F487748

General Info

Members Datasets Scaffolds Average Seq Length
995 281 1990 136

Family's Representative Sequence

Representative Sequence 3300035086|Ga0373934_0324687|Ga0373934_0324687_126_566
Length 146
Sequence MRSARVSAKAIAAVAIFLAATPAWAHHSFAAEFDRNKVVNLEGTIVKMEWVNPHAWIHVAVKNPDGTSTTWMIEANTPNGLLRRGFTKQSLEQGTEVLVRGYQAKSGDNKANGSSMTFKDGKKLFLGSSSGDEEDPTGKAPTKSGK

Samples

Sample ID Description Type Environment
1 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
125 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
129 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
196 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
199 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
200 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
201 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
202 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
206 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
207 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
208 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
213 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
225 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
226 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
233 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
234 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
235 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
239 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
242 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
243 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
246 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
247 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
248 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
251 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
252 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
253 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
254 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
255 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
256 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
257 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
260 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
261 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
262 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
263 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
264 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
273 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.89
Metatranscriptomes 2.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.01
Rhizosphere 97.39
Stem 0
Stem Tuber 0
Unclassified 25.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373934_0324687 3300035086 Bacteria 639
2 SwRhRL2b_contig_134348 2162886007 Unclassified 901
3 Ga0058859_11726138 3300004798 Bacteria 832
4 Ga0058861_11567625 3300004800 Unclassified 2164
5 Ga0058861_11666670 3300004800 Bacteria 726
6 Ga0058860_10032041 3300004801 Bacteria 827
7 Ga0058860_11730977 3300004801 Bacteria 628
8 Ga0058862_10653920 3300004803 Bacteria 700
9 Ga0058862_11764429 3300004803 Unclassified 3160
10 Ga0065715_10305037 3300005293 Bacteria 1033
11 Ga0065715_10534290 3300005293 Unclassified 753
12 Ga0065707_10317247 3300005295 Bacteria 973
13 Ga0070658_10312755 3300005327 Bacteria 1340
14 Ga0070676_10073436 3300005328 Bacteria 2058
15 Ga0070676_10498912 3300005328 Unclassified 864
16 Ga0070676_10883578 3300005328 Unclassified 665
17 Ga0070683_100000668 3300005329 Bacteria 24820
18 Ga0070683_100001579 3300005329 Bacteria 17631
19 Ga0070683_100008117 3300005329 Bacteria 8916
20 Ga0070683_100063533 3300005329 Bacteria 3434
21 Ga0070683_100087057 3300005329 Bacteria 2929
22 Ga0070683_100279454 3300005329 Bacteria 1588
23 Ga0070683_100321022 3300005329 Bacteria 1474
24 Ga0070683_100329826 3300005329 Bacteria 1453
25 Ga0070683_100337545 3300005329 Bacteria 1435
26 Ga0070690_100371840 3300005330 Unclassified 1043
27 Ga0070690_100412354 3300005330 Unclassified 994
28 Ga0070690_100537270 3300005330 Bacteria 879
29 Ga0070670_100009951 3300005331 Bacteria 8117
30 Ga0070677_10864044 3300005333 Unclassified 521
31 Ga0068869_100019204 3300005334 Bacteria 4665
32 Ga0068869_100100713 3300005334 Bacteria 2185
33 Ga0068869_100209394 3300005334 Bacteria 1541
34 Ga0068869_100622670 3300005334 Bacteria 914
35 Ga0068869_100690063 3300005334 Unclassified 870
36 Ga0070666_10033122 3300005335 Bacteria 3417
37 Ga0070666_10053354 3300005335 Unclassified 2727
38 Ga0070680_100003994 3300005336 Bacteria 11041
39 Ga0070680_100029305 3300005336 Bacteria 4421
40 Ga0070680_100055725 3300005336 Unclassified 3231
41 Ga0070680_100473811 3300005336 Bacteria 1070
42 Ga0070682_100856609 3300005337 Bacteria 743
43 Ga0068868_100117999 3300005338 Bacteria 2162
44 Ga0068868_100162368 3300005338 Unclassified 1846
45 Ga0068868_100232182 3300005338 Bacteria 1548
46 Ga0068868_100250425 3300005338 Bacteria 1491
47 Ga0068868_100520535 3300005338 Unclassified 1044
48 Ga0068868_101373881 3300005338 Bacteria 658
49 Ga0068868_101392153 3300005338 Bacteria 654
50 Ga0070660_100089115 3300005339 Unclassified 2431
51 Ga0070660_100188248 3300005339 Bacteria 1671
52 Ga0070660_100199036 3300005339 Bacteria 1625
53 Ga0070689_100080626 3300005340 Unclassified 2554
54 Ga0070689_100430874 3300005340 Bacteria 1119
55 Ga0070689_100597324 3300005340 Bacteria 956
56 Ga0070689_101453603 3300005340 Bacteria 620
57 Ga0070691_10000648 3300005341 Bacteria 13455
58 Ga0070691_10006127 3300005341 Bacteria 5488
59 Ga0070691_10042747 3300005341 Bacteria 2145
60 Ga0070691_10139770 3300005341 Unclassified 1233
61 Ga0070691_10303338 3300005341 Bacteria 873
62 Ga0070687_100010260 3300005343 Bacteria 4044
63 Ga0070661_100074809 3300005344 Unclassified 2495
64 Ga0070661_100336248 3300005344 Unclassified 1182
65 Ga0070661_100761920 3300005344 Bacteria 792
66 Ga0070661_101478756 3300005344 Unclassified 573
67 Ga0070661_101736702 3300005344 Bacteria 529
68 Ga0070692_10121231 3300005345 Bacteria 1458
69 Ga0070669_100814346 3300005353 Bacteria 794
70 Ga0070669_101104529 3300005353 Unclassified 683
71 Ga0070675_100016777 3300005354 Bacteria 5815
72 Ga0070671_100016939 3300005355 Bacteria 5894
73 Ga0070671_100072322 3300005355 Bacteria 2879
74 Ga0070671_100109669 3300005355 Bacteria 2318
75 Ga0070671_100226470 3300005355 Bacteria 1586
76 Ga0070671_100809569 3300005355 Bacteria 816
77 Ga0070673_100086982 3300005364 Bacteria 2547
78 Ga0070673_100108115 3300005364 Unclassified 2302
79 Ga0070673_100194967 3300005364 Bacteria 1742
80 Ga0070673_100823822 3300005364 Bacteria 858
81 Ga0070688_100035067 3300005365 Bacteria 3045
82 Ga0070659_100008560 3300005366 Bacteria 7480
83 Ga0070667_100348286 3300005367 Bacteria 1341
84 Ga0070667_101006357 3300005367 Unclassified 778
85 Ga0070667_101268745 3300005367 Unclassified 690
86 Ga0070709_10087832 3300005434 Bacteria 2044
87 Ga0070709_10176559 3300005434 Bacteria 1497
88 Ga0070709_10814180 3300005434 Bacteria 734
89 Ga0070709_11132039 3300005434 Bacteria 627
90 Ga0070714_100017969 3300005435 Bacteria 5734
91 Ga0070714_100441597 3300005435 Unclassified 1235
92 Ga0070714_100891615 3300005435 Bacteria 863
93 Ga0070713_100008512 3300005436 Bacteria 7280
94 Ga0070713_100032629 3300005436 Bacteria 4162
95 Ga0070713_100163389 3300005436 Bacteria 1989
96 Ga0070713_101051922 3300005436 Bacteria 786
97 Ga0070710_10067712 3300005437 Bacteria 2049
98 Ga0070710_10253919 3300005437 Bacteria 1131
99 Ga0070710_10389933 3300005437 Bacteria 931
100 Ga0070701_10435657 3300005438 Bacteria 838
101 Ga0070701_10530382 3300005438 Bacteria 769
102 Ga0070711_100046386 3300005439 Bacteria 2961
103 Ga0070711_100051884 3300005439 Bacteria 2820
104 Ga0070711_100070201 3300005439 Bacteria 2466
105 Ga0070711_100156478 3300005439 Unclassified 1724
106 Ga0070705_100003820 3300005440 Bacteria 7367
107 Ga0070705_100065347 3300005440 Bacteria 2177
108 Ga0070705_100622466 3300005440 Bacteria 838
109 Ga0070705_101075757 3300005440 Archaea 657
110 Ga0070700_100363289 3300005441 Bacteria 1077
111 Ga0070694_100004969 3300005444 Bacteria 8012
112 Ga0070694_100088746 3300005444 Bacteria 2165
113 Ga0070694_100760698 3300005444 Unclassified 792
114 Ga0070708_100398408 3300005445 Unclassified 1298
115 Ga0070708_100472641 3300005445 Unclassified 1183
116 Ga0070708_101472567 3300005445 Unclassified 635
117 Ga0070663_100308876 3300005455 Bacteria 1268
118 Ga0070662_100036690 3300005457 Bacteria 3470
119 Ga0070662_100228634 3300005457 Bacteria 1487
120 Ga0070681_10000972 3300005458 Bacteria 24213
121 Ga0070681_10003753 3300005458 Bacteria 14255
122 Ga0070681_10163166 3300005458 Unclassified 2152
123 Ga0070681_10584258 3300005458 Bacteria 1031
124 Ga0070681_10893346 3300005458 Unclassified 807
125 Ga0070681_11885596 3300005458 Bacteria 525
126 Ga0068867_100065175 3300005459 Bacteria 2710
127 Ga0068867_100106173 3300005459 Unclassified 2151
128 Ga0068867_100112351 3300005459 Unclassified 2095
129 Ga0068867_100165064 3300005459 Bacteria 1749
130 Ga0068867_100192275 3300005459 Unclassified 1629
131 Ga0068867_100413397 3300005459 Unclassified 1141
132 Ga0070685_10398812 3300005466 Unclassified 952
133 Ga0070706_100198957 3300005467 Bacteria 1872
134 Ga0070707_100126988 3300005468 Unclassified 2478
135 Ga0070698_100944871 3300005471 Bacteria 808
136 Ga0070699_100037311 3300005518 Bacteria 4204
137 Ga0070699_100712427 3300005518 Bacteria 917
138 Ga0070679_100003226 3300005530 Bacteria 14897
139 Ga0070679_100009655 3300005530 Bacteria 9128
140 Ga0070679_100323306 3300005530 Bacteria 1492
141 Ga0070679_100551693 3300005530 Bacteria 1096
142 Ga0070684_100001842 3300005535 Bacteria 15525
143 Ga0070684_100002448 3300005535 Bacteria 13678
144 Ga0070684_100011967 3300005535 Bacteria 6931
145 Ga0070684_100015801 3300005535 Bacteria 6159
146 Ga0070684_100018492 3300005535 Bacteria 5741
147 Ga0070684_100044151 3300005535 Bacteria 3853
148 Ga0070684_100555523 3300005535 Bacteria 1066
149 Ga0070684_100742879 3300005535 Unclassified 916
150 Ga0070684_101045404 3300005535 Archaea 767
151 Ga0070684_101144110 3300005535 Bacteria 732
152 Ga0070697_100191917 3300005536 Bacteria 1734
153 Ga0070697_100238255 3300005536 Bacteria 1553
154 Ga0070697_100280027 3300005536 Bacteria 1431
155 Ga0070697_100348621 3300005536 Bacteria 1278
156 Ga0068853_100137042 3300005539 Unclassified 2195
157 Ga0068853_100172915 3300005539 Bacteria 1955
158 Ga0068853_100174914 3300005539 Bacteria 1944
159 Ga0068853_101023023 3300005539 Unclassified 796
160 Ga0070672_100343960 3300005543 Bacteria 1270
161 Ga0070672_101227356 3300005543 Bacteria 668
162 Ga0070686_100726872 3300005544 Unclassified 794
163 Ga0070695_100005568 3300005545 Bacteria 7416
164 Ga0070695_100062434 3300005545 Bacteria 2419
165 Ga0070695_100184223 3300005545 Unclassified 1482
166 Ga0070695_100552728 3300005545 Unclassified 898
167 Ga0070696_100003974 3300005546 Bacteria 9858
168 Ga0070696_100110820 3300005546 Bacteria 1976
169 Ga0070696_100982591 3300005546 Unclassified 704
170 Ga0070696_101129748 3300005546 Bacteria 660
171 Ga0070693_100037989 3300005547 Bacteria 2688
172 Ga0070693_100046738 3300005547 Unclassified 2460
173 Ga0070693_100156914 3300005547 Bacteria 1446
174 Ga0070704_100087264 3300005549 Bacteria 2315
175 Ga0070704_100178382 3300005549 Bacteria 1697
176 Ga0068855_100013302 3300005563 Bacteria 9926
177 Ga0068855_100014595 3300005563 Bacteria 9461
178 Ga0068855_100025947 3300005563 Bacteria 7010
179 Ga0068855_100083870 3300005563 Bacteria 3691
180 Ga0068855_100099341 3300005563 Bacteria 3352
181 Ga0068855_100166519 3300005563 Bacteria 2498
182 Ga0068855_100297827 3300005563 Bacteria 1787
183 Ga0070664_100028503 3300005564 Bacteria 4645
184 Ga0070664_100156773 3300005564 Bacteria 2012
185 Ga0070664_100616009 3300005564 Bacteria 1007
186 Ga0070664_100621898 3300005564 Unclassified 1002
187 Ga0070664_100779105 3300005564 Bacteria 893
188 Ga0068857_100000120 3300005577 Bacteria 46937
189 Ga0068857_100000543 3300005577 Bacteria 27430
190 Ga0068857_100015291 3300005577 Bacteria 6699
191 Ga0068857_100022503 3300005577 Bacteria 5546
192 Ga0068857_100966793 3300005577 Bacteria 819
193 Ga0068857_101116632 3300005577 Bacteria 762
194 Ga0068854_100032291 3300005578 Bacteria 3642
195 Ga0068854_100330775 3300005578 Bacteria 1241
196 Ga0068856_100016001 3300005614 Bacteria 7251
197 Ga0068856_100039863 3300005614 Bacteria 4612
198 Ga0068856_100046698 3300005614 Bacteria 4265
199 Ga0068856_100065356 3300005614 Bacteria 3595
200 Ga0068856_100077191 3300005614 Bacteria 3300
201 Ga0068856_100233503 3300005614 Bacteria 1855
202 Ga0068856_100960795 3300005614 Bacteria 873
203 Ga0068856_101243468 3300005614 Bacteria 760
204 Ga0068856_101430336 3300005614 Bacteria 706
205 Ga0070702_100111408 3300005615 Bacteria 1697
206 Ga0070702_100315588 3300005615 Bacteria 1087
207 Ga0068852_100009295 3300005616 Bacteria 7290
208 Ga0068852_100041581 3300005616 Bacteria 3886
209 Ga0068852_100052107 3300005616 Bacteria 3516
210 Ga0068852_100305758 3300005616 Unclassified 1540
211 Ga0068852_100401581 3300005616 Bacteria 1348
212 Ga0068852_100876432 3300005616 Bacteria 914
213 Ga0068859_100005183 3300005617 Bacteria 13237
214 Ga0068859_100032397 3300005617 Bacteria 5251
215 Ga0068859_100568961 3300005617 Bacteria 1227
216 Ga0068859_101920291 3300005617 Unclassified 654
217 Ga0068864_100041167 3300005618 Bacteria 3952
218 Ga0068864_100089891 3300005618 Bacteria 2706
219 Ga0068864_100146382 3300005618 Bacteria 2136
220 Ga0068864_100284709 3300005618 Bacteria 1544
221 Ga0068864_100552694 3300005618 Bacteria 1113
222 Ga0068864_100694953 3300005618 Bacteria 993
223 Ga0068864_100702783 3300005618 Bacteria 988
224 Ga0068864_100791100 3300005618 Unclassified 932
225 Ga0068864_101623228 3300005618 Unclassified 651
226 Ga0068866_10104658 3300005718 Bacteria 1568
227 Ga0068861_100011022 3300005719 Bacteria 6282
228 Ga0068861_100089290 3300005719 Bacteria 2429
229 Ga0068861_100324268 3300005719 Bacteria 1342
230 Ga0068861_100435435 3300005719 Bacteria 1171
231 Ga0068861_100827136 3300005719 Bacteria 871
232 Ga0068870_10003561 3300005840 Bacteria 6604
233 Ga0068870_10025719 3300005840 Unclassified 2925
234 Ga0068870_10669500 3300005840 Bacteria 713
235 Ga0068863_100011073 3300005841 Bacteria 8746
236 Ga0068863_100121561 3300005841 Bacteria 2490
237 Ga0068863_100219703 3300005841 Bacteria 1830
238 Ga0068863_102321458 3300005841 Unclassified 546
239 Ga0068858_100012911 3300005842 Bacteria 7877
240 Ga0068858_100029827 3300005842 Bacteria 5067
241 Ga0068858_100033623 3300005842 Bacteria 4756
242 Ga0068858_100056404 3300005842 Bacteria 3631
243 Ga0068858_100074200 3300005842 Bacteria 3158
244 Ga0068858_100356297 3300005842 Bacteria 1402
245 Ga0068858_100356331 3300005842 Bacteria 1402
246 Ga0068858_100358282 3300005842 Bacteria 1398
247 Ga0068858_100371306 3300005842 Bacteria 1372
248 Ga0068858_100621474 3300005842 Unclassified 1049
249 Ga0068858_100759024 3300005842 Unclassified 945
250 Ga0068858_102375832 3300005842 Unclassified 524
251 Ga0068860_100054688 3300005843 Unclassified 3794
252 Ga0068860_100093525 3300005843 Bacteria 2865
253 Ga0068860_100106279 3300005843 Bacteria 2681
254 Ga0068860_100367019 3300005843 Bacteria 1419
255 Ga0068860_100671522 3300005843 Unclassified 1045
256 Ga0068860_102682012 3300005843 Bacteria 517
257 Ga0068862_101149105 3300005844 Bacteria 773
258 Ga0068862_101338003 3300005844 Bacteria 718
259 Ga0070717_10164841 3300006028 Bacteria 1924
260 Ga0070717_11692812 3300006028 Bacteria 572
261 Ga0070712_100793502 3300006175 Bacteria 812
262 Ga0070712_101314381 3300006175 Unclassified 630
263 Ga0097621_100046705 3300006237 Bacteria 3505
264 Ga0097621_100057681 3300006237 Unclassified 3176
265 Ga0097621_100131269 3300006237 Unclassified 2133
266 Ga0097621_100138347 3300006237 Unclassified 2079
267 Ga0097621_100147982 3300006237 Bacteria 2012
268 Ga0097621_100455821 3300006237 Unclassified 1153
269 Ga0068871_100023740 3300006358 Bacteria 4747
270 Ga0068871_100069598 3300006358 Bacteria 2890
271 Ga0068871_100071298 3300006358 Bacteria 2857
272 Ga0068871_100101239 3300006358 Unclassified 2414
273 Ga0068871_100178262 3300006358 Bacteria 1825
274 Ga0068871_100258056 3300006358 Unclassified 1520
275 Ga0068871_100476113 3300006358 Unclassified 1122
276 Ga0068871_100857641 3300006358 Bacteria 840
277 Ga0075428_100006991 3300006844 Bacteria 12516
278 Ga0075428_100009385 3300006844 Bacteria 10853
279 Ga0075428_100072397 3300006844 Bacteria 3765
280 Ga0075430_100006232 3300006846 Bacteria 10061
281 Ga0075430_100262358 3300006846 Unclassified 1431
282 Ga0075430_101177451 3300006846 Unclassified 631
283 Ga0075431_100001397 3300006847 Bacteria 22147
284 Ga0075431_100081134 3300006847 Bacteria 3349
285 Ga0075433_10050736 3300006852 Bacteria 3612
286 Ga0075433_10776410 3300006852 Archaea 838
287 Ga0075433_10866815 3300006852 Bacteria 788
288 Ga0075434_100019558 3300006871 Bacteria 6555
289 Ga0075434_100042778 3300006871 Bacteria 4491
290 Ga0075434_100092807 3300006871 Bacteria 3022
291 Ga0075434_100206194 3300006871 Bacteria 1986
292 Ga0075429_100021559 3300006880 Bacteria 5585
293 Ga0075429_100043509 3300006880 Bacteria 3908
294 Ga0068865_100054622 3300006881 Bacteria 2776
295 Ga0068865_100076718 3300006881 Unclassified 2386
296 Ga0068865_100141869 3300006881 Bacteria 1812
297 Ga0068865_100145328 3300006881 Bacteria 1793
298 Ga0068865_101333507 3300006881 Bacteria 639
299 Ga0075436_100044802 3300006914 Unclassified 3051
300 Ga0075436_100160897 3300006914 Bacteria 1582
301 Ga0075436_100398642 3300006914 Bacteria 997
302 Ga0075436_100759721 3300006914 Unclassified 720
303 Ga0097620_100005183 3300006931 Bacteria 13237
304 Ga0097620_100032397 3300006931 Bacteria 5251
305 Ga0097620_100568885 3300006931 Bacteria 1227
306 Ga0097620_101920306 3300006931 Unclassified 654
307 Ga0075435_100020812 3300007076 Bacteria 5034
308 Ga0075435_100031253 3300007076 Bacteria 4193
309 Ga0075435_100110529 3300007076 Bacteria 2286
310 Ga0075435_100489825 3300007076 Bacteria 1062
311 Ga0075435_100545644 3300007076 Unclassified 1004
312 Ga0075435_100895973 3300007076 Bacteria 773
313 Ga0099794_10021952 3300007265 Bacteria 2905
314 Ga0105240_10002588 3300009093 Bacteria 28968
315 Ga0105240_10006114 3300009093 Bacteria 17759
316 Ga0105240_10009049 3300009093 Bacteria 14140
317 Ga0105240_10081009 3300009093 Bacteria 3990
318 Ga0105240_10137524 3300009093 Bacteria 2924
319 Ga0105240_10158765 3300009093 Unclassified 2688
320 Ga0105240_10294742 3300009093 Bacteria 1858
321 Ga0105240_10388988 3300009093 Bacteria 1573
322 Ga0105240_10551245 3300009093 Bacteria 1275
323 Ga0105240_10933405 3300009093 Bacteria 932
324 Ga0105240_11305864 3300009093 Unclassified 765
325 Ga0111539_10007771 3300009094 Bacteria 13688
326 Ga0111539_10042941 3300009094 Bacteria 5425
327 Ga0111539_10045003 3300009094 Bacteria 5285
328 Ga0111539_10099161 3300009094 Bacteria 3422
329 Ga0105245_10001598 3300009098 Bacteria 20620
330 Ga0105245_10009190 3300009098 Bacteria 8617
331 Ga0105245_10016334 3300009098 Bacteria 6473
332 Ga0105245_10074173 3300009098 Bacteria 3096
333 Ga0105245_10109654 3300009098 Bacteria 2565
334 Ga0105245_10117859 3300009098 Bacteria 2477
335 Ga0105245_10136236 3300009098 Bacteria 2308
336 Ga0105245_10143593 3300009098 Bacteria 2250
337 Ga0105245_10167105 3300009098 Unclassified 2092
338 Ga0105245_10311716 3300009098 Unclassified 1547
339 Ga0105245_10369481 3300009098 Unclassified 1426
340 Ga0105245_10374774 3300009098 Bacteria 1416
341 Ga0105245_10554650 3300009098 Bacteria 1171
342 Ga0105245_10656773 3300009098 Unclassified 1079
343 Ga0105245_11352028 3300009098 Unclassified 762
344 Ga0105245_11876754 3300009098 Unclassified 652
345 Ga0105247_10112158 3300009101 Unclassified 1757
346 Ga0114129_10000153 3300009147 Bacteria 73434
347 Ga0114129_10024148 3300009147 Bacteria 8616
348 Ga0114129_10137402 3300009147 Bacteria 3353
349 Ga0114129_10194988 3300009147 Bacteria 2747
350 Ga0114129_10238618 3300009147 Bacteria 2445
351 Ga0114129_10501604 3300009147 Bacteria 1585
352 Ga0114129_10671932 3300009147 Bacteria 1334
353 Ga0114129_12012724 3300009147 Bacteria 698
354 Ga0105243_10040926 3300009148 Bacteria 3622
355 Ga0105243_10047350 3300009148 Unclassified 3384
356 Ga0105243_10093402 3300009148 Bacteria 2483
357 Ga0105243_10101031 3300009148 Unclassified 2394
358 Ga0105243_10350613 3300009148 Unclassified 1355
359 Ga0105243_11300264 3300009148 Unclassified 744
360 Ga0105241_10002182 3300009174 Bacteria 14748
361 Ga0105241_10008332 3300009174 Bacteria 7633
362 Ga0105241_10063418 3300009174 Bacteria 2851
363 Ga0105241_10083999 3300009174 Bacteria 2499
364 Ga0105241_10270007 3300009174 Bacteria 1449
365 Ga0105241_10317471 3300009174 Unclassified 1342
366 Ga0105241_10322786 3300009174 Unclassified 1332
367 Ga0105241_10424030 3300009174 Unclassified 1171
368 Ga0105241_11174202 3300009174 Bacteria 726
369 Ga0105242_10026565 3300009176 Bacteria 4589
370 Ga0105242_10030637 3300009176 Bacteria 4296
371 Ga0105242_10037460 3300009176 Bacteria 3896
372 Ga0105242_10053301 3300009176 Bacteria 3302
373 Ga0105242_10076849 3300009176 Unclassified 2784
374 Ga0105242_10101331 3300009176 Unclassified 2440
375 Ga0105242_10164366 3300009176 Bacteria 1945
376 Ga0105242_10200063 3300009176 Bacteria 1774
377 Ga0105242_10288403 3300009176 Bacteria 1493
378 Ga0105242_10308967 3300009176 Bacteria 1446
379 Ga0105242_10356654 3300009176 Bacteria 1352
380 Ga0105242_11219366 3300009176 Unclassified 772
381 Ga0105242_11636330 3300009176 Bacteria 678
382 Ga0105242_12989164 3300009176 Unclassified 523
383 Ga0105248_10001136 3300009177 Bacteria 29626
384 Ga0105248_10009526 3300009177 Bacteria 10689
385 Ga0105248_10035236 3300009177 Bacteria 5599
386 Ga0105248_10044359 3300009177 Bacteria 4987
387 Ga0105248_10058702 3300009177 Bacteria 4321
388 Ga0105248_10060946 3300009177 Bacteria 4236
389 Ga0105248_10075845 3300009177 Bacteria 3779
390 Ga0105248_10131287 3300009177 Bacteria 2826
391 Ga0105248_10136588 3300009177 Unclassified 2766
392 Ga0105248_10195271 3300009177 Bacteria 2280
393 Ga0105248_10539762 3300009177 Unclassified 1315
394 Ga0105248_12353856 3300009177 Unclassified 607
395 Ga0105237_10007273 3300009545 Bacteria 12148
396 Ga0105237_10015088 3300009545 Bacteria 8051
397 Ga0105237_10055577 3300009545 Bacteria 3964
398 Ga0105237_10129760 3300009545 Bacteria 2515
399 Ga0105237_10328776 3300009545 Bacteria 1533
400 Ga0105237_10920298 3300009545 Bacteria 881
401 Ga0105237_11386761 3300009545 Unclassified 709
402 Ga0105238_10004033 3300009551 Bacteria 14566
403 Ga0105238_10004718 3300009551 Bacteria 13477
404 Ga0105238_10006871 3300009551 Bacteria 11364
405 Ga0105238_10019996 3300009551 Bacteria 6815
406 Ga0105238_10024610 3300009551 Bacteria 6136
407 Ga0105238_10058613 3300009551 Bacteria 3859
408 Ga0105238_10073691 3300009551 Bacteria 3408
409 Ga0105238_10091602 3300009551 Unclassified 3027
410 Ga0105238_10124692 3300009551 Bacteria 2555
411 Ga0105238_10435315 3300009551 Unclassified 1307
412 Ga0105238_11361924 3300009551 Bacteria 736
413 Ga0105238_12139236 3300009551 Unclassified 594
414 Ga0105238_12328458 3300009551 Unclassified 571
415 Ga0105249_10012667 3300009553 Bacteria 7437
416 Ga0105249_10031669 3300009553 Bacteria 4783
417 Ga0105249_10324251 3300009553 Unclassified 1552
418 Ga0105249_10580681 3300009553 Bacteria 1174
419 Ga0105239_10001243 3300010375 Bacteria 34669
420 Ga0105239_10003025 3300010375 Bacteria 20951
421 Ga0105239_10028292 3300010375 Bacteria 6166
422 Ga0105239_10079327 3300010375 Bacteria 3612
423 Ga0105239_10126396 3300010375 Unclassified 2842
424 Ga0105246_10031209 3300011119 Bacteria 3525
425 Ga0105246_10042303 3300011119 Bacteria 3085
426 Ga0105246_10106310 3300011119 Unclassified 2053
427 Ga0105246_10397105 3300011119 Bacteria 1144
428 Ga0105246_10803273 3300011119 Unclassified 835
429 Ga0105246_11157640 3300011119 Unclassified 709
430 Ga0157373_10460647 3300013100 Unclassified 916
431 Ga0157373_11071205 3300013100 Unclassified 604
432 Ga0157371_10071601 3300013102 Unclassified 2454
433 Ga0157370_10002217 3300013104 Bacteria 23692
434 Ga0157370_10005870 3300013104 Bacteria 13703
435 Ga0157370_10105625 3300013104 Unclassified 2636
436 Ga0157370_10109990 3300013104 Bacteria 2576
437 Ga0157369_10000587 3300013105 Bacteria 47424
438 Ga0157369_10002200 3300013105 Bacteria 23482
439 Ga0157369_10002261 3300013105 Bacteria 23149
440 Ga0157369_10018710 3300013105 Bacteria 7768
441 Ga0157369_10019978 3300013105 Bacteria 7490
442 Ga0157369_11407332 3300013105 Unclassified 710
443 Ga0157369_11863655 3300013105 Bacteria 611
444 Ga0157374_10072230 3300013296 Bacteria 3255
445 Ga0157374_10131434 3300013296 Bacteria 2423
446 Ga0157374_10143738 3300013296 Bacteria 2317
447 Ga0157374_10160342 3300013296 Bacteria 2191
448 Ga0157374_10305832 3300013296 Unclassified 1574
449 Ga0157374_10329011 3300013296 Unclassified 1515
450 Ga0157374_10523885 3300013296 Bacteria 1191
451 Ga0157374_11026445 3300013296 Bacteria 844
452 Ga0157374_11062381 3300013296 Unclassified 830
453 Ga0157378_10002744 3300013297 Bacteria 15684
454 Ga0157378_10039411 3300013297 Bacteria 4190
455 Ga0157378_10171154 3300013297 Unclassified 2037
456 Ga0157378_10390926 3300013297 Bacteria 1368
457 Ga0157378_10478933 3300013297 Unclassified 1240
458 Ga0163162_10100500 3300013306 Bacteria 2984
459 Ga0163162_10232201 3300013306 Bacteria 1975
460 Ga0163162_10300486 3300013306 Bacteria 1737
461 Ga0163162_10709863 3300013306 Bacteria 1127
462 Ga0163162_10855033 3300013306 Bacteria 1025
463 Ga0163162_10941600 3300013306 Bacteria 975
464 Ga0163162_11005129 3300013306 Bacteria 943
465 Ga0163162_11009152 3300013306 Bacteria 941
466 Ga0157372_10002038 3300013307 Bacteria 21977
467 Ga0157372_10004925 3300013307 Bacteria 14182
468 Ga0157372_10005878 3300013307 Bacteria 13059
469 Ga0157372_10013921 3300013307 Bacteria 8595
470 Ga0157372_10045750 3300013307 Bacteria 4857
471 Ga0157372_10244737 3300013307 Bacteria 2081
472 Ga0157372_10538713 3300013307 Bacteria 1361
473 Ga0157372_10564689 3300013307 Bacteria 1326
474 Ga0157372_11029688 3300013307 Bacteria 953
475 Ga0157372_11344227 3300013307 Bacteria 824
476 Ga0157372_11566352 3300013307 Unclassified 759
477 Ga0157372_11993671 3300013307 Unclassified 667
478 Ga0157375_10006905 3300013308 Bacteria 9904
479 Ga0157375_10009069 3300013308 Bacteria 8709
480 Ga0157375_10378248 3300013308 Bacteria 1583
481 Ga0157375_10415787 3300013308 Unclassified 1511
482 Ga0157375_11067099 3300013308 Unclassified 945
483 Ga0157375_11094594 3300013308 Unclassified 933
484 Ga0157375_12781087 3300013308 Unclassified 585
485 Ga0163163_10074157 3300014325 Bacteria 3394
486 Ga0163163_10511234 3300014325 Unclassified 1263
487 Ga0163163_10887399 3300014325 Bacteria 955
488 Ga0163163_10902915 3300014325 Bacteria 947
489 Ga0163163_12126175 3300014325 Unclassified 621
490 Ga0157380_10321750 3300014326 Bacteria 1434
491 Ga0157380_10707130 3300014326 Bacteria 1013
492 Ga0157377_10181095 3300014745 Unclassified 1325
493 Ga0157377_10710806 3300014745 Unclassified 731
494 Ga0157377_11014136 3300014745 Bacteria 629
495 Ga0157379_10101709 3300014968 Bacteria 2579
496 Ga0157379_10177756 3300014968 Bacteria 1922
497 Ga0157379_10493696 3300014968 Unclassified 1134
498 Ga0157379_11287278 3300014968 Unclassified 706
499 Ga0157379_11528906 3300014968 Unclassified 650
500 Ga0157376_10078263 3300014969 Bacteria 2831
501 Ga0157376_10084034 3300014969 Bacteria 2740
502 Ga0157376_10207703 3300014969 Bacteria 1806
503 Ga0157376_10491033 3300014969 Unclassified 1205
504 Ga0157376_10546365 3300014969 Bacteria 1146
505 Ga0157376_10568711 3300014969 Bacteria 1124
506 Ga0157376_10649166 3300014969 Unclassified 1055
507 Ga0157376_11102676 3300014969 Unclassified 819
508 Ga0157376_11172541 3300014969 Unclassified 796
509 Ga0157376_13065828 3300014969 Unclassified 506
510 Ga0197907_11355935 3300020069 Bacteria 943
511 Ga0206356_10168128 3300020070 Bacteria 898
512 Ga0206356_10818372 3300020070 Unclassified 3896
513 Ga0206356_11703082 3300020070 Bacteria 1127
514 Ga0206349_1030428 3300020075 Bacteria 1060
515 Ga0206355_1125849 3300020076 Unclassified 1553
516 Ga0206352_10309109 3300020078 Unclassified 1638
517 Ga0206352_10548793 3300020078 Bacteria 888
518 Ga0206352_10776619 3300020078 Bacteria 798
519 Ga0206350_11578675 3300020080 Bacteria 2854
520 Ga0213876_10020527 3300021384 Bacteria 3492
521 Ga0213876_10130465 3300021384 Bacteria 1336
522 Ga0213876_10415668 3300021384 Bacteria 715
523 Ga0213876_10563666 3300021384 Unclassified 606
524 Ga0213875_10038848 3300021388 Bacteria 2243
525 Ga0213875_10176804 3300021388 Unclassified 1002
526 Ga0224712_10059868 3300022467 Unclassified 1513
527 Ga0224712_10067629 3300022467 Bacteria 1442
528 Ga0207692_10093713 3300025898 Bacteria 1634
529 Ga0207642_10080795 3300025899 Bacteria 1578
530 Ga0207642_10179365 3300025899 Bacteria 1153
531 Ga0207710_10145907 3300025900 Bacteria 1145
532 Ga0207680_11082023 3300025903 Unclassified 573
533 Ga0207647_10397384 3300025904 Bacteria 777
534 Ga0207699_10374653 3300025906 Bacteria 1009
535 Ga0207699_10662872 3300025906 Bacteria 763
536 Ga0207645_10805318 3300025907 Unclassified 639
537 Ga0207643_10244289 3300025908 Bacteria 1104
538 Ga0207643_10708485 3300025908 Unclassified 651
539 Ga0207684_10135846 3300025910 Bacteria 2112
540 Ga0207684_10668597 3300025910 Bacteria 884
541 Ga0207654_10003701 3300025911 Bacteria 7712
542 Ga0207654_10003892 3300025911 Bacteria 7524
543 Ga0207654_10058991 3300025911 Bacteria 2236
544 Ga0207654_10474310 3300025911 Unclassified 880
545 Ga0207654_10564980 3300025911 Unclassified 809
546 Ga0207654_10694988 3300025911 Bacteria 730
547 Ga0207707_10000567 3300025912 Bacteria 37470
548 Ga0207707_10001348 3300025912 Bacteria 22873
549 Ga0207707_10027488 3300025912 Bacteria 4974
550 Ga0207707_10766644 3300025912 Unclassified 806
551 Ga0207695_10001123 3300025913 Bacteria 46509
552 Ga0207695_10003190 3300025913 Bacteria 23367
553 Ga0207695_10003846 3300025913 Bacteria 20787
554 Ga0207695_10004024 3300025913 Bacteria 20235
555 Ga0207695_10282558 3300025913 Bacteria 1553
556 Ga0207695_10502188 3300025913 Bacteria 1095
557 Ga0207695_11134138 3300025913 Unclassified 662
558 Ga0207671_10005457 3300025914 Bacteria 11704
559 Ga0207671_10026432 3300025914 Bacteria 4350
560 Ga0207671_10084887 3300025914 Bacteria 2378
561 Ga0207671_10102078 3300025914 Bacteria 2174
562 Ga0207671_10511608 3300025914 Bacteria 957
563 Ga0207671_10879173 3300025914 Unclassified 709
564 Ga0207693_10271319 3300025915 Bacteria 1329
565 Ga0207693_10352669 3300025915 Bacteria 1151
566 Ga0207693_11205580 3300025915 Unclassified 570
567 Ga0207663_10109485 3300025916 Unclassified 1872
568 Ga0207663_10123444 3300025916 Bacteria 1777
569 Ga0207663_10125415 3300025916 Bacteria 1765
570 Ga0207663_10229445 3300025916 Bacteria 1355
571 Ga0207660_10108867 3300025917 Bacteria 2082
572 Ga0207660_10295063 3300025917 Unclassified 1290
573 Ga0207660_10701349 3300025917 Bacteria 826
574 Ga0207662_10362349 3300025918 Unclassified 976
575 Ga0207657_10029205 3300025919 Bacteria 5022
576 Ga0207657_10146368 3300025919 Bacteria 1927
577 Ga0207657_10187503 3300025919 Bacteria 1670
578 Ga0207657_10537517 3300025919 Unclassified 914
579 Ga0207649_10188180 3300025920 Unclassified 1450
580 Ga0207649_10301855 3300025920 Bacteria 1171
581 Ga0207649_10528774 3300025920 Bacteria 900
582 Ga0207652_10005806 3300025921 Bacteria 10012
583 Ga0207652_10005857 3300025921 Bacteria 9952
584 Ga0207652_10820535 3300025921 Bacteria 825
585 Ga0207646_10202872 3300025922 Unclassified 1791
586 Ga0207681_10379183 3300025923 Bacteria 1138
587 Ga0207694_10000348 3300025924 Bacteria 43729
588 Ga0207694_10004755 3300025924 Bacteria 10558
589 Ga0207694_10014781 3300025924 Bacteria 5886
590 Ga0207694_10018587 3300025924 Bacteria 5253
591 Ga0207694_10049373 3300025924 Bacteria 3257
592 Ga0207694_10055615 3300025924 Bacteria 3072
593 Ga0207694_10146613 3300025924 Bacteria 1900
594 Ga0207694_10204227 3300025924 Unclassified 1608
595 Ga0207694_10231687 3300025924 Bacteria 1508
596 Ga0207694_10421512 3300025924 Unclassified 1112
597 Ga0207694_10568588 3300025924 Unclassified 952
598 Ga0207650_10002798 3300025925 Bacteria 12050
599 Ga0207659_10052047 3300025926 Bacteria 2915
600 Ga0207659_11132980 3300025926 Unclassified 673
601 Ga0207687_10001518 3300025927 Bacteria 15899
602 Ga0207687_10012048 3300025927 Bacteria 5654
603 Ga0207687_10021052 3300025927 Bacteria 4329
604 Ga0207687_10074857 3300025927 Bacteria 2428
605 Ga0207687_10079534 3300025927 Unclassified 2364
606 Ga0207687_10131692 3300025927 Bacteria 1886
607 Ga0207687_10208461 3300025927 Unclassified 1532
608 Ga0207687_10352074 3300025927 Unclassified 1200
609 Ga0207687_10556617 3300025927 Unclassified 963
610 Ga0207687_10630981 3300025927 Unclassified 905
611 Ga0207687_10804075 3300025927 Bacteria 802
612 Ga0207687_10897397 3300025927 Unclassified 758
613 Ga0207700_10002286 3300025928 Bacteria 10997
614 Ga0207700_10031655 3300025928 Bacteria 3761
615 Ga0207700_10258819 3300025928 Unclassified 1489
616 Ga0207700_10498069 3300025928 Unclassified 1078
617 Ga0207700_10946578 3300025928 Bacteria 771
618 Ga0207664_10009122 3300025929 Bacteria 6949
619 Ga0207644_10087928 3300025931 Bacteria 2310
620 Ga0207644_10287961 3300025931 Bacteria 1320
621 Ga0207644_10344232 3300025931 Bacteria 1209
622 Ga0207690_10412506 3300025932 Bacteria 1079
623 Ga0207690_11359157 3300025932 Bacteria 594
624 Ga0207706_10054048 3300025933 Bacteria 3545
625 Ga0207706_10248102 3300025933 Bacteria 1555
626 Ga0207686_10019473 3300025934 Bacteria 3862
627 Ga0207686_10023523 3300025934 Bacteria 3560
628 Ga0207686_10132550 3300025934 Bacteria 1711
629 Ga0207686_10168514 3300025934 Bacteria 1542
630 Ga0207686_10183296 3300025934 Bacteria 1486
631 Ga0207686_10239290 3300025934 Bacteria 1320
632 Ga0207686_10259708 3300025934 Bacteria 1273
633 Ga0207686_10374615 3300025934 Bacteria 1078
634 Ga0207686_10433819 3300025934 Unclassified 1007
635 Ga0207709_10053822 3300025935 Bacteria 2478
636 Ga0207709_10094757 3300025935 Bacteria 1960
637 Ga0207709_10297930 3300025935 Bacteria 1198
638 Ga0207670_10199926 3300025936 Unclassified 1518
639 Ga0207670_10211989 3300025936 Bacteria 1478
640 Ga0207670_10367965 3300025936 Bacteria 1142
641 Ga0207670_10720009 3300025936 Bacteria 827
642 Ga0207670_11243545 3300025936 Bacteria 631
643 Ga0207704_10037607 3300025938 Bacteria 2797
644 Ga0207704_10251783 3300025938 Bacteria 1326
645 Ga0207704_10351509 3300025938 Bacteria 1148
646 Ga0207691_10205192 3300025940 Bacteria 1714
647 Ga0207691_10329532 3300025940 Bacteria 1308
648 Ga0207711_10001511 3300025941 Bacteria 21627
649 Ga0207711_10001890 3300025941 Bacteria 19067
650 Ga0207711_10043970 3300025941 Bacteria 3811
651 Ga0207711_10086763 3300025941 Bacteria 2745
652 Ga0207711_10093497 3300025941 Unclassified 2648
653 Ga0207711_10109516 3300025941 Bacteria 2454
654 Ga0207711_10654084 3300025941 Bacteria 980
655 Ga0207711_10663787 3300025941 Bacteria 973
656 Ga0207711_11465092 3300025941 Unclassified 626
657 Ga0207689_10049037 3300025942 Bacteria 3484
658 Ga0207689_10065640 3300025942 Unclassified 2985
659 Ga0207689_10065691 3300025942 Bacteria 2984
660 Ga0207689_10096422 3300025942 Unclassified 2429
661 Ga0207689_10437950 3300025942 Unclassified 1092
662 Ga0207689_10781230 3300025942 Bacteria 806
663 Ga0207661_10014829 3300025944 Bacteria 5716
664 Ga0207661_10031659 3300025944 Bacteria 4089
665 Ga0207661_10041592 3300025944 Bacteria 3618
666 Ga0207661_10050076 3300025944 Bacteria 3326
667 Ga0207661_10403053 3300025944 Bacteria 1240
668 Ga0207661_10430732 3300025944 Bacteria 1199
669 Ga0207661_10591179 3300025944 Unclassified 1018
670 Ga0207661_11116501 3300025944 Bacteria 726
671 Ga0207661_11784499 3300025944 Unclassified 561
672 Ga0207679_10017649 3300025945 Bacteria 4764
673 Ga0207679_10267919 3300025945 Bacteria 1459
674 Ga0207679_10715460 3300025945 Bacteria 909
675 Ga0207679_11483341 3300025945 Unclassified 622
676 Ga0207667_10000369 3300025949 Bacteria 60858
677 Ga0207667_10000558 3300025949 Bacteria 48930
678 Ga0207667_10000650 3300025949 Bacteria 45011
679 Ga0207667_10007172 3300025949 Bacteria 13445
680 Ga0207667_10011270 3300025949 Bacteria 10399
681 Ga0207667_10018492 3300025949 Bacteria 7812
682 Ga0207667_10039858 3300025949 Bacteria 5003
683 Ga0207651_10160381 3300025960 Bacteria 1762
684 Ga0207651_10189757 3300025960 Bacteria 1638
685 Ga0207651_10218859 3300025960 Bacteria 1538
686 Ga0207712_10077811 3300025961 Bacteria 2405
687 Ga0207712_10346299 3300025961 Unclassified 1234
688 Ga0207712_10761583 3300025961 Unclassified 849
689 Ga0207640_10052260 3300025981 Unclassified 2661
690 Ga0207640_10345972 3300025981 Bacteria 1193
691 Ga0207658_10128377 3300025986 Bacteria 2033
692 Ga0207658_10596019 3300025986 Unclassified 992
693 Ga0207658_10851838 3300025986 Unclassified 829
694 Ga0207677_10080746 3300026023 Bacteria 2331
695 Ga0207677_10270752 3300026023 Unclassified 1389
696 Ga0207677_10677303 3300026023 Bacteria 913
697 Ga0207677_10868001 3300026023 Bacteria 812
698 Ga0207677_11098164 3300026023 Bacteria 725
699 Ga0207677_11971555 3300026023 Unclassified 543
700 Ga0207703_10014466 3300026035 Bacteria 6154
701 Ga0207703_10028780 3300026035 Bacteria 4383
702 Ga0207703_10055585 3300026035 Bacteria 3221
703 Ga0207703_10057058 3300026035 Bacteria 3182
704 Ga0207703_10109401 3300026035 Bacteria 2356
705 Ga0207703_10175063 3300026035 Bacteria 1890
706 Ga0207703_10326425 3300026035 Bacteria 1407
707 Ga0207703_10513694 3300026035 Bacteria 1126
708 Ga0207703_10697782 3300026035 Bacteria 965
709 Ga0207703_11409507 3300026035 Bacteria 670
710 Ga0207639_10045485 3300026041 Bacteria 3306
711 Ga0207639_10065656 3300026041 Bacteria 2818
712 Ga0207639_10081096 3300026041 Bacteria 2569
713 Ga0207639_10359057 3300026041 Unclassified 1303
714 Ga0207639_11030078 3300026041 Unclassified 771
715 Ga0207678_10511371 3300026067 Bacteria 1047
716 Ga0207708_10093698 3300026075 Bacteria 2318
717 Ga0207708_10327234 3300026075 Bacteria 1252
718 Ga0207702_10004880 3300026078 Bacteria 11806
719 Ga0207702_10035528 3300026078 Bacteria 4168
720 Ga0207702_10065231 3300026078 Bacteria 3118
721 Ga0207702_10113785 3300026078 Unclassified 2411
722 Ga0207702_10162764 3300026078 Bacteria 2039
723 Ga0207702_10276589 3300026078 Bacteria 1585
724 Ga0207702_10319199 3300026078 Bacteria 1479
725 Ga0207702_10336993 3300026078 Bacteria 1440
726 Ga0207702_10665704 3300026078 Unclassified 1024
727 Ga0207702_11654122 3300026078 Bacteria 633
728 Ga0207641_10142600 3300026088 Bacteria 2163
729 Ga0207641_10214355 3300026088 Bacteria 1782
730 Ga0207641_10766098 3300026088 Bacteria 953
731 Ga0207648_10028077 3300026089 Bacteria 4991
732 Ga0207648_10078214 3300026089 Unclassified 2885
733 Ga0207648_10146964 3300026089 Bacteria 2079
734 Ga0207648_10346583 3300026089 Bacteria 1338
735 Ga0207648_10810684 3300026089 Unclassified 872
736 Ga0207648_11599578 3300026089 Unclassified 612
737 Ga0207676_10073593 3300026095 Bacteria 2750
738 Ga0207676_10272942 3300026095 Bacteria 1532
739 Ga0207676_10294026 3300026095 Bacteria 1480
740 Ga0207676_10676505 3300026095 Bacteria 998
741 Ga0207676_10819909 3300026095 Bacteria 909
742 Ga0207676_11003727 3300026095 Bacteria 822
743 Ga0207676_12290727 3300026095 Unclassified 538
744 Ga0207674_10000063 3300026116 Bacteria 110904
745 Ga0207674_10000484 3300026116 Bacteria 52530
746 Ga0207674_10000657 3300026116 Bacteria 44932
747 Ga0207674_10003310 3300026116 Bacteria 19811
748 Ga0207674_10124070 3300026116 Unclassified 2548
749 Ga0207674_10787924 3300026116 Bacteria 917
750 Ga0207675_100047384 3300026118 Bacteria 4013
751 Ga0207675_100485099 3300026118 Unclassified 1229
752 Ga0207675_100752740 3300026118 Bacteria 986
753 Ga0207675_100852951 3300026118 Bacteria 926
754 Ga0207683_10025344 3300026121 Bacteria 5116
755 Ga0207683_10357236 3300026121 Bacteria 1342
756 Ga0207698_10005842 3300026142 Bacteria 7644
757 Ga0207698_10090092 3300026142 Bacteria 2508
758 Ga0207698_10244801 3300026142 Bacteria 1637
759 Ga0207698_10366235 3300026142 Bacteria 1367
760 Ga0207698_10488128 3300026142 Bacteria 1196
761 Ga0207698_10670886 3300026142 Bacteria 1029
762 Ga0207698_12130543 3300026142 Unclassified 574
763 Ga0209588_1006477 3300027671 Bacteria 3404
764 Ga0209966_1072022 3300027695 Unclassified 758
765 Ga0207428_10025949 3300027907 Bacteria 4896
766 Ga0207428_10238530 3300027907 Bacteria 1359
767 Ga0268265_10864170 3300028380 Bacteria 886
768 Ga0268264_10326260 3300028381 Unclassified 1453
769 Ga0268264_10417623 3300028381 Bacteria 1293
770 Ga0268264_11597463 3300028381 Bacteria 663
771 Ga0268264_12028518 3300028381 Unclassified 584
772 Ga0265775_100924 3300030762 Bacteria 1309
773 Ga0265760_10200186 3300031090 Bacteria 674
774 Ga0265340_10022406 3300031247 Bacteria 3230
775 Ga0265313_10000978 3300031595 Bacteria 28254
776 Ga0265314_10000542 3300031711 Bacteria 48535
777 Ga0373948_0023841 3300034817 Bacteria 1190
778 Ga0373958_0034319 3300034819 Bacteria 1010
779 Ga0373926_0130802 3300035083 Unclassified 950
780 Ga0373934_0003315 3300035086 Bacteria 5894
781 Ga0373934_0006789 3300035086 Bacteria 4250
782 Ga0373934_0085935 3300035086 Bacteria 1266
783 Ga0373944_0152108 3300035089 Unclassified 816
784 Ga0373944_0279496 3300035089 Bacteria 622
785 Ga0373952_0063560 3300035092 Bacteria 908
786 Ga0373923_0025983 3300035111 Bacteria 2326
787 Ga0373923_0146238 3300035111 Bacteria 1071
788 Ga0373936_0180639 3300035113 Bacteria 925
789 Ga0373936_0321744 3300035113 Bacteria 701
790 Ga0373941_0130307 3300035115 Unclassified 905
791 Ga0373953_0053002 3300035117 Bacteria 1643
792 Ga0373954_0008545 3300035118 Bacteria 4498
793 Ga0373954_0015875 3300035118 Bacteria 3368
794 Ga0373954_0026343 3300035118 Bacteria 2665
795 Ga0373954_0041987 3300035118 Bacteria 2133
796 Ga0373954_0076499 3300035118 Bacteria 1595
797 Ga0373954_0559389 3300035118 Unclassified 567
798 Ga0373954_0606001 3300035118 Bacteria 543
799 Ga0373956_0135504 3300035119 Bacteria 1155
800 Ga0373956_0246130 3300035119 Bacteria 850
801 Ga0373943_0163907 3300035170 Bacteria 1212
802 Ga0373946_0285159 3300035171 Unclassified 813
803 Ga0373955_0004305 3300035172 Bacteria 6289
804 Ga0373955_0022020 3300035172 Bacteria 3226
805 Ga0373955_0033572 3300035172 Bacteria 2703
806 Ga0373955_0170191 3300035172 Bacteria 1289
807 Ga0373955_0340296 3300035172 Bacteria 908
808 Ga0373961_0050496 3300035241 Bacteria 1232
809 Ga0373924_0034070 3300035410 Bacteria 2060
810 Ga0373924_0069773 3300035410 Bacteria 1481
811 Ga0373931_0059241 3300035691 Bacteria 2059
812 Ga0373931_1213679 3300035691 Unclassified 517
813 Ga0373935_0094008 3300035692 Bacteria 1967
814 Ga0373935_0096540 3300035692 Bacteria 1943
815 Ga0373935_0108233 3300035692 Bacteria 1841
816 Ga0373935_0173147 3300035692 Bacteria 1478
817 Ga0373935_0217397 3300035692 Bacteria 1326
818 Ga0373927_0003526 3300035695 Bacteria 11197
819 Ga0373927_0048222 3300035695 Unclassified 2755
820 Ga0373927_0087005 3300035695 Bacteria 2029
821 Ga0373927_0240847 3300035695 Unclassified 1189
822 Ga0373927_0317964 3300035695 Bacteria 1025
823 Ga0373933_0022280 3300035724 Bacteria 3606
824 Ga0373933_0144416 3300035724 Unclassified 1504
825 Ga0373933_0185102 3300035724 Bacteria 1329
826 Ga0373933_0236110 3300035724 Bacteria 1175
827 Ga0373933_0314482 3300035724 Unclassified 1015
828 Ga0373933_0876253 3300035724 Bacteria 591
829 Ga0373947_0000466 3300035725 Bacteria 23099
830 Ga0373947_0108943 3300035725 Bacteria 1748
831 Ga0373947_0239105 3300035725 Unclassified 1198
832 Ga0373947_0375590 3300035725 Bacteria 956
833 Ga0373937_0002529 3300036401 Bacteria 15180
834 Ga0373937_0009057 3300036401 Bacteria 8639
835 Ga0373937_0017813 3300036401 Bacteria 6338
836 Ga0373937_0037647 3300036401 Bacteria 4408
837 Ga0373937_0121986 3300036401 Bacteria 2429
838 Ga0373937_0151304 3300036401 Unclassified 2174
839 Ga0373937_0252277 3300036401 Unclassified 1663
840 Ga0373937_0450507 3300036401 Unclassified 1222
841 Ga0373937_0528735 3300036401 Unclassified 1120
842 Ga0373925_0001318 3300037068 Bacteria 21737
843 Ga0373925_0462200 3300037068 Bacteria 1040
844 Ga0373925_0509357 3300037068 Bacteria 988
845 Ga0395900_1670412 3300037418 Unclassified 548
846 Ga0436364_0014045 3300037853 Bacteria 3934
847 Ga0436364_0112772 3300037853 Bacteria 6952
848 Ga0436364_0888227 3300037853 Bacteria 543
849 Ga0436365_0792504 3300039437 Bacteria 1592
850 Ga0436365_1210156 3300039437 Unclassified 1207
851 Ga0436365_1620093 3300039437 Bacteria 2567
852 Ga0436365_1776261 3300039437 Bacteria 1758
853 Ga0436362_1071320 3300039453 Bacteria 3026
854 Ga0439460_0073772 3300042461 Bacteria 1061
855 Ga0453683_0308974 3300044673 Unclassified 1012
856 Ga0453683_0484205 3300044673 Unclassified 802
857 Ga0453684_1054812 3300044712 Unclassified 861
858 Ga0453684_1425785 3300044712 Unclassified 717
859 Ga0451576_0022151 3300045051 Bacteria 6894
860 Ga0451576_0068440 3300045051 Bacteria 3694
861 Ga0451576_0109274 3300045051 Bacteria 2877
862 Ga0451576_0132970 3300045051 Bacteria 2593
863 Ga0451576_0445353 3300045051 Bacteria 1359
864 Ga0495592_0029498 3300046454 Bacteria 4154
865 Ga0495603_0221726 3300046455 Bacteria 1091
866 Ga0495651_0056024 3300046462 Bacteria 3028
867 Ga0495651_0254712 3300046462 Bacteria 1197
868 Ga0495651_0525238 3300046462 Bacteria 755
869 Ga0495580_0051798 3300046472 Unclassified 2901
870 Ga0495580_0126601 3300046472 Bacteria 1773
871 Ga0495580_0215870 3300046472 Bacteria 1319
872 Ga0495582_0009156 3300046473 Bacteria 5462
873 Ga0495584_0069478 3300046491 Bacteria 1770
874 Ga0495594_0360331 3300046499 Bacteria 828
875 Ga0495594_0417051 3300046499 Unclassified 764
876 Ga0495628_0327363 3300046516 Bacteria 1130
877 Ga0495628_0371286 3300046516 Bacteria 1049
878 Ga0495630_0407759 3300046517 Unclassified 1041
879 Ga0495630_0808049 3300046517 Bacteria 716
880 Ga0495630_1130738 3300046517 Unclassified 593
881 Ga0495663_0144644 3300046525 Bacteria 808
882 Ga0495666_0128649 3300046526 Bacteria 1184
883 Ga0495652_0063982 3300046529 Bacteria 3096
884 Ga0495652_0155725 3300046529 Bacteria 1780
885 Ga0495652_0239338 3300046529 Unclassified 1352
886 Ga0495652_0387089 3300046529 Bacteria 993
887 Ga0495652_0462545 3300046529 Bacteria 886
888 Ga0495665_0038934 3300046531 Bacteria 2534
889 Ga0495665_0558912 3300046531 Unclassified 574
890 Ga0495587_0000822 3300046536 Bacteria 20574
891 Ga0495587_0003986 3300046536 Bacteria 9787
892 Ga0495587_0262822 3300046536 Bacteria 969
893 Ga0495621_0081672 3300046539 Bacteria 1206
894 Ga0495645_0106650 3300046543 Bacteria 1987
895 Ga0495645_0661058 3300046543 Bacteria 637
896 Ga0495667_0090237 3300046559 Bacteria 1986
897 Ga0495667_0455408 3300046559 Bacteria 804
898 Ga0495667_1030466 3300046559 Unclassified 501
899 Ga0495656_0684306 3300046615 Unclassified 551
900 Ga0495668_0239833 3300046616 Bacteria 993
901 Ga0495634_0029752 3300046642 Bacteria 3780
902 Ga0495634_0404099 3300046642 Bacteria 811
903 Ga0495635_0260042 3300046663 Unclassified 1169
904 Ga0495635_1098413 3300046663 Bacteria 503
905 Ga0495659_0063027 3300046664 Unclassified 1373
906 Ga0495659_0084306 3300046664 Bacteria 1211
907 Ga0495599_0011458 3300046678 Bacteria 5448
908 Ga0495599_0021022 3300046678 Bacteria 4069
909 Ga0495599_0149864 3300046678 Bacteria 1445
910 Ga0495599_0222482 3300046678 Bacteria 1154
911 Ga0495599_0401531 3300046678 Unclassified 816
912 Ga0495599_0681168 3300046678 Unclassified 594
913 Ga0495623_0204731 3300046679 Bacteria 1133
914 Ga0495658_0007879 3300046683 Bacteria 5274
915 Ga0495658_0056030 3300046683 Bacteria 2247
916 Ga0495669_0015225 3300046684 Bacteria 3293
917 Ga0495669_0073447 3300046684 Unclassified 1562
918 Ga0495669_0302325 3300046684 Unclassified 771
919 Ga0495613_0143161 3300046689 Bacteria 1707
920 Ga0495589_0255161 3300046794 Bacteria 819
921 Ga0495600_0844692 3300046809 Bacteria 543
922 Ga0495604_0627625 3300047317 Bacteria 687
923 Ga0495674_0139931 3300047319 Bacteria 2035
924 Ga0495674_0169578 3300047319 Bacteria 1822
925 Ga0495674_0514904 3300047319 Bacteria 956
926 Ga0495680_0054934 3300047322 Bacteria 3090
927 Ga0495680_0092088 3300047322 Bacteria 2272
928 Ga0495680_0879924 3300047322 Bacteria 580
929 Ga0495675_0092652 3300047444 Unclassified 1896
930 Ga0495675_0174387 3300047444 Bacteria 1319
931 Ga0495685_072958 3300047447 Bacteria 1148
932 Ga0495684_0006795 3300047471 Bacteria 8883
933 Ga0495684_0103544 3300047471 Bacteria 2151
934 Ga0495684_0463344 3300047471 Bacteria 878
935 Ga0495602_0001193 3300048088 Bacteria 25517
936 Ga0495602_0005450 3300048088 Bacteria 13344
937 Ga0495602_0195182 3300048088 Bacteria 1549
938 Ga0496102_0225926 3300048905 Bacteria 1765
939 Ga0496102_1166034 3300048905 Unclassified 690
940 Ga0496104_0050189 3300048907 Bacteria 3937
941 Ga0496104_1393341 3300048907 Unclassified 604
942 Ga0496106_0632654 3300048909 Unclassified 856
943 Ga0496106_1361946 3300048909 Unclassified 549
944 Ga0496112_0189988 3300048915 Unclassified 2016
945 Ga0496112_0450444 3300048915 Unclassified 1225
946 Ga0496115_0096149 3300048918 Bacteria 2425
947 Ga0496115_0139999 3300048918 Unclassified 1996
948 Ga0501068_0213450 3300049584 Bacteria 1226
949 Ga0501068_0426946 3300049584 Bacteria 856
950 nmdc:mga05p37_133348_c1 3300050507 Bacteria 3047
951 nmdc:mga05p37_1387951_c1 3300050507 Bacteria 709
952 nmdc:mga05p37_247851_c1 3300050507 Bacteria 2138
953 nmdc:mga05p37_3548_c1 3300050507 Bacteria 18214
954 nmdc:mga05p37_397445_c1 3300050507 Unclassified 1610
955 nmdc:mga05p37_42105_c1 3300050507 Bacteria 5610
956 nmdc:mga05p37_6452_c1 3300050507 Bacteria 13832
957 nmdc:mga05p37_806414_c1 3300050507 Bacteria 1026
958 nmdc:mga09592_100417_c1 3300050508 Bacteria 2478
959 nmdc:mga09592_177256_c1 3300050508 Unclassified 1843
960 nmdc:mga09592_221852_c1 3300050508 Bacteria 1638
961 nmdc:mga09592_62029_c1 3300050508 Bacteria 3162
962 nmdc:mga0qj67_1362922_c1 3300050509 Unclassified 548
963 nmdc:mga0qj67_33462_c1 3300050509 Bacteria 4011
964 nmdc:mga0qj67_64353_c1 3300050509 Unclassified 2917
965 nmdc:mga06r32_176545_c1 3300050510 Bacteria 2121
966 nmdc:mga06r32_34297_c1 3300050510 Bacteria 4785
967 nmdc:mga08y16_11227_c1 3300050511 Bacteria 5190
968 nmdc:mga08y16_124852_c1 3300050511 Bacteria 2678
969 nmdc:mga08y16_474497_c1 3300050511 Bacteria 1273
970 nmdc:mga08y16_57615_c1 3300050511 Unclassified 4059
971 nmdc:mga0n895_1044046_c1 3300050512 Bacteria 797
972 nmdc:mga0n895_125075_c1 3300050512 Bacteria 2595
973 nmdc:mga0n895_1789829_c1 3300050512 Unclassified 575
974 nmdc:mga0n895_245025_c1 3300050512 Bacteria 1819
975 nmdc:mga0n895_426840_c1 3300050512 Bacteria 1340
976 nmdc:mga0n895_67697_c1 3300050512 Bacteria 3537
977 nmdc:mga0rr50_111966_c1 3300050513 Unclassified 2161
978 nmdc:mga0rr50_1441112_c1 3300050513 Bacteria 583
979 nmdc:mga0rr50_297420_c1 3300050513 Bacteria 1350
980 nmdc:mga0rr50_305194_c1 3300050513 Bacteria 1332
981 nmdc:mga0rr50_355252_c1 3300050513 Unclassified 1233
982 nmdc:mga0rr50_392245_c1 3300050513 Bacteria 1172
983 nmdc:mga0rr50_571795_c1 3300050513 Unclassified 963
984 nmdc:mga08x19_310532_c1 3300050514 Bacteria 1096
985 nmdc:mga08x19_65897_c1 3300050514 Unclassified 2353
986 nmdc:mga08x19_740232_c1 3300050514 Unclassified 698
987 nmdc:mga08x19_846108_c1 3300050514 Bacteria 650
988 nmdc:mga0a205_137502_c1 3300050515 Bacteria 2344
989 nmdc:mga0a205_41720_c1 3300050515 Bacteria 4420
990 nmdc:mga0a205_59469_c1 3300050515 Bacteria 3691
991 nmdc:mga0a205_918980_c1 3300050515 Bacteria 722
992 Ga0495601_0084418 3300053077 Bacteria 2040
993 Ga0495601_0127154 3300053077 Bacteria 1658
994 Ga0495601_0721779 3300053077 Unclassified 635
995 Ga0495619_0254983 3300053085 Bacteria 1216
996 Ga0373934_0324687
997 SwRhRL2b_contig_134348
998 Ga0058859_11726138
999 Ga0058861_11567625
1000 Ga0058861_11666670
1001 Ga0058860_10032041
1002 Ga0058860_11730977
1003 Ga0058862_10653920
1004 Ga0058862_11764429
1005 Ga0065715_10305037
1006 Ga0065715_10534290
1007 Ga0065707_10317247
1008 Ga0070658_10312755
1009 Ga0070676_10073436
1010 Ga0070676_10498912
1011 Ga0070676_10883578
1012 Ga0070683_100000668
1013 Ga0070683_100001579
1014 Ga0070683_100008117
1015 Ga0070683_100063533
1016 Ga0070683_100087057
1017 Ga0070683_100279454
1018 Ga0070683_100321022
1019 Ga0070683_100329826
1020 Ga0070683_100337545
1021 Ga0070690_100371840
1022 Ga0070690_100412354
1023 Ga0070690_100537270
1024 Ga0070670_100009951
1025 Ga0070677_10864044
1026 Ga0068869_100019204
1027 Ga0068869_100100713
1028 Ga0068869_100209394
1029 Ga0068869_100622670
1030 Ga0068869_100690063
1031 Ga0070666_10033122
1032 Ga0070666_10053354
1033 Ga0070680_100003994
1034 Ga0070680_100029305
1035 Ga0070680_100055725
1036 Ga0070680_100473811
1037 Ga0070682_100856609
1038 Ga0068868_100117999
1039 Ga0068868_100162368
1040 Ga0068868_100232182
1041 Ga0068868_100250425
1042 Ga0068868_100520535
1043 Ga0068868_101373881
1044 Ga0068868_101392153
1045 Ga0070660_100089115
1046 Ga0070660_100188248
1047 Ga0070660_100199036
1048 Ga0070689_100080626
1049 Ga0070689_100430874
1050 Ga0070689_100597324
1051 Ga0070689_101453603
1052 Ga0070691_10000648
1053 Ga0070691_10006127
1054 Ga0070691_10042747
1055 Ga0070691_10139770
1056 Ga0070691_10303338
1057 Ga0070687_100010260
1058 Ga0070661_100074809
1059 Ga0070661_100336248
1060 Ga0070661_100761920
1061 Ga0070661_101478756
1062 Ga0070661_101736702
1063 Ga0070692_10121231
1064 Ga0070669_100814346
1065 Ga0070669_101104529
1066 Ga0070675_100016777
1067 Ga0070671_100016939
1068 Ga0070671_100072322
1069 Ga0070671_100109669
1070 Ga0070671_100226470
1071 Ga0070671_100809569
1072 Ga0070673_100086982
1073 Ga0070673_100108115
1074 Ga0070673_100194967
1075 Ga0070673_100823822
1076 Ga0070688_100035067
1077 Ga0070659_100008560
1078 Ga0070667_100348286
1079 Ga0070667_101006357
1080 Ga0070667_101268745
1081 Ga0070709_10087832
1082 Ga0070709_10176559
1083 Ga0070709_10814180
1084 Ga0070709_11132039
1085 Ga0070714_100017969
1086 Ga0070714_100441597
1087 Ga0070714_100891615
1088 Ga0070713_100008512
1089 Ga0070713_100032629
1090 Ga0070713_100163389
1091 Ga0070713_101051922
1092 Ga0070710_10067712
1093 Ga0070710_10253919
1094 Ga0070710_10389933
1095 Ga0070701_10435657
1096 Ga0070701_10530382
1097 Ga0070711_100046386
1098 Ga0070711_100051884
1099 Ga0070711_100070201
1100 Ga0070711_100156478
1101 Ga0070705_100003820
1102 Ga0070705_100065347
1103 Ga0070705_100622466
1104 Ga0070705_101075757
1105 Ga0070700_100363289
1106 Ga0070694_100004969
1107 Ga0070694_100088746
1108 Ga0070694_100760698
1109 Ga0070708_100398408
1110 Ga0070708_100472641
1111 Ga0070708_101472567
1112 Ga0070663_100308876
1113 Ga0070662_100036690
1114 Ga0070662_100228634
1115 Ga0070681_10000972
1116 Ga0070681_10003753
1117 Ga0070681_10163166
1118 Ga0070681_10584258
1119 Ga0070681_10893346
1120 Ga0070681_11885596
1121 Ga0068867_100065175
1122 Ga0068867_100106173
1123 Ga0068867_100112351
1124 Ga0068867_100165064
1125 Ga0068867_100192275
1126 Ga0068867_100413397
1127 Ga0070685_10398812
1128 Ga0070706_100198957
1129 Ga0070707_100126988
1130 Ga0070698_100944871
1131 Ga0070699_100037311
1132 Ga0070699_100712427
1133 Ga0070679_100003226
1134 Ga0070679_100009655
1135 Ga0070679_100323306
1136 Ga0070679_100551693
1137 Ga0070684_100001842
1138 Ga0070684_100002448
1139 Ga0070684_100011967
1140 Ga0070684_100015801
1141 Ga0070684_100018492
1142 Ga0070684_100044151
1143 Ga0070684_100555523
1144 Ga0070684_100742879
1145 Ga0070684_101045404
1146 Ga0070684_101144110
1147 Ga0070697_100191917
1148 Ga0070697_100238255
1149 Ga0070697_100280027
1150 Ga0070697_100348621
1151 Ga0068853_100137042
1152 Ga0068853_100172915
1153 Ga0068853_100174914
1154 Ga0068853_101023023
1155 Ga0070672_100343960
1156 Ga0070672_101227356
1157 Ga0070686_100726872
1158 Ga0070695_100005568
1159 Ga0070695_100062434
1160 Ga0070695_100184223
1161 Ga0070695_100552728
1162 Ga0070696_100003974
1163 Ga0070696_100110820
1164 Ga0070696_100982591
1165 Ga0070696_101129748
1166 Ga0070693_100037989
1167 Ga0070693_100046738
1168 Ga0070693_100156914
1169 Ga0070704_100087264
1170 Ga0070704_100178382
1171 Ga0068855_100013302
1172 Ga0068855_100014595
1173 Ga0068855_100025947
1174 Ga0068855_100083870
1175 Ga0068855_100099341
1176 Ga0068855_100166519
1177 Ga0068855_100297827
1178 Ga0070664_100028503
1179 Ga0070664_100156773
1180 Ga0070664_100616009
1181 Ga0070664_100621898
1182 Ga0070664_100779105
1183 Ga0068857_100000120
1184 Ga0068857_100000543
1185 Ga0068857_100015291
1186 Ga0068857_100022503
1187 Ga0068857_100966793
1188 Ga0068857_101116632
1189 Ga0068854_100032291
1190 Ga0068854_100330775
1191 Ga0068856_100016001
1192 Ga0068856_100039863
1193 Ga0068856_100046698
1194 Ga0068856_100065356
1195 Ga0068856_100077191
1196 Ga0068856_100233503
1197 Ga0068856_100960795
1198 Ga0068856_101243468
1199 Ga0068856_101430336
1200 Ga0070702_100111408
1201 Ga0070702_100315588
1202 Ga0068852_100009295
1203 Ga0068852_100041581
1204 Ga0068852_100052107
1205 Ga0068852_100305758
1206 Ga0068852_100401581
1207 Ga0068852_100876432
1208 Ga0068859_100005183
1209 Ga0068859_100032397
1210 Ga0068859_100568961
1211 Ga0068859_101920291
1212 Ga0068864_100041167
1213 Ga0068864_100089891
1214 Ga0068864_100146382
1215 Ga0068864_100284709
1216 Ga0068864_100552694
1217 Ga0068864_100694953
1218 Ga0068864_100702783
1219 Ga0068864_100791100
1220 Ga0068864_101623228
1221 Ga0068866_10104658
1222 Ga0068861_100011022
1223 Ga0068861_100089290
1224 Ga0068861_100324268
1225 Ga0068861_100435435
1226 Ga0068861_100827136
1227 Ga0068870_10003561
1228 Ga0068870_10025719
1229 Ga0068870_10669500
1230 Ga0068863_100011073
1231 Ga0068863_100121561
1232 Ga0068863_100219703
1233 Ga0068863_102321458
1234 Ga0068858_100012911
1235 Ga0068858_100029827
1236 Ga0068858_100033623
1237 Ga0068858_100056404
1238 Ga0068858_100074200
1239 Ga0068858_100356297
1240 Ga0068858_100356331
1241 Ga0068858_100358282
1242 Ga0068858_100371306
1243 Ga0068858_100621474
1244 Ga0068858_100759024
1245 Ga0068858_102375832
1246 Ga0068860_100054688
1247 Ga0068860_100093525
1248 Ga0068860_100106279
1249 Ga0068860_100367019
1250 Ga0068860_100671522
1251 Ga0068860_102682012
1252 Ga0068862_101149105
1253 Ga0068862_101338003
1254 Ga0070717_10164841
1255 Ga0070717_11692812
1256 Ga0070712_100793502
1257 Ga0070712_101314381
1258 Ga0097621_100046705
1259 Ga0097621_100057681
1260 Ga0097621_100131269
1261 Ga0097621_100138347
1262 Ga0097621_100147982
1263 Ga0097621_100455821
1264 Ga0068871_100023740
1265 Ga0068871_100069598
1266 Ga0068871_100071298
1267 Ga0068871_100101239
1268 Ga0068871_100178262
1269 Ga0068871_100258056
1270 Ga0068871_100476113
1271 Ga0068871_100857641
1272 Ga0075428_100006991
1273 Ga0075428_100009385
1274 Ga0075428_100072397
1275 Ga0075430_100006232
1276 Ga0075430_100262358
1277 Ga0075430_101177451
1278 Ga0075431_100001397
1279 Ga0075431_100081134
1280 Ga0075433_10050736
1281 Ga0075433_10776410
1282 Ga0075433_10866815
1283 Ga0075434_100019558
1284 Ga0075434_100042778
1285 Ga0075434_100092807
1286 Ga0075434_100206194
1287 Ga0075429_100021559
1288 Ga0075429_100043509
1289 Ga0068865_100054622
1290 Ga0068865_100076718
1291 Ga0068865_100141869
1292 Ga0068865_100145328
1293 Ga0068865_101333507
1294 Ga0075436_100044802
1295 Ga0075436_100160897
1296 Ga0075436_100398642
1297 Ga0075436_100759721
1298 Ga0097620_100005183
1299 Ga0097620_100032397
1300 Ga0097620_100568885
1301 Ga0097620_101920306
1302 Ga0075435_100020812
1303 Ga0075435_100031253
1304 Ga0075435_100110529
1305 Ga0075435_100489825
1306 Ga0075435_100545644
1307 Ga0075435_100895973
1308 Ga0099794_10021952
1309 Ga0105240_10002588
1310 Ga0105240_10006114
1311 Ga0105240_10009049
1312 Ga0105240_10081009
1313 Ga0105240_10137524
1314 Ga0105240_10158765
1315 Ga0105240_10294742
1316 Ga0105240_10388988
1317 Ga0105240_10551245
1318 Ga0105240_10933405
1319 Ga0105240_11305864
1320 Ga0111539_10007771
1321 Ga0111539_10042941
1322 Ga0111539_10045003
1323 Ga0111539_10099161
1324 Ga0105245_10001598
1325 Ga0105245_10009190
1326 Ga0105245_10016334
1327 Ga0105245_10074173
1328 Ga0105245_10109654
1329 Ga0105245_10117859
1330 Ga0105245_10136236
1331 Ga0105245_10143593
1332 Ga0105245_10167105
1333 Ga0105245_10311716
1334 Ga0105245_10369481
1335 Ga0105245_10374774
1336 Ga0105245_10554650
1337 Ga0105245_10656773
1338 Ga0105245_11352028
1339 Ga0105245_11876754
1340 Ga0105247_10112158
1341 Ga0114129_10000153
1342 Ga0114129_10024148
1343 Ga0114129_10137402
1344 Ga0114129_10194988
1345 Ga0114129_10238618
1346 Ga0114129_10501604
1347 Ga0114129_10671932
1348 Ga0114129_12012724
1349 Ga0105243_10040926
1350 Ga0105243_10047350
1351 Ga0105243_10093402
1352 Ga0105243_10101031
1353 Ga0105243_10350613
1354 Ga0105243_11300264
1355 Ga0105241_10002182
1356 Ga0105241_10008332
1357 Ga0105241_10063418
1358 Ga0105241_10083999
1359 Ga0105241_10270007
1360 Ga0105241_10317471
1361 Ga0105241_10322786
1362 Ga0105241_10424030
1363 Ga0105241_11174202
1364 Ga0105242_10026565
1365 Ga0105242_10030637
1366 Ga0105242_10037460
1367 Ga0105242_10053301
1368 Ga0105242_10076849
1369 Ga0105242_10101331
1370 Ga0105242_10164366
1371 Ga0105242_10200063
1372 Ga0105242_10288403
1373 Ga0105242_10308967
1374 Ga0105242_10356654
1375 Ga0105242_11219366
1376 Ga0105242_11636330
1377 Ga0105242_12989164
1378 Ga0105248_10001136
1379 Ga0105248_10009526
1380 Ga0105248_10035236
1381 Ga0105248_10044359
1382 Ga0105248_10058702
1383 Ga0105248_10060946
1384 Ga0105248_10075845
1385 Ga0105248_10131287
1386 Ga0105248_10136588
1387 Ga0105248_10195271
1388 Ga0105248_10539762
1389 Ga0105248_12353856
1390 Ga0105237_10007273
1391 Ga0105237_10015088
1392 Ga0105237_10055577
1393 Ga0105237_10129760
1394 Ga0105237_10328776
1395 Ga0105237_10920298
1396 Ga0105237_11386761
1397 Ga0105238_10004033
1398 Ga0105238_10004718
1399 Ga0105238_10006871
1400 Ga0105238_10019996
1401 Ga0105238_10024610
1402 Ga0105238_10058613
1403 Ga0105238_10073691
1404 Ga0105238_10091602
1405 Ga0105238_10124692
1406 Ga0105238_10435315
1407 Ga0105238_11361924
1408 Ga0105238_12139236
1409 Ga0105238_12328458
1410 Ga0105249_10012667
1411 Ga0105249_10031669
1412 Ga0105249_10324251
1413 Ga0105249_10580681
1414 Ga0105239_10001243
1415 Ga0105239_10003025
1416 Ga0105239_10028292
1417 Ga0105239_10079327
1418 Ga0105239_10126396
1419 Ga0105246_10031209
1420 Ga0105246_10042303
1421 Ga0105246_10106310
1422 Ga0105246_10397105
1423 Ga0105246_10803273
1424 Ga0105246_11157640
1425 Ga0157373_10460647
1426 Ga0157373_11071205
1427 Ga0157371_10071601
1428 Ga0157370_10002217
1429 Ga0157370_10005870
1430 Ga0157370_10105625
1431 Ga0157370_10109990
1432 Ga0157369_10000587
1433 Ga0157369_10002200
1434 Ga0157369_10002261
1435 Ga0157369_10018710
1436 Ga0157369_10019978
1437 Ga0157369_11407332
1438 Ga0157369_11863655
1439 Ga0157374_10072230
1440 Ga0157374_10131434
1441 Ga0157374_10143738
1442 Ga0157374_10160342
1443 Ga0157374_10305832
1444 Ga0157374_10329011
1445 Ga0157374_10523885
1446 Ga0157374_11026445
1447 Ga0157374_11062381
1448 Ga0157378_10002744
1449 Ga0157378_10039411
1450 Ga0157378_10171154
1451 Ga0157378_10390926
1452 Ga0157378_10478933
1453 Ga0163162_10100500
1454 Ga0163162_10232201
1455 Ga0163162_10300486
1456 Ga0163162_10709863
1457 Ga0163162_10855033
1458 Ga0163162_10941600
1459 Ga0163162_11005129
1460 Ga0163162_11009152
1461 Ga0157372_10002038
1462 Ga0157372_10004925
1463 Ga0157372_10005878
1464 Ga0157372_10013921
1465 Ga0157372_10045750
1466 Ga0157372_10244737
1467 Ga0157372_10538713
1468 Ga0157372_10564689
1469 Ga0157372_11029688
1470 Ga0157372_11344227
1471 Ga0157372_11566352
1472 Ga0157372_11993671
1473 Ga0157375_10006905
1474 Ga0157375_10009069
1475 Ga0157375_10378248
1476 Ga0157375_10415787
1477 Ga0157375_11067099
1478 Ga0157375_11094594
1479 Ga0157375_12781087
1480 Ga0163163_10074157
1481 Ga0163163_10511234
1482 Ga0163163_10887399
1483 Ga0163163_10902915
1484 Ga0163163_12126175
1485 Ga0157380_10321750
1486 Ga0157380_10707130
1487 Ga0157377_10181095
1488 Ga0157377_10710806
1489 Ga0157377_11014136
1490 Ga0157379_10101709
1491 Ga0157379_10177756
1492 Ga0157379_10493696
1493 Ga0157379_11287278
1494 Ga0157379_11528906
1495 Ga0157376_10078263
1496 Ga0157376_10084034
1497 Ga0157376_10207703
1498 Ga0157376_10491033
1499 Ga0157376_10546365
1500 Ga0157376_10568711
1501 Ga0157376_10649166
1502 Ga0157376_11102676
1503 Ga0157376_11172541
1504 Ga0157376_13065828
1505 Ga0197907_11355935
1506 Ga0206356_10168128
1507 Ga0206356_10818372
1508 Ga0206356_11703082
1509 Ga0206349_1030428
1510 Ga0206355_1125849
1511 Ga0206352_10309109
1512 Ga0206352_10548793
1513 Ga0206352_10776619
1514 Ga0206350_11578675
1515 Ga0213876_10020527
1516 Ga0213876_10130465
1517 Ga0213876_10415668
1518 Ga0213876_10563666
1519 Ga0213875_10038848
1520 Ga0213875_10176804
1521 Ga0224712_10059868
1522 Ga0224712_10067629
1523 Ga0207692_10093713
1524 Ga0207642_10080795
1525 Ga0207642_10179365
1526 Ga0207710_10145907
1527 Ga0207680_11082023
1528 Ga0207647_10397384
1529 Ga0207699_10374653
1530 Ga0207699_10662872
1531 Ga0207645_10805318
1532 Ga0207643_10244289
1533 Ga0207643_10708485
1534 Ga0207684_10135846
1535 Ga0207684_10668597
1536 Ga0207654_10003701
1537 Ga0207654_10003892
1538 Ga0207654_10058991
1539 Ga0207654_10474310
1540 Ga0207654_10564980
1541 Ga0207654_10694988
1542 Ga0207707_10000567
1543 Ga0207707_10001348
1544 Ga0207707_10027488
1545 Ga0207707_10766644
1546 Ga0207695_10001123
1547 Ga0207695_10003190
1548 Ga0207695_10003846
1549 Ga0207695_10004024
1550 Ga0207695_10282558
1551 Ga0207695_10502188
1552 Ga0207695_11134138
1553 Ga0207671_10005457
1554 Ga0207671_10026432
1555 Ga0207671_10084887
1556 Ga0207671_10102078
1557 Ga0207671_10511608
1558 Ga0207671_10879173
1559 Ga0207693_10271319
1560 Ga0207693_10352669
1561 Ga0207693_11205580
1562 Ga0207663_10109485
1563 Ga0207663_10123444
1564 Ga0207663_10125415
1565 Ga0207663_10229445
1566 Ga0207660_10108867
1567 Ga0207660_10295063
1568 Ga0207660_10701349
1569 Ga0207662_10362349
1570 Ga0207657_10029205
1571 Ga0207657_10146368
1572 Ga0207657_10187503
1573 Ga0207657_10537517
1574 Ga0207649_10188180
1575 Ga0207649_10301855
1576 Ga0207649_10528774
1577 Ga0207652_10005806
1578 Ga0207652_10005857
1579 Ga0207652_10820535
1580 Ga0207646_10202872
1581 Ga0207681_10379183
1582 Ga0207694_10000348
1583 Ga0207694_10004755
1584 Ga0207694_10014781
1585 Ga0207694_10018587
1586 Ga0207694_10049373
1587 Ga0207694_10055615
1588 Ga0207694_10146613
1589 Ga0207694_10204227
1590 Ga0207694_10231687
1591 Ga0207694_10421512
1592 Ga0207694_10568588
1593 Ga0207650_10002798
1594 Ga0207659_10052047
1595 Ga0207659_11132980
1596 Ga0207687_10001518
1597 Ga0207687_10012048
1598 Ga0207687_10021052
1599 Ga0207687_10074857
1600 Ga0207687_10079534
1601 Ga0207687_10131692
1602 Ga0207687_10208461
1603 Ga0207687_10352074
1604 Ga0207687_10556617
1605 Ga0207687_10630981
1606 Ga0207687_10804075
1607 Ga0207687_10897397
1608 Ga0207700_10002286
1609 Ga0207700_10031655
1610 Ga0207700_10258819
1611 Ga0207700_10498069
1612 Ga0207700_10946578
1613 Ga0207664_10009122
1614 Ga0207644_10087928
1615 Ga0207644_10287961
1616 Ga0207644_10344232
1617 Ga0207690_10412506
1618 Ga0207690_11359157
1619 Ga0207706_10054048
1620 Ga0207706_10248102
1621 Ga0207686_10019473
1622 Ga0207686_10023523
1623 Ga0207686_10132550
1624 Ga0207686_10168514
1625 Ga0207686_10183296
1626 Ga0207686_10239290
1627 Ga0207686_10259708
1628 Ga0207686_10374615
1629 Ga0207686_10433819
1630 Ga0207709_10053822
1631 Ga0207709_10094757
1632 Ga0207709_10297930
1633 Ga0207670_10199926
1634 Ga0207670_10211989
1635 Ga0207670_10367965
1636 Ga0207670_10720009
1637 Ga0207670_11243545
1638 Ga0207704_10037607
1639 Ga0207704_10251783
1640 Ga0207704_10351509
1641 Ga0207691_10205192
1642 Ga0207691_10329532
1643 Ga0207711_10001511
1644 Ga0207711_10001890
1645 Ga0207711_10043970
1646 Ga0207711_10086763
1647 Ga0207711_10093497
1648 Ga0207711_10109516
1649 Ga0207711_10654084
1650 Ga0207711_10663787
1651 Ga0207711_11465092
1652 Ga0207689_10049037
1653 Ga0207689_10065640
1654 Ga0207689_10065691
1655 Ga0207689_10096422
1656 Ga0207689_10437950
1657 Ga0207689_10781230
1658 Ga0207661_10014829
1659 Ga0207661_10031659
1660 Ga0207661_10041592
1661 Ga0207661_10050076
1662 Ga0207661_10403053
1663 Ga0207661_10430732
1664 Ga0207661_10591179
1665 Ga0207661_11116501
1666 Ga0207661_11784499
1667 Ga0207679_10017649
1668 Ga0207679_10267919
1669 Ga0207679_10715460
1670 Ga0207679_11483341
1671 Ga0207667_10000369
1672 Ga0207667_10000558
1673 Ga0207667_10000650
1674 Ga0207667_10007172
1675 Ga0207667_10011270
1676 Ga0207667_10018492
1677 Ga0207667_10039858
1678 Ga0207651_10160381
1679 Ga0207651_10189757
1680 Ga0207651_10218859
1681 Ga0207712_10077811
1682 Ga0207712_10346299
1683 Ga0207712_10761583
1684 Ga0207640_10052260
1685 Ga0207640_10345972
1686 Ga0207658_10128377
1687 Ga0207658_10596019
1688 Ga0207658_10851838
1689 Ga0207677_10080746
1690 Ga0207677_10270752
1691 Ga0207677_10677303
1692 Ga0207677_10868001
1693 Ga0207677_11098164
1694 Ga0207677_11971555
1695 Ga0207703_10014466
1696 Ga0207703_10028780
1697 Ga0207703_10055585
1698 Ga0207703_10057058
1699 Ga0207703_10109401
1700 Ga0207703_10175063
1701 Ga0207703_10326425
1702 Ga0207703_10513694
1703 Ga0207703_10697782
1704 Ga0207703_11409507
1705 Ga0207639_10045485
1706 Ga0207639_10065656
1707 Ga0207639_10081096
1708 Ga0207639_10359057
1709 Ga0207639_11030078
1710 Ga0207678_10511371
1711 Ga0207708_10093698
1712 Ga0207708_10327234
1713 Ga0207702_10004880
1714 Ga0207702_10035528
1715 Ga0207702_10065231
1716 Ga0207702_10113785
1717 Ga0207702_10162764
1718 Ga0207702_10276589
1719 Ga0207702_10319199
1720 Ga0207702_10336993
1721 Ga0207702_10665704
1722 Ga0207702_11654122
1723 Ga0207641_10142600
1724 Ga0207641_10214355
1725 Ga0207641_10766098
1726 Ga0207648_10028077
1727 Ga0207648_10078214
1728 Ga0207648_10146964
1729 Ga0207648_10346583
1730 Ga0207648_10810684
1731 Ga0207648_11599578
1732 Ga0207676_10073593
1733 Ga0207676_10272942
1734 Ga0207676_10294026
1735 Ga0207676_10676505
1736 Ga0207676_10819909
1737 Ga0207676_11003727
1738 Ga0207676_12290727
1739 Ga0207674_10000063
1740 Ga0207674_10000484
1741 Ga0207674_10000657
1742 Ga0207674_10003310
1743 Ga0207674_10124070
1744 Ga0207674_10787924
1745 Ga0207675_100047384
1746 Ga0207675_100485099
1747 Ga0207675_100752740
1748 Ga0207675_100852951
1749 Ga0207683_10025344
1750 Ga0207683_10357236
1751 Ga0207698_10005842
1752 Ga0207698_10090092
1753 Ga0207698_10244801
1754 Ga0207698_10366235
1755 Ga0207698_10488128
1756 Ga0207698_10670886
1757 Ga0207698_12130543
1758 Ga0209588_1006477
1759 Ga0209966_1072022
1760 Ga0207428_10025949
1761 Ga0207428_10238530
1762 Ga0268265_10864170
1763 Ga0268264_10326260
1764 Ga0268264_10417623
1765 Ga0268264_11597463
1766 Ga0268264_12028518
1767 Ga0265775_100924
1768 Ga0265760_10200186
1769 Ga0265340_10022406
1770 Ga0265313_10000978
1771 Ga0265314_10000542
1772 Ga0373948_0023841
1773 Ga0373958_0034319
1774 Ga0373926_0130802
1775 Ga0373934_0003315
1776 Ga0373934_0006789
1777 Ga0373934_0085935
1778 Ga0373944_0152108
1779 Ga0373944_0279496
1780 Ga0373952_0063560
1781 Ga0373923_0025983
1782 Ga0373923_0146238
1783 Ga0373936_0180639
1784 Ga0373936_0321744
1785 Ga0373941_0130307
1786 Ga0373953_0053002
1787 Ga0373954_0008545
1788 Ga0373954_0015875
1789 Ga0373954_0026343
1790 Ga0373954_0041987
1791 Ga0373954_0076499
1792 Ga0373954_0559389
1793 Ga0373954_0606001
1794 Ga0373956_0135504
1795 Ga0373956_0246130
1796 Ga0373943_0163907
1797 Ga0373946_0285159
1798 Ga0373955_0004305
1799 Ga0373955_0022020
1800 Ga0373955_0033572
1801 Ga0373955_0170191
1802 Ga0373955_0340296
1803 Ga0373961_0050496
1804 Ga0373924_0034070
1805 Ga0373924_0069773
1806 Ga0373931_0059241
1807 Ga0373931_1213679
1808 Ga0373935_0094008
1809 Ga0373935_0096540
1810 Ga0373935_0108233
1811 Ga0373935_0173147
1812 Ga0373935_0217397
1813 Ga0373927_0003526
1814 Ga0373927_0048222
1815 Ga0373927_0087005
1816 Ga0373927_0240847
1817 Ga0373927_0317964
1818 Ga0373933_0022280
1819 Ga0373933_0144416
1820 Ga0373933_0185102
1821 Ga0373933_0236110
1822 Ga0373933_0314482
1823 Ga0373933_0876253
1824 Ga0373947_0000466
1825 Ga0373947_0108943
1826 Ga0373947_0239105
1827 Ga0373947_0375590
1828 Ga0373937_0002529
1829 Ga0373937_0009057
1830 Ga0373937_0017813
1831 Ga0373937_0037647
1832 Ga0373937_0121986
1833 Ga0373937_0151304
1834 Ga0373937_0252277
1835 Ga0373937_0450507
1836 Ga0373937_0528735
1837 Ga0373925_0001318
1838 Ga0373925_0462200
1839 Ga0373925_0509357
1840 Ga0395900_1670412
1841 Ga0436364_0014045
1842 Ga0436364_0112772
1843 Ga0436364_0888227
1844 Ga0436365_0792504
1845 Ga0436365_1210156
1846 Ga0436365_1620093
1847 Ga0436365_1776261
1848 Ga0436362_1071320
1849 Ga0439460_0073772
1850 Ga0453683_0308974
1851 Ga0453683_0484205
1852 Ga0453684_1054812
1853 Ga0453684_1425785
1854 Ga0451576_0022151
1855 Ga0451576_0068440
1856 Ga0451576_0109274
1857 Ga0451576_0132970
1858 Ga0451576_0445353
1859 Ga0495592_0029498
1860 Ga0495603_0221726
1861 Ga0495651_0056024
1862 Ga0495651_0254712
1863 Ga0495651_0525238
1864 Ga0495580_0051798
1865 Ga0495580_0126601
1866 Ga0495580_0215870
1867 Ga0495582_0009156
1868 Ga0495584_0069478
1869 Ga0495594_0360331
1870 Ga0495594_0417051
1871 Ga0495628_0327363
1872 Ga0495628_0371286
1873 Ga0495630_0407759
1874 Ga0495630_0808049
1875 Ga0495630_1130738
1876 Ga0495663_0144644
1877 Ga0495666_0128649
1878 Ga0495652_0063982
1879 Ga0495652_0155725
1880 Ga0495652_0239338
1881 Ga0495652_0387089
1882 Ga0495652_0462545
1883 Ga0495665_0038934
1884 Ga0495665_0558912
1885 Ga0495587_0000822
1886 Ga0495587_0003986
1887 Ga0495587_0262822
1888 Ga0495621_0081672
1889 Ga0495645_0106650
1890 Ga0495645_0661058
1891 Ga0495667_0090237
1892 Ga0495667_0455408
1893 Ga0495667_1030466
1894 Ga0495656_0684306
1895 Ga0495668_0239833
1896 Ga0495634_0029752
1897 Ga0495634_0404099
1898 Ga0495635_0260042
1899 Ga0495635_1098413
1900 Ga0495659_0063027
1901 Ga0495659_0084306
1902 Ga0495599_0011458
1903 Ga0495599_0021022
1904 Ga0495599_0149864
1905 Ga0495599_0222482
1906 Ga0495599_0401531
1907 Ga0495599_0681168
1908 Ga0495623_0204731
1909 Ga0495658_0007879
1910 Ga0495658_0056030
1911 Ga0495669_0015225
1912 Ga0495669_0073447
1913 Ga0495669_0302325
1914 Ga0495613_0143161
1915 Ga0495589_0255161
1916 Ga0495600_0844692
1917 Ga0495604_0627625
1918 Ga0495674_0139931
1919 Ga0495674_0169578
1920 Ga0495674_0514904
1921 Ga0495680_0054934
1922 Ga0495680_0092088
1923 Ga0495680_0879924
1924 Ga0495675_0092652
1925 Ga0495675_0174387
1926 Ga0495685_072958
1927 Ga0495684_0006795
1928 Ga0495684_0103544
1929 Ga0495684_0463344
1930 Ga0495602_0001193
1931 Ga0495602_0005450
1932 Ga0495602_0195182
1933 Ga0496102_0225926
1934 Ga0496102_1166034
1935 Ga0496104_0050189
1936 Ga0496104_1393341
1937 Ga0496106_0632654
1938 Ga0496106_1361946
1939 Ga0496112_0189988
1940 Ga0496112_0450444
1941 Ga0496115_0096149
1942 Ga0496115_0139999
1943 Ga0501068_0213450
1944 Ga0501068_0426946
1945 nmdc:mga05p37_133348_c1
1946 nmdc:mga05p37_1387951_c1
1947 nmdc:mga05p37_247851_c1
1948 nmdc:mga05p37_3548_c1
1949 nmdc:mga05p37_397445_c1
1950 nmdc:mga05p37_42105_c1
1951 nmdc:mga05p37_6452_c1
1952 nmdc:mga05p37_806414_c1
1953 nmdc:mga09592_100417_c1
1954 nmdc:mga09592_177256_c1
1955 nmdc:mga09592_221852_c1
1956 nmdc:mga09592_62029_c1
1957 nmdc:mga0qj67_1362922_c1
1958 nmdc:mga0qj67_33462_c1
1959 nmdc:mga0qj67_64353_c1
1960 nmdc:mga06r32_176545_c1
1961 nmdc:mga06r32_34297_c1
1962 nmdc:mga08y16_11227_c1
1963 nmdc:mga08y16_124852_c1
1964 nmdc:mga08y16_474497_c1
1965 nmdc:mga08y16_57615_c1
1966 nmdc:mga0n895_1044046_c1
1967 nmdc:mga0n895_125075_c1
1968 nmdc:mga0n895_1789829_c1
1969 nmdc:mga0n895_245025_c1
1970 nmdc:mga0n895_426840_c1
1971 nmdc:mga0n895_67697_c1
1972 nmdc:mga0rr50_111966_c1
1973 nmdc:mga0rr50_1441112_c1
1974 nmdc:mga0rr50_297420_c1
1975 nmdc:mga0rr50_305194_c1
1976 nmdc:mga0rr50_355252_c1
1977 nmdc:mga0rr50_392245_c1
1978 nmdc:mga0rr50_571795_c1
1979 nmdc:mga08x19_310532_c1
1980 nmdc:mga08x19_65897_c1
1981 nmdc:mga08x19_740232_c1
1982 nmdc:mga08x19_846108_c1
1983 nmdc:mga0a205_137502_c1
1984 nmdc:mga0a205_41720_c1
1985 nmdc:mga0a205_59469_c1
1986 nmdc:mga0a205_918980_c1
1987 Ga0495601_0084418
1988 Ga0495601_0127154
1989 Ga0495601_0721779
1990 Ga0495619_0254983

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

13

114

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7og2-assembly1.cif.gz_B crystal structure of pseudoalteromonas luteoviolacea l-amino acid oxidase 0.8407 39 71
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7962 38 73
4fxd-assembly2.cif.gz_B crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7946 38 73
3o6z-assembly1.cif.gz_A structure of the d152a e.coli gdp-mannose hydrolase (yffh) in complex with mg++ 0.7929 41 72
8d0k-assembly1.cif.gz_F human cst-dna polymerase alpha/primase preinitiation complex bound to 4xtel-foldback template - prim2c advanced pic 0.7846 37 71
ID Description Score Start End Superfamily
af_Q9VKY7_200_296_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8304 41 75 2.30.29.30
af_A0A1D8PQ00_161_443_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8275 41 71 2.130.10.10
3rlfA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8052 36 96 2.40.50.140
af_P87307_123_212_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7947 35 117 2.40.50.140
af_Q8VIG0_99_222_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.788 39 71 3.30.1520.10
ID Description Score Start End GO Terms
AF-A0A3N5PN25-F1-model_v4 DNA-binding protein 0.9517 21 128
AF-A0A832R6Q9-F1-model_v4 OB-fold nucleic acid binding domain-containing protein 0.9484 21 122
AF-A0A2V8L6J6-F1-model_v4 DNA-binding protein 0.9467 21 128
AF-A0A382AM76-F1-model_v4 OB-fold nucleic acid binding domain-containing protein 0.9377 19 118
AF-A0A383BXH4-F1-model_v4 OB-fold nucleic acid binding domain-containing protein 0.937 21 119

Map