Ga0157375_100454194 | 292 |
| 719 | 3300013308 | Ga0157375_10200002 | Ga0157375_102000022 | 292 |
| 720 | 3300014745 | Ga0157377_10001055 | Ga0157377_100010553 | 292 |
| 721 | 3300025906 | Ga0207699_10029412 | Ga0207699_100294122 | 292 |
| 722 | 3300025907 | Ga0207645_10062268 | Ga0207645_100622682 | 292 |
| 723 | 3300025911 | Ga0207654_10029460 | Ga0207654_100294602 | 292 |
| 724 | 3300025912 | Ga0207707_10001523 | Ga0207707_100015239 | 292 |
| 725 | 3300025912 | Ga0207707_10008968 | Ga0207707_100089685 | 292 |
| 726 | 3300025912 | Ga0207707_10032600 | Ga0207707_100326004 | 292 |
| 727 | 3300025917 | Ga0207660_10019765 | Ga0207660_100197652 | 292 |
| 728 | 3300025917 | Ga0207660_10037713 | Ga0207660_100377132 | 292 |
| 729 | 3300025917 | Ga0207660_10058997 | Ga0207660_100589972 | 292 |
| 730 | 3300025918 | Ga0207662_10019240 | Ga0207662_100192403 | 292 |
| 731 | 3300025919 | Ga0207657_10270933 | Ga0207657_102709332 | 292 |
| 732 | 3300025920 | Ga0207649_10029678 | Ga0207649_100296783 | 292 |
| 733 | 3300025921 | Ga0207652_10001245 | Ga0207652_1000124513 | 292 |
| 734 | 3300025921 | Ga0207652_10001643 | Ga0207652_1000164317 | 292 |
| 735 | 3300025921 | Ga0207652_10078565 | Ga0207652_100785652 | 292 |
| 736 | 3300025927 | Ga0207687_10209355 | Ga0207687_102093552 | 292 |
| 737 | 3300025933 | Ga0207706_10076139 | Ga0207706_100761392 | 292 |
| 738 | 3300025934 | Ga0207686_10069814 | Ga0207686_100698141 | 292 |
| 739 | 3300025936 | Ga0207670_10076266 | Ga0207670_100762662 | 292 |
| 740 | 3300025940 | Ga0207691_10172390 | Ga0207691_101723902 | 292 |
| 741 | 3300025940 | Ga0207691_10466690 | Ga0207691_104666901 | 292 |
| 742 | 3300025941 | Ga0207711_10047435 | Ga0207711_100474352 | 292 |
| 743 | 3300025942 | Ga0207689_10000181 | Ga0207689_1000018128 | 292 |
| 744 | 3300025942 | Ga0207689_10097526 | Ga0207689_100975263 | 292 |
| 745 | 3300025944 | Ga0207661_10002310 | Ga0207661_100023102 | 292 |
| 746 | 3300025944 | Ga0207661_10011578 | Ga0207661_100115783 | 292 |
| 747 | 3300025944 | Ga0207661_10015259 | Ga0207661_100152594 | 292 |
| 748 | 3300025945 | Ga0207679_10024147 | Ga0207679_100241473 | 292 |
| 749 | 3300025986 | Ga0207658_10278163 | Ga0207658_102781632 | 292 |
| 750 | 3300026023 | Ga0207677_10012998 | Ga0207677_100129984 | 292 |
| 751 | 3300026078 | Ga0207702_10270524 | Ga0207702_102705242 | 292 |
| 752 | 3300026088 | Ga0207641_10117873 | Ga0207641_101178732 | 292 |
| 753 | 3300026088 | Ga0207641_10254050 | Ga0207641_102540502 | 292 |
| 754 | 3300026095 | Ga0207676_10002114 | Ga0207676_100021143 | 292 |
| 755 | 3300026116 | Ga0207674_10000081 | Ga0207674_1000008138 | 292 |
| 756 | 3300028380 | Ga0268265_10150856 | Ga0268265_101508562 | 292 |
| 757 | 3300032002 | Ga0307416_100088768 | Ga0307416_1000887682 | 292 |
| 758 | 3300035086 | Ga0373934_0003818 | Ga0373934_0003818_79_960 | 292 |
| 759 | 3300035171 | Ga0373946_0030047 | Ga0373946_0030047_159_1040 | 292 |
| 760 | 3300035691 | Ga0373931_0007349 | Ga0373931_0007349_580_1461 | 292 |
| 761 | 3300035695 | Ga0373927_0028708 | Ga0373927_0028708_218_1099 | 292 |
| 762 | 3300036401 | Ga0373937_0186683 | Ga0373937_0186683_253_1134 | 292 |
| 763 | 3300037068 | Ga0373925_0095142 | Ga0373925_0095142_878_1759 | 292 |
| 764 | 3300045051 | Ga0451576_0077197 | Ga0451576_0077197_2294_3175 | 292 |
| 765 | 3300046472 | Ga0495580_0172059 | Ga0495580_0172059_475_1356 | 292 |
| 766 | 3300046475 | Ga0495639_0061606 | Ga0495639_0061606_375_1256 | 292 |
| 767 | 3300046517 | Ga0495630_0014681 | Ga0495630_0014681_3317_4198 | 292 |
| 768 | 3300046529 | Ga0495652_0200419 | Ga0495652_0200419_553_1434 | 292 |
| 769 | 3300046535 | Ga0495586_0011789 | Ga0495586_0011789_3427_4308 | 292 |
| 770 | 3300046536 | Ga0495587_0000740 | Ga0495587_0000740_16234_17115 | 292 |
| 771 | 3300046543 | Ga0495645_0000080 | Ga0495645_0000080_49400_50281 | 292 |
| 772 | 3300046559 | Ga0495667_0003463 | Ga0495667_0003463_5943_6824 | 292 |
| 773 | 3300046674 | Ga0495588_0053078 | Ga0495588_0053078_817_1698 | 292 |
| 774 | 3300046678 | Ga0495599_0031490 | Ga0495599_0031490_863_1744 | 292 |
| 775 | 3300046681 | Ga0495647_0069786 | Ga0495647_0069786_266_1147 | 292 |
| 776 | 3300047315 | Ga0495581_0009007 | Ga0495581_0009007_4833_5714 | 292 |
| 777 | 3300047319 | Ga0495674_0013484 | Ga0495674_0013484_191_1072 | 292 |
| 778 | 3300047444 | Ga0495675_0091852 | Ga0495675_0091852_302_1183 | 292 |
| 779 | 3300047471 | Ga0495684_0049402 | Ga0495684_0049402_777_1658 | 292 |
| 780 | 3300050511 | nmdc:mga08y16_203482_c1 | nmdc:mga08y16_203482_c1_253_1134 | 292 |
| 781 | 3300053084 | Ga0495595_0191954 | Ga0495595_0191954_86_967 | 292 |
| 782 | 3300005718 | Ga0068866_10038891 | Ga0068866_100388912 | 293 |
| 783 | 3300006852 | Ga0075433_10006048 | Ga0075433_100060484 | 293 |
| 784 | 3300006871 | Ga0075434_100002916 | Ga0075434_1000029163 | 293 |
| 785 | 3300009094 | Ga0111539_10370993 | Ga0111539_103709932 | 293 |
| 786 | 3300009147 | Ga0114129_10009159 | Ga0114129_100091598 | 293 |
| 787 | 3300009176 | Ga0105242_10023587 | Ga0105242_100235874 | 293 |
| 788 | 3300025934 | Ga0207686_10078807 | Ga0207686_100788072 | 293 |
| 789 | 3300026089 | Ga0207648_10032327 | Ga0207648_100323273 | 293 |
| 790 | 3300032002 | Ga0307416_100576451 | Ga0307416_1005764512 | 293 |
| 791 | 3300050507 | nmdc:mga05p37_9827_c1 | nmdc:mga05p37_9827_c1_9688_10587 | 293 |
| 792 | 3300050511 | nmdc:mga08y16_65794_c1 | nmdc:mga08y16_65794_c1_394_1293 | 293 |
| 793 | 3300050515 | nmdc:mga0a205_114988_c1 | nmdc:mga0a205_114988_c1_811_1710 | 293 |
| 794 | 3300005333 | Ga0070677_10089112 | Ga0070677_100891121 | 294 |
| 795 | 3300005354 | Ga0070675_100009924 | Ga0070675_1000099245 | 294 |
| 796 | 3300005434 | Ga0070709_10115238 | Ga0070709_101152382 | 294 |
| 797 | 3300005547 | Ga0070693_100004554 | Ga0070693_1000045544 | 294 |
| 798 | 3300005844 | Ga0068862_100116261 | Ga0068862_1001162612 | 294 |
| 799 | 3300006881 | Ga0068865_100055990 | Ga0068865_1000559902 | 294 |
| 800 | 3300025912 | Ga0207707_10046041 | Ga0207707_100460412 | 294 |
| 801 | 3300025917 | Ga0207660_10116102 | Ga0207660_101161022 | 294 |
| 802 | 3300025926 | Ga0207659_10125112 | Ga0207659_101251122 | 294 |
| 803 | 3300025938 | Ga0207704_10042122 | Ga0207704_100421222 | 294 |
| 804 | 3300025940 | Ga0207691_10000685 | Ga0207691_100006858 | 294 |
| 805 | 3300025986 | Ga0207658_10124765 | Ga0207658_101247652 | 294 |
| 806 | 3300031548 | Ga0307408_100051921 | Ga0307408_1000519212 | 294 |
| 807 | 3300031824 | Ga0307413_10026970 | Ga0307413_100269702 | 294 |
| 808 | 3300031995 | Ga0307409_100052141 | Ga0307409_1000521412 | 294 |
| 809 | 3300032002 | Ga0307416_100030151 | Ga0307416_1000301514 | 294 |
| 810 | 3300032005 | Ga0307411_10021823 | Ga0307411_100218232 | 294 |
| 811 | 3300032126 | Ga0307415_100035168 | Ga0307415_1000351683 | 294 |
| 812 | 3300035170 | Ga0373943_0000516 | Ga0373943_0000516_8254_9141 | 294 |
| 813 | 3300035171 | Ga0373946_0006578 | Ga0373946_0006578_2624_3511 | 294 |
| 814 | 3300035695 | Ga0373927_0003119 | Ga0373927_0003119_326_1213 | 294 |
| 815 | 3300035725 | Ga0373947_0000354 | Ga0373947_0000354_5345_6232 | 294 |
| 816 | 3300037068 | Ga0373925_0002130 | Ga0373925_0002130_2399_3286 | 294 |
| 817 | 3300046455 | Ga0495603_0000907 | Ga0495603_0000907_14930_15817 | 294 |
| 818 | 3300046472 | Ga0495580_0000095 | Ga0495580_0000095_29619_30506 | 294 |
| 819 | 3300046473 | Ga0495582_0000169 | Ga0495582_0000169_32717_33604 | 294 |
| 820 | 3300046475 | Ga0495639_0000541 | Ga0495639_0000541_6255_7142 | 294 |
| 821 | 3300046517 | Ga0495630_0013921 | Ga0495630_0013921_522_1409 | 294 |
| 822 | 3300046531 | Ga0495665_0000198 | Ga0495665_0000198_10310_11197 | 294 |
| 823 | 3300046674 | Ga0495588_0001099 | Ga0495588_0001099_4435_5322 | 294 |
| 824 | 3300046681 | Ga0495647_0034734 | Ga0495647_0034734_963_1850 | 294 |
| 825 | 3300046683 | Ga0495658_0000753 | Ga0495658_0000753_10301_11188 | 294 |
| 826 | 3300046689 | Ga0495613_0022565 | Ga0495613_0022565_1540_2427 | 294 |
| 827 | 3300047315 | Ga0495581_0000266 | Ga0495581_0000266_19899_20786 | 294 |
| 828 | 3300047673 | Ga0495593_0000838 | Ga0495593_0000838_6345_7232 | 294 |
| 829 | 3300048089 | Ga0495614_0000001 | Ga0495614_0000001_38303_39190 | 294 |
| 830 | 3300037312 | Ga0395899_0139200 | Ga0395899_0139200_471_1502 | 297 |
| 831 | 3300037471 | Ga0395905_0029800 | Ga0395905_0029800_769_1800 | 297 |
| 832 | 3300038443 | Ga0395901_0051868 | Ga0395901_0051868_420_1451 | 297 |
| 833 | 3300005437 | Ga0070710_10155163 | Ga0070710_101551631 | 298 |
| 834 | 3300005439 | Ga0070711_100070640 | Ga0070711_1000706401 | 298 |
| 835 | 3300005471 | Ga0070698_100121865 | Ga0070698_1001218652 | 298 |
| 836 | 3300005518 | Ga0070699_100315242 | Ga0070699_1003152422 | 298 |
| 837 | 3300006844 | Ga0075428_100433064 | Ga0075428_1004330642 | 298 |
| 838 | 3300006846 | Ga0075430_100001947 | Ga0075430_10000194715 | 298 |
| 839 | 3300006846 | Ga0075430_100036046 | Ga0075430_1000360465 | 298 |
| 840 | 3300006847 | Ga0075431_100183837 | Ga0075431_1001838372 | 298 |
| 841 | 3300025898 | Ga0207692_10131294 | Ga0207692_101312941 | 298 |
| 842 | 3300035170 | Ga0373943_0118972 | Ga0373943_0118972_56_952 | 298 |
| 843 | 3300035692 | Ga0373935_0360972 | Ga0373935_0360972_99_995 | 298 |
| 844 | 3300035725 | Ga0373947_0322747 | Ga0373947_0322747_74_970 | 298 |
| 845 | 3300046472 | Ga0495580_0089168 | Ga0495580_0089168_332_1228 | 298 |
| 846 | 3300050509 | nmdc:mga0qj67_1547_c1 | nmdc:mga0qj67_1547_c1_612_1511 | 298 |
| 847 | 3300001990 | JGI24737J22298_10045853 | JGI24737J22298_100458531 | 299 |
| 848 | 3300005328 | Ga0070676_10000594 | Ga0070676_1000059411 | 299 |
| 849 | 3300005329 | Ga0070683_100033167 | Ga0070683_1000331673 | 299 |
| 850 | 3300005331 | Ga0070670_100001303 | Ga0070670_10000130310 | 299 |
| 851 | 3300005331 | Ga0070670_100251892 | Ga0070670_1002518922 | 299 |
| 852 | 3300005334 | Ga0068869_100013618 | Ga0068869_1000136182 | 299 |
| 853 | 3300005338 | Ga0068868_100010299 | Ga0068868_1000102995 | 299 |
| 854 | 3300005340 | Ga0070689_100037528 | Ga0070689_1000375282 | 299 |
| 855 | 3300005343 | Ga0070687_100006707 | Ga0070687_1000067073 | 299 |
| 856 | 3300005344 | Ga0070661_100001777 | Ga0070661_1000017779 | 299 |
| 857 | 3300005344 | Ga0070661_100002926 | Ga0070661_1000029264 | 299 |
| 858 | 3300005347 | Ga0070668_100002959 | Ga0070668_1000029599 | 299 |
| 859 | 3300005347 | Ga0070668_100004148 | Ga0070668_1000041489 | 299 |
| 860 | 3300005353 | Ga0070669_100004381 | Ga0070669_1000043818 | 299 |
| 861 | 3300005353 | Ga0070669_100004515 | Ga0070669_1000045155 | 299 |
| 862 | 3300005354 | Ga0070675_100001698 | Ga0070675_10000169810 | 299 |
| 863 | 3300005355 | Ga0070671_100057861 | Ga0070671_1000578612 | 299 |
| 864 | 3300005355 | Ga0070671_100070816 | Ga0070671_1000708163 | 299 |
| 865 | 3300005356 | Ga0070674_100027133 | Ga0070674_1000271332 | 299 |
| 866 | 3300005356 | Ga0070674_100155304 | Ga0070674_1001553041 | 299 |
| 867 | 3300005365 | Ga0070688_100005984 | Ga0070688_1000059843 | 299 |
| 868 | 3300005366 | Ga0070659_100003038 | Ga0070659_1000030388 | 299 |
| 869 | 3300005366 | Ga0070659_100015628 | Ga0070659_1000156284 | 299 |
| 870 | 3300005367 | Ga0070667_100002826 | Ga0070667_1000028267 | 299 |
| 871 | 3300005438 | Ga0070701_10001273 | Ga0070701_100012736 | 299 |
| 872 | 3300005438 | Ga0070701_10008731 | Ga0070701_100087312 | 299 |
| 873 | 3300005441 | Ga0070700_100011072 | Ga0070700_1000110722 | 299 |
| 874 | 3300005441 | Ga0070700_100015648 | Ga0070700_1000156483 | 299 |
| 875 | 3300005455 | Ga0070663_100022798 | Ga0070663_1000227984 | 299 |
| 876 | 3300005457 | Ga0070662_100001636 | Ga0070662_10000163611 | 299 |
| 877 | 3300005458 | Ga0070681_10000349 | Ga0070681_1000034930 | 299 |
| 878 | 3300005466 | Ga0070685_10027877 | Ga0070685_100278773 | 299 |
| 879 | 3300005535 | Ga0070684_100006943 | Ga0070684_1000069432 | 299 |
| 880 | 3300005539 | Ga0068853_100007984 | Ga0068853_1000079843 | 299 |
| 881 | 3300005543 | Ga0070672_100001009 | Ga0070672_1000010099 | 299 |
| 882 | 3300005544 | Ga0070686_100037060 | Ga0070686_1000370603 | 299 |
| 883 | 3300005564 | Ga0070664_100005563 | Ga0070664_1000055637 | 299 |
| 884 | 3300005564 | Ga0070664_100056936 | Ga0070664_1000569363 | 299 |
| 885 | 3300005564 | Ga0070664_100291730 | Ga0070664_1002917301 | 299 |
| 886 | 3300005577 | Ga0068857_100001942 | Ga0068857_1000019427 | 299 |
| 887 | 3300005577 | Ga0068857_100185383 | Ga0068857_1001853831 | 299 |
| 888 | 3300005578 | Ga0068854_100060335 | Ga0068854_1000603352 | 299 |
| 889 | 3300005616 | Ga0068852_100000642 | Ga0068852_10000064212 | 299 |
| 890 | 3300005616 | Ga0068852_100015929 | Ga0068852_1000159295 | 299 |
| 891 | 3300005617 | Ga0068859_100067117 | Ga0068859_1000671172 | 299 |
| 892 | 3300005719 | Ga0068861_100001041 | Ga0068861_1000010412 | 299 |
| 893 | 3300005719 | Ga0068861_100009433 | Ga0068861_1000094335 | 299 |
| 894 | 3300005834 | Ga0068851_10026626 | Ga0068851_100266262 | 299 |
| 895 | 3300005840 | Ga0068870_10002369 | Ga0068870_100023696 | 299 |
| 896 | 3300005841 | Ga0068863_100008965 | Ga0068863_1000089652 | 299 |
| 897 | 3300005842 | Ga0068858_100010522 | Ga0068858_1000105222 | 299 |
| 898 | 3300005843 | Ga0068860_100010610 | Ga0068860_1000106106 | 299 |
| 899 | 3300005844 | Ga0068862_100000266 | Ga0068862_10000026634 | 299 |
| 900 | 3300005844 | Ga0068862_100003004 | Ga0068862_1000030045 | 299 |
| 901 | 3300006846 | Ga0075430_100006661 | Ga0075430_1000066614 | 299 |
| 902 | 3300006846 | Ga0075430_100064871 | Ga0075430_1000648712 | 299 |
| 903 | 3300006847 | Ga0075431_100497977 | Ga0075431_1004979772 | 299 |
| 904 | 3300006881 | Ga0068865_100020556 | Ga0068865_1000205563 | 299 |
| 905 | 3300006931 | Ga0097620_100067112 | Ga0097620_1000671122 | 299 |
| 906 | 3300009093 | Ga0105240_10310155 | Ga0105240_103101552 | 299 |
| 907 | 3300009094 | Ga0111539_10042573 | Ga0111539_100425735 | 299 |
| 908 | 3300009094 | Ga0111539_10420958 | Ga0111539_104209582 | 299 |
| 909 | 3300009147 | Ga0114129_10043062 | Ga0114129_100430625 | 299 |
| 910 | 3300009147 | Ga0114129_10199121 | Ga0114129_101991212 | 299 |
| 911 | 3300009177 | Ga0105248_10107095 | Ga0105248_101070952 | 299 |
| 912 | 3300009553 | Ga0105249_10000199 | Ga0105249_1000019932 | 299 |
| 913 | 3300009553 | Ga0105249_10004256 | Ga0105249_100042562 | 299 |
| 914 | 3300013102 | Ga0157371_10004178 | Ga0157371_1000417810 | 299 |
| 915 | 3300013297 | Ga0157378_10110325 | Ga0157378_101103253 | 299 |
| 916 | 3300013306 | Ga0163162_10004093 | Ga0163162_100040934 | 299 |
| 917 | 3300013306 | Ga0163162_10466005 | Ga0163162_104660052 | 299 |
| 918 | 3300013308 | Ga0157375_10011017 | Ga0157375_100110172 | 299 |
| 919 | 3300013308 | Ga0157375_10152055 | Ga0157375_101520552 | 299 |
| 920 | 3300014326 | Ga0157380_10004094 | Ga0157380_100040945 | 299 |
| 921 | 3300014745 | Ga0157377_10022270 | Ga0157377_100222703 | 299 |
| 922 | 3300014968 | Ga0157379_10037929 | Ga0157379_100379292 | 299 |
| 923 | 3300017792 | Ga0163161_10082717 | Ga0163161_100827172 | 299 |
| 924 | 3300025315 | Ga0207697_10015529 | Ga0207697_100155294 | 299 |
| 925 | 3300025321 | Ga0207656_10012547 | Ga0207656_100125472 | 299 |
| 926 | 3300025893 | Ga0207682_10031167 | Ga0207682_100311672 | 299 |
| 927 | 3300025899 | Ga0207642_10011144 | Ga0207642_100111442 | 299 |
| 928 | 3300025903 | Ga0207680_10087365 | Ga0207680_100873652 | 299 |
| 929 | 3300025907 | Ga0207645_10000183 | Ga0207645_1000018311 | 299 |
| 930 | 3300025908 | Ga0207643_10005312 | Ga0207643_100053124 | 299 |
| 931 | 3300025912 | Ga0207707_10005648 | Ga0207707_100056483 | 299 |
| 932 | 3300025917 | Ga0207660_10016979 | Ga0207660_100169793 | 299 |
| 933 | 3300025918 | Ga0207662_10003481 | Ga0207662_100034813 | 299 |
| 934 | 3300025919 | Ga0207657_10090121 | Ga0207657_100901212 | 299 |
| 935 | 3300025920 | Ga0207649_10003545 | Ga0207649_100035456 | 299 |
| 936 | 3300025920 | Ga0207649_10022935 | Ga0207649_100229353 | 299 |
| 937 | 3300025923 | Ga0207681_10003688 | Ga0207681_100036882 | 299 |
| 938 | 3300025923 | Ga0207681_10004290 | Ga0207681_100042906 | 299 |
| 939 | 3300025925 | Ga0207650_10005530 | Ga0207650_100055305 | 299 |
| 940 | 3300025925 | Ga0207650_10037877 | Ga0207650_100378774 | 299 |
| 941 | 3300025926 | Ga0207659_10004586 | Ga0207659_100045868 | 299 |
| 942 | 3300025927 | Ga0207687_10152998 | Ga0207687_101529981 | 299 |
| 943 | 3300025932 | Ga0207690_10003280 | Ga0207690_100032802 | 299 |
| 944 | 3300025932 | Ga0207690_10006373 | Ga0207690_100063733 | 299 |
| 945 | 3300025933 | Ga0207706_10000565 | Ga0207706_1000056521 | 299 |
| 946 | 3300025936 | Ga0207670_10034304 | Ga0207670_100343042 | 299 |
| 947 | 3300025937 | Ga0207669_10049180 | Ga0207669_100491802 | 299 |
| 948 | 3300025938 | Ga0207704_10326947 | Ga0207704_103269471 | 299 |
| 949 | 3300025940 | Ga0207691_10000109 | Ga0207691_1000010935 | 299 |
| 950 | 3300025941 | Ga0207711_10073206 | Ga0207711_100732062 | 299 |
| 951 | 3300025942 | Ga0207689_10005513 | Ga0207689_100055137 | 299 |
| 952 | 3300025944 | Ga0207661_10014723 | Ga0207661_100147232 | 299 |
| 953 | 3300025945 | Ga0207679_10001098 | Ga0207679_100010986 | 299 |
| 954 | 3300025945 | Ga0207679_10005409 | Ga0207679_100054095 | 299 |
| 955 | 3300025945 | Ga0207679_10030240 | Ga0207679_100302402 | 299 |
| 956 | 3300025961 | Ga0207712_10000276 | Ga0207712_1000027632 | 299 |
| 957 | 3300025961 | Ga0207712_10036346 | Ga0207712_100363462 | 299 |
| 958 | 3300025972 | Ga0207668_10019075 | Ga0207668_100190752 | 299 |
| 959 | 3300025972 | Ga0207668_10025365 | Ga0207668_100253654 | 299 |
| 960 | 3300025981 | Ga0207640_10106130 | Ga0207640_101061302 | 299 |
| 961 | 3300025986 | Ga0207658_10023602 | Ga0207658_100236024 | 299 |
| 962 | 3300026035 | Ga0207703_10092608 | Ga0207703_100926083 | 299 |
| 963 | 3300026041 | Ga0207639_10045201 | Ga0207639_100452014 | 299 |
| 964 | 3300026067 | Ga0207678_10022886 | Ga0207678_100228862 | 299 |
| 965 | 3300026075 | Ga0207708_10009211 | Ga0207708_100092113 | 299 |
| 966 | 3300026075 | Ga0207708_10024580 | Ga0207708_100245802 | 299 |
| 967 | 3300026116 | Ga0207674_10000388 | Ga0207674_1000038835 | 299 |
| 968 | 3300026116 | Ga0207674_10000888 | Ga0207674_1000088816 | 299 |
| 969 | 3300026118 | Ga0207675_100000650 | Ga0207675_10000065013 | 299 |
| 970 | 3300026118 | Ga0207675_100003901 | Ga0207675_10000390113 | 299 |
| 971 | 3300026142 | Ga0207698_10000888 | Ga0207698_100008889 | 299 |
| 972 | 3300026142 | Ga0207698_10095935 | Ga0207698_100959352 | 299 |
| 973 | 3300028380 | Ga0268265_10001227 | Ga0268265_100012276 | 299 |
| 974 | 3300028380 | Ga0268265_10072678 | Ga0268265_100726782 | 299 |
| 975 | 3300028381 | Ga0268264_10080970 | Ga0268264_100809702 | 299 |
| 976 | 3300031548 | Ga0307408_100016250 | Ga0307408_1000162502 | 299 |
| 977 | 3300031731 | Ga0307405_10009469 | Ga0307405_100094694 | 299 |
| 978 | 3300031852 | Ga0307410_10001361 | Ga0307410_1000136110 | 299 |
| 979 | 3300031852 | Ga0307410_10199764 | Ga0307410_101997642 | 299 |
| 980 | 3300031901 | Ga0307406_10011369 | Ga0307406_100113695 | 299 |
| 981 | 3300031903 | Ga0307407_10009235 | Ga0307407_100092353 | 299 |
| 982 | 3300031995 | Ga0307409_100030207 | Ga0307409_1000302073 | 299 |
| 983 | 3300032002 | Ga0307416_100019225 | Ga0307416_1000192253 | 299 |
| 984 | 3300032002 | Ga0307416_100088318 | Ga0307416_1000883183 | 299 |
| 985 | 3300032002 | Ga0307416_100348198 | Ga0307416_1003481982 | 299 |
| 986 | 3300032005 | Ga0307411_10001049 | Ga0307411_100010495 | 299 |
| 987 | 3300048912 | Ga0496109_0180774 | Ga0496109_0180774_1042_1941 | 299 |
| 988 | 3300049679 | Ga0501249_008461 | Ga0501249_008461_124_1026 | 299 |
| 989 | 3300050509 | nmdc:mga0qj67_23498_c1 | nmdc:mga0qj67_23498_c1_2362_3267 | 299 |
| 990 | 3300050509 | nmdc:mga0qj67_24511_c1 | nmdc:mga0qj67_24511_c1_3567_4472 | 299 |
| 991 | 3300050510 | nmdc:mga06r32_481487_c1 | nmdc:mga06r32_481487_c1_120_1025 | 299 |
| 992 | 3300050510 | nmdc:mga06r32_8011_c1 | nmdc:mga06r32_8011_c1_6686_7591 | 299 |
| 993 | 3300050511 | nmdc:mga08y16_207005_c1 | nmdc:mga08y16_207005_c1_920_1819 | 299 |
| 994 | 3300050515 | nmdc:mga0a205_216169_c1 | nmdc:mga0a205_216169_c1_186_1085 | 299 |
| 995 | 3300050515 | nmdc:mga0a205_24941_c2 | nmdc:mga0a205_24941_c2_2556_3458 | 299 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
119
305
0.97
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tui-assembly2.cif.gz_E | inward facing conformations of the metni methionine abc transporter: cy5 native crystal form | 0.7839 | 72 | 279 |
| 3tui-assembly2.cif.gz_E | inward facing conformations of the metni methionine abc transporter: cy5 native crystal form | 0.7544 | 72 | 279 |
| 3tuz-assembly2.cif.gz_F | inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form | 0.7206 | 75 | 279 |
| 7mc0-assembly1.cif.gz_B | inward facing conformation of the metni methionine abc transporter | 0.7185 | 83 | 279 |
| 3rlf-assembly1.cif.gz_F | crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp | 0.7072 | 72 | 262 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZQ8_74_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9451 | 73 | 276 | 1.10.3720.10 |
| af_P33915_131_335_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9426 | 71 | 277 | 1.10.3720.10 |
| af_Q2G1F6_179_383_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9397 | 73 | 279 | 1.10.3720.10 |
| af_P33915_131_335_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9338 | 71 | 277 | 1.10.3720.10 |
| af_Q2FVE9_63_269_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9332 | 70 | 278 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9HMT0-F1-model_v4 | ABC transporter permease | 0.9616 | 2 | 281 |
GO:0005886
GO:0055085 |
| AF-A0A484RC28-F1-model_v4 | Dipeptide transport system permease protein DppC (TC 3.A.1.5.2) | 0.9596 | 7 | 282 |
GO:0005886
GO:0055085 |
| AF-A0A3D2NVU1-F1-model_v4 | deleted | 0.9586 | 16 | 281 |
|
| AF-A0A3D9QUC2-F1-model_v4 | Peptide/nickel transport system permease protein | 0.9583 | 5 | 281 |
GO:0005886
GO:0055085 |
| AF-A0A847G5B4-F1-model_v4 | ABC transporter permease | 0.9577 | 7 | 285 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar