F487748
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 995 | 281 | 1990 | 136 |
Family's Representative Sequence
| Representative Sequence | 3300035086|Ga0373934_0324687|Ga0373934_0324687_126_566 |
| Length | 146 |
| Sequence | MRSARVSAKAIAAVAIFLAATPAWAHHSFAAEFDRNKVVNLEGTIVKMEWVNPHAWIHVAVKNPDGTSTTWMIEANTPNGLLRRGFTKQSLEQGTEVLVRGYQAKSGDNKANGSSMTFKDGKKLFLGSSSGDEEDPTGKAPTKSGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 6 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 125 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 128 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 129 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 196 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 197 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 199 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 201 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 203 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 217 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 218 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 219 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 222 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 223 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 224 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 225 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 226 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 227 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 228 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 229 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 266 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 267 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 268 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 269 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 270 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.89 |
| Metatranscriptomes | 2.11 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.01 |
| Rhizosphere | 97.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 25.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373934_0324687 | 3300035086 | Bacteria | 639 |
| 2 | SwRhRL2b_contig_134348 | 2162886007 | Unclassified | 901 |
| 3 | Ga0058859_11726138 | 3300004798 | Bacteria | 832 |
| 4 | Ga0058861_11567625 | 3300004800 | Unclassified | 2164 |
| 5 | Ga0058861_11666670 | 3300004800 | Bacteria | 726 |
| 6 | Ga0058860_10032041 | 3300004801 | Bacteria | 827 |
| 7 | Ga0058860_11730977 | 3300004801 | Bacteria | 628 |
| 8 | Ga0058862_10653920 | 3300004803 | Bacteria | 700 |
| 9 | Ga0058862_11764429 | 3300004803 | Unclassified | 3160 |
| 10 | Ga0065715_10305037 | 3300005293 | Bacteria | 1033 |
| 11 | Ga0065715_10534290 | 3300005293 | Unclassified | 753 |
| 12 | Ga0065707_10317247 | 3300005295 | Bacteria | 973 |
| 13 | Ga0070658_10312755 | 3300005327 | Bacteria | 1340 |
| 14 | Ga0070676_10073436 | 3300005328 | Bacteria | 2058 |
| 15 | Ga0070676_10498912 | 3300005328 | Unclassified | 864 |
| 16 | Ga0070676_10883578 | 3300005328 | Unclassified | 665 |
| 17 | Ga0070683_100000668 | 3300005329 | Bacteria | 24820 |
| 18 | Ga0070683_100001579 | 3300005329 | Bacteria | 17631 |
| 19 | Ga0070683_100008117 | 3300005329 | Bacteria | 8916 |
| 20 | Ga0070683_100063533 | 3300005329 | Bacteria | 3434 |
| 21 | Ga0070683_100087057 | 3300005329 | Bacteria | 2929 |
| 22 | Ga0070683_100279454 | 3300005329 | Bacteria | 1588 |
| 23 | Ga0070683_100321022 | 3300005329 | Bacteria | 1474 |
| 24 | Ga0070683_100329826 | 3300005329 | Bacteria | 1453 |
| 25 | Ga0070683_100337545 | 3300005329 | Bacteria | 1435 |
| 26 | Ga0070690_100371840 | 3300005330 | Unclassified | 1043 |
| 27 | Ga0070690_100412354 | 3300005330 | Unclassified | 994 |
| 28 | Ga0070690_100537270 | 3300005330 | Bacteria | 879 |
| 29 | Ga0070670_100009951 | 3300005331 | Bacteria | 8117 |
| 30 | Ga0070677_10864044 | 3300005333 | Unclassified | 521 |
| 31 | Ga0068869_100019204 | 3300005334 | Bacteria | 4665 |
| 32 | Ga0068869_100100713 | 3300005334 | Bacteria | 2185 |
| 33 | Ga0068869_100209394 | 3300005334 | Bacteria | 1541 |
| 34 | Ga0068869_100622670 | 3300005334 | Bacteria | 914 |
| 35 | Ga0068869_100690063 | 3300005334 | Unclassified | 870 |
| 36 | Ga0070666_10033122 | 3300005335 | Bacteria | 3417 |
| 37 | Ga0070666_10053354 | 3300005335 | Unclassified | 2727 |
| 38 | Ga0070680_100003994 | 3300005336 | Bacteria | 11041 |
| 39 | Ga0070680_100029305 | 3300005336 | Bacteria | 4421 |
| 40 | Ga0070680_100055725 | 3300005336 | Unclassified | 3231 |
| 41 | Ga0070680_100473811 | 3300005336 | Bacteria | 1070 |
| 42 | Ga0070682_100856609 | 3300005337 | Bacteria | 743 |
| 43 | Ga0068868_100117999 | 3300005338 | Bacteria | 2162 |
| 44 | Ga0068868_100162368 | 3300005338 | Unclassified | 1846 |
| 45 | Ga0068868_100232182 | 3300005338 | Bacteria | 1548 |
| 46 | Ga0068868_100250425 | 3300005338 | Bacteria | 1491 |
| 47 | Ga0068868_100520535 | 3300005338 | Unclassified | 1044 |
| 48 | Ga0068868_101373881 | 3300005338 | Bacteria | 658 |
| 49 | Ga0068868_101392153 | 3300005338 | Bacteria | 654 |
| 50 | Ga0070660_100089115 | 3300005339 | Unclassified | 2431 |
| 51 | Ga0070660_100188248 | 3300005339 | Bacteria | 1671 |
| 52 | Ga0070660_100199036 | 3300005339 | Bacteria | 1625 |
| 53 | Ga0070689_100080626 | 3300005340 | Unclassified | 2554 |
| 54 | Ga0070689_100430874 | 3300005340 | Bacteria | 1119 |
| 55 | Ga0070689_100597324 | 3300005340 | Bacteria | 956 |
| 56 | Ga0070689_101453603 | 3300005340 | Bacteria | 620 |
| 57 | Ga0070691_10000648 | 3300005341 | Bacteria | 13455 |
| 58 | Ga0070691_10006127 | 3300005341 | Bacteria | 5488 |
| 59 | Ga0070691_10042747 | 3300005341 | Bacteria | 2145 |
| 60 | Ga0070691_10139770 | 3300005341 | Unclassified | 1233 |
| 61 | Ga0070691_10303338 | 3300005341 | Bacteria | 873 |
| 62 | Ga0070687_100010260 | 3300005343 | Bacteria | 4044 |
| 63 | Ga0070661_100074809 | 3300005344 | Unclassified | 2495 |
| 64 | Ga0070661_100336248 | 3300005344 | Unclassified | 1182 |
| 65 | Ga0070661_100761920 | 3300005344 | Bacteria | 792 |
| 66 | Ga0070661_101478756 | 3300005344 | Unclassified | 573 |
| 67 | Ga0070661_101736702 | 3300005344 | Bacteria | 529 |
| 68 | Ga0070692_10121231 | 3300005345 | Bacteria | 1458 |
| 69 | Ga0070669_100814346 | 3300005353 | Bacteria | 794 |
| 70 | Ga0070669_101104529 | 3300005353 | Unclassified | 683 |
| 71 | Ga0070675_100016777 | 3300005354 | Bacteria | 5815 |
| 72 | Ga0070671_100016939 | 3300005355 | Bacteria | 5894 |
| 73 | Ga0070671_100072322 | 3300005355 | Bacteria | 2879 |
| 74 | Ga0070671_100109669 | 3300005355 | Bacteria | 2318 |
| 75 | Ga0070671_100226470 | 3300005355 | Bacteria | 1586 |
| 76 | Ga0070671_100809569 | 3300005355 | Bacteria | 816 |
| 77 | Ga0070673_100086982 | 3300005364 | Bacteria | 2547 |
| 78 | Ga0070673_100108115 | 3300005364 | Unclassified | 2302 |
| 79 | Ga0070673_100194967 | 3300005364 | Bacteria | 1742 |
| 80 | Ga0070673_100823822 | 3300005364 | Bacteria | 858 |
| 81 | Ga0070688_100035067 | 3300005365 | Bacteria | 3045 |
| 82 | Ga0070659_100008560 | 3300005366 | Bacteria | 7480 |
| 83 | Ga0070667_100348286 | 3300005367 | Bacteria | 1341 |
| 84 | Ga0070667_101006357 | 3300005367 | Unclassified | 778 |
| 85 | Ga0070667_101268745 | 3300005367 | Unclassified | 690 |
| 86 | Ga0070709_10087832 | 3300005434 | Bacteria | 2044 |
| 87 | Ga0070709_10176559 | 3300005434 | Bacteria | 1497 |
| 88 | Ga0070709_10814180 | 3300005434 | Bacteria | 734 |
| 89 | Ga0070709_11132039 | 3300005434 | Bacteria | 627 |
| 90 | Ga0070714_100017969 | 3300005435 | Bacteria | 5734 |
| 91 | Ga0070714_100441597 | 3300005435 | Unclassified | 1235 |
| 92 | Ga0070714_100891615 | 3300005435 | Bacteria | 863 |
| 93 | Ga0070713_100008512 | 3300005436 | Bacteria | 7280 |
| 94 | Ga0070713_100032629 | 3300005436 | Bacteria | 4162 |
| 95 | Ga0070713_100163389 | 3300005436 | Bacteria | 1989 |
| 96 | Ga0070713_101051922 | 3300005436 | Bacteria | 786 |
| 97 | Ga0070710_10067712 | 3300005437 | Bacteria | 2049 |
| 98 | Ga0070710_10253919 | 3300005437 | Bacteria | 1131 |
| 99 | Ga0070710_10389933 | 3300005437 | Bacteria | 931 |
| 100 | Ga0070701_10435657 | 3300005438 | Bacteria | 838 |
| 101 | Ga0070701_10530382 | 3300005438 | Bacteria | 769 |
| 102 | Ga0070711_100046386 | 3300005439 | Bacteria | 2961 |
| 103 | Ga0070711_100051884 | 3300005439 | Bacteria | 2820 |
| 104 | Ga0070711_100070201 | 3300005439 | Bacteria | 2466 |
| 105 | Ga0070711_100156478 | 3300005439 | Unclassified | 1724 |
| 106 | Ga0070705_100003820 | 3300005440 | Bacteria | 7367 |
| 107 | Ga0070705_100065347 | 3300005440 | Bacteria | 2177 |
| 108 | Ga0070705_100622466 | 3300005440 | Bacteria | 838 |
| 109 | Ga0070705_101075757 | 3300005440 | Archaea | 657 |
| 110 | Ga0070700_100363289 | 3300005441 | Bacteria | 1077 |
| 111 | Ga0070694_100004969 | 3300005444 | Bacteria | 8012 |
| 112 | Ga0070694_100088746 | 3300005444 | Bacteria | 2165 |
| 113 | Ga0070694_100760698 | 3300005444 | Unclassified | 792 |
| 114 | Ga0070708_100398408 | 3300005445 | Unclassified | 1298 |
| 115 | Ga0070708_100472641 | 3300005445 | Unclassified | 1183 |
| 116 | Ga0070708_101472567 | 3300005445 | Unclassified | 635 |
| 117 | Ga0070663_100308876 | 3300005455 | Bacteria | 1268 |
| 118 | Ga0070662_100036690 | 3300005457 | Bacteria | 3470 |
| 119 | Ga0070662_100228634 | 3300005457 | Bacteria | 1487 |
| 120 | Ga0070681_10000972 | 3300005458 | Bacteria | 24213 |
| 121 | Ga0070681_10003753 | 3300005458 | Bacteria | 14255 |
| 122 | Ga0070681_10163166 | 3300005458 | Unclassified | 2152 |
| 123 | Ga0070681_10584258 | 3300005458 | Bacteria | 1031 |
| 124 | Ga0070681_10893346 | 3300005458 | Unclassified | 807 |
| 125 | Ga0070681_11885596 | 3300005458 | Bacteria | 525 |
| 126 | Ga0068867_100065175 | 3300005459 | Bacteria | 2710 |
| 127 | Ga0068867_100106173 | 3300005459 | Unclassified | 2151 |
| 128 | Ga0068867_100112351 | 3300005459 | Unclassified | 2095 |
| 129 | Ga0068867_100165064 | 3300005459 | Bacteria | 1749 |
| 130 | Ga0068867_100192275 | 3300005459 | Unclassified | 1629 |
| 131 | Ga0068867_100413397 | 3300005459 | Unclassified | 1141 |
| 132 | Ga0070685_10398812 | 3300005466 | Unclassified | 952 |
| 133 | Ga0070706_100198957 | 3300005467 | Bacteria | 1872 |
| 134 | Ga0070707_100126988 | 3300005468 | Unclassified | 2478 |
| 135 | Ga0070698_100944871 | 3300005471 | Bacteria | 808 |
| 136 | Ga0070699_100037311 | 3300005518 | Bacteria | 4204 |
| 137 | Ga0070699_100712427 | 3300005518 | Bacteria | 917 |
| 138 | Ga0070679_100003226 | 3300005530 | Bacteria | 14897 |
| 139 | Ga0070679_100009655 | 3300005530 | Bacteria | 9128 |
| 140 | Ga0070679_100323306 | 3300005530 | Bacteria | 1492 |
| 141 | Ga0070679_100551693 | 3300005530 | Bacteria | 1096 |
| 142 | Ga0070684_100001842 | 3300005535 | Bacteria | 15525 |
| 143 | Ga0070684_100002448 | 3300005535 | Bacteria | 13678 |
| 144 | Ga0070684_100011967 | 3300005535 | Bacteria | 6931 |
| 145 | Ga0070684_100015801 | 3300005535 | Bacteria | 6159 |
| 146 | Ga0070684_100018492 | 3300005535 | Bacteria | 5741 |
| 147 | Ga0070684_100044151 | 3300005535 | Bacteria | 3853 |
| 148 | Ga0070684_100555523 | 3300005535 | Bacteria | 1066 |
| 149 | Ga0070684_100742879 | 3300005535 | Unclassified | 916 |
| 150 | Ga0070684_101045404 | 3300005535 | Archaea | 767 |
| 151 | Ga0070684_101144110 | 3300005535 | Bacteria | 732 |
| 152 | Ga0070697_100191917 | 3300005536 | Bacteria | 1734 |
| 153 | Ga0070697_100238255 | 3300005536 | Bacteria | 1553 |
| 154 | Ga0070697_100280027 | 3300005536 | Bacteria | 1431 |
| 155 | Ga0070697_100348621 | 3300005536 | Bacteria | 1278 |
| 156 | Ga0068853_100137042 | 3300005539 | Unclassified | 2195 |
| 157 | Ga0068853_100172915 | 3300005539 | Bacteria | 1955 |
| 158 | Ga0068853_100174914 | 3300005539 | Bacteria | 1944 |
| 159 | Ga0068853_101023023 | 3300005539 | Unclassified | 796 |
| 160 | Ga0070672_100343960 | 3300005543 | Bacteria | 1270 |
| 161 | Ga0070672_101227356 | 3300005543 | Bacteria | 668 |
| 162 | Ga0070686_100726872 | 3300005544 | Unclassified | 794 |
| 163 | Ga0070695_100005568 | 3300005545 | Bacteria | 7416 |
| 164 | Ga0070695_100062434 | 3300005545 | Bacteria | 2419 |
| 165 | Ga0070695_100184223 | 3300005545 | Unclassified | 1482 |
| 166 | Ga0070695_100552728 | 3300005545 | Unclassified | 898 |
| 167 | Ga0070696_100003974 | 3300005546 | Bacteria | 9858 |
| 168 | Ga0070696_100110820 | 3300005546 | Bacteria | 1976 |
| 169 | Ga0070696_100982591 | 3300005546 | Unclassified | 704 |
| 170 | Ga0070696_101129748 | 3300005546 | Bacteria | 660 |
| 171 | Ga0070693_100037989 | 3300005547 | Bacteria | 2688 |
| 172 | Ga0070693_100046738 | 3300005547 | Unclassified | 2460 |
| 173 | Ga0070693_100156914 | 3300005547 | Bacteria | 1446 |
| 174 | Ga0070704_100087264 | 3300005549 | Bacteria | 2315 |
| 175 | Ga0070704_100178382 | 3300005549 | Bacteria | 1697 |
| 176 | Ga0068855_100013302 | 3300005563 | Bacteria | 9926 |
| 177 | Ga0068855_100014595 | 3300005563 | Bacteria | 9461 |
| 178 | Ga0068855_100025947 | 3300005563 | Bacteria | 7010 |
| 179 | Ga0068855_100083870 | 3300005563 | Bacteria | 3691 |
| 180 | Ga0068855_100099341 | 3300005563 | Bacteria | 3352 |
| 181 | Ga0068855_100166519 | 3300005563 | Bacteria | 2498 |
| 182 | Ga0068855_100297827 | 3300005563 | Bacteria | 1787 |
| 183 | Ga0070664_100028503 | 3300005564 | Bacteria | 4645 |
| 184 | Ga0070664_100156773 | 3300005564 | Bacteria | 2012 |
| 185 | Ga0070664_100616009 | 3300005564 | Bacteria | 1007 |
| 186 | Ga0070664_100621898 | 3300005564 | Unclassified | 1002 |
| 187 | Ga0070664_100779105 | 3300005564 | Bacteria | 893 |
| 188 | Ga0068857_100000120 | 3300005577 | Bacteria | 46937 |
| 189 | Ga0068857_100000543 | 3300005577 | Bacteria | 27430 |
| 190 | Ga0068857_100015291 | 3300005577 | Bacteria | 6699 |
| 191 | Ga0068857_100022503 | 3300005577 | Bacteria | 5546 |
| 192 | Ga0068857_100966793 | 3300005577 | Bacteria | 819 |
| 193 | Ga0068857_101116632 | 3300005577 | Bacteria | 762 |
| 194 | Ga0068854_100032291 | 3300005578 | Bacteria | 3642 |
| 195 | Ga0068854_100330775 | 3300005578 | Bacteria | 1241 |
| 196 | Ga0068856_100016001 | 3300005614 | Bacteria | 7251 |
| 197 | Ga0068856_100039863 | 3300005614 | Bacteria | 4612 |
| 198 | Ga0068856_100046698 | 3300005614 | Bacteria | 4265 |
| 199 | Ga0068856_100065356 | 3300005614 | Bacteria | 3595 |
| 200 | Ga0068856_100077191 | 3300005614 | Bacteria | 3300 |
| 201 | Ga0068856_100233503 | 3300005614 | Bacteria | 1855 |
| 202 | Ga0068856_100960795 | 3300005614 | Bacteria | 873 |
| 203 | Ga0068856_101243468 | 3300005614 | Bacteria | 760 |
| 204 | Ga0068856_101430336 | 3300005614 | Bacteria | 706 |
| 205 | Ga0070702_100111408 | 3300005615 | Bacteria | 1697 |
| 206 | Ga0070702_100315588 | 3300005615 | Bacteria | 1087 |
| 207 | Ga0068852_100009295 | 3300005616 | Bacteria | 7290 |
| 208 | Ga0068852_100041581 | 3300005616 | Bacteria | 3886 |
| 209 | Ga0068852_100052107 | 3300005616 | Bacteria | 3516 |
| 210 | Ga0068852_100305758 | 3300005616 | Unclassified | 1540 |
| 211 | Ga0068852_100401581 | 3300005616 | Bacteria | 1348 |
| 212 | Ga0068852_100876432 | 3300005616 | Bacteria | 914 |
| 213 | Ga0068859_100005183 | 3300005617 | Bacteria | 13237 |
| 214 | Ga0068859_100032397 | 3300005617 | Bacteria | 5251 |
| 215 | Ga0068859_100568961 | 3300005617 | Bacteria | 1227 |
| 216 | Ga0068859_101920291 | 3300005617 | Unclassified | 654 |
| 217 | Ga0068864_100041167 | 3300005618 | Bacteria | 3952 |
| 218 | Ga0068864_100089891 | 3300005618 | Bacteria | 2706 |
| 219 | Ga0068864_100146382 | 3300005618 | Bacteria | 2136 |
| 220 | Ga0068864_100284709 | 3300005618 | Bacteria | 1544 |
| 221 | Ga0068864_100552694 | 3300005618 | Bacteria | 1113 |
| 222 | Ga0068864_100694953 | 3300005618 | Bacteria | 993 |
| 223 | Ga0068864_100702783 | 3300005618 | Bacteria | 988 |
| 224 | Ga0068864_100791100 | 3300005618 | Unclassified | 932 |
| 225 | Ga0068864_101623228 | 3300005618 | Unclassified | 651 |
| 226 | Ga0068866_10104658 | 3300005718 | Bacteria | 1568 |
| 227 | Ga0068861_100011022 | 3300005719 | Bacteria | 6282 |
| 228 | Ga0068861_100089290 | 3300005719 | Bacteria | 2429 |
| 229 | Ga0068861_100324268 | 3300005719 | Bacteria | 1342 |
| 230 | Ga0068861_100435435 | 3300005719 | Bacteria | 1171 |
| 231 | Ga0068861_100827136 | 3300005719 | Bacteria | 871 |
| 232 | Ga0068870_10003561 | 3300005840 | Bacteria | 6604 |
| 233 | Ga0068870_10025719 | 3300005840 | Unclassified | 2925 |
| 234 | Ga0068870_10669500 | 3300005840 | Bacteria | 713 |
| 235 | Ga0068863_100011073 | 3300005841 | Bacteria | 8746 |
| 236 | Ga0068863_100121561 | 3300005841 | Bacteria | 2490 |
| 237 | Ga0068863_100219703 | 3300005841 | Bacteria | 1830 |
| 238 | Ga0068863_102321458 | 3300005841 | Unclassified | 546 |
| 239 | Ga0068858_100012911 | 3300005842 | Bacteria | 7877 |
| 240 | Ga0068858_100029827 | 3300005842 | Bacteria | 5067 |
| 241 | Ga0068858_100033623 | 3300005842 | Bacteria | 4756 |
| 242 | Ga0068858_100056404 | 3300005842 | Bacteria | 3631 |
| 243 | Ga0068858_100074200 | 3300005842 | Bacteria | 3158 |
| 244 | Ga0068858_100356297 | 3300005842 | Bacteria | 1402 |
| 245 | Ga0068858_100356331 | 3300005842 | Bacteria | 1402 |
| 246 | Ga0068858_100358282 | 3300005842 | Bacteria | 1398 |
| 247 | Ga0068858_100371306 | 3300005842 | Bacteria | 1372 |
| 248 | Ga0068858_100621474 | 3300005842 | Unclassified | 1049 |
| 249 | Ga0068858_100759024 | 3300005842 | Unclassified | 945 |
| 250 | Ga0068858_102375832 | 3300005842 | Unclassified | 524 |
| 251 | Ga0068860_100054688 | 3300005843 | Unclassified | 3794 |
| 252 | Ga0068860_100093525 | 3300005843 | Bacteria | 2865 |
| 253 | Ga0068860_100106279 | 3300005843 | Bacteria | 2681 |
| 254 | Ga0068860_100367019 | 3300005843 | Bacteria | 1419 |
| 255 | Ga0068860_100671522 | 3300005843 | Unclassified | 1045 |
| 256 | Ga0068860_102682012 | 3300005843 | Bacteria | 517 |
| 257 | Ga0068862_101149105 | 3300005844 | Bacteria | 773 |
| 258 | Ga0068862_101338003 | 3300005844 | Bacteria | 718 |
| 259 | Ga0070717_10164841 | 3300006028 | Bacteria | 1924 |
| 260 | Ga0070717_11692812 | 3300006028 | Bacteria | 572 |
| 261 | Ga0070712_100793502 | 3300006175 | Bacteria | 812 |
| 262 | Ga0070712_101314381 | 3300006175 | Unclassified | 630 |
| 263 | Ga0097621_100046705 | 3300006237 | Bacteria | 3505 |
| 264 | Ga0097621_100057681 | 3300006237 | Unclassified | 3176 |
| 265 | Ga0097621_100131269 | 3300006237 | Unclassified | 2133 |
| 266 | Ga0097621_100138347 | 3300006237 | Unclassified | 2079 |
| 267 | Ga0097621_100147982 | 3300006237 | Bacteria | 2012 |
| 268 | Ga0097621_100455821 | 3300006237 | Unclassified | 1153 |
| 269 | Ga0068871_100023740 | 3300006358 | Bacteria | 4747 |
| 270 | Ga0068871_100069598 | 3300006358 | Bacteria | 2890 |
| 271 | Ga0068871_100071298 | 3300006358 | Bacteria | 2857 |
| 272 | Ga0068871_100101239 | 3300006358 | Unclassified | 2414 |
| 273 | Ga0068871_100178262 | 3300006358 | Bacteria | 1825 |
| 274 | Ga0068871_100258056 | 3300006358 | Unclassified | 1520 |
| 275 | Ga0068871_100476113 | 3300006358 | Unclassified | 1122 |
| 276 | Ga0068871_100857641 | 3300006358 | Bacteria | 840 |
| 277 | Ga0075428_100006991 | 3300006844 | Bacteria | 12516 |
| 278 | Ga0075428_100009385 | 3300006844 | Bacteria | 10853 |
| 279 | Ga0075428_100072397 | 3300006844 | Bacteria | 3765 |
| 280 | Ga0075430_100006232 | 3300006846 | Bacteria | 10061 |
| 281 | Ga0075430_100262358 | 3300006846 | Unclassified | 1431 |
| 282 | Ga0075430_101177451 | 3300006846 | Unclassified | 631 |
| 283 | Ga0075431_100001397 | 3300006847 | Bacteria | 22147 |
| 284 | Ga0075431_100081134 | 3300006847 | Bacteria | 3349 |
| 285 | Ga0075433_10050736 | 3300006852 | Bacteria | 3612 |
| 286 | Ga0075433_10776410 | 3300006852 | Archaea | 838 |
| 287 | Ga0075433_10866815 | 3300006852 | Bacteria | 788 |
| 288 | Ga0075434_100019558 | 3300006871 | Bacteria | 6555 |
| 289 | Ga0075434_100042778 | 3300006871 | Bacteria | 4491 |
| 290 | Ga0075434_100092807 | 3300006871 | Bacteria | 3022 |
| 291 | Ga0075434_100206194 | 3300006871 | Bacteria | 1986 |
| 292 | Ga0075429_100021559 | 3300006880 | Bacteria | 5585 |
| 293 | Ga0075429_100043509 | 3300006880 | Bacteria | 3908 |
| 294 | Ga0068865_100054622 | 3300006881 | Bacteria | 2776 |
| 295 | Ga0068865_100076718 | 3300006881 | Unclassified | 2386 |
| 296 | Ga0068865_100141869 | 3300006881 | Bacteria | 1812 |
| 297 | Ga0068865_100145328 | 3300006881 | Bacteria | 1793 |
| 298 | Ga0068865_101333507 | 3300006881 | Bacteria | 639 |
| 299 | Ga0075436_100044802 | 3300006914 | Unclassified | 3051 |
| 300 | Ga0075436_100160897 | 3300006914 | Bacteria | 1582 |
| 301 | Ga0075436_100398642 | 3300006914 | Bacteria | 997 |
| 302 | Ga0075436_100759721 | 3300006914 | Unclassified | 720 |
| 303 | Ga0097620_100005183 | 3300006931 | Bacteria | 13237 |
| 304 | Ga0097620_100032397 | 3300006931 | Bacteria | 5251 |
| 305 | Ga0097620_100568885 | 3300006931 | Bacteria | 1227 |
| 306 | Ga0097620_101920306 | 3300006931 | Unclassified | 654 |
| 307 | Ga0075435_100020812 | 3300007076 | Bacteria | 5034 |
| 308 | Ga0075435_100031253 | 3300007076 | Bacteria | 4193 |
| 309 | Ga0075435_100110529 | 3300007076 | Bacteria | 2286 |
| 310 | Ga0075435_100489825 | 3300007076 | Bacteria | 1062 |
| 311 | Ga0075435_100545644 | 3300007076 | Unclassified | 1004 |
| 312 | Ga0075435_100895973 | 3300007076 | Bacteria | 773 |
| 313 | Ga0099794_10021952 | 3300007265 | Bacteria | 2905 |
| 314 | Ga0105240_10002588 | 3300009093 | Bacteria | 28968 |
| 315 | Ga0105240_10006114 | 3300009093 | Bacteria | 17759 |
| 316 | Ga0105240_10009049 | 3300009093 | Bacteria | 14140 |
| 317 | Ga0105240_10081009 | 3300009093 | Bacteria | 3990 |
| 318 | Ga0105240_10137524 | 3300009093 | Bacteria | 2924 |
| 319 | Ga0105240_10158765 | 3300009093 | Unclassified | 2688 |
| 320 | Ga0105240_10294742 | 3300009093 | Bacteria | 1858 |
| 321 | Ga0105240_10388988 | 3300009093 | Bacteria | 1573 |
| 322 | Ga0105240_10551245 | 3300009093 | Bacteria | 1275 |
| 323 | Ga0105240_10933405 | 3300009093 | Bacteria | 932 |
| 324 | Ga0105240_11305864 | 3300009093 | Unclassified | 765 |
| 325 | Ga0111539_10007771 | 3300009094 | Bacteria | 13688 |
| 326 | Ga0111539_10042941 | 3300009094 | Bacteria | 5425 |
| 327 | Ga0111539_10045003 | 3300009094 | Bacteria | 5285 |
| 328 | Ga0111539_10099161 | 3300009094 | Bacteria | 3422 |
| 329 | Ga0105245_10001598 | 3300009098 | Bacteria | 20620 |
| 330 | Ga0105245_10009190 | 3300009098 | Bacteria | 8617 |
| 331 | Ga0105245_10016334 | 3300009098 | Bacteria | 6473 |
| 332 | Ga0105245_10074173 | 3300009098 | Bacteria | 3096 |
| 333 | Ga0105245_10109654 | 3300009098 | Bacteria | 2565 |
| 334 | Ga0105245_10117859 | 3300009098 | Bacteria | 2477 |
| 335 | Ga0105245_10136236 | 3300009098 | Bacteria | 2308 |
| 336 | Ga0105245_10143593 | 3300009098 | Bacteria | 2250 |
| 337 | Ga0105245_10167105 | 3300009098 | Unclassified | 2092 |
| 338 | Ga0105245_10311716 | 3300009098 | Unclassified | 1547 |
| 339 | Ga0105245_10369481 | 3300009098 | Unclassified | 1426 |
| 340 | Ga0105245_10374774 | 3300009098 | Bacteria | 1416 |
| 341 | Ga0105245_10554650 | 3300009098 | Bacteria | 1171 |
| 342 | Ga0105245_10656773 | 3300009098 | Unclassified | 1079 |
| 343 | Ga0105245_11352028 | 3300009098 | Unclassified | 762 |
| 344 | Ga0105245_11876754 | 3300009098 | Unclassified | 652 |
| 345 | Ga0105247_10112158 | 3300009101 | Unclassified | 1757 |
| 346 | Ga0114129_10000153 | 3300009147 | Bacteria | 73434 |
| 347 | Ga0114129_10024148 | 3300009147 | Bacteria | 8616 |
| 348 | Ga0114129_10137402 | 3300009147 | Bacteria | 3353 |
| 349 | Ga0114129_10194988 | 3300009147 | Bacteria | 2747 |
| 350 | Ga0114129_10238618 | 3300009147 | Bacteria | 2445 |
| 351 | Ga0114129_10501604 | 3300009147 | Bacteria | 1585 |
| 352 | Ga0114129_10671932 | 3300009147 | Bacteria | 1334 |
| 353 | Ga0114129_12012724 | 3300009147 | Bacteria | 698 |
| 354 | Ga0105243_10040926 | 3300009148 | Bacteria | 3622 |
| 355 | Ga0105243_10047350 | 3300009148 | Unclassified | 3384 |
| 356 | Ga0105243_10093402 | 3300009148 | Bacteria | 2483 |
| 357 | Ga0105243_10101031 | 3300009148 | Unclassified | 2394 |
| 358 | Ga0105243_10350613 | 3300009148 | Unclassified | 1355 |
| 359 | Ga0105243_11300264 | 3300009148 | Unclassified | 744 |
| 360 | Ga0105241_10002182 | 3300009174 | Bacteria | 14748 |
| 361 | Ga0105241_10008332 | 3300009174 | Bacteria | 7633 |
| 362 | Ga0105241_10063418 | 3300009174 | Bacteria | 2851 |
| 363 | Ga0105241_10083999 | 3300009174 | Bacteria | 2499 |
| 364 | Ga0105241_10270007 | 3300009174 | Bacteria | 1449 |
| 365 | Ga0105241_10317471 | 3300009174 | Unclassified | 1342 |
| 366 | Ga0105241_10322786 | 3300009174 | Unclassified | 1332 |
| 367 | Ga0105241_10424030 | 3300009174 | Unclassified | 1171 |
| 368 | Ga0105241_11174202 | 3300009174 | Bacteria | 726 |
| 369 | Ga0105242_10026565 | 3300009176 | Bacteria | 4589 |
| 370 | Ga0105242_10030637 | 3300009176 | Bacteria | 4296 |
| 371 | Ga0105242_10037460 | 3300009176 | Bacteria | 3896 |
| 372 | Ga0105242_10053301 | 3300009176 | Bacteria | 3302 |
| 373 | Ga0105242_10076849 | 3300009176 | Unclassified | 2784 |
| 374 | Ga0105242_10101331 | 3300009176 | Unclassified | 2440 |
| 375 | Ga0105242_10164366 | 3300009176 | Bacteria | 1945 |
| 376 | Ga0105242_10200063 | 3300009176 | Bacteria | 1774 |
| 377 | Ga0105242_10288403 | 3300009176 | Bacteria | 1493 |
| 378 | Ga0105242_10308967 | 3300009176 | Bacteria | 1446 |
| 379 | Ga0105242_10356654 | 3300009176 | Bacteria | 1352 |
| 380 | Ga0105242_11219366 | 3300009176 | Unclassified | 772 |
| 381 | Ga0105242_11636330 | 3300009176 | Bacteria | 678 |
| 382 | Ga0105242_12989164 | 3300009176 | Unclassified | 523 |
| 383 | Ga0105248_10001136 | 3300009177 | Bacteria | 29626 |
| 384 | Ga0105248_10009526 | 3300009177 | Bacteria | 10689 |
| 385 | Ga0105248_10035236 | 3300009177 | Bacteria | 5599 |
| 386 | Ga0105248_10044359 | 3300009177 | Bacteria | 4987 |
| 387 | Ga0105248_10058702 | 3300009177 | Bacteria | 4321 |
| 388 | Ga0105248_10060946 | 3300009177 | Bacteria | 4236 |
| 389 | Ga0105248_10075845 | 3300009177 | Bacteria | 3779 |
| 390 | Ga0105248_10131287 | 3300009177 | Bacteria | 2826 |
| 391 | Ga0105248_10136588 | 3300009177 | Unclassified | 2766 |
| 392 | Ga0105248_10195271 | 3300009177 | Bacteria | 2280 |
| 393 | Ga0105248_10539762 | 3300009177 | Unclassified | 1315 |
| 394 | Ga0105248_12353856 | 3300009177 | Unclassified | 607 |
| 395 | Ga0105237_10007273 | 3300009545 | Bacteria | 12148 |
| 396 | Ga0105237_10015088 | 3300009545 | Bacteria | 8051 |
| 397 | Ga0105237_10055577 | 3300009545 | Bacteria | 3964 |
| 398 | Ga0105237_10129760 | 3300009545 | Bacteria | 2515 |
| 399 | Ga0105237_10328776 | 3300009545 | Bacteria | 1533 |
| 400 | Ga0105237_10920298 | 3300009545 | Bacteria | 881 |
| 401 | Ga0105237_11386761 | 3300009545 | Unclassified | 709 |
| 402 | Ga0105238_10004033 | 3300009551 | Bacteria | 14566 |
| 403 | Ga0105238_10004718 | 3300009551 | Bacteria | 13477 |
| 404 | Ga0105238_10006871 | 3300009551 | Bacteria | 11364 |
| 405 | Ga0105238_10019996 | 3300009551 | Bacteria | 6815 |
| 406 | Ga0105238_10024610 | 3300009551 | Bacteria | 6136 |
| 407 | Ga0105238_10058613 | 3300009551 | Bacteria | 3859 |
| 408 | Ga0105238_10073691 | 3300009551 | Bacteria | 3408 |
| 409 | Ga0105238_10091602 | 3300009551 | Unclassified | 3027 |
| 410 | Ga0105238_10124692 | 3300009551 | Bacteria | 2555 |
| 411 | Ga0105238_10435315 | 3300009551 | Unclassified | 1307 |
| 412 | Ga0105238_11361924 | 3300009551 | Bacteria | 736 |
| 413 | Ga0105238_12139236 | 3300009551 | Unclassified | 594 |
| 414 | Ga0105238_12328458 | 3300009551 | Unclassified | 571 |
| 415 | Ga0105249_10012667 | 3300009553 | Bacteria | 7437 |
| 416 | Ga0105249_10031669 | 3300009553 | Bacteria | 4783 |
| 417 | Ga0105249_10324251 | 3300009553 | Unclassified | 1552 |
| 418 | Ga0105249_10580681 | 3300009553 | Bacteria | 1174 |
| 419 | Ga0105239_10001243 | 3300010375 | Bacteria | 34669 |
| 420 | Ga0105239_10003025 | 3300010375 | Bacteria | 20951 |
| 421 | Ga0105239_10028292 | 3300010375 | Bacteria | 6166 |
| 422 | Ga0105239_10079327 | 3300010375 | Bacteria | 3612 |
| 423 | Ga0105239_10126396 | 3300010375 | Unclassified | 2842 |
| 424 | Ga0105246_10031209 | 3300011119 | Bacteria | 3525 |
| 425 | Ga0105246_10042303 | 3300011119 | Bacteria | 3085 |
| 426 | Ga0105246_10106310 | 3300011119 | Unclassified | 2053 |
| 427 | Ga0105246_10397105 | 3300011119 | Bacteria | 1144 |
| 428 | Ga0105246_10803273 | 3300011119 | Unclassified | 835 |
| 429 | Ga0105246_11157640 | 3300011119 | Unclassified | 709 |
| 430 | Ga0157373_10460647 | 3300013100 | Unclassified | 916 |
| 431 | Ga0157373_11071205 | 3300013100 | Unclassified | 604 |
| 432 | Ga0157371_10071601 | 3300013102 | Unclassified | 2454 |
| 433 | Ga0157370_10002217 | 3300013104 | Bacteria | 23692 |
| 434 | Ga0157370_10005870 | 3300013104 | Bacteria | 13703 |
| 435 | Ga0157370_10105625 | 3300013104 | Unclassified | 2636 |
| 436 | Ga0157370_10109990 | 3300013104 | Bacteria | 2576 |
| 437 | Ga0157369_10000587 | 3300013105 | Bacteria | 47424 |
| 438 | Ga0157369_10002200 | 3300013105 | Bacteria | 23482 |
| 439 | Ga0157369_10002261 | 3300013105 | Bacteria | 23149 |
| 440 | Ga0157369_10018710 | 3300013105 | Bacteria | 7768 |
| 441 | Ga0157369_10019978 | 3300013105 | Bacteria | 7490 |
| 442 | Ga0157369_11407332 | 3300013105 | Unclassified | 710 |
| 443 | Ga0157369_11863655 | 3300013105 | Bacteria | 611 |
| 444 | Ga0157374_10072230 | 3300013296 | Bacteria | 3255 |
| 445 | Ga0157374_10131434 | 3300013296 | Bacteria | 2423 |
| 446 | Ga0157374_10143738 | 3300013296 | Bacteria | 2317 |
| 447 | Ga0157374_10160342 | 3300013296 | Bacteria | 2191 |
| 448 | Ga0157374_10305832 | 3300013296 | Unclassified | 1574 |
| 449 | Ga0157374_10329011 | 3300013296 | Unclassified | 1515 |
| 450 | Ga0157374_10523885 | 3300013296 | Bacteria | 1191 |
| 451 | Ga0157374_11026445 | 3300013296 | Bacteria | 844 |
| 452 | Ga0157374_11062381 | 3300013296 | Unclassified | 830 |
| 453 | Ga0157378_10002744 | 3300013297 | Bacteria | 15684 |
| 454 | Ga0157378_10039411 | 3300013297 | Bacteria | 4190 |
| 455 | Ga0157378_10171154 | 3300013297 | Unclassified | 2037 |
| 456 | Ga0157378_10390926 | 3300013297 | Bacteria | 1368 |
| 457 | Ga0157378_10478933 | 3300013297 | Unclassified | 1240 |
| 458 | Ga0163162_10100500 | 3300013306 | Bacteria | 2984 |
| 459 | Ga0163162_10232201 | 3300013306 | Bacteria | 1975 |
| 460 | Ga0163162_10300486 | 3300013306 | Bacteria | 1737 |
| 461 | Ga0163162_10709863 | 3300013306 | Bacteria | 1127 |
| 462 | Ga0163162_10855033 | 3300013306 | Bacteria | 1025 |
| 463 | Ga0163162_10941600 | 3300013306 | Bacteria | 975 |
| 464 | Ga0163162_11005129 | 3300013306 | Bacteria | 943 |
| 465 | Ga0163162_11009152 | 3300013306 | Bacteria | 941 |
| 466 | Ga0157372_10002038 | 3300013307 | Bacteria | 21977 |
| 467 | Ga0157372_10004925 | 3300013307 | Bacteria | 14182 |
| 468 | Ga0157372_10005878 | 3300013307 | Bacteria | 13059 |
| 469 | Ga0157372_10013921 | 3300013307 | Bacteria | 8595 |
| 470 | Ga0157372_10045750 | 3300013307 | Bacteria | 4857 |
| 471 | Ga0157372_10244737 | 3300013307 | Bacteria | 2081 |
| 472 | Ga0157372_10538713 | 3300013307 | Bacteria | 1361 |
| 473 | Ga0157372_10564689 | 3300013307 | Bacteria | 1326 |
| 474 | Ga0157372_11029688 | 3300013307 | Bacteria | 953 |
| 475 | Ga0157372_11344227 | 3300013307 | Bacteria | 824 |
| 476 | Ga0157372_11566352 | 3300013307 | Unclassified | 759 |
| 477 | Ga0157372_11993671 | 3300013307 | Unclassified | 667 |
| 478 | Ga0157375_10006905 | 3300013308 | Bacteria | 9904 |
| 479 | Ga0157375_10009069 | 3300013308 | Bacteria | 8709 |
| 480 | Ga0157375_10378248 | 3300013308 | Bacteria | 1583 |
| 481 | Ga0157375_10415787 | 3300013308 | Unclassified | 1511 |
| 482 | Ga0157375_11067099 | 3300013308 | Unclassified | 945 |
| 483 | Ga0157375_11094594 | 3300013308 | Unclassified | 933 |
| 484 | Ga0157375_12781087 | 3300013308 | Unclassified | 585 |
| 485 | Ga0163163_10074157 | 3300014325 | Bacteria | 3394 |
| 486 | Ga0163163_10511234 | 3300014325 | Unclassified | 1263 |
| 487 | Ga0163163_10887399 | 3300014325 | Bacteria | 955 |
| 488 | Ga0163163_10902915 | 3300014325 | Bacteria | 947 |
| 489 | Ga0163163_12126175 | 3300014325 | Unclassified | 621 |
| 490 | Ga0157380_10321750 | 3300014326 | Bacteria | 1434 |
| 491 | Ga0157380_10707130 | 3300014326 | Bacteria | 1013 |
| 492 | Ga0157377_10181095 | 3300014745 | Unclassified | 1325 |
| 493 | Ga0157377_10710806 | 3300014745 | Unclassified | 731 |
| 494 | Ga0157377_11014136 | 3300014745 | Bacteria | 629 |
| 495 | Ga0157379_10101709 | 3300014968 | Bacteria | 2579 |
| 496 | Ga0157379_10177756 | 3300014968 | Bacteria | 1922 |
| 497 | Ga0157379_10493696 | 3300014968 | Unclassified | 1134 |
| 498 | Ga0157379_11287278 | 3300014968 | Unclassified | 706 |
| 499 | Ga0157379_11528906 | 3300014968 | Unclassified | 650 |
| 500 | Ga0157376_10078263 | 3300014969 | Bacteria | 2831 |
| 501 | Ga0157376_10084034 | 3300014969 | Bacteria | 2740 |
| 502 | Ga0157376_10207703 | 3300014969 | Bacteria | 1806 |
| 503 | Ga0157376_10491033 | 3300014969 | Unclassified | 1205 |
| 504 | Ga0157376_10546365 | 3300014969 | Bacteria | 1146 |
| 505 | Ga0157376_10568711 | 3300014969 | Bacteria | 1124 |
| 506 | Ga0157376_10649166 | 3300014969 | Unclassified | 1055 |
| 507 | Ga0157376_11102676 | 3300014969 | Unclassified | 819 |
| 508 | Ga0157376_11172541 | 3300014969 | Unclassified | 796 |
| 509 | Ga0157376_13065828 | 3300014969 | Unclassified | 506 |
| 510 | Ga0197907_11355935 | 3300020069 | Bacteria | 943 |
| 511 | Ga0206356_10168128 | 3300020070 | Bacteria | 898 |
| 512 | Ga0206356_10818372 | 3300020070 | Unclassified | 3896 |
| 513 | Ga0206356_11703082 | 3300020070 | Bacteria | 1127 |
| 514 | Ga0206349_1030428 | 3300020075 | Bacteria | 1060 |
| 515 | Ga0206355_1125849 | 3300020076 | Unclassified | 1553 |
| 516 | Ga0206352_10309109 | 3300020078 | Unclassified | 1638 |
| 517 | Ga0206352_10548793 | 3300020078 | Bacteria | 888 |
| 518 | Ga0206352_10776619 | 3300020078 | Bacteria | 798 |
| 519 | Ga0206350_11578675 | 3300020080 | Bacteria | 2854 |
| 520 | Ga0213876_10020527 | 3300021384 | Bacteria | 3492 |
| 521 | Ga0213876_10130465 | 3300021384 | Bacteria | 1336 |
| 522 | Ga0213876_10415668 | 3300021384 | Bacteria | 715 |
| 523 | Ga0213876_10563666 | 3300021384 | Unclassified | 606 |
| 524 | Ga0213875_10038848 | 3300021388 | Bacteria | 2243 |
| 525 | Ga0213875_10176804 | 3300021388 | Unclassified | 1002 |
| 526 | Ga0224712_10059868 | 3300022467 | Unclassified | 1513 |
| 527 | Ga0224712_10067629 | 3300022467 | Bacteria | 1442 |
| 528 | Ga0207692_10093713 | 3300025898 | Bacteria | 1634 |
| 529 | Ga0207642_10080795 | 3300025899 | Bacteria | 1578 |
| 530 | Ga0207642_10179365 | 3300025899 | Bacteria | 1153 |
| 531 | Ga0207710_10145907 | 3300025900 | Bacteria | 1145 |
| 532 | Ga0207680_11082023 | 3300025903 | Unclassified | 573 |
| 533 | Ga0207647_10397384 | 3300025904 | Bacteria | 777 |
| 534 | Ga0207699_10374653 | 3300025906 | Bacteria | 1009 |
| 535 | Ga0207699_10662872 | 3300025906 | Bacteria | 763 |
| 536 | Ga0207645_10805318 | 3300025907 | Unclassified | 639 |
| 537 | Ga0207643_10244289 | 3300025908 | Bacteria | 1104 |
| 538 | Ga0207643_10708485 | 3300025908 | Unclassified | 651 |
| 539 | Ga0207684_10135846 | 3300025910 | Bacteria | 2112 |
| 540 | Ga0207684_10668597 | 3300025910 | Bacteria | 884 |
| 541 | Ga0207654_10003701 | 3300025911 | Bacteria | 7712 |
| 542 | Ga0207654_10003892 | 3300025911 | Bacteria | 7524 |
| 543 | Ga0207654_10058991 | 3300025911 | Bacteria | 2236 |
| 544 | Ga0207654_10474310 | 3300025911 | Unclassified | 880 |
| 545 | Ga0207654_10564980 | 3300025911 | Unclassified | 809 |
| 546 | Ga0207654_10694988 | 3300025911 | Bacteria | 730 |
| 547 | Ga0207707_10000567 | 3300025912 | Bacteria | 37470 |
| 548 | Ga0207707_10001348 | 3300025912 | Bacteria | 22873 |
| 549 | Ga0207707_10027488 | 3300025912 | Bacteria | 4974 |
| 550 | Ga0207707_10766644 | 3300025912 | Unclassified | 806 |
| 551 | Ga0207695_10001123 | 3300025913 | Bacteria | 46509 |
| 552 | Ga0207695_10003190 | 3300025913 | Bacteria | 23367 |
| 553 | Ga0207695_10003846 | 3300025913 | Bacteria | 20787 |
| 554 | Ga0207695_10004024 | 3300025913 | Bacteria | 20235 |
| 555 | Ga0207695_10282558 | 3300025913 | Bacteria | 1553 |
| 556 | Ga0207695_10502188 | 3300025913 | Bacteria | 1095 |
| 557 | Ga0207695_11134138 | 3300025913 | Unclassified | 662 |
| 558 | Ga0207671_10005457 | 3300025914 | Bacteria | 11704 |
| 559 | Ga0207671_10026432 | 3300025914 | Bacteria | 4350 |
| 560 | Ga0207671_10084887 | 3300025914 | Bacteria | 2378 |
| 561 | Ga0207671_10102078 | 3300025914 | Bacteria | 2174 |
| 562 | Ga0207671_10511608 | 3300025914 | Bacteria | 957 |
| 563 | Ga0207671_10879173 | 3300025914 | Unclassified | 709 |
| 564 | Ga0207693_10271319 | 3300025915 | Bacteria | 1329 |
| 565 | Ga0207693_10352669 | 3300025915 | Bacteria | 1151 |
| 566 | Ga0207693_11205580 | 3300025915 | Unclassified | 570 |
| 567 | Ga0207663_10109485 | 3300025916 | Unclassified | 1872 |
| 568 | Ga0207663_10123444 | 3300025916 | Bacteria | 1777 |
| 569 | Ga0207663_10125415 | 3300025916 | Bacteria | 1765 |
| 570 | Ga0207663_10229445 | 3300025916 | Bacteria | 1355 |
| 571 | Ga0207660_10108867 | 3300025917 | Bacteria | 2082 |
| 572 | Ga0207660_10295063 | 3300025917 | Unclassified | 1290 |
| 573 | Ga0207660_10701349 | 3300025917 | Bacteria | 826 |
| 574 | Ga0207662_10362349 | 3300025918 | Unclassified | 976 |
| 575 | Ga0207657_10029205 | 3300025919 | Bacteria | 5022 |
| 576 | Ga0207657_10146368 | 3300025919 | Bacteria | 1927 |
| 577 | Ga0207657_10187503 | 3300025919 | Bacteria | 1670 |
| 578 | Ga0207657_10537517 | 3300025919 | Unclassified | 914 |
| 579 | Ga0207649_10188180 | 3300025920 | Unclassified | 1450 |
| 580 | Ga0207649_10301855 | 3300025920 | Bacteria | 1171 |
| 581 | Ga0207649_10528774 | 3300025920 | Bacteria | 900 |
| 582 | Ga0207652_10005806 | 3300025921 | Bacteria | 10012 |
| 583 | Ga0207652_10005857 | 3300025921 | Bacteria | 9952 |
| 584 | Ga0207652_10820535 | 3300025921 | Bacteria | 825 |
| 585 | Ga0207646_10202872 | 3300025922 | Unclassified | 1791 |
| 586 | Ga0207681_10379183 | 3300025923 | Bacteria | 1138 |
| 587 | Ga0207694_10000348 | 3300025924 | Bacteria | 43729 |
| 588 | Ga0207694_10004755 | 3300025924 | Bacteria | 10558 |
| 589 | Ga0207694_10014781 | 3300025924 | Bacteria | 5886 |
| 590 | Ga0207694_10018587 | 3300025924 | Bacteria | 5253 |
| 591 | Ga0207694_10049373 | 3300025924 | Bacteria | 3257 |
| 592 | Ga0207694_10055615 | 3300025924 | Bacteria | 3072 |
| 593 | Ga0207694_10146613 | 3300025924 | Bacteria | 1900 |
| 594 | Ga0207694_10204227 | 3300025924 | Unclassified | 1608 |
| 595 | Ga0207694_10231687 | 3300025924 | Bacteria | 1508 |
| 596 | Ga0207694_10421512 | 3300025924 | Unclassified | 1112 |
| 597 | Ga0207694_10568588 | 3300025924 | Unclassified | 952 |
| 598 | Ga0207650_10002798 | 3300025925 | Bacteria | 12050 |
| 599 | Ga0207659_10052047 | 3300025926 | Bacteria | 2915 |
| 600 | Ga0207659_11132980 | 3300025926 | Unclassified | 673 |
| 601 | Ga0207687_10001518 | 3300025927 | Bacteria | 15899 |
| 602 | Ga0207687_10012048 | 3300025927 | Bacteria | 5654 |
| 603 | Ga0207687_10021052 | 3300025927 | Bacteria | 4329 |
| 604 | Ga0207687_10074857 | 3300025927 | Bacteria | 2428 |
| 605 | Ga0207687_10079534 | 3300025927 | Unclassified | 2364 |
| 606 | Ga0207687_10131692 | 3300025927 | Bacteria | 1886 |
| 607 | Ga0207687_10208461 | 3300025927 | Unclassified | 1532 |
| 608 | Ga0207687_10352074 | 3300025927 | Unclassified | 1200 |
| 609 | Ga0207687_10556617 | 3300025927 | Unclassified | 963 |
| 610 | Ga0207687_10630981 | 3300025927 | Unclassified | 905 |
| 611 | Ga0207687_10804075 | 3300025927 | Bacteria | 802 |
| 612 | Ga0207687_10897397 | 3300025927 | Unclassified | 758 |
| 613 | Ga0207700_10002286 | 3300025928 | Bacteria | 10997 |
| 614 | Ga0207700_10031655 | 3300025928 | Bacteria | 3761 |
| 615 | Ga0207700_10258819 | 3300025928 | Unclassified | 1489 |
| 616 | Ga0207700_10498069 | 3300025928 | Unclassified | 1078 |
| 617 | Ga0207700_10946578 | 3300025928 | Bacteria | 771 |
| 618 | Ga0207664_10009122 | 3300025929 | Bacteria | 6949 |
| 619 | Ga0207644_10087928 | 3300025931 | Bacteria | 2310 |
| 620 | Ga0207644_10287961 | 3300025931 | Bacteria | 1320 |
| 621 | Ga0207644_10344232 | 3300025931 | Bacteria | 1209 |
| 622 | Ga0207690_10412506 | 3300025932 | Bacteria | 1079 |
| 623 | Ga0207690_11359157 | 3300025932 | Bacteria | 594 |
| 624 | Ga0207706_10054048 | 3300025933 | Bacteria | 3545 |
| 625 | Ga0207706_10248102 | 3300025933 | Bacteria | 1555 |
| 626 | Ga0207686_10019473 | 3300025934 | Bacteria | 3862 |
| 627 | Ga0207686_10023523 | 3300025934 | Bacteria | 3560 |
| 628 | Ga0207686_10132550 | 3300025934 | Bacteria | 1711 |
| 629 | Ga0207686_10168514 | 3300025934 | Bacteria | 1542 |
| 630 | Ga0207686_10183296 | 3300025934 | Bacteria | 1486 |
| 631 | Ga0207686_10239290 | 3300025934 | Bacteria | 1320 |
| 632 | Ga0207686_10259708 | 3300025934 | Bacteria | 1273 |
| 633 | Ga0207686_10374615 | 3300025934 | Bacteria | 1078 |
| 634 | Ga0207686_10433819 | 3300025934 | Unclassified | 1007 |
| 635 | Ga0207709_10053822 | 3300025935 | Bacteria | 2478 |
| 636 | Ga0207709_10094757 | 3300025935 | Bacteria | 1960 |
| 637 | Ga0207709_10297930 | 3300025935 | Bacteria | 1198 |
| 638 | Ga0207670_10199926 | 3300025936 | Unclassified | 1518 |
| 639 | Ga0207670_10211989 | 3300025936 | Bacteria | 1478 |
| 640 | Ga0207670_10367965 | 3300025936 | Bacteria | 1142 |
| 641 | Ga0207670_10720009 | 3300025936 | Bacteria | 827 |
| 642 | Ga0207670_11243545 | 3300025936 | Bacteria | 631 |
| 643 | Ga0207704_10037607 | 3300025938 | Bacteria | 2797 |
| 644 | Ga0207704_10251783 | 3300025938 | Bacteria | 1326 |
| 645 | Ga0207704_10351509 | 3300025938 | Bacteria | 1148 |
| 646 | Ga0207691_10205192 | 3300025940 | Bacteria | 1714 |
| 647 | Ga0207691_10329532 | 3300025940 | Bacteria | 1308 |
| 648 | Ga0207711_10001511 | 3300025941 | Bacteria | 21627 |
| 649 | Ga0207711_10001890 | 3300025941 | Bacteria | 19067 |
| 650 | Ga0207711_10043970 | 3300025941 | Bacteria | 3811 |
| 651 | Ga0207711_10086763 | 3300025941 | Bacteria | 2745 |
| 652 | Ga0207711_10093497 | 3300025941 | Unclassified | 2648 |
| 653 | Ga0207711_10109516 | 3300025941 | Bacteria | 2454 |
| 654 | Ga0207711_10654084 | 3300025941 | Bacteria | 980 |
| 655 | Ga0207711_10663787 | 3300025941 | Bacteria | 973 |
| 656 | Ga0207711_11465092 | 3300025941 | Unclassified | 626 |
| 657 | Ga0207689_10049037 | 3300025942 | Bacteria | 3484 |
| 658 | Ga0207689_10065640 | 3300025942 | Unclassified | 2985 |
| 659 | Ga0207689_10065691 | 3300025942 | Bacteria | 2984 |
| 660 | Ga0207689_10096422 | 3300025942 | Unclassified | 2429 |
| 661 | Ga0207689_10437950 | 3300025942 | Unclassified | 1092 |
| 662 | Ga0207689_10781230 | 3300025942 | Bacteria | 806 |
| 663 | Ga0207661_10014829 | 3300025944 | Bacteria | 5716 |
| 664 | Ga0207661_10031659 | 3300025944 | Bacteria | 4089 |
| 665 | Ga0207661_10041592 | 3300025944 | Bacteria | 3618 |
| 666 | Ga0207661_10050076 | 3300025944 | Bacteria | 3326 |
| 667 | Ga0207661_10403053 | 3300025944 | Bacteria | 1240 |
| 668 | Ga0207661_10430732 | 3300025944 | Bacteria | 1199 |
| 669 | Ga0207661_10591179 | 3300025944 | Unclassified | 1018 |
| 670 | Ga0207661_11116501 | 3300025944 | Bacteria | 726 |
| 671 | Ga0207661_11784499 | 3300025944 | Unclassified | 561 |
| 672 | Ga0207679_10017649 | 3300025945 | Bacteria | 4764 |
| 673 | Ga0207679_10267919 | 3300025945 | Bacteria | 1459 |
| 674 | Ga0207679_10715460 | 3300025945 | Bacteria | 909 |
| 675 | Ga0207679_11483341 | 3300025945 | Unclassified | 622 |
| 676 | Ga0207667_10000369 | 3300025949 | Bacteria | 60858 |
| 677 | Ga0207667_10000558 | 3300025949 | Bacteria | 48930 |
| 678 | Ga0207667_10000650 | 3300025949 | Bacteria | 45011 |
| 679 | Ga0207667_10007172 | 3300025949 | Bacteria | 13445 |
| 680 | Ga0207667_10011270 | 3300025949 | Bacteria | 10399 |
| 681 | Ga0207667_10018492 | 3300025949 | Bacteria | 7812 |
| 682 | Ga0207667_10039858 | 3300025949 | Bacteria | 5003 |
| 683 | Ga0207651_10160381 | 3300025960 | Bacteria | 1762 |
| 684 | Ga0207651_10189757 | 3300025960 | Bacteria | 1638 |
| 685 | Ga0207651_10218859 | 3300025960 | Bacteria | 1538 |
| 686 | Ga0207712_10077811 | 3300025961 | Bacteria | 2405 |
| 687 | Ga0207712_10346299 | 3300025961 | Unclassified | 1234 |
| 688 | Ga0207712_10761583 | 3300025961 | Unclassified | 849 |
| 689 | Ga0207640_10052260 | 3300025981 | Unclassified | 2661 |
| 690 | Ga0207640_10345972 | 3300025981 | Bacteria | 1193 |
| 691 | Ga0207658_10128377 | 3300025986 | Bacteria | 2033 |
| 692 | Ga0207658_10596019 | 3300025986 | Unclassified | 992 |
| 693 | Ga0207658_10851838 | 3300025986 | Unclassified | 829 |
| 694 | Ga0207677_10080746 | 3300026023 | Bacteria | 2331 |
| 695 | Ga0207677_10270752 | 3300026023 | Unclassified | 1389 |
| 696 | Ga0207677_10677303 | 3300026023 | Bacteria | 913 |
| 697 | Ga0207677_10868001 | 3300026023 | Bacteria | 812 |
| 698 | Ga0207677_11098164 | 3300026023 | Bacteria | 725 |
| 699 | Ga0207677_11971555 | 3300026023 | Unclassified | 543 |
| 700 | Ga0207703_10014466 | 3300026035 | Bacteria | 6154 |
| 701 | Ga0207703_10028780 | 3300026035 | Bacteria | 4383 |
| 702 | Ga0207703_10055585 | 3300026035 | Bacteria | 3221 |
| 703 | Ga0207703_10057058 | 3300026035 | Bacteria | 3182 |
| 704 | Ga0207703_10109401 | 3300026035 | Bacteria | 2356 |
| 705 | Ga0207703_10175063 | 3300026035 | Bacteria | 1890 |
| 706 | Ga0207703_10326425 | 3300026035 | Bacteria | 1407 |
| 707 | Ga0207703_10513694 | 3300026035 | Bacteria | 1126 |
| 708 | Ga0207703_10697782 | 3300026035 | Bacteria | 965 |
| 709 | Ga0207703_11409507 | 3300026035 | Bacteria | 670 |
| 710 | Ga0207639_10045485 | 3300026041 | Bacteria | 3306 |
| 711 | Ga0207639_10065656 | 3300026041 | Bacteria | 2818 |
| 712 | Ga0207639_10081096 | 3300026041 | Bacteria | 2569 |
| 713 | Ga0207639_10359057 | 3300026041 | Unclassified | 1303 |
| 714 | Ga0207639_11030078 | 3300026041 | Unclassified | 771 |
| 715 | Ga0207678_10511371 | 3300026067 | Bacteria | 1047 |
| 716 | Ga0207708_10093698 | 3300026075 | Bacteria | 2318 |
| 717 | Ga0207708_10327234 | 3300026075 | Bacteria | 1252 |
| 718 | Ga0207702_10004880 | 3300026078 | Bacteria | 11806 |
| 719 | Ga0207702_10035528 | 3300026078 | Bacteria | 4168 |
| 720 | Ga0207702_10065231 | 3300026078 | Bacteria | 3118 |
| 721 | Ga0207702_10113785 | 3300026078 | Unclassified | 2411 |
| 722 | Ga0207702_10162764 | 3300026078 | Bacteria | 2039 |
| 723 | Ga0207702_10276589 | 3300026078 | Bacteria | 1585 |
| 724 | Ga0207702_10319199 | 3300026078 | Bacteria | 1479 |
| 725 | Ga0207702_10336993 | 3300026078 | Bacteria | 1440 |
| 726 | Ga0207702_10665704 | 3300026078 | Unclassified | 1024 |
| 727 | Ga0207702_11654122 | 3300026078 | Bacteria | 633 |
| 728 | Ga0207641_10142600 | 3300026088 | Bacteria | 2163 |
| 729 | Ga0207641_10214355 | 3300026088 | Bacteria | 1782 |
| 730 | Ga0207641_10766098 | 3300026088 | Bacteria | 953 |
| 731 | Ga0207648_10028077 | 3300026089 | Bacteria | 4991 |
| 732 | Ga0207648_10078214 | 3300026089 | Unclassified | 2885 |
| 733 | Ga0207648_10146964 | 3300026089 | Bacteria | 2079 |
| 734 | Ga0207648_10346583 | 3300026089 | Bacteria | 1338 |
| 735 | Ga0207648_10810684 | 3300026089 | Unclassified | 872 |
| 736 | Ga0207648_11599578 | 3300026089 | Unclassified | 612 |
| 737 | Ga0207676_10073593 | 3300026095 | Bacteria | 2750 |
| 738 | Ga0207676_10272942 | 3300026095 | Bacteria | 1532 |
| 739 | Ga0207676_10294026 | 3300026095 | Bacteria | 1480 |
| 740 | Ga0207676_10676505 | 3300026095 | Bacteria | 998 |
| 741 | Ga0207676_10819909 | 3300026095 | Bacteria | 909 |
| 742 | Ga0207676_11003727 | 3300026095 | Bacteria | 822 |
| 743 | Ga0207676_12290727 | 3300026095 | Unclassified | 538 |
| 744 | Ga0207674_10000063 | 3300026116 | Bacteria | 110904 |
| 745 | Ga0207674_10000484 | 3300026116 | Bacteria | 52530 |
| 746 | Ga0207674_10000657 | 3300026116 | Bacteria | 44932 |
| 747 | Ga0207674_10003310 | 3300026116 | Bacteria | 19811 |
| 748 | Ga0207674_10124070 | 3300026116 | Unclassified | 2548 |
| 749 | Ga0207674_10787924 | 3300026116 | Bacteria | 917 |
| 750 | Ga0207675_100047384 | 3300026118 | Bacteria | 4013 |
| 751 | Ga0207675_100485099 | 3300026118 | Unclassified | 1229 |
| 752 | Ga0207675_100752740 | 3300026118 | Bacteria | 986 |
| 753 | Ga0207675_100852951 | 3300026118 | Bacteria | 926 |
| 754 | Ga0207683_10025344 | 3300026121 | Bacteria | 5116 |
| 755 | Ga0207683_10357236 | 3300026121 | Bacteria | 1342 |
| 756 | Ga0207698_10005842 | 3300026142 | Bacteria | 7644 |
| 757 | Ga0207698_10090092 | 3300026142 | Bacteria | 2508 |
| 758 | Ga0207698_10244801 | 3300026142 | Bacteria | 1637 |
| 759 | Ga0207698_10366235 | 3300026142 | Bacteria | 1367 |
| 760 | Ga0207698_10488128 | 3300026142 | Bacteria | 1196 |
| 761 | Ga0207698_10670886 | 3300026142 | Bacteria | 1029 |
| 762 | Ga0207698_12130543 | 3300026142 | Unclassified | 574 |
| 763 | Ga0209588_1006477 | 3300027671 | Bacteria | 3404 |
| 764 | Ga0209966_1072022 | 3300027695 | Unclassified | 758 |
| 765 | Ga0207428_10025949 | 3300027907 | Bacteria | 4896 |
| 766 | Ga0207428_10238530 | 3300027907 | Bacteria | 1359 |
| 767 | Ga0268265_10864170 | 3300028380 | Bacteria | 886 |
| 768 | Ga0268264_10326260 | 3300028381 | Unclassified | 1453 |
| 769 | Ga0268264_10417623 | 3300028381 | Bacteria | 1293 |
| 770 | Ga0268264_11597463 | 3300028381 | Bacteria | 663 |
| 771 | Ga0268264_12028518 | 3300028381 | Unclassified | 584 |
| 772 | Ga0265775_100924 | 3300030762 | Bacteria | 1309 |
| 773 | Ga0265760_10200186 | 3300031090 | Bacteria | 674 |
| 774 | Ga0265340_10022406 | 3300031247 | Bacteria | 3230 |
| 775 | Ga0265313_10000978 | 3300031595 | Bacteria | 28254 |
| 776 | Ga0265314_10000542 | 3300031711 | Bacteria | 48535 |
| 777 | Ga0373948_0023841 | 3300034817 | Bacteria | 1190 |
| 778 | Ga0373958_0034319 | 3300034819 | Bacteria | 1010 |
| 779 | Ga0373926_0130802 | 3300035083 | Unclassified | 950 |
| 780 | Ga0373934_0003315 | 3300035086 | Bacteria | 5894 |
| 781 | Ga0373934_0006789 | 3300035086 | Bacteria | 4250 |
| 782 | Ga0373934_0085935 | 3300035086 | Bacteria | 1266 |
| 783 | Ga0373944_0152108 | 3300035089 | Unclassified | 816 |
| 784 | Ga0373944_0279496 | 3300035089 | Bacteria | 622 |
| 785 | Ga0373952_0063560 | 3300035092 | Bacteria | 908 |
| 786 | Ga0373923_0025983 | 3300035111 | Bacteria | 2326 |
| 787 | Ga0373923_0146238 | 3300035111 | Bacteria | 1071 |
| 788 | Ga0373936_0180639 | 3300035113 | Bacteria | 925 |
| 789 | Ga0373936_0321744 | 3300035113 | Bacteria | 701 |
| 790 | Ga0373941_0130307 | 3300035115 | Unclassified | 905 |
| 791 | Ga0373953_0053002 | 3300035117 | Bacteria | 1643 |
| 792 | Ga0373954_0008545 | 3300035118 | Bacteria | 4498 |
| 793 | Ga0373954_0015875 | 3300035118 | Bacteria | 3368 |
| 794 | Ga0373954_0026343 | 3300035118 | Bacteria | 2665 |
| 795 | Ga0373954_0041987 | 3300035118 | Bacteria | 2133 |
| 796 | Ga0373954_0076499 | 3300035118 | Bacteria | 1595 |
| 797 | Ga0373954_0559389 | 3300035118 | Unclassified | 567 |
| 798 | Ga0373954_0606001 | 3300035118 | Bacteria | 543 |
| 799 | Ga0373956_0135504 | 3300035119 | Bacteria | 1155 |
| 800 | Ga0373956_0246130 | 3300035119 | Bacteria | 850 |
| 801 | Ga0373943_0163907 | 3300035170 | Bacteria | 1212 |
| 802 | Ga0373946_0285159 | 3300035171 | Unclassified | 813 |
| 803 | Ga0373955_0004305 | 3300035172 | Bacteria | 6289 |
| 804 | Ga0373955_0022020 | 3300035172 | Bacteria | 3226 |
| 805 | Ga0373955_0033572 | 3300035172 | Bacteria | 2703 |
| 806 | Ga0373955_0170191 | 3300035172 | Bacteria | 1289 |
| 807 | Ga0373955_0340296 | 3300035172 | Bacteria | 908 |
| 808 | Ga0373961_0050496 | 3300035241 | Bacteria | 1232 |
| 809 | Ga0373924_0034070 | 3300035410 | Bacteria | 2060 |
| 810 | Ga0373924_0069773 | 3300035410 | Bacteria | 1481 |
| 811 | Ga0373931_0059241 | 3300035691 | Bacteria | 2059 |
| 812 | Ga0373931_1213679 | 3300035691 | Unclassified | 517 |
| 813 | Ga0373935_0094008 | 3300035692 | Bacteria | 1967 |
| 814 | Ga0373935_0096540 | 3300035692 | Bacteria | 1943 |
| 815 | Ga0373935_0108233 | 3300035692 | Bacteria | 1841 |
| 816 | Ga0373935_0173147 | 3300035692 | Bacteria | 1478 |
| 817 | Ga0373935_0217397 | 3300035692 | Bacteria | 1326 |
| 818 | Ga0373927_0003526 | 3300035695 | Bacteria | 11197 |
| 819 | Ga0373927_0048222 | 3300035695 | Unclassified | 2755 |
| 820 | Ga0373927_0087005 | 3300035695 | Bacteria | 2029 |
| 821 | Ga0373927_0240847 | 3300035695 | Unclassified | 1189 |
| 822 | Ga0373927_0317964 | 3300035695 | Bacteria | 1025 |
| 823 | Ga0373933_0022280 | 3300035724 | Bacteria | 3606 |
| 824 | Ga0373933_0144416 | 3300035724 | Unclassified | 1504 |
| 825 | Ga0373933_0185102 | 3300035724 | Bacteria | 1329 |
| 826 | Ga0373933_0236110 | 3300035724 | Bacteria | 1175 |
| 827 | Ga0373933_0314482 | 3300035724 | Unclassified | 1015 |
| 828 | Ga0373933_0876253 | 3300035724 | Bacteria | 591 |
| 829 | Ga0373947_0000466 | 3300035725 | Bacteria | 23099 |
| 830 | Ga0373947_0108943 | 3300035725 | Bacteria | 1748 |
| 831 | Ga0373947_0239105 | 3300035725 | Unclassified | 1198 |
| 832 | Ga0373947_0375590 | 3300035725 | Bacteria | 956 |
| 833 | Ga0373937_0002529 | 3300036401 | Bacteria | 15180 |
| 834 | Ga0373937_0009057 | 3300036401 | Bacteria | 8639 |
| 835 | Ga0373937_0017813 | 3300036401 | Bacteria | 6338 |
| 836 | Ga0373937_0037647 | 3300036401 | Bacteria | 4408 |
| 837 | Ga0373937_0121986 | 3300036401 | Bacteria | 2429 |
| 838 | Ga0373937_0151304 | 3300036401 | Unclassified | 2174 |
| 839 | Ga0373937_0252277 | 3300036401 | Unclassified | 1663 |
| 840 | Ga0373937_0450507 | 3300036401 | Unclassified | 1222 |
| 841 | Ga0373937_0528735 | 3300036401 | Unclassified | 1120 |
| 842 | Ga0373925_0001318 | 3300037068 | Bacteria | 21737 |
| 843 | Ga0373925_0462200 | 3300037068 | Bacteria | 1040 |
| 844 | Ga0373925_0509357 | 3300037068 | Bacteria | 988 |
| 845 | Ga0395900_1670412 | 3300037418 | Unclassified | 548 |
| 846 | Ga0436364_0014045 | 3300037853 | Bacteria | 3934 |
| 847 | Ga0436364_0112772 | 3300037853 | Bacteria | 6952 |
| 848 | Ga0436364_0888227 | 3300037853 | Bacteria | 543 |
| 849 | Ga0436365_0792504 | 3300039437 | Bacteria | 1592 |
| 850 | Ga0436365_1210156 | 3300039437 | Unclassified | 1207 |
| 851 | Ga0436365_1620093 | 3300039437 | Bacteria | 2567 |
| 852 | Ga0436365_1776261 | 3300039437 | Bacteria | 1758 |
| 853 | Ga0436362_1071320 | 3300039453 | Bacteria | 3026 |
| 854 | Ga0439460_0073772 | 3300042461 | Bacteria | 1061 |
| 855 | Ga0453683_0308974 | 3300044673 | Unclassified | 1012 |
| 856 | Ga0453683_0484205 | 3300044673 | Unclassified | 802 |
| 857 | Ga0453684_1054812 | 3300044712 | Unclassified | 861 |
| 858 | Ga0453684_1425785 | 3300044712 | Unclassified | 717 |
| 859 | Ga0451576_0022151 | 3300045051 | Bacteria | 6894 |
| 860 | Ga0451576_0068440 | 3300045051 | Bacteria | 3694 |
| 861 | Ga0451576_0109274 | 3300045051 | Bacteria | 2877 |
| 862 | Ga0451576_0132970 | 3300045051 | Bacteria | 2593 |
| 863 | Ga0451576_0445353 | 3300045051 | Bacteria | 1359 |
| 864 | Ga0495592_0029498 | 3300046454 | Bacteria | 4154 |
| 865 | Ga0495603_0221726 | 3300046455 | Bacteria | 1091 |
| 866 | Ga0495651_0056024 | 3300046462 | Bacteria | 3028 |
| 867 | Ga0495651_0254712 | 3300046462 | Bacteria | 1197 |
| 868 | Ga0495651_0525238 | 3300046462 | Bacteria | 755 |
| 869 | Ga0495580_0051798 | 3300046472 | Unclassified | 2901 |
| 870 | Ga0495580_0126601 | 3300046472 | Bacteria | 1773 |
| 871 | Ga0495580_0215870 | 3300046472 | Bacteria | 1319 |
| 872 | Ga0495582_0009156 | 3300046473 | Bacteria | 5462 |
| 873 | Ga0495584_0069478 | 3300046491 | Bacteria | 1770 |
| 874 | Ga0495594_0360331 | 3300046499 | Bacteria | 828 |
| 875 | Ga0495594_0417051 | 3300046499 | Unclassified | 764 |
| 876 | Ga0495628_0327363 | 3300046516 | Bacteria | 1130 |
| 877 | Ga0495628_0371286 | 3300046516 | Bacteria | 1049 |
| 878 | Ga0495630_0407759 | 3300046517 | Unclassified | 1041 |
| 879 | Ga0495630_0808049 | 3300046517 | Bacteria | 716 |
| 880 | Ga0495630_1130738 | 3300046517 | Unclassified | 593 |
| 881 | Ga0495663_0144644 | 3300046525 | Bacteria | 808 |
| 882 | Ga0495666_0128649 | 3300046526 | Bacteria | 1184 |
| 883 | Ga0495652_0063982 | 3300046529 | Bacteria | 3096 |
| 884 | Ga0495652_0155725 | 3300046529 | Bacteria | 1780 |
| 885 | Ga0495652_0239338 | 3300046529 | Unclassified | 1352 |
| 886 | Ga0495652_0387089 | 3300046529 | Bacteria | 993 |
| 887 | Ga0495652_0462545 | 3300046529 | Bacteria | 886 |
| 888 | Ga0495665_0038934 | 3300046531 | Bacteria | 2534 |
| 889 | Ga0495665_0558912 | 3300046531 | Unclassified | 574 |
| 890 | Ga0495587_0000822 | 3300046536 | Bacteria | 20574 |
| 891 | Ga0495587_0003986 | 3300046536 | Bacteria | 9787 |
| 892 | Ga0495587_0262822 | 3300046536 | Bacteria | 969 |
| 893 | Ga0495621_0081672 | 3300046539 | Bacteria | 1206 |
| 894 | Ga0495645_0106650 | 3300046543 | Bacteria | 1987 |
| 895 | Ga0495645_0661058 | 3300046543 | Bacteria | 637 |
| 896 | Ga0495667_0090237 | 3300046559 | Bacteria | 1986 |
| 897 | Ga0495667_0455408 | 3300046559 | Bacteria | 804 |
| 898 | Ga0495667_1030466 | 3300046559 | Unclassified | 501 |
| 899 | Ga0495656_0684306 | 3300046615 | Unclassified | 551 |
| 900 | Ga0495668_0239833 | 3300046616 | Bacteria | 993 |
| 901 | Ga0495634_0029752 | 3300046642 | Bacteria | 3780 |
| 902 | Ga0495634_0404099 | 3300046642 | Bacteria | 811 |
| 903 | Ga0495635_0260042 | 3300046663 | Unclassified | 1169 |
| 904 | Ga0495635_1098413 | 3300046663 | Bacteria | 503 |
| 905 | Ga0495659_0063027 | 3300046664 | Unclassified | 1373 |
| 906 | Ga0495659_0084306 | 3300046664 | Bacteria | 1211 |
| 907 | Ga0495599_0011458 | 3300046678 | Bacteria | 5448 |
| 908 | Ga0495599_0021022 | 3300046678 | Bacteria | 4069 |
| 909 | Ga0495599_0149864 | 3300046678 | Bacteria | 1445 |
| 910 | Ga0495599_0222482 | 3300046678 | Bacteria | 1154 |
| 911 | Ga0495599_0401531 | 3300046678 | Unclassified | 816 |
| 912 | Ga0495599_0681168 | 3300046678 | Unclassified | 594 |
| 913 | Ga0495623_0204731 | 3300046679 | Bacteria | 1133 |
| 914 | Ga0495658_0007879 | 3300046683 | Bacteria | 5274 |
| 915 | Ga0495658_0056030 | 3300046683 | Bacteria | 2247 |
| 916 | Ga0495669_0015225 | 3300046684 | Bacteria | 3293 |
| 917 | Ga0495669_0073447 | 3300046684 | Unclassified | 1562 |
| 918 | Ga0495669_0302325 | 3300046684 | Unclassified | 771 |
| 919 | Ga0495613_0143161 | 3300046689 | Bacteria | 1707 |
| 920 | Ga0495589_0255161 | 3300046794 | Bacteria | 819 |
| 921 | Ga0495600_0844692 | 3300046809 | Bacteria | 543 |
| 922 | Ga0495604_0627625 | 3300047317 | Bacteria | 687 |
| 923 | Ga0495674_0139931 | 3300047319 | Bacteria | 2035 |
| 924 | Ga0495674_0169578 | 3300047319 | Bacteria | 1822 |
| 925 | Ga0495674_0514904 | 3300047319 | Bacteria | 956 |
| 926 | Ga0495680_0054934 | 3300047322 | Bacteria | 3090 |
| 927 | Ga0495680_0092088 | 3300047322 | Bacteria | 2272 |
| 928 | Ga0495680_0879924 | 3300047322 | Bacteria | 580 |
| 929 | Ga0495675_0092652 | 3300047444 | Unclassified | 1896 |
| 930 | Ga0495675_0174387 | 3300047444 | Bacteria | 1319 |
| 931 | Ga0495685_072958 | 3300047447 | Bacteria | 1148 |
| 932 | Ga0495684_0006795 | 3300047471 | Bacteria | 8883 |
| 933 | Ga0495684_0103544 | 3300047471 | Bacteria | 2151 |
| 934 | Ga0495684_0463344 | 3300047471 | Bacteria | 878 |
| 935 | Ga0495602_0001193 | 3300048088 | Bacteria | 25517 |
| 936 | Ga0495602_0005450 | 3300048088 | Bacteria | 13344 |
| 937 | Ga0495602_0195182 | 3300048088 | Bacteria | 1549 |
| 938 | Ga0496102_0225926 | 3300048905 | Bacteria | 1765 |
| 939 | Ga0496102_1166034 | 3300048905 | Unclassified | 690 |
| 940 | Ga0496104_0050189 | 3300048907 | Bacteria | 3937 |
| 941 | Ga0496104_1393341 | 3300048907 | Unclassified | 604 |
| 942 | Ga0496106_0632654 | 3300048909 | Unclassified | 856 |
| 943 | Ga0496106_1361946 | 3300048909 | Unclassified | 549 |
| 944 | Ga0496112_0189988 | 3300048915 | Unclassified | 2016 |
| 945 | Ga0496112_0450444 | 3300048915 | Unclassified | 1225 |
| 946 | Ga0496115_0096149 | 3300048918 | Bacteria | 2425 |
| 947 | Ga0496115_0139999 | 3300048918 | Unclassified | 1996 |
| 948 | Ga0501068_0213450 | 3300049584 | Bacteria | 1226 |
| 949 | Ga0501068_0426946 | 3300049584 | Bacteria | 856 |
| 950 | nmdc:mga05p37_133348_c1 | 3300050507 | Bacteria | 3047 |
| 951 | nmdc:mga05p37_1387951_c1 | 3300050507 | Bacteria | 709 |
| 952 | nmdc:mga05p37_247851_c1 | 3300050507 | Bacteria | 2138 |
| 953 | nmdc:mga05p37_3548_c1 | 3300050507 | Bacteria | 18214 |
| 954 | nmdc:mga05p37_397445_c1 | 3300050507 | Unclassified | 1610 |
| 955 | nmdc:mga05p37_42105_c1 | 3300050507 | Bacteria | 5610 |
| 956 | nmdc:mga05p37_6452_c1 | 3300050507 | Bacteria | 13832 |
| 957 | nmdc:mga05p37_806414_c1 | 3300050507 | Bacteria | 1026 |
| 958 | nmdc:mga09592_100417_c1 | 3300050508 | Bacteria | 2478 |
| 959 | nmdc:mga09592_177256_c1 | 3300050508 | Unclassified | 1843 |
| 960 | nmdc:mga09592_221852_c1 | 3300050508 | Bacteria | 1638 |
| 961 | nmdc:mga09592_62029_c1 | 3300050508 | Bacteria | 3162 |
| 962 | nmdc:mga0qj67_1362922_c1 | 3300050509 | Unclassified | 548 |
| 963 | nmdc:mga0qj67_33462_c1 | 3300050509 | Bacteria | 4011 |
| 964 | nmdc:mga0qj67_64353_c1 | 3300050509 | Unclassified | 2917 |
| 965 | nmdc:mga06r32_176545_c1 | 3300050510 | Bacteria | 2121 |
| 966 | nmdc:mga06r32_34297_c1 | 3300050510 | Bacteria | 4785 |
| 967 | nmdc:mga08y16_11227_c1 | 3300050511 | Bacteria | 5190 |
| 968 | nmdc:mga08y16_124852_c1 | 3300050511 | Bacteria | 2678 |
| 969 | nmdc:mga08y16_474497_c1 | 3300050511 | Bacteria | 1273 |
| 970 | nmdc:mga08y16_57615_c1 | 3300050511 | Unclassified | 4059 |
| 971 | nmdc:mga0n895_1044046_c1 | 3300050512 | Bacteria | 797 |
| 972 | nmdc:mga0n895_125075_c1 | 3300050512 | Bacteria | 2595 |
| 973 | nmdc:mga0n895_1789829_c1 | 3300050512 | Unclassified | 575 |
| 974 | nmdc:mga0n895_245025_c1 | 3300050512 | Bacteria | 1819 |
| 975 | nmdc:mga0n895_426840_c1 | 3300050512 | Bacteria | 1340 |
| 976 | nmdc:mga0n895_67697_c1 | 3300050512 | Bacteria | 3537 |
| 977 | nmdc:mga0rr50_111966_c1 | 3300050513 | Unclassified | 2161 |
| 978 | nmdc:mga0rr50_1441112_c1 | 3300050513 | Bacteria | 583 |
| 979 | nmdc:mga0rr50_297420_c1 | 3300050513 | Bacteria | 1350 |
| 980 | nmdc:mga0rr50_305194_c1 | 3300050513 | Bacteria | 1332 |
| 981 | nmdc:mga0rr50_355252_c1 | 3300050513 | Unclassified | 1233 |
| 982 | nmdc:mga0rr50_392245_c1 | 3300050513 | Bacteria | 1172 |
| 983 | nmdc:mga0rr50_571795_c1 | 3300050513 | Unclassified | 963 |
| 984 | nmdc:mga08x19_310532_c1 | 3300050514 | Bacteria | 1096 |
| 985 | nmdc:mga08x19_65897_c1 | 3300050514 | Unclassified | 2353 |
| 986 | nmdc:mga08x19_740232_c1 | 3300050514 | Unclassified | 698 |
| 987 | nmdc:mga08x19_846108_c1 | 3300050514 | Bacteria | 650 |
| 988 | nmdc:mga0a205_137502_c1 | 3300050515 | Bacteria | 2344 |
| 989 | nmdc:mga0a205_41720_c1 | 3300050515 | Bacteria | 4420 |
| 990 | nmdc:mga0a205_59469_c1 | 3300050515 | Bacteria | 3691 |
| 991 | nmdc:mga0a205_918980_c1 | 3300050515 | Bacteria | 722 |
| 992 | Ga0495601_0084418 | 3300053077 | Bacteria | 2040 |
| 993 | Ga0495601_0127154 | 3300053077 | Bacteria | 1658 |
| 994 | Ga0495601_0721779 | 3300053077 | Unclassified | 635 |
| 995 | Ga0495619_0254983 | 3300053085 | Bacteria | 1216 |
| 996 | Ga0373934_0324687 | |||
| 997 | SwRhRL2b_contig_134348 | |||
| 998 | Ga0058859_11726138 | |||
| 999 | Ga0058861_11567625 | |||
| 1000 | Ga0058861_11666670 | |||
| 1001 | Ga0058860_10032041 | |||
| 1002 | Ga0058860_11730977 | |||
| 1003 | Ga0058862_10653920 | |||
| 1004 | Ga0058862_11764429 | |||
| 1005 | Ga0065715_10305037 | |||
| 1006 | Ga0065715_10534290 | |||
| 1007 | Ga0065707_10317247 | |||
| 1008 | Ga0070658_10312755 | |||
| 1009 | Ga0070676_10073436 | |||
| 1010 | Ga0070676_10498912 | |||
| 1011 | Ga0070676_10883578 | |||
| 1012 | Ga0070683_100000668 | |||
| 1013 | Ga0070683_100001579 | |||
| 1014 | Ga0070683_100008117 | |||
| 1015 | Ga0070683_100063533 | |||
| 1016 | Ga0070683_100087057 | |||
| 1017 | Ga0070683_100279454 | |||
| 1018 | Ga0070683_100321022 | |||
| 1019 | Ga0070683_100329826 | |||
| 1020 | Ga0070683_100337545 | |||
| 1021 | Ga0070690_100371840 | |||
| 1022 | Ga0070690_100412354 | |||
| 1023 | Ga0070690_100537270 | |||
| 1024 | Ga0070670_100009951 | |||
| 1025 | Ga0070677_10864044 | |||
| 1026 | Ga0068869_100019204 | |||
| 1027 | Ga0068869_100100713 | |||
| 1028 | Ga0068869_100209394 | |||
| 1029 | Ga0068869_100622670 | |||
| 1030 | Ga0068869_100690063 | |||
| 1031 | Ga0070666_10033122 | |||
| 1032 | Ga0070666_10053354 | |||
| 1033 | Ga0070680_100003994 | |||
| 1034 | Ga0070680_100029305 | |||
| 1035 | Ga0070680_100055725 | |||
| 1036 | Ga0070680_100473811 | |||
| 1037 | Ga0070682_100856609 | |||
| 1038 | Ga0068868_100117999 | |||
| 1039 | Ga0068868_100162368 | |||
| 1040 | Ga0068868_100232182 | |||
| 1041 | Ga0068868_100250425 | |||
| 1042 | Ga0068868_100520535 | |||
| 1043 | Ga0068868_101373881 | |||
| 1044 | Ga0068868_101392153 | |||
| 1045 | Ga0070660_100089115 | |||
| 1046 | Ga0070660_100188248 | |||
| 1047 | Ga0070660_100199036 | |||
| 1048 | Ga0070689_100080626 | |||
| 1049 | Ga0070689_100430874 | |||
| 1050 | Ga0070689_100597324 | |||
| 1051 | Ga0070689_101453603 | |||
| 1052 | Ga0070691_10000648 | |||
| 1053 | Ga0070691_10006127 | |||
| 1054 | Ga0070691_10042747 | |||
| 1055 | Ga0070691_10139770 | |||
| 1056 | Ga0070691_10303338 | |||
| 1057 | Ga0070687_100010260 | |||
| 1058 | Ga0070661_100074809 | |||
| 1059 | Ga0070661_100336248 | |||
| 1060 | Ga0070661_100761920 | |||
| 1061 | Ga0070661_101478756 | |||
| 1062 | Ga0070661_101736702 | |||
| 1063 | Ga0070692_10121231 | |||
| 1064 | Ga0070669_100814346 | |||
| 1065 | Ga0070669_101104529 | |||
| 1066 | Ga0070675_100016777 | |||
| 1067 | Ga0070671_100016939 | |||
| 1068 | Ga0070671_100072322 | |||
| 1069 | Ga0070671_100109669 | |||
| 1070 | Ga0070671_100226470 | |||
| 1071 | Ga0070671_100809569 | |||
| 1072 | Ga0070673_100086982 | |||
| 1073 | Ga0070673_100108115 | |||
| 1074 | Ga0070673_100194967 | |||
| 1075 | Ga0070673_100823822 | |||
| 1076 | Ga0070688_100035067 | |||
| 1077 | Ga0070659_100008560 | |||
| 1078 | Ga0070667_100348286 | |||
| 1079 | Ga0070667_101006357 | |||
| 1080 | Ga0070667_101268745 | |||
| 1081 | Ga0070709_10087832 | |||
| 1082 | Ga0070709_10176559 | |||
| 1083 | Ga0070709_10814180 | |||
| 1084 | Ga0070709_11132039 | |||
| 1085 | Ga0070714_100017969 | |||
| 1086 | Ga0070714_100441597 | |||
| 1087 | Ga0070714_100891615 | |||
| 1088 | Ga0070713_100008512 | |||
| 1089 | Ga0070713_100032629 | |||
| 1090 | Ga0070713_100163389 | |||
| 1091 | Ga0070713_101051922 | |||
| 1092 | Ga0070710_10067712 | |||
| 1093 | Ga0070710_10253919 | |||
| 1094 | Ga0070710_10389933 | |||
| 1095 | Ga0070701_10435657 | |||
| 1096 | Ga0070701_10530382 | |||
| 1097 | Ga0070711_100046386 | |||
| 1098 | Ga0070711_100051884 | |||
| 1099 | Ga0070711_100070201 | |||
| 1100 | Ga0070711_100156478 | |||
| 1101 | Ga0070705_100003820 | |||
| 1102 | Ga0070705_100065347 | |||
| 1103 | Ga0070705_100622466 | |||
| 1104 | Ga0070705_101075757 | |||
| 1105 | Ga0070700_100363289 | |||
| 1106 | Ga0070694_100004969 | |||
| 1107 | Ga0070694_100088746 | |||
| 1108 | Ga0070694_100760698 | |||
| 1109 | Ga0070708_100398408 | |||
| 1110 | Ga0070708_100472641 | |||
| 1111 | Ga0070708_101472567 | |||
| 1112 | Ga0070663_100308876 | |||
| 1113 | Ga0070662_100036690 | |||
| 1114 | Ga0070662_100228634 | |||
| 1115 | Ga0070681_10000972 | |||
| 1116 | Ga0070681_10003753 | |||
| 1117 | Ga0070681_10163166 | |||
| 1118 | Ga0070681_10584258 | |||
| 1119 | Ga0070681_10893346 | |||
| 1120 | Ga0070681_11885596 | |||
| 1121 | Ga0068867_100065175 | |||
| 1122 | Ga0068867_100106173 | |||
| 1123 | Ga0068867_100112351 | |||
| 1124 | Ga0068867_100165064 | |||
| 1125 | Ga0068867_100192275 | |||
| 1126 | Ga0068867_100413397 | |||
| 1127 | Ga0070685_10398812 | |||
| 1128 | Ga0070706_100198957 | |||
| 1129 | Ga0070707_100126988 | |||
| 1130 | Ga0070698_100944871 | |||
| 1131 | Ga0070699_100037311 | |||
| 1132 | Ga0070699_100712427 | |||
| 1133 | Ga0070679_100003226 | |||
| 1134 | Ga0070679_100009655 | |||
| 1135 | Ga0070679_100323306 | |||
| 1136 | Ga0070679_100551693 | |||
| 1137 | Ga0070684_100001842 | |||
| 1138 | Ga0070684_100002448 | |||
| 1139 | Ga0070684_100011967 | |||
| 1140 | Ga0070684_100015801 | |||
| 1141 | Ga0070684_100018492 | |||
| 1142 | Ga0070684_100044151 | |||
| 1143 | Ga0070684_100555523 | |||
| 1144 | Ga0070684_100742879 | |||
| 1145 | Ga0070684_101045404 | |||
| 1146 | Ga0070684_101144110 | |||
| 1147 | Ga0070697_100191917 | |||
| 1148 | Ga0070697_100238255 | |||
| 1149 | Ga0070697_100280027 | |||
| 1150 | Ga0070697_100348621 | |||
| 1151 | Ga0068853_100137042 | |||
| 1152 | Ga0068853_100172915 | |||
| 1153 | Ga0068853_100174914 | |||
| 1154 | Ga0068853_101023023 | |||
| 1155 | Ga0070672_100343960 | |||
| 1156 | Ga0070672_101227356 | |||
| 1157 | Ga0070686_100726872 | |||
| 1158 | Ga0070695_100005568 | |||
| 1159 | Ga0070695_100062434 | |||
| 1160 | Ga0070695_100184223 | |||
| 1161 | Ga0070695_100552728 | |||
| 1162 | Ga0070696_100003974 | |||
| 1163 | Ga0070696_100110820 | |||
| 1164 | Ga0070696_100982591 | |||
| 1165 | Ga0070696_101129748 | |||
| 1166 | Ga0070693_100037989 | |||
| 1167 | Ga0070693_100046738 | |||
| 1168 | Ga0070693_100156914 | |||
| 1169 | Ga0070704_100087264 | |||
| 1170 | Ga0070704_100178382 | |||
| 1171 | Ga0068855_100013302 | |||
| 1172 | Ga0068855_100014595 | |||
| 1173 | Ga0068855_100025947 | |||
| 1174 | Ga0068855_100083870 | |||
| 1175 | Ga0068855_100099341 | |||
| 1176 | Ga0068855_100166519 | |||
| 1177 | Ga0068855_100297827 | |||
| 1178 | Ga0070664_100028503 | |||
| 1179 | Ga0070664_100156773 | |||
| 1180 | Ga0070664_100616009 | |||
| 1181 | Ga0070664_100621898 | |||
| 1182 | Ga0070664_100779105 | |||
| 1183 | Ga0068857_100000120 | |||
| 1184 | Ga0068857_100000543 | |||
| 1185 | Ga0068857_100015291 | |||
| 1186 | Ga0068857_100022503 | |||
| 1187 | Ga0068857_100966793 | |||
| 1188 | Ga0068857_101116632 | |||
| 1189 | Ga0068854_100032291 | |||
| 1190 | Ga0068854_100330775 | |||
| 1191 | Ga0068856_100016001 | |||
| 1192 | Ga0068856_100039863 | |||
| 1193 | Ga0068856_100046698 | |||
| 1194 | Ga0068856_100065356 | |||
| 1195 | Ga0068856_100077191 | |||
| 1196 | Ga0068856_100233503 | |||
| 1197 | Ga0068856_100960795 | |||
| 1198 | Ga0068856_101243468 | |||
| 1199 | Ga0068856_101430336 | |||
| 1200 | Ga0070702_100111408 | |||
| 1201 | Ga0070702_100315588 | |||
| 1202 | Ga0068852_100009295 | |||
| 1203 | Ga0068852_100041581 | |||
| 1204 | Ga0068852_100052107 | |||
| 1205 | Ga0068852_100305758 | |||
| 1206 | Ga0068852_100401581 | |||
| 1207 | Ga0068852_100876432 | |||
| 1208 | Ga0068859_100005183 | |||
| 1209 | Ga0068859_100032397 | |||
| 1210 | Ga0068859_100568961 | |||
| 1211 | Ga0068859_101920291 | |||
| 1212 | Ga0068864_100041167 | |||
| 1213 | Ga0068864_100089891 | |||
| 1214 | Ga0068864_100146382 | |||
| 1215 | Ga0068864_100284709 | |||
| 1216 | Ga0068864_100552694 | |||
| 1217 | Ga0068864_100694953 | |||
| 1218 | Ga0068864_100702783 | |||
| 1219 | Ga0068864_100791100 | |||
| 1220 | Ga0068864_101623228 | |||
| 1221 | Ga0068866_10104658 | |||
| 1222 | Ga0068861_100011022 | |||
| 1223 | Ga0068861_100089290 | |||
| 1224 | Ga0068861_100324268 | |||
| 1225 | Ga0068861_100435435 | |||
| 1226 | Ga0068861_100827136 | |||
| 1227 | Ga0068870_10003561 | |||
| 1228 | Ga0068870_10025719 | |||
| 1229 | Ga0068870_10669500 | |||
| 1230 | Ga0068863_100011073 | |||
| 1231 | Ga0068863_100121561 | |||
| 1232 | Ga0068863_100219703 | |||
| 1233 | Ga0068863_102321458 | |||
| 1234 | Ga0068858_100012911 | |||
| 1235 | Ga0068858_100029827 | |||
| 1236 | Ga0068858_100033623 | |||
| 1237 | Ga0068858_100056404 | |||
| 1238 | Ga0068858_100074200 | |||
| 1239 | Ga0068858_100356297 | |||
| 1240 | Ga0068858_100356331 | |||
| 1241 | Ga0068858_100358282 | |||
| 1242 | Ga0068858_100371306 | |||
| 1243 | Ga0068858_100621474 | |||
| 1244 | Ga0068858_100759024 | |||
| 1245 | Ga0068858_102375832 | |||
| 1246 | Ga0068860_100054688 | |||
| 1247 | Ga0068860_100093525 | |||
| 1248 | Ga0068860_100106279 | |||
| 1249 | Ga0068860_100367019 | |||
| 1250 | Ga0068860_100671522 | |||
| 1251 | Ga0068860_102682012 | |||
| 1252 | Ga0068862_101149105 | |||
| 1253 | Ga0068862_101338003 | |||
| 1254 | Ga0070717_10164841 | |||
| 1255 | Ga0070717_11692812 | |||
| 1256 | Ga0070712_100793502 | |||
| 1257 | Ga0070712_101314381 | |||
| 1258 | Ga0097621_100046705 | |||
| 1259 | Ga0097621_100057681 | |||
| 1260 | Ga0097621_100131269 | |||
| 1261 | Ga0097621_100138347 | |||
| 1262 | Ga0097621_100147982 | |||
| 1263 | Ga0097621_100455821 | |||
| 1264 | Ga0068871_100023740 | |||
| 1265 | Ga0068871_100069598 | |||
| 1266 | Ga0068871_100071298 | |||
| 1267 | Ga0068871_100101239 | |||
| 1268 | Ga0068871_100178262 | |||
| 1269 | Ga0068871_100258056 | |||
| 1270 | Ga0068871_100476113 | |||
| 1271 | Ga0068871_100857641 | |||
| 1272 | Ga0075428_100006991 | |||
| 1273 | Ga0075428_100009385 | |||
| 1274 | Ga0075428_100072397 | |||
| 1275 | Ga0075430_100006232 | |||
| 1276 | Ga0075430_100262358 | |||
| 1277 | Ga0075430_101177451 | |||
| 1278 | Ga0075431_100001397 | |||
| 1279 | Ga0075431_100081134 | |||
| 1280 | Ga0075433_10050736 | |||
| 1281 | Ga0075433_10776410 | |||
| 1282 | Ga0075433_10866815 | |||
| 1283 | Ga0075434_100019558 | |||
| 1284 | Ga0075434_100042778 | |||
| 1285 | Ga0075434_100092807 | |||
| 1286 | Ga0075434_100206194 | |||
| 1287 | Ga0075429_100021559 | |||
| 1288 | Ga0075429_100043509 | |||
| 1289 | Ga0068865_100054622 | |||
| 1290 | Ga0068865_100076718 | |||
| 1291 | Ga0068865_100141869 | |||
| 1292 | Ga0068865_100145328 | |||
| 1293 | Ga0068865_101333507 | |||
| 1294 | Ga0075436_100044802 | |||
| 1295 | Ga0075436_100160897 | |||
| 1296 | Ga0075436_100398642 | |||
| 1297 | Ga0075436_100759721 | |||
| 1298 | Ga0097620_100005183 | |||
| 1299 | Ga0097620_100032397 | |||
| 1300 | Ga0097620_100568885 | |||
| 1301 | Ga0097620_101920306 | |||
| 1302 | Ga0075435_100020812 | |||
| 1303 | Ga0075435_100031253 | |||
| 1304 | Ga0075435_100110529 | |||
| 1305 | Ga0075435_100489825 | |||
| 1306 | Ga0075435_100545644 | |||
| 1307 | Ga0075435_100895973 | |||
| 1308 | Ga0099794_10021952 | |||
| 1309 | Ga0105240_10002588 | |||
| 1310 | Ga0105240_10006114 | |||
| 1311 | Ga0105240_10009049 | |||
| 1312 | Ga0105240_10081009 | |||
| 1313 | Ga0105240_10137524 | |||
| 1314 | Ga0105240_10158765 | |||
| 1315 | Ga0105240_10294742 | |||
| 1316 | Ga0105240_10388988 | |||
| 1317 | Ga0105240_10551245 | |||
| 1318 | Ga0105240_10933405 | |||
| 1319 | Ga0105240_11305864 | |||
| 1320 | Ga0111539_10007771 | |||
| 1321 | Ga0111539_10042941 | |||
| 1322 | Ga0111539_10045003 | |||
| 1323 | Ga0111539_10099161 | |||
| 1324 | Ga0105245_10001598 | |||
| 1325 | Ga0105245_10009190 | |||
| 1326 | Ga0105245_10016334 | |||
| 1327 | Ga0105245_10074173 | |||
| 1328 | Ga0105245_10109654 | |||
| 1329 | Ga0105245_10117859 | |||
| 1330 | Ga0105245_10136236 | |||
| 1331 | Ga0105245_10143593 | |||
| 1332 | Ga0105245_10167105 | |||
| 1333 | Ga0105245_10311716 | |||
| 1334 | Ga0105245_10369481 | |||
| 1335 | Ga0105245_10374774 | |||
| 1336 | Ga0105245_10554650 | |||
| 1337 | Ga0105245_10656773 | |||
| 1338 | Ga0105245_11352028 | |||
| 1339 | Ga0105245_11876754 | |||
| 1340 | Ga0105247_10112158 | |||
| 1341 | Ga0114129_10000153 | |||
| 1342 | Ga0114129_10024148 | |||
| 1343 | Ga0114129_10137402 | |||
| 1344 | Ga0114129_10194988 | |||
| 1345 | Ga0114129_10238618 | |||
| 1346 | Ga0114129_10501604 | |||
| 1347 | Ga0114129_10671932 | |||
| 1348 | Ga0114129_12012724 | |||
| 1349 | Ga0105243_10040926 | |||
| 1350 | Ga0105243_10047350 | |||
| 1351 | Ga0105243_10093402 | |||
| 1352 | Ga0105243_10101031 | |||
| 1353 | Ga0105243_10350613 | |||
| 1354 | Ga0105243_11300264 | |||
| 1355 | Ga0105241_10002182 | |||
| 1356 | Ga0105241_10008332 | |||
| 1357 | Ga0105241_10063418 | |||
| 1358 | Ga0105241_10083999 | |||
| 1359 | Ga0105241_10270007 | |||
| 1360 | Ga0105241_10317471 | |||
| 1361 | Ga0105241_10322786 | |||
| 1362 | Ga0105241_10424030 | |||
| 1363 | Ga0105241_11174202 | |||
| 1364 | Ga0105242_10026565 | |||
| 1365 | Ga0105242_10030637 | |||
| 1366 | Ga0105242_10037460 | |||
| 1367 | Ga0105242_10053301 | |||
| 1368 | Ga0105242_10076849 | |||
| 1369 | Ga0105242_10101331 | |||
| 1370 | Ga0105242_10164366 | |||
| 1371 | Ga0105242_10200063 | |||
| 1372 | Ga0105242_10288403 | |||
| 1373 | Ga0105242_10308967 | |||
| 1374 | Ga0105242_10356654 | |||
| 1375 | Ga0105242_11219366 | |||
| 1376 | Ga0105242_11636330 | |||
| 1377 | Ga0105242_12989164 | |||
| 1378 | Ga0105248_10001136 | |||
| 1379 | Ga0105248_10009526 | |||
| 1380 | Ga0105248_10035236 | |||
| 1381 | Ga0105248_10044359 | |||
| 1382 | Ga0105248_10058702 | |||
| 1383 | Ga0105248_10060946 | |||
| 1384 | Ga0105248_10075845 | |||
| 1385 | Ga0105248_10131287 | |||
| 1386 | Ga0105248_10136588 | |||
| 1387 | Ga0105248_10195271 | |||
| 1388 | Ga0105248_10539762 | |||
| 1389 | Ga0105248_12353856 | |||
| 1390 | Ga0105237_10007273 | |||
| 1391 | Ga0105237_10015088 | |||
| 1392 | Ga0105237_10055577 | |||
| 1393 | Ga0105237_10129760 | |||
| 1394 | Ga0105237_10328776 | |||
| 1395 | Ga0105237_10920298 | |||
| 1396 | Ga0105237_11386761 | |||
| 1397 | Ga0105238_10004033 | |||
| 1398 | Ga0105238_10004718 | |||
| 1399 | Ga0105238_10006871 | |||
| 1400 | Ga0105238_10019996 | |||
| 1401 | Ga0105238_10024610 | |||
| 1402 | Ga0105238_10058613 | |||
| 1403 | Ga0105238_10073691 | |||
| 1404 | Ga0105238_10091602 | |||
| 1405 | Ga0105238_10124692 | |||
| 1406 | Ga0105238_10435315 | |||
| 1407 | Ga0105238_11361924 | |||
| 1408 | Ga0105238_12139236 | |||
| 1409 | Ga0105238_12328458 | |||
| 1410 | Ga0105249_10012667 | |||
| 1411 | Ga0105249_10031669 | |||
| 1412 | Ga0105249_10324251 | |||
| 1413 | Ga0105249_10580681 | |||
| 1414 | Ga0105239_10001243 | |||
| 1415 | Ga0105239_10003025 | |||
| 1416 | Ga0105239_10028292 | |||
| 1417 | Ga0105239_10079327 | |||
| 1418 | Ga0105239_10126396 | |||
| 1419 | Ga0105246_10031209 | |||
| 1420 | Ga0105246_10042303 | |||
| 1421 | Ga0105246_10106310 | |||
| 1422 | Ga0105246_10397105 | |||
| 1423 | Ga0105246_10803273 | |||
| 1424 | Ga0105246_11157640 | |||
| 1425 | Ga0157373_10460647 | |||
| 1426 | Ga0157373_11071205 | |||
| 1427 | Ga0157371_10071601 | |||
| 1428 | Ga0157370_10002217 | |||
| 1429 | Ga0157370_10005870 | |||
| 1430 | Ga0157370_10105625 | |||
| 1431 | Ga0157370_10109990 | |||
| 1432 | Ga0157369_10000587 | |||
| 1433 | Ga0157369_10002200 | |||
| 1434 | Ga0157369_10002261 | |||
| 1435 | Ga0157369_10018710 | |||
| 1436 | Ga0157369_10019978 | |||
| 1437 | Ga0157369_11407332 | |||
| 1438 | Ga0157369_11863655 | |||
| 1439 | Ga0157374_10072230 | |||
| 1440 | Ga0157374_10131434 | |||
| 1441 | Ga0157374_10143738 | |||
| 1442 | Ga0157374_10160342 | |||
| 1443 | Ga0157374_10305832 | |||
| 1444 | Ga0157374_10329011 | |||
| 1445 | Ga0157374_10523885 | |||
| 1446 | Ga0157374_11026445 | |||
| 1447 | Ga0157374_11062381 | |||
| 1448 | Ga0157378_10002744 | |||
| 1449 | Ga0157378_10039411 | |||
| 1450 | Ga0157378_10171154 | |||
| 1451 | Ga0157378_10390926 | |||
| 1452 | Ga0157378_10478933 | |||
| 1453 | Ga0163162_10100500 | |||
| 1454 | Ga0163162_10232201 | |||
| 1455 | Ga0163162_10300486 | |||
| 1456 | Ga0163162_10709863 | |||
| 1457 | Ga0163162_10855033 | |||
| 1458 | Ga0163162_10941600 | |||
| 1459 | Ga0163162_11005129 | |||
| 1460 | Ga0163162_11009152 | |||
| 1461 | Ga0157372_10002038 | |||
| 1462 | Ga0157372_10004925 | |||
| 1463 | Ga0157372_10005878 | |||
| 1464 | Ga0157372_10013921 | |||
| 1465 | Ga0157372_10045750 | |||
| 1466 | Ga0157372_10244737 | |||
| 1467 | Ga0157372_10538713 | |||
| 1468 | Ga0157372_10564689 | |||
| 1469 | Ga0157372_11029688 | |||
| 1470 | Ga0157372_11344227 | |||
| 1471 | Ga0157372_11566352 | |||
| 1472 | Ga0157372_11993671 | |||
| 1473 | Ga0157375_10006905 | |||
| 1474 | Ga0157375_10009069 | |||
| 1475 | Ga0157375_10378248 | |||
| 1476 | Ga0157375_10415787 | |||
| 1477 | Ga0157375_11067099 | |||
| 1478 | Ga0157375_11094594 | |||
| 1479 | Ga0157375_12781087 | |||
| 1480 | Ga0163163_10074157 | |||
| 1481 | Ga0163163_10511234 | |||
| 1482 | Ga0163163_10887399 | |||
| 1483 | Ga0163163_10902915 | |||
| 1484 | Ga0163163_12126175 | |||
| 1485 | Ga0157380_10321750 | |||
| 1486 | Ga0157380_10707130 | |||
| 1487 | Ga0157377_10181095 | |||
| 1488 | Ga0157377_10710806 | |||
| 1489 | Ga0157377_11014136 | |||
| 1490 | Ga0157379_10101709 | |||
| 1491 | Ga0157379_10177756 | |||
| 1492 | Ga0157379_10493696 | |||
| 1493 | Ga0157379_11287278 | |||
| 1494 | Ga0157379_11528906 | |||
| 1495 | Ga0157376_10078263 | |||
| 1496 | Ga0157376_10084034 | |||
| 1497 | Ga0157376_10207703 | |||
| 1498 | Ga0157376_10491033 | |||
| 1499 | Ga0157376_10546365 | |||
| 1500 | Ga0157376_10568711 | |||
| 1501 | Ga0157376_10649166 | |||
| 1502 | Ga0157376_11102676 | |||
| 1503 | Ga0157376_11172541 | |||
| 1504 | Ga0157376_13065828 | |||
| 1505 | Ga0197907_11355935 | |||
| 1506 | Ga0206356_10168128 | |||
| 1507 | Ga0206356_10818372 | |||
| 1508 | Ga0206356_11703082 | |||
| 1509 | Ga0206349_1030428 | |||
| 1510 | Ga0206355_1125849 | |||
| 1511 | Ga0206352_10309109 | |||
| 1512 | Ga0206352_10548793 | |||
| 1513 | Ga0206352_10776619 | |||
| 1514 | Ga0206350_11578675 | |||
| 1515 | Ga0213876_10020527 | |||
| 1516 | Ga0213876_10130465 | |||
| 1517 | Ga0213876_10415668 | |||
| 1518 | Ga0213876_10563666 | |||
| 1519 | Ga0213875_10038848 | |||
| 1520 | Ga0213875_10176804 | |||
| 1521 | Ga0224712_10059868 | |||
| 1522 | Ga0224712_10067629 | |||
| 1523 | Ga0207692_10093713 | |||
| 1524 | Ga0207642_10080795 | |||
| 1525 | Ga0207642_10179365 | |||
| 1526 | Ga0207710_10145907 | |||
| 1527 | Ga0207680_11082023 | |||
| 1528 | Ga0207647_10397384 | |||
| 1529 | Ga0207699_10374653 | |||
| 1530 | Ga0207699_10662872 | |||
| 1531 | Ga0207645_10805318 | |||
| 1532 | Ga0207643_10244289 | |||
| 1533 | Ga0207643_10708485 | |||
| 1534 | Ga0207684_10135846 | |||
| 1535 | Ga0207684_10668597 | |||
| 1536 | Ga0207654_10003701 | |||
| 1537 | Ga0207654_10003892 | |||
| 1538 | Ga0207654_10058991 | |||
| 1539 | Ga0207654_10474310 | |||
| 1540 | Ga0207654_10564980 | |||
| 1541 | Ga0207654_10694988 | |||
| 1542 | Ga0207707_10000567 | |||
| 1543 | Ga0207707_10001348 | |||
| 1544 | Ga0207707_10027488 | |||
| 1545 | Ga0207707_10766644 | |||
| 1546 | Ga0207695_10001123 | |||
| 1547 | Ga0207695_10003190 | |||
| 1548 | Ga0207695_10003846 | |||
| 1549 | Ga0207695_10004024 | |||
| 1550 | Ga0207695_10282558 | |||
| 1551 | Ga0207695_10502188 | |||
| 1552 | Ga0207695_11134138 | |||
| 1553 | Ga0207671_10005457 | |||
| 1554 | Ga0207671_10026432 | |||
| 1555 | Ga0207671_10084887 | |||
| 1556 | Ga0207671_10102078 | |||
| 1557 | Ga0207671_10511608 | |||
| 1558 | Ga0207671_10879173 | |||
| 1559 | Ga0207693_10271319 | |||
| 1560 | Ga0207693_10352669 | |||
| 1561 | Ga0207693_11205580 | |||
| 1562 | Ga0207663_10109485 | |||
| 1563 | Ga0207663_10123444 | |||
| 1564 | Ga0207663_10125415 | |||
| 1565 | Ga0207663_10229445 | |||
| 1566 | Ga0207660_10108867 | |||
| 1567 | Ga0207660_10295063 | |||
| 1568 | Ga0207660_10701349 | |||
| 1569 | Ga0207662_10362349 | |||
| 1570 | Ga0207657_10029205 | |||
| 1571 | Ga0207657_10146368 | |||
| 1572 | Ga0207657_10187503 | |||
| 1573 | Ga0207657_10537517 | |||
| 1574 | Ga0207649_10188180 | |||
| 1575 | Ga0207649_10301855 | |||
| 1576 | Ga0207649_10528774 | |||
| 1577 | Ga0207652_10005806 | |||
| 1578 | Ga0207652_10005857 | |||
| 1579 | Ga0207652_10820535 | |||
| 1580 | Ga0207646_10202872 | |||
| 1581 | Ga0207681_10379183 | |||
| 1582 | Ga0207694_10000348 | |||
| 1583 | Ga0207694_10004755 | |||
| 1584 | Ga0207694_10014781 | |||
| 1585 | Ga0207694_10018587 | |||
| 1586 | Ga0207694_10049373 | |||
| 1587 | Ga0207694_10055615 | |||
| 1588 | Ga0207694_10146613 | |||
| 1589 | Ga0207694_10204227 | |||
| 1590 | Ga0207694_10231687 | |||
| 1591 | Ga0207694_10421512 | |||
| 1592 | Ga0207694_10568588 | |||
| 1593 | Ga0207650_10002798 | |||
| 1594 | Ga0207659_10052047 | |||
| 1595 | Ga0207659_11132980 | |||
| 1596 | Ga0207687_10001518 | |||
| 1597 | Ga0207687_10012048 | |||
| 1598 | Ga0207687_10021052 | |||
| 1599 | Ga0207687_10074857 | |||
| 1600 | Ga0207687_10079534 | |||
| 1601 | Ga0207687_10131692 | |||
| 1602 | Ga0207687_10208461 | |||
| 1603 | Ga0207687_10352074 | |||
| 1604 | Ga0207687_10556617 | |||
| 1605 | Ga0207687_10630981 | |||
| 1606 | Ga0207687_10804075 | |||
| 1607 | Ga0207687_10897397 | |||
| 1608 | Ga0207700_10002286 | |||
| 1609 | Ga0207700_10031655 | |||
| 1610 | Ga0207700_10258819 | |||
| 1611 | Ga0207700_10498069 | |||
| 1612 | Ga0207700_10946578 | |||
| 1613 | Ga0207664_10009122 | |||
| 1614 | Ga0207644_10087928 | |||
| 1615 | Ga0207644_10287961 | |||
| 1616 | Ga0207644_10344232 | |||
| 1617 | Ga0207690_10412506 | |||
| 1618 | Ga0207690_11359157 | |||
| 1619 | Ga0207706_10054048 | |||
| 1620 | Ga0207706_10248102 | |||
| 1621 | Ga0207686_10019473 | |||
| 1622 | Ga0207686_10023523 | |||
| 1623 | Ga0207686_10132550 | |||
| 1624 | Ga0207686_10168514 | |||
| 1625 | Ga0207686_10183296 | |||
| 1626 | Ga0207686_10239290 | |||
| 1627 | Ga0207686_10259708 | |||
| 1628 | Ga0207686_10374615 | |||
| 1629 | Ga0207686_10433819 | |||
| 1630 | Ga0207709_10053822 | |||
| 1631 | Ga0207709_10094757 | |||
| 1632 | Ga0207709_10297930 | |||
| 1633 | Ga0207670_10199926 | |||
| 1634 | Ga0207670_10211989 | |||
| 1635 | Ga0207670_10367965 | |||
| 1636 | Ga0207670_10720009 | |||
| 1637 | Ga0207670_11243545 | |||
| 1638 | Ga0207704_10037607 | |||
| 1639 | Ga0207704_10251783 | |||
| 1640 | Ga0207704_10351509 | |||
| 1641 | Ga0207691_10205192 | |||
| 1642 | Ga0207691_10329532 | |||
| 1643 | Ga0207711_10001511 | |||
| 1644 | Ga0207711_10001890 | |||
| 1645 | Ga0207711_10043970 | |||
| 1646 | Ga0207711_10086763 | |||
| 1647 | Ga0207711_10093497 | |||
| 1648 | Ga0207711_10109516 | |||
| 1649 | Ga0207711_10654084 | |||
| 1650 | Ga0207711_10663787 | |||
| 1651 | Ga0207711_11465092 | |||
| 1652 | Ga0207689_10049037 | |||
| 1653 | Ga0207689_10065640 | |||
| 1654 | Ga0207689_10065691 | |||
| 1655 | Ga0207689_10096422 | |||
| 1656 | Ga0207689_10437950 | |||
| 1657 | Ga0207689_10781230 | |||
| 1658 | Ga0207661_10014829 | |||
| 1659 | Ga0207661_10031659 | |||
| 1660 | Ga0207661_10041592 | |||
| 1661 | Ga0207661_10050076 | |||
| 1662 | Ga0207661_10403053 | |||
| 1663 | Ga0207661_10430732 | |||
| 1664 | Ga0207661_10591179 | |||
| 1665 | Ga0207661_11116501 | |||
| 1666 | Ga0207661_11784499 | |||
| 1667 | Ga0207679_10017649 | |||
| 1668 | Ga0207679_10267919 | |||
| 1669 | Ga0207679_10715460 | |||
| 1670 | Ga0207679_11483341 | |||
| 1671 | Ga0207667_10000369 | |||
| 1672 | Ga0207667_10000558 | |||
| 1673 | Ga0207667_10000650 | |||
| 1674 | Ga0207667_10007172 | |||
| 1675 | Ga0207667_10011270 | |||
| 1676 | Ga0207667_10018492 | |||
| 1677 | Ga0207667_10039858 | |||
| 1678 | Ga0207651_10160381 | |||
| 1679 | Ga0207651_10189757 | |||
| 1680 | Ga0207651_10218859 | |||
| 1681 | Ga0207712_10077811 | |||
| 1682 | Ga0207712_10346299 | |||
| 1683 | Ga0207712_10761583 | |||
| 1684 | Ga0207640_10052260 | |||
| 1685 | Ga0207640_10345972 | |||
| 1686 | Ga0207658_10128377 | |||
| 1687 | Ga0207658_10596019 | |||
| 1688 | Ga0207658_10851838 | |||
| 1689 | Ga0207677_10080746 | |||
| 1690 | Ga0207677_10270752 | |||
| 1691 | Ga0207677_10677303 | |||
| 1692 | Ga0207677_10868001 | |||
| 1693 | Ga0207677_11098164 | |||
| 1694 | Ga0207677_11971555 | |||
| 1695 | Ga0207703_10014466 | |||
| 1696 | Ga0207703_10028780 | |||
| 1697 | Ga0207703_10055585 | |||
| 1698 | Ga0207703_10057058 | |||
| 1699 | Ga0207703_10109401 | |||
| 1700 | Ga0207703_10175063 | |||
| 1701 | Ga0207703_10326425 | |||
| 1702 | Ga0207703_10513694 | |||
| 1703 | Ga0207703_10697782 | |||
| 1704 | Ga0207703_11409507 | |||
| 1705 | Ga0207639_10045485 | |||
| 1706 | Ga0207639_10065656 | |||
| 1707 | Ga0207639_10081096 | |||
| 1708 | Ga0207639_10359057 | |||
| 1709 | Ga0207639_11030078 | |||
| 1710 | Ga0207678_10511371 | |||
| 1711 | Ga0207708_10093698 | |||
| 1712 | Ga0207708_10327234 | |||
| 1713 | Ga0207702_10004880 | |||
| 1714 | Ga0207702_10035528 | |||
| 1715 | Ga0207702_10065231 | |||
| 1716 | Ga0207702_10113785 | |||
| 1717 | Ga0207702_10162764 | |||
| 1718 | Ga0207702_10276589 | |||
| 1719 | Ga0207702_10319199 | |||
| 1720 | Ga0207702_10336993 | |||
| 1721 | Ga0207702_10665704 | |||
| 1722 | Ga0207702_11654122 | |||
| 1723 | Ga0207641_10142600 | |||
| 1724 | Ga0207641_10214355 | |||
| 1725 | Ga0207641_10766098 | |||
| 1726 | Ga0207648_10028077 | |||
| 1727 | Ga0207648_10078214 | |||
| 1728 | Ga0207648_10146964 | |||
| 1729 | Ga0207648_10346583 | |||
| 1730 | Ga0207648_10810684 | |||
| 1731 | Ga0207648_11599578 | |||
| 1732 | Ga0207676_10073593 | |||
| 1733 | Ga0207676_10272942 | |||
| 1734 | Ga0207676_10294026 | |||
| 1735 | Ga0207676_10676505 | |||
| 1736 | Ga0207676_10819909 | |||
| 1737 | Ga0207676_11003727 | |||
| 1738 | Ga0207676_12290727 | |||
| 1739 | Ga0207674_10000063 | |||
| 1740 | Ga0207674_10000484 | |||
| 1741 | Ga0207674_10000657 | |||
| 1742 | Ga0207674_10003310 | |||
| 1743 | Ga0207674_10124070 | |||
| 1744 | Ga0207674_10787924 | |||
| 1745 | Ga0207675_100047384 | |||
| 1746 | Ga0207675_100485099 | |||
| 1747 | Ga0207675_100752740 | |||
| 1748 | Ga0207675_100852951 | |||
| 1749 | Ga0207683_10025344 | |||
| 1750 | Ga0207683_10357236 | |||
| 1751 | Ga0207698_10005842 | |||
| 1752 | Ga0207698_10090092 | |||
| 1753 | Ga0207698_10244801 | |||
| 1754 | Ga0207698_10366235 | |||
| 1755 | Ga0207698_10488128 | |||
| 1756 | Ga0207698_10670886 | |||
| 1757 | Ga0207698_12130543 | |||
| 1758 | Ga0209588_1006477 | |||
| 1759 | Ga0209966_1072022 | |||
| 1760 | Ga0207428_10025949 | |||
| 1761 | Ga0207428_10238530 | |||
| 1762 | Ga0268265_10864170 | |||
| 1763 | Ga0268264_10326260 | |||
| 1764 | Ga0268264_10417623 | |||
| 1765 | Ga0268264_11597463 | |||
| 1766 | Ga0268264_12028518 | |||
| 1767 | Ga0265775_100924 | |||
| 1768 | Ga0265760_10200186 | |||
| 1769 | Ga0265340_10022406 | |||
| 1770 | Ga0265313_10000978 | |||
| 1771 | Ga0265314_10000542 | |||
| 1772 | Ga0373948_0023841 | |||
| 1773 | Ga0373958_0034319 | |||
| 1774 | Ga0373926_0130802 | |||
| 1775 | Ga0373934_0003315 | |||
| 1776 | Ga0373934_0006789 | |||
| 1777 | Ga0373934_0085935 | |||
| 1778 | Ga0373944_0152108 | |||
| 1779 | Ga0373944_0279496 | |||
| 1780 | Ga0373952_0063560 | |||
| 1781 | Ga0373923_0025983 | |||
| 1782 | Ga0373923_0146238 | |||
| 1783 | Ga0373936_0180639 | |||
| 1784 | Ga0373936_0321744 | |||
| 1785 | Ga0373941_0130307 | |||
| 1786 | Ga0373953_0053002 | |||
| 1787 | Ga0373954_0008545 | |||
| 1788 | Ga0373954_0015875 | |||
| 1789 | Ga0373954_0026343 | |||
| 1790 | Ga0373954_0041987 | |||
| 1791 | Ga0373954_0076499 | |||
| 1792 | Ga0373954_0559389 | |||
| 1793 | Ga0373954_0606001 | |||
| 1794 | Ga0373956_0135504 | |||
| 1795 | Ga0373956_0246130 | |||
| 1796 | Ga0373943_0163907 | |||
| 1797 | Ga0373946_0285159 | |||
| 1798 | Ga0373955_0004305 | |||
| 1799 | Ga0373955_0022020 | |||
| 1800 | Ga0373955_0033572 | |||
| 1801 | Ga0373955_0170191 | |||
| 1802 | Ga0373955_0340296 | |||
| 1803 | Ga0373961_0050496 | |||
| 1804 | Ga0373924_0034070 | |||
| 1805 | Ga0373924_0069773 | |||
| 1806 | Ga0373931_0059241 | |||
| 1807 | Ga0373931_1213679 | |||
| 1808 | Ga0373935_0094008 | |||
| 1809 | Ga0373935_0096540 | |||
| 1810 | Ga0373935_0108233 | |||
| 1811 | Ga0373935_0173147 | |||
| 1812 | Ga0373935_0217397 | |||
| 1813 | Ga0373927_0003526 | |||
| 1814 | Ga0373927_0048222 | |||
| 1815 | Ga0373927_0087005 | |||
| 1816 | Ga0373927_0240847 | |||
| 1817 | Ga0373927_0317964 | |||
| 1818 | Ga0373933_0022280 | |||
| 1819 | Ga0373933_0144416 | |||
| 1820 | Ga0373933_0185102 | |||
| 1821 | Ga0373933_0236110 | |||
| 1822 | Ga0373933_0314482 | |||
| 1823 | Ga0373933_0876253 | |||
| 1824 | Ga0373947_0000466 | |||
| 1825 | Ga0373947_0108943 | |||
| 1826 | Ga0373947_0239105 | |||
| 1827 | Ga0373947_0375590 | |||
| 1828 | Ga0373937_0002529 | |||
| 1829 | Ga0373937_0009057 | |||
| 1830 | Ga0373937_0017813 | |||
| 1831 | Ga0373937_0037647 | |||
| 1832 | Ga0373937_0121986 | |||
| 1833 | Ga0373937_0151304 | |||
| 1834 | Ga0373937_0252277 | |||
| 1835 | Ga0373937_0450507 | |||
| 1836 | Ga0373937_0528735 | |||
| 1837 | Ga0373925_0001318 | |||
| 1838 | Ga0373925_0462200 | |||
| 1839 | Ga0373925_0509357 | |||
| 1840 | Ga0395900_1670412 | |||
| 1841 | Ga0436364_0014045 | |||
| 1842 | Ga0436364_0112772 | |||
| 1843 | Ga0436364_0888227 | |||
| 1844 | Ga0436365_0792504 | |||
| 1845 | Ga0436365_1210156 | |||
| 1846 | Ga0436365_1620093 | |||
| 1847 | Ga0436365_1776261 | |||
| 1848 | Ga0436362_1071320 | |||
| 1849 | Ga0439460_0073772 | |||
| 1850 | Ga0453683_0308974 | |||
| 1851 | Ga0453683_0484205 | |||
| 1852 | Ga0453684_1054812 | |||
| 1853 | Ga0453684_1425785 | |||
| 1854 | Ga0451576_0022151 | |||
| 1855 | Ga0451576_0068440 | |||
| 1856 | Ga0451576_0109274 | |||
| 1857 | Ga0451576_0132970 | |||
| 1858 | Ga0451576_0445353 | |||
| 1859 | Ga0495592_0029498 | |||
| 1860 | Ga0495603_0221726 | |||
| 1861 | Ga0495651_0056024 | |||
| 1862 | Ga0495651_0254712 | |||
| 1863 | Ga0495651_0525238 | |||
| 1864 | Ga0495580_0051798 | |||
| 1865 | Ga0495580_0126601 | |||
| 1866 | Ga0495580_0215870 | |||
| 1867 | Ga0495582_0009156 | |||
| 1868 | Ga0495584_0069478 | |||
| 1869 | Ga0495594_0360331 | |||
| 1870 | Ga0495594_0417051 | |||
| 1871 | Ga0495628_0327363 | |||
| 1872 | Ga0495628_0371286 | |||
| 1873 | Ga0495630_0407759 | |||
| 1874 | Ga0495630_0808049 | |||
| 1875 | Ga0495630_1130738 | |||
| 1876 | Ga0495663_0144644 | |||
| 1877 | Ga0495666_0128649 | |||
| 1878 | Ga0495652_0063982 | |||
| 1879 | Ga0495652_0155725 | |||
| 1880 | Ga0495652_0239338 | |||
| 1881 | Ga0495652_0387089 | |||
| 1882 | Ga0495652_0462545 | |||
| 1883 | Ga0495665_0038934 | |||
| 1884 | Ga0495665_0558912 | |||
| 1885 | Ga0495587_0000822 | |||
| 1886 | Ga0495587_0003986 | |||
| 1887 | Ga0495587_0262822 | |||
| 1888 | Ga0495621_0081672 | |||
| 1889 | Ga0495645_0106650 | |||
| 1890 | Ga0495645_0661058 | |||
| 1891 | Ga0495667_0090237 | |||
| 1892 | Ga0495667_0455408 | |||
| 1893 | Ga0495667_1030466 | |||
| 1894 | Ga0495656_0684306 | |||
| 1895 | Ga0495668_0239833 | |||
| 1896 | Ga0495634_0029752 | |||
| 1897 | Ga0495634_0404099 | |||
| 1898 | Ga0495635_0260042 | |||
| 1899 | Ga0495635_1098413 | |||
| 1900 | Ga0495659_0063027 | |||
| 1901 | Ga0495659_0084306 | |||
| 1902 | Ga0495599_0011458 | |||
| 1903 | Ga0495599_0021022 | |||
| 1904 | Ga0495599_0149864 | |||
| 1905 | Ga0495599_0222482 | |||
| 1906 | Ga0495599_0401531 | |||
| 1907 | Ga0495599_0681168 | |||
| 1908 | Ga0495623_0204731 | |||
| 1909 | Ga0495658_0007879 | |||
| 1910 | Ga0495658_0056030 | |||
| 1911 | Ga0495669_0015225 | |||
| 1912 | Ga0495669_0073447 | |||
| 1913 | Ga0495669_0302325 | |||
| 1914 | Ga0495613_0143161 | |||
| 1915 | Ga0495589_0255161 | |||
| 1916 | Ga0495600_0844692 | |||
| 1917 | Ga0495604_0627625 | |||
| 1918 | Ga0495674_0139931 | |||
| 1919 | Ga0495674_0169578 | |||
| 1920 | Ga0495674_0514904 | |||
| 1921 | Ga0495680_0054934 | |||
| 1922 | Ga0495680_0092088 | |||
| 1923 | Ga0495680_0879924 | |||
| 1924 | Ga0495675_0092652 | |||
| 1925 | Ga0495675_0174387 | |||
| 1926 | Ga0495685_072958 | |||
| 1927 | Ga0495684_0006795 | |||
| 1928 | Ga0495684_0103544 | |||
| 1929 | Ga0495684_0463344 | |||
| 1930 | Ga0495602_0001193 | |||
| 1931 | Ga0495602_0005450 | |||
| 1932 | Ga0495602_0195182 | |||
| 1933 | Ga0496102_0225926 | |||
| 1934 | Ga0496102_1166034 | |||
| 1935 | Ga0496104_0050189 | |||
| 1936 | Ga0496104_1393341 | |||
| 1937 | Ga0496106_0632654 | |||
| 1938 | Ga0496106_1361946 | |||
| 1939 | Ga0496112_0189988 | |||
| 1940 | Ga0496112_0450444 | |||
| 1941 | Ga0496115_0096149 | |||
| 1942 | Ga0496115_0139999 | |||
| 1943 | Ga0501068_0213450 | |||
| 1944 | Ga0501068_0426946 | |||
| 1945 | nmdc:mga05p37_133348_c1 | |||
| 1946 | nmdc:mga05p37_1387951_c1 | |||
| 1947 | nmdc:mga05p37_247851_c1 | |||
| 1948 | nmdc:mga05p37_3548_c1 | |||
| 1949 | nmdc:mga05p37_397445_c1 | |||
| 1950 | nmdc:mga05p37_42105_c1 | |||
| 1951 | nmdc:mga05p37_6452_c1 | |||
| 1952 | nmdc:mga05p37_806414_c1 | |||
| 1953 | nmdc:mga09592_100417_c1 | |||
| 1954 | nmdc:mga09592_177256_c1 | |||
| 1955 | nmdc:mga09592_221852_c1 | |||
| 1956 | nmdc:mga09592_62029_c1 | |||
| 1957 | nmdc:mga0qj67_1362922_c1 | |||
| 1958 | nmdc:mga0qj67_33462_c1 | |||
| 1959 | nmdc:mga0qj67_64353_c1 | |||
| 1960 | nmdc:mga06r32_176545_c1 | |||
| 1961 | nmdc:mga06r32_34297_c1 | |||
| 1962 | nmdc:mga08y16_11227_c1 | |||
| 1963 | nmdc:mga08y16_124852_c1 | |||
| 1964 | nmdc:mga08y16_474497_c1 | |||
| 1965 | nmdc:mga08y16_57615_c1 | |||
| 1966 | nmdc:mga0n895_1044046_c1 | |||
| 1967 | nmdc:mga0n895_125075_c1 | |||
| 1968 | nmdc:mga0n895_1789829_c1 | |||
| 1969 | nmdc:mga0n895_245025_c1 | |||
| 1970 | nmdc:mga0n895_426840_c1 | |||
| 1971 | nmdc:mga0n895_67697_c1 | |||
| 1972 | nmdc:mga0rr50_111966_c1 | |||
| 1973 | nmdc:mga0rr50_1441112_c1 | |||
| 1974 | nmdc:mga0rr50_297420_c1 | |||
| 1975 | nmdc:mga0rr50_305194_c1 | |||
| 1976 | nmdc:mga0rr50_355252_c1 | |||
| 1977 | nmdc:mga0rr50_392245_c1 | |||
| 1978 | nmdc:mga0rr50_571795_c1 | |||
| 1979 | nmdc:mga08x19_310532_c1 | |||
| 1980 | nmdc:mga08x19_65897_c1 | |||
| 1981 | nmdc:mga08x19_740232_c1 | |||
| 1982 | nmdc:mga08x19_846108_c1 | |||
| 1983 | nmdc:mga0a205_137502_c1 | |||
| 1984 | nmdc:mga0a205_41720_c1 | |||
| 1985 | nmdc:mga0a205_59469_c1 | |||
| 1986 | nmdc:mga0a205_918980_c1 | |||
| 1987 | Ga0495601_0084418 | |||
| 1988 | Ga0495601_0127154 | |||
| 1989 | Ga0495601_0721779 | |||
| 1990 | Ga0495619_0254983 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7og2-assembly1.cif.gz_B | crystal structure of pseudoalteromonas luteoviolacea l-amino acid oxidase | 0.8407 | 39 | 71 |
| 4fxd-assembly1.cif.gz_A | crystal structure of yeast dna polymerase alpha bound to dna/rna | 0.7962 | 38 | 73 |
| 4fxd-assembly2.cif.gz_B | crystal structure of yeast dna polymerase alpha bound to dna/rna | 0.7946 | 38 | 73 |
| 3o6z-assembly1.cif.gz_A | structure of the d152a e.coli gdp-mannose hydrolase (yffh) in complex with mg++ | 0.7929 | 41 | 72 |
| 8d0k-assembly1.cif.gz_F | human cst-dna polymerase alpha/primase preinitiation complex bound to 4xtel-foldback template - prim2c advanced pic | 0.7846 | 37 | 71 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VKY7_200_296_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.8304 | 41 | 75 | 2.30.29.30 |
| af_A0A1D8PQ00_161_443_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8275 | 41 | 71 | 2.130.10.10 |
| 3rlfA03 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8052 | 36 | 96 | 2.40.50.140 |
| af_P87307_123_212_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7947 | 35 | 117 | 2.40.50.140 |
| af_Q8VIG0_99_222_3.30.1520.10 | Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain | 0.788 | 39 | 71 | 3.30.1520.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N5PN25-F1-model_v4 | DNA-binding protein | 0.9517 | 21 | 128 |
|
| AF-A0A832R6Q9-F1-model_v4 | OB-fold nucleic acid binding domain-containing protein | 0.9484 | 21 | 122 |
|
| AF-A0A2V8L6J6-F1-model_v4 | DNA-binding protein | 0.9467 | 21 | 128 |
|
| AF-A0A382AM76-F1-model_v4 | OB-fold nucleic acid binding domain-containing protein | 0.9377 | 19 | 118 |
|
| AF-A0A383BXH4-F1-model_v4 | OB-fold nucleic acid binding domain-containing protein | 0.937 | 21 | 119 |
|