F487673

General Info

Members Datasets Scaffolds Average Seq Length
993 354 985 260

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100368253|Ga0068852_1003682532
Length 298
Sequence MSDTEIREQVRQRYAAAAVAVSARGADALTVLDDCCSPAANASCCGSTGEVDAAFGAGLYSADEHGELPVEAVAASLGCGNPTAVAELRAGERVLDLGSGGGIDVLLSARRVGPTGYAYGVDMTDEMLALANANKAKAGIDNVEFRAVDVVISNCVVNLSTDKPAVLAEMFRVLTPGGRIGISDVVAEDHLSPADRAERGSYVGCIAGALSRQEYLDGLAAVGFADAEVIFTHEAAPGMHSAIVRAVKPVTAASETAVFQRMATASAXXXXPLASEPLTPAAGQLSAAACCSTNEQDR

Samples

Sample ID Description Type Environment
1 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
2 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
3 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
4 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
5 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
6 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
7 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
8 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
152 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
153 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
156 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
159 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
163 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
164 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
177 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
178 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
179 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
180 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
181 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
187 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
192 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
209 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
210 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
211 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
212 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
213 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
214 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
215 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
216 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
217 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
218 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
219 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
222 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
223 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
226 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
227 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
228 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
231 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
232 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
233 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
234 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
235 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
236 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
237 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
238 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
239 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
240 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
241 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
242 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
243 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
247 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
248 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
249 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
250 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
251 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
254 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
255 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
256 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
257 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
258 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
263 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
264 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
265 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
266 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
267 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
268 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
269 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
270 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
271 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
274 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
275 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
280 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
281 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
282 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
283 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
284 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
285 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
286 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
287 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
288 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
289 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
290 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
294 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
295 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
296 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
297 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
298 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
299 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
300 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
301 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
302 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
303 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
319 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
320 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
321 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
322 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
323 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
324 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
325 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
326 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
327 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
328 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
329 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
330 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
331 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
332 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
333 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
336 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
337 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
338 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
339 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
340 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
341 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
342 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
343 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
344 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
345 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
346 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
347 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
348 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
349 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
350 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
351 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
352 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
353 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
354 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.89
Metatranscriptomes 0.3
Isolates 0.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 5.44
Rhizosphere 91.64
Stem 0
Stem Tuber 0
Unclassified 2.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10003631 3300003203 Bacteria 7235
2 JGI25407J50210_10026255 3300003373 Unclassified 1510
3 JGI25407J50210_10027708 3300003373 Bacteria 1469
4 Ga0065714_10028532 3300005288 Bacteria 1288
5 Ga0070658_10180420 3300005327 Bacteria 1776
6 Ga0070658_10431688 3300005327 Bacteria 1134
7 Ga0070683_100002447 3300005329 Bacteria 14774
8 Ga0070683_100023996 3300005329 Bacteria 5459
9 Ga0070690_100129205 3300005330 Bacteria 1704
10 Ga0068869_100240303 3300005334 Bacteria 1443
11 Ga0070666_10137103 3300005335 Bacteria 1703
12 Ga0070680_100012407 3300005336 Bacteria 6620
13 Ga0070680_100425661 3300005336 Bacteria 1133
14 Ga0070682_100053667 3300005337 Bacteria 2527
15 Ga0070682_100193124 3300005337 Bacteria 1431
16 Ga0068868_100220539 3300005338 Bacteria 1587
17 Ga0068868_100235958 3300005338 Bacteria 1535
18 Ga0070689_100206095 3300005340 Bacteria 1608
19 Ga0070691_10009567 3300005341 Bacteria 4425
20 Ga0070691_10169231 3300005341 Bacteria 1131
21 Ga0070671_100200799 3300005355 Bacteria 1690
22 Ga0070674_100024274 3300005356 Bacteria 3934
23 Ga0070673_100049920 3300005364 Bacteria 3269
24 Ga0070673_100201967 3300005364 Bacteria 1712
25 Ga0070673_100209167 3300005364 Bacteria 1684
26 Ga0070709_10000701 3300005434 Bacteria 19084
27 Ga0070709_10051088 3300005434 Bacteria 2593
28 Ga0070709_10113308 3300005434 Bacteria 1826
29 Ga0070709_10128004 3300005434 Bacteria 1730
30 Ga0070714_100000933 3300005435 Bacteria 20761
31 Ga0070714_100014534 3300005435 Bacteria 6327
32 Ga0070714_100036934 3300005435 Bacteria 4102
33 Ga0070714_100111427 3300005435 Bacteria 2423
34 Ga0070714_100272121 3300005435 Bacteria 1571
35 Ga0070713_100017046 3300005436 Bacteria 5480
36 Ga0070713_100017740 3300005436 Bacteria 5395
37 Ga0070713_100031913 3300005436 Bacteria 4201
38 Ga0070713_100236913 3300005436 Bacteria 1660
39 Ga0070713_100380571 3300005436 Bacteria 1315
40 Ga0070710_10000411 3300005437 Bacteria 20167
41 Ga0070710_10028450 3300005437 Bacteria 2990
42 Ga0070710_10053899 3300005437 Bacteria 2267
43 Ga0070711_100002526 3300005439 Bacteria 10461
44 Ga0070711_100040371 3300005439 Bacteria 3147
45 Ga0070711_100216626 3300005439 Bacteria 1486
46 Ga0070705_100306982 3300005440 Bacteria 1140
47 Ga0070694_100214927 3300005444 Bacteria 1440
48 Ga0070708_100002228 3300005445 Bacteria 14985
49 Ga0070708_100005830 3300005445 Bacteria 9776
50 Ga0070663_100206341 3300005455 Bacteria 1536
51 Ga0070662_100330273 3300005457 Bacteria 1246
52 Ga0070706_100009587 3300005467 Bacteria 9005
53 Ga0070706_100022514 3300005467 Bacteria 5800
54 Ga0070706_100183715 3300005467 Bacteria 1953
55 Ga0070706_100204395 3300005467 Bacteria 1845
56 Ga0070707_100007797 3300005468 Bacteria 9944
57 Ga0070707_100075214 3300005468 Bacteria 3257
58 Ga0070707_100120691 3300005468 Bacteria 2545
59 Ga0070707_100912696 3300005468 Bacteria 843
60 Ga0070698_100003498 3300005471 Bacteria 17291
61 Ga0070698_100017226 3300005471 Bacteria 7612
62 Ga0070698_100022472 3300005471 Bacteria 6598
63 Ga0070698_100178834 3300005471 Bacteria 2060
64 Ga0070699_100010943 3300005518 Bacteria 7847
65 Ga0070699_100047694 3300005518 Bacteria 3706
66 Ga0070699_100161924 3300005518 Bacteria 1980
67 Ga0070699_100228815 3300005518 Bacteria 1658
68 Ga0070699_100476636 3300005518 Bacteria 1132
69 Ga0070684_100059444 3300005535 Bacteria 3342
70 Ga0070684_100067391 3300005535 Bacteria 3144
71 Ga0070684_100126215 3300005535 Bacteria 2305
72 Ga0070697_100093464 3300005536 Bacteria 2490
73 Ga0068853_100275342 3300005539 Bacteria 1550
74 Ga0070672_100155535 3300005543 Bacteria 1894
75 Ga0070695_100140392 3300005545 Bacteria 1675
76 Ga0070665_100062479 3300005548 Bacteria 3734
77 Ga0070704_100370248 3300005549 Bacteria 1214
78 Ga0068855_100010217 3300005563 Bacteria 11316
79 Ga0068855_100261130 3300005563 Bacteria 1929
80 Ga0070664_100084380 3300005564 Bacteria 2742
81 Ga0070664_100129328 3300005564 Bacteria 2217
82 Ga0070664_100147418 3300005564 Bacteria 2076
83 Ga0070664_100872487 3300005564 Bacteria 843
84 Ga0068857_100179797 3300005577 Bacteria 1925
85 Ga0068857_100222935 3300005577 Bacteria 1723
86 Ga0068857_100624301 3300005577 Bacteria 1020
87 Ga0068854_100129413 3300005578 Bacteria 1926
88 Ga0068856_100216277 3300005614 Bacteria 1931
89 Ga0068856_100391874 3300005614 Bacteria 1408
90 Ga0070702_100196895 3300005615 Bacteria 1330
91 Ga0068852_100089488 3300005616 Bacteria 2751
92 Ga0068852_100368253 3300005616 Bacteria 1407
93 Ga0068859_100924034 3300005617 Bacteria 957
94 Ga0068864_100069738 3300005618 Bacteria 3057
95 Ga0068864_100298068 3300005618 Bacteria 1509
96 Ga0068861_100112996 3300005719 Bacteria 2178
97 Ga0068870_10014788 3300005840 Bacteria 3693
98 Ga0068863_100063255 3300005841 Bacteria 3499
99 Ga0068863_100234987 3300005841 Bacteria 1769
100 Ga0068858_100000551 3300005842 Bacteria 39065
101 Ga0068858_100117837 3300005842 Bacteria 2482
102 Ga0068858_100653739 3300005842 Bacteria 1021
103 Ga0068860_100121928 3300005843 Bacteria 2497
104 Ga0068860_100367791 3300005843 Bacteria 1418
105 Ga0081455_10096526 3300005937 Bacteria 2383
106 Ga0081538_10000336 3300005981 Bacteria 53233
107 Ga0081538_10000556 3300005981 Bacteria 41334
108 Ga0081538_10001009 3300005981 Bacteria 30023
109 Ga0081538_10006601 3300005981 Bacteria 10180
110 Ga0081538_10009646 3300005981 Bacteria 8025
111 Ga0081538_10021539 3300005981 Bacteria 4700
112 Ga0081538_10027367 3300005981 Bacteria 3955
113 Ga0081538_10031177 3300005981 Bacteria 3602
114 Ga0081538_10043437 3300005981 Bacteria 2822
115 Ga0081538_10102767 3300005981 Bacteria 1432
116 Ga0081538_10159762 3300005981 Bacteria 1004
117 Ga0081540_1010306 3300005983 Bacteria 6340
118 Ga0081539_10003891 3300005985 Bacteria 17409
119 Ga0081539_10008348 3300005985 Bacteria 9050
120 Ga0081539_10026756 3300005985 Bacteria 3670
121 Ga0081539_10029700 3300005985 Bacteria 3409
122 Ga0081539_10037336 3300005985 Bacteria 2895
123 Ga0070717_10003028 3300006028 Bacteria 11974
124 Ga0070717_10042057 3300006028 Bacteria 3727
125 Ga0070717_10196231 3300006028 Bacteria 1766
126 Ga0070717_10300840 3300006028 Bacteria 1426
127 Ga0075368_10001498 3300006042 Bacteria 7482
128 Ga0075432_10053240 3300006058 Bacteria 1431
129 Ga0070716_100000316 3300006173 Bacteria 19449
130 Ga0070716_100134376 3300006173 Bacteria 1568
131 Ga0070712_100001872 3300006175 Bacteria 12845
132 Ga0070712_100024746 3300006175 Bacteria 3983
133 Ga0070712_100031376 3300006175 Bacteria 3579
134 Ga0070712_100111938 3300006175 Bacteria 2039
135 Ga0070712_100136991 3300006175 Bacteria 1863
136 Ga0070712_100193921 3300006175 Bacteria 1591
137 Ga0070712_100562507 3300006175 Bacteria 962
138 Ga0075367_10000161 3300006178 Bacteria 21029
139 Ga0075428_100008819 3300006844 Bacteria 11192
140 Ga0075428_100067912 3300006844 Bacteria 3901
141 Ga0075428_100540373 3300006844 Bacteria 1246
142 Ga0075428_100747199 3300006844 Bacteria 1041
143 Ga0075430_100000755 3300006846 Bacteria 24936
144 Ga0075430_100006823 3300006846 Bacteria 9622
145 Ga0075430_100042918 3300006846 Bacteria 3823
146 Ga0075430_100056542 3300006846 Bacteria 3299
147 Ga0075431_100070701 3300006847 Bacteria 3601
148 Ga0075431_100077452 3300006847 Bacteria 3432
149 Ga0075431_100130426 3300006847 Bacteria 2593
150 Ga0075431_100183579 3300006847 Bacteria 2146
151 Ga0075431_100444421 3300006847 Bacteria 1293
152 Ga0075433_10014254 3300006852 Bacteria 6491
153 Ga0075433_10091088 3300006852 Bacteria 2695
154 Ga0075434_100011783 3300006871 Bacteria 8262
155 Ga0075434_100062311 3300006871 Bacteria 3712
156 Ga0075429_100000518 3300006880 Bacteria 29269
157 Ga0075429_100020176 3300006880 Bacteria 5779
158 Ga0075429_100032146 3300006880 Bacteria 4561
159 Ga0097620_100924039 3300006931 Bacteria 957
160 Ga0075435_100021448 3300007076 Bacteria 4969
161 Ga0075435_100029557 3300007076 Bacteria 4301
162 Ga0075435_100090162 3300007076 Bacteria 2529
163 Ga0099795_10042866 3300007788 Bacteria 1617
164 Ga0105240_10166293 3300009093 Bacteria 2616
165 Ga0105240_10640263 3300009093 Bacteria 1166
166 Ga0111539_10003901 3300009094 Bacteria 19612
167 Ga0111539_10017234 3300009094 Bacteria 8939
168 Ga0111539_10282141 3300009094 Bacteria 1933
169 Ga0111539_10346858 3300009094 Bacteria 1728
170 Ga0111539_10370663 3300009094 Bacteria 1667
171 Ga0111539_10548579 3300009094 Bacteria 1346
172 Ga0105245_10209359 3300009098 Bacteria 1876
173 Ga0105245_10350362 3300009098 Bacteria 1463
174 Ga0105245_10840429 3300009098 Bacteria 958
175 Ga0105247_10372543 3300009101 Bacteria 1010
176 Ga0114129_10000440 3300009147 Bacteria 49341
177 Ga0114129_10009535 3300009147 Bacteria 13850
178 Ga0114129_10361442 3300009147 Bacteria 1921
179 Ga0114129_10393954 3300009147 Bacteria 1826
180 Ga0114129_10407784 3300009147 Bacteria 1790
181 Ga0105243_10082368 3300009148 Bacteria 2629
182 Ga0105241_10180901 3300009174 Bacteria 1749
183 Ga0105242_10122871 3300009176 Bacteria 2231
184 Ga0105242_10550945 3300009176 Bacteria 1106
185 Ga0105248_10122385 3300009177 Bacteria 2935
186 Ga0105248_10601460 3300009177 Bacteria 1241
187 Ga0105248_10675838 3300009177 Bacteria 1165
188 Ga0105238_10456293 3300009551 Bacteria 1275
189 Ga0105249_10363037 3300009553 Bacteria 1470
190 Ga0105239_10516066 3300010375 Bacteria 1359
191 Ga0105246_10241604 3300011119 Bacteria 1428
192 Ga0157370_10092292 3300013104 Bacteria 2842
193 Ga0157369_10057659 3300013105 Bacteria 4189
194 Ga0157369_10076989 3300013105 Bacteria 3576
195 Ga0157369_10274812 3300013105 Bacteria 1755
196 Ga0157374_10613859 3300013296 Bacteria 1098
197 Ga0163162_10085237 3300013306 Bacteria 3236
198 Ga0157372_10148994 3300013307 Bacteria 2699
199 Ga0157372_10821169 3300013307 Bacteria 1080
200 Ga0163163_10004571 3300014325 Bacteria 11812
201 Ga0163163_10132387 3300014325 Bacteria 2534
202 Ga0163163_10178095 3300014325 Bacteria 2173
203 Ga0163163_10745178 3300014325 Bacteria 1043
204 Ga0157377_10209723 3300014745 Bacteria 1241
205 Ga0157379_10037611 3300014968 Bacteria 4317
206 Ga0157379_10114298 3300014968 Bacteria 2426
207 Ga0157379_10170292 3300014968 Bacteria 1966
208 Ga0157376_10425034 3300014969 Bacteria 1290
209 Ga0206356_11150109 3300020070 Bacteria 804
210 Ga0206350_11291229 3300020080 Bacteria 1388
211 Ga0206353_10331881 3300020082 Bacteria 2165
212 Ga0213875_10001641 3300021388 Bacteria 14126
213 Ga0213875_10009989 3300021388 Bacteria 4775
214 Ga0213875_10011897 3300021388 Bacteria 4314
215 Ga0213875_10035250 3300021388 Bacteria 2361
216 Ga0224572_1017956 3300024225 Bacteria 1359
217 Ga0207653_10025778 3300025885 Bacteria 1882
218 Ga0207692_10000708 3300025898 Bacteria 11730
219 Ga0207692_10107647 3300025898 Bacteria 1541
220 Ga0207692_10178010 3300025898 Bacteria 1237
221 Ga0207642_10122093 3300025899 Bacteria 1346
222 Ga0207688_10013197 3300025901 Bacteria 4491
223 Ga0207688_10014998 3300025901 Bacteria 4204
224 Ga0207688_10198827 3300025901 Bacteria 1201
225 Ga0207680_10048298 3300025903 Bacteria 2527
226 Ga0207699_10000918 3300025906 Bacteria 14073
227 Ga0207699_10181130 3300025906 Bacteria 1416
228 Ga0207643_10006930 3300025908 Bacteria 6076
229 Ga0207643_10049781 3300025908 Bacteria 2375
230 Ga0207684_10003011 3300025910 Bacteria 16706
231 Ga0207684_10026867 3300025910 Bacteria 4909
232 Ga0207684_10043339 3300025910 Bacteria 3815
233 Ga0207684_10354854 3300025910 Bacteria 1262
234 Ga0207684_10504020 3300025910 Bacteria 1037
235 Ga0207693_10009326 3300025915 Bacteria 8001
236 Ga0207693_10025458 3300025915 Bacteria 4692
237 Ga0207693_10043582 3300025915 Bacteria 3529
238 Ga0207693_10115974 3300025915 Bacteria 2103
239 Ga0207693_10150964 3300025915 Bacteria 1827
240 Ga0207693_10325511 3300025915 Bacteria 1203
241 Ga0207663_10039511 3300025916 Bacteria 2860
242 Ga0207663_10129364 3300025916 Bacteria 1742
243 Ga0207663_10289641 3300025916 Bacteria 1219
244 Ga0207657_10040905 3300025919 Bacteria 4103
245 Ga0207652_10116272 3300025921 Bacteria 2376
246 Ga0207646_10025433 3300025922 Bacteria 5415
247 Ga0207646_10040912 3300025922 Bacteria 4167
248 Ga0207646_10045105 3300025922 Bacteria 3958
249 Ga0207646_10464482 3300025922 Bacteria 1141
250 Ga0207650_10201397 3300025925 Bacteria 1595
251 Ga0207687_10099571 3300025927 Bacteria 2136
252 Ga0207687_10146681 3300025927 Bacteria 1796
253 Ga0207687_10252510 3300025927 Bacteria 1402
254 Ga0207700_10000662 3300025928 Bacteria 20159
255 Ga0207700_10004691 3300025928 Bacteria 8100
256 Ga0207700_10005292 3300025928 Bacteria 7696
257 Ga0207700_10088166 3300025928 Bacteria 2442
258 Ga0207700_10110690 3300025928 Bacteria 2209
259 Ga0207700_10364539 3300025928 Bacteria 1260
260 Ga0207664_10001227 3300025929 Bacteria 16980
261 Ga0207664_10015632 3300025929 Bacteria 5515
262 Ga0207664_10017475 3300025929 Bacteria 5260
263 Ga0207664_10035879 3300025929 Bacteria 3829
264 Ga0207664_10072274 3300025929 Bacteria 2781
265 Ga0207664_10073313 3300025929 Bacteria 2762
266 Ga0207664_10585117 3300025929 Bacteria 1002
267 Ga0207644_10439478 3300025931 Bacteria 1071
268 Ga0207706_10013188 3300025933 Bacteria 7520
269 Ga0207686_10110563 3300025934 Bacteria 1852
270 Ga0207670_10002309 3300025936 Bacteria 9993
271 Ga0207665_10000242 3300025939 Bacteria 37438
272 Ga0207665_10001127 3300025939 Bacteria 17970
273 Ga0207711_10007526 3300025941 Bacteria 9108
274 Ga0207689_10131963 3300025942 Bacteria 2056
275 Ga0207689_10211301 3300025942 Bacteria 1603
276 Ga0207661_10029219 3300025944 Bacteria 4231
277 Ga0207661_10036293 3300025944 Bacteria 3846
278 Ga0207661_10435719 3300025944 Bacteria 1192
279 Ga0207679_10636367 3300025945 Bacteria 964
280 Ga0207667_10025772 3300025949 Bacteria 6432
281 Ga0207667_10329952 3300025949 Bacteria 1558
282 Ga0207651_10030130 3300025960 Bacteria 3450
283 Ga0207651_10148042 3300025960 Bacteria 1824
284 Ga0207712_10205745 3300025961 Bacteria 1564
285 Ga0207640_10098671 3300025981 Bacteria 2043
286 Ga0207677_10186888 3300026023 Bacteria 1635
287 Ga0207703_10000232 3300026035 Bacteria 63879
288 Ga0207703_10065849 3300026035 Bacteria 2979
289 Ga0207703_10428403 3300026035 Bacteria 1232
290 Ga0207639_10245698 3300026041 Bacteria 1558
291 Ga0207702_10229391 3300026078 Bacteria 1734
292 Ga0207641_10260395 3300026088 Bacteria 1624
293 Ga0207641_10406862 3300026088 Bacteria 1308
294 Ga0207676_10242267 3300026095 Bacteria 1618
295 Ga0207676_10526415 3300026095 Bacteria 1126
296 Ga0207674_10023560 3300026116 Bacteria 6592
297 Ga0207674_10842922 3300026116 Bacteria 884
298 Ga0207675_100045735 3300026118 Bacteria 4089
299 Ga0207683_10222386 3300026121 Bacteria 1720
300 Ga0207683_10473150 3300026121 Bacteria 1156
301 Ga0207698_10033868 3300026142 Bacteria 3716
302 Ga0207698_10383538 3300026142 Bacteria 1338
303 Ga0209179_1027653 3300027512 Bacteria 1145
304 Ga0209813_10054016 3300027866 Bacteria 1264
305 Ga0207428_10034425 3300027907 Bacteria 4151
306 Ga0207428_10307592 3300027907 Bacteria 1172
307 Ga0268266_10254979 3300028379 Bacteria 1624
308 Ga0268266_10443857 3300028379 Bacteria 1233
309 Ga0268264_10079604 3300028381 Bacteria 2796
310 Ga0265319_1001666 3300028563 Bacteria 12856
311 Ga0265319_1028149 3300028563 Bacteria 1984
312 Ga0265334_10009965 3300028573 Bacteria 4017
313 Ga0265318_10001695 3300028577 Bacteria 12649
314 Ga0265338_10085687 3300028800 Bacteria 2625
315 Ga0265338_10150390 3300028800 Bacteria 1810
316 Ga0307512_10009621 3300030522 Bacteria 9294
317 Ga0265320_10044210 3300031240 Bacteria 2196
318 Ga0265325_10005794 3300031241 Bacteria 7575
319 Ga0265340_10036050 3300031247 Bacteria 2453
320 Ga0265339_10022369 3300031249 Bacteria 3664
321 Ga0265316_10147223 3300031344 Bacteria 1765
322 Ga0307408_100267379 3300031548 Bacteria 1418
323 Ga0307408_100277958 3300031548 Bacteria 1393
324 Ga0265313_10089254 3300031595 Bacteria 1387
325 Ga0307508_10010752 3300031616 Bacteria 8368
326 Ga0307516_10001550 3300031730 Bacteria 31620
327 Ga0307405_10010719 3300031731 Bacteria 4765
328 Ga0307405_10045762 3300031731 Bacteria 2684
329 Ga0307405_10310188 3300031731 Bacteria 1201
330 Ga0307405_10325169 3300031731 Bacteria 1176
331 Ga0307413_10265286 3300031824 Bacteria 1282
332 Ga0307410_10006039 3300031852 Bacteria 6490
333 Ga0307410_10045905 3300031852 Bacteria 2912
334 Ga0307410_10073917 3300031852 Bacteria 2372
335 Ga0307406_10025356 3300031901 Bacteria 3550
336 Ga0307406_10157953 3300031901 Bacteria 1626
337 Ga0307406_10296544 3300031901 Bacteria 1240
338 Ga0307407_10000233 3300031903 Bacteria 16468
339 Ga0307407_10009971 3300031903 Bacteria 4454
340 Ga0307407_10062285 3300031903 Bacteria 2184
341 Ga0307412_10101515 3300031911 Bacteria 2036
342 Ga0307412_10108067 3300031911 Bacteria 1981
343 Ga0307409_100003046 3300031995 Bacteria 8963
344 Ga0307409_100033193 3300031995 Bacteria 3753
345 Ga0307409_100077230 3300031995 Bacteria 2674
346 Ga0307409_100168798 3300031995 Bacteria 1923
347 Ga0307409_100216504 3300031995 Bacteria 1726
348 Ga0307409_100258319 3300031995 Bacteria 1597
349 Ga0307416_100003770 3300032002 Bacteria 8992
350 Ga0307416_100013836 3300032002 Bacteria 5500
351 Ga0307416_100019981 3300032002 Bacteria 4766
352 Ga0307416_100085957 3300032002 Bacteria 2679
353 Ga0307416_100206499 3300032002 Bacteria 1869
354 Ga0307416_100345875 3300032002 Bacteria 1502
355 Ga0307416_100592414 3300032002 Bacteria 1187
356 Ga0307414_10167045 3300032004 Bacteria 1755
357 Ga0307411_10049442 3300032005 Bacteria 2732
358 Ga0307411_10058446 3300032005 Bacteria 2552
359 Ga0307415_100003679 3300032126 Bacteria 7846
360 Ga0307415_100005171 3300032126 Bacteria 6888
361 Ga0307415_100036005 3300032126 Bacteria 3239
362 Ga0307507_10020421 3300033179 Bacteria 7418
363 Ga0307510_10042591 3300033180 Bacteria 4946
364 Ga0373934_0000008 3300035086 Bacteria 74071
365 Ga0373934_0001843 3300035086 Bacteria 7794
366 Ga0373934_0046557 3300035086 Bacteria 1715
367 Ga0373944_0006609 3300035089 Bacteria 3079
368 Ga0373952_0061045 3300035092 Bacteria 922
369 Ga0373923_0005382 3300035111 Bacteria 4344
370 Ga0373923_0006700 3300035111 Bacteria 4003
371 Ga0373923_0010520 3300035111 Bacteria 3369
372 Ga0373923_0013805 3300035111 Bacteria 3018
373 Ga0373936_0002996 3300035113 Bacteria 6314
374 Ga0373936_0009126 3300035113 Bacteria 3738
375 Ga0373936_0019325 3300035113 Bacteria 2640
376 Ga0373936_0122412 3300035113 Bacteria 1112
377 Ga0373945_0000406 3300035116 Bacteria 12356
378 Ga0373945_0100388 3300035116 Bacteria 1132
379 Ga0373953_0000057 3300035117 Bacteria 28552
380 Ga0373953_0046096 3300035117 Bacteria 1749
381 Ga0373953_0059519 3300035117 Bacteria 1559
382 Ga0373954_0002289 3300035118 Bacteria 7974
383 Ga0373954_0012652 3300035118 Bacteria 3754
384 Ga0373954_0016934 3300035118 Bacteria 3270
385 Ga0373954_0036913 3300035118 Bacteria 2269
386 Ga0373954_0062170 3300035118 Bacteria 1763
387 Ga0373954_0099620 3300035118 Bacteria 1401
388 Ga0373956_0005479 3300035119 Bacteria 5080
389 Ga0373956_0013197 3300035119 Bacteria 3436
390 Ga0373956_0031980 3300035119 Bacteria 2307
391 Ga0373957_0000164 3300035120 Bacteria 16962
392 Ga0373957_0000836 3300035120 Bacteria 8053
393 Ga0373957_0013534 3300035120 Bacteria 2769
394 Ga0373943_0002294 3300035170 Bacteria 8689
395 Ga0373943_0040035 3300035170 Bacteria 2261
396 Ga0373946_0004299 3300035171 Bacteria 5089
397 Ga0373955_0000660 3300035172 Bacteria 14675
398 Ga0373955_0001687 3300035172 Bacteria 9445
399 Ga0373955_0003081 3300035172 Bacteria 7295
400 Ga0373955_0047077 3300035172 Bacteria 2334
401 Ga0373955_0072480 3300035172 Bacteria 1929
402 Ga0373962_0043395 3300035242 Bacteria 1275
403 Ga0373924_0002548 3300035410 Bacteria 6150
404 Ga0373924_0006314 3300035410 Bacteria 4240
405 Ga0373924_0015285 3300035410 Bacteria 2916
406 Ga0373924_0020410 3300035410 Bacteria 2575
407 Ga0373924_0022153 3300035410 Bacteria 2482
408 Ga0373931_0289311 3300035691 Bacteria 1008
409 Ga0373935_0024869 3300035692 Bacteria 3688
410 Ga0373935_0028094 3300035692 Bacteria 3476
411 Ga0373935_0200250 3300035692 Bacteria 1379
412 Ga0373927_0001584 3300035695 Bacteria 17074
413 Ga0373927_0165752 3300035695 Bacteria 1448
414 Ga0373933_0000150 3300035724 Bacteria 45663
415 Ga0373933_0001027 3300035724 Bacteria 16979
416 Ga0373933_0097095 3300035724 Bacteria 1824
417 Ga0373933_0099988 3300035724 Bacteria 1798
418 Ga0373933_0131273 3300035724 Bacteria 1575
419 Ga0373933_0153041 3300035724 Bacteria 1461
420 Ga0373947_0003709 3300035725 Bacteria 9023
421 Ga0373947_0175820 3300035725 Bacteria 1391
422 Ga0373937_0000002 3300036401 Bacteria 304133
423 Ga0373937_0038707 3300036401 Bacteria 4345
424 Ga0373937_0046021 3300036401 Bacteria 3988
425 Ga0373937_0055004 3300036401 Bacteria 3652
426 Ga0373937_0072237 3300036401 Bacteria 3182
427 Ga0373937_0080373 3300036401 Bacteria 3014
428 Ga0373937_0113483 3300036401 Bacteria 2521
429 Ga0373937_0254108 3300036401 Bacteria 1657
430 Ga0373937_0283181 3300036401 Bacteria 1565
431 Ga0373937_0300395 3300036401 Bacteria 1517
432 Ga0373925_0003875 3300037068 Bacteria 11439
433 Ga0373925_0079378 3300037068 Bacteria 2493
434 Ga0395899_0009014 3300037312 Bacteria 7668
435 Ga0395899_0060446 3300037312 Bacteria 2792
436 Ga0395899_0075670 3300037312 Bacteria 2458
437 Ga0395900_0000728 3300037418 Bacteria 43848
438 Ga0395900_0002127 3300037418 Bacteria 22170
439 Ga0395900_0024834 3300037418 Bacteria 6134
440 Ga0395900_0169054 3300037418 Bacteria 2227
441 Ga0395900_0243967 3300037418 Bacteria 1801
442 Ga0395900_0320023 3300037418 Bacteria 1532
443 Ga0395898_0038489 3300037466 Bacteria 4739
444 Ga0395898_0086697 3300037466 Bacteria 3017
445 Ga0395898_0090933 3300037466 Bacteria 2937
446 Ga0395905_0004578 3300037471 Bacteria 14307
447 Ga0395905_0153750 3300037471 Bacteria 2164
448 Ga0395905_0338789 3300037471 Bacteria 1395
449 Ga0436364_0047523 3300037853 Bacteria 1908
450 Ga0436364_0162021 3300037853 Bacteria 1304
451 Ga0436364_0525292 3300037853 Bacteria 2264
452 Ga0436364_0553397 3300037853 Bacteria 8828
453 Ga0436364_0910455 3300037853 Bacteria 7448
454 Ga0436364_0913146 3300037853 Bacteria 22722
455 Ga0436364_1051289 3300037853 Bacteria 3964
456 Ga0395901_0004408 3300038443 Bacteria 14188
457 Ga0395901_0075388 3300038443 Bacteria 3519
458 Ga0395901_0101464 3300038443 Bacteria 3019
459 Ga0395901_0171986 3300038443 Bacteria 2273
460 Ga0395901_0323363 3300038443 Bacteria 1595
461 Ga0436365_1203819 3300039437 Bacteria 913
462 Ga0436363_1086998 3300039450 Bacteria 1045
463 Ga0439433_0000431 3300041999 Bacteria 7652
464 Ga0439442_002517 3300042002 Bacteria 3598
465 Ga0439448_0009788 3300042005 Bacteria 2830
466 Ga0439448_0032520 3300042005 Bacteria 1660
467 Ga0439450_002169 3300042008 Bacteria 3036
468 Ga0439455_0007276 3300042012 Bacteria 2336
469 Ga0439463_001816 3300042016 Bacteria 5554
470 Ga0439446_0006770 3300042156 Bacteria 3000
471 Ga0439459_0022074 3300042438 Bacteria 1229
472 Ga0439464_0001242 3300042439 Bacteria 5927
473 Ga0439464_0010275 3300042439 Bacteria 2470
474 Ga0439460_0003952 3300042461 Bacteria 3602
475 Ga0439440_0000085 3300042993 Bacteria 11972
476 Ga0439440_0010001 3300042993 Bacteria 1973
477 Ga0466963_0069603 3300044694 Bacteria 2365
478 Ga0466963_0104837 3300044694 Bacteria 1938
479 Ga0466963_0193594 3300044694 Bacteria 1421
480 Ga0466963_0281326 3300044694 Bacteria 1169
481 Ga0466967_0000799 3300045976 Bacteria 16449
482 Ga0466967_0039141 3300045976 Bacteria 4073
483 Ga0466967_0169965 3300045976 Bacteria 2050
484 Ga0466967_0315184 3300045976 Bacteria 1507
485 Ga0495617_078920 3300046452 Bacteria 1079
486 Ga0495592_0000003 3300046454 Bacteria 200744
487 Ga0495592_0001690 3300046454 Bacteria 15487
488 Ga0495592_0002442 3300046454 Bacteria 13102
489 Ga0495592_0009147 3300046454 Bacteria 7454
490 Ga0495592_0110313 3300046454 Bacteria 1947
491 Ga0495592_0153827 3300046454 Bacteria 1588
492 Ga0495603_0001819 3300046455 Bacteria 12591
493 Ga0495603_0032222 3300046455 Bacteria 3154
494 Ga0495603_0072515 3300046455 Bacteria 2023
495 Ga0495603_0141673 3300046455 Bacteria 1398
496 Ga0495629_0001430 3300046459 Bacteria 18824
497 Ga0495629_0041055 3300046459 Bacteria 3255
498 Ga0495629_0155247 3300046459 Bacteria 1590
499 Ga0495629_0171078 3300046459 Bacteria 1507
500 Ga0495629_0263381 3300046459 Bacteria 1185
501 Ga0495638_0078207 3300046460 Bacteria 2013
502 Ga0495641_0001557 3300046461 Bacteria 19435
503 Ga0495641_0056815 3300046461 Bacteria 1773
504 Ga0495651_0000031 3300046462 Bacteria 103122
505 Ga0495651_0001698 3300046462 Bacteria 16989
506 Ga0495651_0032072 3300046462 Bacteria 4099
507 Ga0495651_0044372 3300046462 Bacteria 3446
508 Ga0495651_0057937 3300046462 Bacteria 2973
509 Ga0495651_0074425 3300046462 Bacteria 2576
510 Ga0495651_0168540 3300046462 Bacteria 1562
511 Ga0495651_0258442 3300046462 Bacteria 1186
512 Ga0495651_0277913 3300046462 Bacteria 1132
513 Ga0495653_0022055 3300046463 Bacteria 5154
514 Ga0495653_0028649 3300046463 Bacteria 4452
515 Ga0495653_0029406 3300046463 Bacteria 4386
516 Ga0495653_0083777 3300046463 Bacteria 2350
517 Ga0495653_0096349 3300046463 Bacteria 2151
518 Ga0495653_0109074 3300046463 Bacteria 1992
519 Ga0495580_0003337 3300046472 Bacteria 13724
520 Ga0495582_0000900 3300046473 Bacteria 16539
521 Ga0495582_0002973 3300046473 Bacteria 9497
522 Ga0495582_0034330 3300046473 Bacteria 2788
523 Ga0495582_0135691 3300046473 Bacteria 1392
524 Ga0495605_0005430 3300046474 Bacteria 7422
525 Ga0495639_0004240 3300046475 Bacteria 6152
526 Ga0495639_0063947 3300046475 Bacteria 1690
527 Ga0495662_0002002 3300046476 Bacteria 10211
528 Ga0495662_0003716 3300046476 Bacteria 7689
529 Ga0495662_0004321 3300046476 Bacteria 7147
530 Ga0495662_0017641 3300046476 Bacteria 3455
531 Ga0495664_0024750 3300046477 Bacteria 3490
532 Ga0495664_0037535 3300046477 Bacteria 2859
533 Ga0495664_0050545 3300046477 Bacteria 2468
534 Ga0495664_0087529 3300046477 Bacteria 1871
535 Ga0495664_0131509 3300046477 Bacteria 1515
536 Ga0495664_0394726 3300046477 Bacteria 831
537 Ga0495585_0014007 3300046492 Bacteria 4683
538 Ga0495585_0118674 3300046492 Bacteria 1401
539 Ga0495594_0003058 3300046499 Bacteria 8669
540 Ga0495594_0008442 3300046499 Bacteria 5308
541 Ga0495607_0039083 3300046501 Bacteria 2836
542 Ga0495583_0006670 3300046506 Bacteria 7485
543 Ga0495606_0014087 3300046507 Bacteria 6263
544 Ga0495608_0000018 3300046511 Bacteria 192512
545 Ga0495608_0001179 3300046511 Bacteria 18539
546 Ga0495608_0012462 3300046511 Bacteria 5899
547 Ga0495608_0035937 3300046511 Bacteria 3337
548 Ga0495608_0074240 3300046511 Bacteria 2216
549 Ga0495608_0122797 3300046511 Bacteria 1665
550 Ga0495608_0145977 3300046511 Bacteria 1509
551 Ga0495610_0034389 3300046512 Bacteria 2611
552 Ga0495618_0044785 3300046514 Bacteria 2790
553 Ga0495618_0047943 3300046514 Bacteria 2696
554 Ga0495618_0122996 3300046514 Bacteria 1661
555 Ga0495618_0175575 3300046514 Bacteria 1362
556 Ga0495618_0305259 3300046514 Bacteria 988
557 Ga0495620_0004863 3300046515 Bacteria 7537
558 Ga0495628_0005767 3300046516 Bacteria 10848
559 Ga0495628_0007721 3300046516 Bacteria 9285
560 Ga0495628_0017377 3300046516 Bacteria 5991
561 Ga0495628_0050820 3300046516 Bacteria 3278
562 Ga0495628_0112881 3300046516 Bacteria 2089
563 Ga0495628_0115522 3300046516 Bacteria 2061
564 Ga0495630_0002461 3300046517 Bacteria 12824
565 Ga0495630_0154107 3300046517 Bacteria 1749
566 Ga0495630_0284226 3300046517 Bacteria 1264
567 Ga0495631_0022562 3300046518 Bacteria 2926
568 Ga0495666_0000587 3300046526 Bacteria 16270
569 Ga0495666_0001571 3300046526 Bacteria 11239
570 Ga0495652_0000013 3300046529 Bacteria 238164
571 Ga0495652_0003007 3300046529 Bacteria 16913
572 Ga0495652_0021496 3300046529 Bacteria 5735
573 Ga0495652_0062438 3300046529 Bacteria 3141
574 Ga0495652_0119182 3300046529 Bacteria 2108
575 Ga0495652_0214104 3300046529 Bacteria 1452
576 Ga0495665_0003481 3300046531 Bacteria 8547
577 Ga0495665_0005814 3300046531 Bacteria 6654
578 Ga0495640_0001550 3300046533 Bacteria 18099
579 Ga0495640_0077283 3300046533 Bacteria 2219
580 Ga0495586_0024228 3300046535 Bacteria 3242
581 Ga0495586_0032966 3300046535 Bacteria 2779
582 Ga0495586_0191857 3300046535 Bacteria 1157
583 Ga0495587_0000014 3300046536 Bacteria 192100
584 Ga0495587_0001222 3300046536 Bacteria 16991
585 Ga0495587_0004895 3300046536 Bacteria 8782
586 Ga0495587_0030451 3300046536 Bacteria 3272
587 Ga0495587_0068648 3300046536 Bacteria 2064
588 Ga0495587_0268481 3300046536 Bacteria 957
589 Ga0495597_0063195 3300046542 Bacteria 1609
590 Ga0495645_0010064 3300046543 Bacteria 6625
591 Ga0495645_0054136 3300046543 Bacteria 2916
592 Ga0495645_0099184 3300046543 Bacteria 2073
593 Ga0495645_0200787 3300046543 Bacteria 1353
594 Ga0495645_0225925 3300046543 Bacteria 1256
595 Ga0495622_0001625 3300046557 Bacteria 11092
596 Ga0495667_0000014 3300046559 Bacteria 200767
597 Ga0495667_0001583 3300046559 Bacteria 15111
598 Ga0495667_0002840 3300046559 Bacteria 11580
599 Ga0495667_0004627 3300046559 Bacteria 9301
600 Ga0495667_0096230 3300046559 Bacteria 1916
601 Ga0495667_0109181 3300046559 Bacteria 1787
602 Ga0495656_0165988 3300046615 Bacteria 1076
603 Ga0495668_0006862 3300046616 Bacteria 7381
604 Ga0495634_0015156 3300046642 Bacteria 5541
605 Ga0495634_0020643 3300046642 Bacteria 4668
606 Ga0495634_0102267 3300046642 Bacteria 1850
607 Ga0495625_0005158 3300046660 Bacteria 12053
608 Ga0495635_0002971 3300046663 Bacteria 11634
609 Ga0495635_0009654 3300046663 Bacteria 6747
610 Ga0495635_0032021 3300046663 Bacteria 3649
611 Ga0495635_0040666 3300046663 Bacteria 3213
612 Ga0495635_0062708 3300046663 Bacteria 2553
613 Ga0495635_0115917 3300046663 Bacteria 1828
614 Ga0495588_0049698 3300046674 Bacteria 2157
615 Ga0495657_0000012 3300046675 Bacteria 197154
616 Ga0495657_0002083 3300046675 Bacteria 16990
617 Ga0495657_0002488 3300046675 Bacteria 15491
618 Ga0495657_0007964 3300046675 Bacteria 8122
619 Ga0495657_0044769 3300046675 Bacteria 3008
620 Ga0495599_0000071 3300046678 Bacteria 70833
621 Ga0495599_0001462 3300046678 Bacteria 13570
622 Ga0495599_0003420 3300046678 Bacteria 9288
623 Ga0495599_0040865 3300046678 Bacteria 2912
624 Ga0495599_0075304 3300046678 Bacteria 2107
625 Ga0495599_0088226 3300046678 Bacteria 1936
626 Ga0495599_0099750 3300046678 Bacteria 1810
627 Ga0495623_0000066 3300046679 Bacteria 64935
628 Ga0495623_0009736 3300046679 Bacteria 6237
629 Ga0495623_0020840 3300046679 Bacteria 4237
630 Ga0495623_0035880 3300046679 Bacteria 3177
631 Ga0495623_0209598 3300046679 Bacteria 1116
632 Ga0495646_0002179 3300046680 Bacteria 11931
633 Ga0495646_0010588 3300046680 Bacteria 5859
634 Ga0495646_0013612 3300046680 Bacteria 5170
635 Ga0495646_0051900 3300046680 Bacteria 2480
636 Ga0495646_0073924 3300046680 Bacteria 2002
637 Ga0495646_0082200 3300046680 Bacteria 1874
638 Ga0495646_0180353 3300046680 Bacteria 1159
639 Ga0495647_0008098 3300046681 Bacteria 3532
640 Ga0495658_0001467 3300046683 Bacteria 12419
641 Ga0495658_0025839 3300046683 Bacteria 3143
642 Ga0495658_0026533 3300046683 Bacteria 3106
643 Ga0495658_0238336 3300046683 Bacteria 1142
644 Ga0495658_0263171 3300046683 Bacteria 1086
645 Ga0495613_0001226 3300046689 Bacteria 19608
646 Ga0495613_0018971 3300046689 Bacteria 5124
647 Ga0495613_0048343 3300046689 Bacteria 3141
648 Ga0495613_0117004 3300046689 Bacteria 1917
649 Ga0495613_0150575 3300046689 Bacteria 1659
650 Ga0495624_0024307 3300046690 Bacteria 3987
651 Ga0495624_0063452 3300046690 Bacteria 2309
652 Ga0495624_0090033 3300046690 Bacteria 1893
653 Ga0495624_0096144 3300046690 Bacteria 1825
654 Ga0495624_0179061 3300046690 Bacteria 1292
655 Ga0495670_0163212 3300046691 Bacteria 1171
656 Ga0495600_0011397 3300046809 Bacteria 5537
657 Ga0495600_0013523 3300046809 Bacteria 5131
658 Ga0495600_0034947 3300046809 Bacteria 3263
659 Ga0495600_0042054 3300046809 Bacteria 2978
660 Ga0495600_0054273 3300046809 Bacteria 2617
661 Ga0495600_0084208 3300046809 Bacteria 2075
662 Ga0495600_0188913 3300046809 Bacteria 1325
663 Ga0495660_0001825 3300046810 Bacteria 13981
664 Ga0495581_0001384 3300047315 Bacteria 13413
665 Ga0495581_0035219 3300047315 Bacteria 2896
666 Ga0495581_0052815 3300047315 Bacteria 2348
667 Ga0495604_0000054 3300047317 Bacteria 101084
668 Ga0495604_0001896 3300047317 Bacteria 16984
669 Ga0495604_0004151 3300047317 Bacteria 11503
670 Ga0495604_0047486 3300047317 Bacteria 3343
671 Ga0495604_0265760 3300047317 Bacteria 1164
672 Ga0495674_0005276 3300047319 Bacteria 12391
673 Ga0495674_0059826 3300047319 Bacteria 3326
674 Ga0495674_0158922 3300047319 Bacteria 1891
675 Ga0495676_0009620 3300047321 Bacteria 8796
676 Ga0495676_0052211 3300047321 Bacteria 3264
677 Ga0495676_0102103 3300047321 Bacteria 2120
678 Ga0495676_0181609 3300047321 Bacteria 1474
679 Ga0495680_0000003 3300047322 Bacteria 172246
680 Ga0495680_0002973 3300047322 Bacteria 16946
681 Ga0495680_0007615 3300047322 Bacteria 9897
682 Ga0495680_0023739 3300047322 Bacteria 5096
683 Ga0495680_0032570 3300047322 Bacteria 4228
684 Ga0495680_0045187 3300047322 Bacteria 3478
685 Ga0495680_0052617 3300047322 Bacteria 3173
686 Ga0495683_0004421 3300047323 Bacteria 7981
687 Ga0495675_0000406 3300047444 Bacteria 29682
688 Ga0495675_0001024 3300047444 Bacteria 16977
689 Ga0495675_0019329 3300047444 Bacteria 4326
690 Ga0495675_0204279 3300047444 Bacteria 1201
691 Ga0495685_010177 3300047447 Bacteria 3152
692 Ga0495685_020744 3300047447 Bacteria 2259
693 Ga0495684_0040840 3300047471 Bacteria 3555
694 Ga0495684_0047171 3300047471 Bacteria 3295
695 Ga0495684_0060711 3300047471 Bacteria 2877
696 Ga0495686_0235339 3300047472 Bacteria 1035
697 Ga0495593_0001170 3300047673 Bacteria 15332
698 Ga0495593_0003493 3300047673 Bacteria 9405
699 Ga0495602_0000014 3300048088 Bacteria 193335
700 Ga0495602_0003146 3300048088 Bacteria 16991
701 Ga0495602_0008563 3300048088 Bacteria 10683
702 Ga0495602_0113889 3300048088 Bacteria 2191
703 Ga0495602_0186852 3300048088 Bacteria 1592
704 Ga0495614_0000979 3300048089 Bacteria 12148
705 Ga0495614_0013002 3300048089 Bacteria 3649
706 Ga0495614_0016302 3300048089 Bacteria 3235
707 Ga0495614_0026085 3300048089 Bacteria 2518
708 Ga0495626_0077053 3300048091 Bacteria 1487
709 Ga0496100_0034092 3300048903 Bacteria 3191
710 Ga0496101_0038896 3300048904 Bacteria 3380
711 Ga0496101_0044109 3300048904 Bacteria 3190
712 Ga0496101_0335949 3300048904 Bacteria 1186
713 Ga0496102_0110247 3300048905 Bacteria 2565
714 Ga0496102_0244036 3300048905 Bacteria 1694
715 Ga0496102_0292353 3300048905 Bacteria 1536
716 Ga0496104_0000722 3300048907 Bacteria 28422
717 Ga0496104_0020574 3300048907 Bacteria 6050
718 Ga0496104_0021280 3300048907 Bacteria 5952
719 Ga0496104_0108427 3300048907 Bacteria 2661
720 Ga0496104_0109429 3300048907 Bacteria 2648
721 Ga0496104_0416754 3300048907 Bacteria 1255
722 Ga0496105_0023370 3300048908 Bacteria 5012
723 Ga0496105_0050944 3300048908 Bacteria 3421
724 Ga0496105_0072964 3300048908 Bacteria 2836
725 Ga0496105_0361653 3300048908 Bacteria 1158
726 Ga0496105_0555171 3300048908 Bacteria 896
727 Ga0496107_0143703 3300048910 Bacteria 1764
728 Ga0496108_0005257 3300048911 Bacteria 10456
729 Ga0496108_0022746 3300048911 Bacteria 5156
730 Ga0496108_0039119 3300048911 Bacteria 3953
731 Ga0496108_0544960 3300048911 Bacteria 1012
732 Ga0496109_0003779 3300048912 Bacteria 12640
733 Ga0496109_0005143 3300048912 Bacteria 10918
734 Ga0496109_0019319 3300048912 Bacteria 6005
735 Ga0496109_0032477 3300048912 Bacteria 4692
736 Ga0496109_0087190 3300048912 Bacteria 2883
737 Ga0496109_0128552 3300048912 Bacteria 2364
738 Ga0496109_0243426 3300048912 Bacteria 1693
739 Ga0496109_0258151 3300048912 Bacteria 1641
740 Ga0496109_0363850 3300048912 Bacteria 1366
741 Ga0496110_0010416 3300048913 Bacteria 7559
742 Ga0496110_0028189 3300048913 Bacteria 4820
743 Ga0496110_0051691 3300048913 Bacteria 3611
744 Ga0496110_0109059 3300048913 Bacteria 2486
745 Ga0496110_0378805 3300048913 Bacteria 1289
746 Ga0496111_0002767 3300048914 Bacteria 10671
747 Ga0496111_0031532 3300048914 Bacteria 3776
748 Ga0496112_0070761 3300048915 Bacteria 3448
749 Ga0496112_0083395 3300048915 Bacteria 3161
750 Ga0496112_0378567 3300048915 Bacteria 1356
751 Ga0496112_0544230 3300048915 Bacteria 1095
752 Ga0496113_0006089 3300048916 Bacteria 7607
753 Ga0496113_0095449 3300048916 Bacteria 2298
754 Ga0496114_0011659 3300048917 Bacteria 7031
755 Ga0496114_0013605 3300048917 Bacteria 6525
756 Ga0496114_0061195 3300048917 Bacteria 3148
757 Ga0496114_0069477 3300048917 Bacteria 2958
758 Ga0496114_0199626 3300048917 Bacteria 1752
759 Ga0496114_0319993 3300048917 Bacteria 1371
760 Ga0496114_0345250 3300048917 Bacteria 1316
761 Ga0496115_0154469 3300048918 Bacteria 1895
762 Ga0496115_0229223 3300048918 Bacteria 1532
763 Ga0496125_0000074 3300048928 Bacteria 235549
764 Ga0501031_0005785 3300049568 Bacteria 8057
765 Ga0501031_0024185 3300049568 Bacteria 3960
766 Ga0501031_0035251 3300049568 Bacteria 3264
767 Ga0501031_0157707 3300049568 Bacteria 1483
768 Ga0501032_0000108 3300049569 Bacteria 71059
769 Ga0501032_0030399 3300049569 Bacteria 3706
770 Ga0501032_0039674 3300049569 Bacteria 3202
771 Ga0501032_0271987 3300049569 Bacteria 1098
772 Ga0501033_0000164 3300049570 Bacteria 63459
773 Ga0501033_0006788 3300049570 Bacteria 8936
774 Ga0501033_0098336 3300049570 Bacteria 2137
775 Ga0501033_0108179 3300049570 Bacteria 2025
776 Ga0501033_0150222 3300049570 Bacteria 1681
777 Ga0501033_0188427 3300049570 Bacteria 1477
778 Ga0501034_0003397 3300049571 Bacteria 18185
779 Ga0501034_0020392 3300049571 Bacteria 6767
780 Ga0501036_0001671 3300049572 Bacteria 17198
781 Ga0501036_0011171 3300049572 Bacteria 7430
782 Ga0501036_0060563 3300049572 Bacteria 3207
783 Ga0501036_0101931 3300049572 Bacteria 2428
784 Ga0501036_0136008 3300049572 Bacteria 2074
785 Ga0501036_0326930 3300049572 Bacteria 1281
786 Ga0501037_0007348 3300049573 Bacteria 8057
787 Ga0501037_0025622 3300049573 Bacteria 4357
788 Ga0501037_0122721 3300049573 Bacteria 1867
789 Ga0501037_0217418 3300049573 Bacteria 1345
790 Ga0501037_0453959 3300049573 Bacteria 874
791 Ga0501038_0000161 3300049574 Bacteria 57288
792 Ga0501038_0002544 3300049574 Bacteria 16995
793 Ga0501038_0003748 3300049574 Bacteria 14146
794 Ga0501038_0005612 3300049574 Bacteria 11643
795 Ga0501038_0012178 3300049574 Bacteria 7853
796 Ga0501038_0039457 3300049574 Bacteria 4130
797 Ga0501038_0221224 3300049574 Bacteria 1510
798 Ga0501039_0001976 3300049575 Bacteria 15199
799 Ga0501039_0009217 3300049575 Bacteria 7521
800 Ga0501039_0014708 3300049575 Bacteria 5986
801 Ga0501039_0036426 3300049575 Bacteria 3797
802 Ga0501039_0232363 3300049575 Bacteria 1450
803 Ga0501040_0001937 3300049576 Bacteria 13308
804 Ga0501040_0004560 3300049576 Bacteria 8993
805 Ga0501040_0016228 3300049576 Bacteria 4925
806 Ga0501040_0035744 3300049576 Bacteria 3370
807 Ga0501040_0046914 3300049576 Bacteria 2949
808 Ga0501040_0130703 3300049576 Bacteria 1765
809 Ga0501040_0215696 3300049576 Bacteria 1365
810 Ga0501041_0004430 3300049577 Bacteria 8123
811 Ga0501041_0070628 3300049577 Bacteria 2143
812 Ga0501041_0166888 3300049577 Bacteria 1377
813 Ga0501041_0253473 3300049577 Bacteria 1106
814 Ga0501042_0006280 3300049578 Bacteria 7712
815 Ga0501042_0106636 3300049578 Bacteria 2017
816 Ga0501042_0185078 3300049578 Bacteria 1502
817 Ga0501042_0333612 3300049578 Bacteria 1096
818 Ga0501043_0000221 3300049579 Bacteria 51649
819 Ga0501043_0005784 3300049579 Bacteria 9952
820 Ga0501046_0000414 3300049580 Bacteria 42564
821 Ga0501046_0000945 3300049580 Bacteria 28480
822 Ga0501046_0031079 3300049580 Bacteria 4332
823 Ga0501046_0037972 3300049580 Bacteria 3868
824 Ga0501046_0095804 3300049580 Bacteria 2280
825 Ga0501046_0098345 3300049580 Bacteria 2247
826 Ga0501047_0004081 3300049581 Bacteria 13739
827 Ga0501047_0013200 3300049581 Bacteria 7823
828 Ga0501047_0029065 3300049581 Bacteria 5331
829 Ga0501047_0102106 3300049581 Bacteria 2747
830 Ga0501048_0000090 3300049582 Bacteria 48441
831 Ga0501048_0001170 3300049582 Bacteria 19793
832 Ga0501048_0015701 3300049582 Bacteria 5587
833 Ga0501048_0016989 3300049582 Bacteria 5363
834 Ga0501048_0082200 3300049582 Bacteria 2272
835 Ga0501048_0095229 3300049582 Bacteria 2099
836 Ga0501048_0112367 3300049582 Bacteria 1924
837 Ga0501048_0159296 3300049582 Bacteria 1597
838 Ga0501048_0266940 3300049582 Bacteria 1216
839 Ga0501067_0009083 3300049583 Bacteria 5505
840 Ga0501068_0079893 3300049584 Bacteria 2005
841 Ga0501068_0131115 3300049584 Bacteria 1567
842 Ga0501068_0350852 3300049584 Bacteria 948
843 Ga0501068_0461702 3300049584 Bacteria 822
844 Ga0501069_0001513 3300049585 Bacteria 11507
845 Ga0501069_0052427 3300049585 Bacteria 2272
846 Ga0501070_0001610 3300049586 Bacteria 20037
847 Ga0501070_0002854 3300049586 Bacteria 15068
848 Ga0501070_0126720 3300049586 Bacteria 2110
849 Ga0501070_0154626 3300049586 Bacteria 1892
850 Ga0501070_0199897 3300049586 Bacteria 1642
851 Ga0501071_0025912 3300049587 Bacteria 4111
852 Ga0501071_0116468 3300049587 Bacteria 1978
853 Ga0501072_0014252 3300049588 Bacteria 6091
854 Ga0501072_0016025 3300049588 Bacteria 5747
855 Ga0501072_0033774 3300049588 Bacteria 4009
856 Ga0501072_0078480 3300049588 Bacteria 2614
857 Ga0501072_0209267 3300049588 Bacteria 1554
858 Ga0501072_0285634 3300049588 Bacteria 1312
859 Ga0501073_0462637 3300049589 Bacteria 877
860 Ga0501074_0000924 3300049590 Bacteria 18846
861 Ga0501074_0019890 3300049590 Bacteria 4876
862 Ga0501074_0243016 3300049590 Bacteria 1280
863 Ga0501074_0343933 3300049590 Bacteria 1059
864 Ga0501075_0000524 3300049591 Bacteria 23176
865 Ga0501075_0004638 3300049591 Bacteria 9326
866 Ga0501075_0011861 3300049591 Bacteria 6182
867 Ga0501075_0032259 3300049591 Bacteria 3891
868 Ga0501075_0059596 3300049591 Bacteria 2876
869 Ga0501075_0338034 3300049591 Bacteria 1147
870 Ga0501075_0428980 3300049591 Bacteria 1008
871 Ga0501076_0006666 3300049592 Bacteria 8376
872 Ga0501076_0015358 3300049592 Bacteria 5786
873 Ga0501076_0022716 3300049592 Bacteria 4823
874 Ga0501076_0036830 3300049592 Bacteria 3835
875 Ga0501076_0162526 3300049592 Bacteria 1819
876 Ga0501076_0270765 3300049592 Bacteria 1391
877 Ga0501077_0002491 3300049593 Bacteria 11029
878 Ga0501077_0019315 3300049593 Bacteria 4310
879 Ga0501077_0103918 3300049593 Bacteria 1800
880 Ga0501077_0119163 3300049593 Bacteria 1672
881 Ga0501077_0308238 3300049593 Bacteria 1009
882 Ga0501079_0043610 3300049741 Bacteria 3462
883 Ga0501079_0044397 3300049741 Bacteria 3430
884 Ga0501079_0115151 3300049741 Bacteria 2090
885 Ga0501079_0192763 3300049741 Bacteria 1591
886 Ga0501080_0094830 3300049742 Bacteria 2771
887 Ga0501080_0167277 3300049742 Bacteria 2029
888 Ga0501080_0295822 3300049742 Bacteria 1469
889 Ga0501080_0878481 3300049742 Bacteria 782
890 Ga0501081_0003946 3300049743 Bacteria 9505
891 Ga0501081_0021613 3300049743 Bacteria 4294
892 Ga0501081_0022951 3300049743 Bacteria 4178
893 Ga0501081_0026133 3300049743 Bacteria 3933
894 Ga0501081_0229248 3300049743 Bacteria 1352
895 Ga0501081_0231687 3300049743 Bacteria 1345
896 Ga0501081_0350997 3300049743 Bacteria 1087
897 Ga0501083_0003637 3300049744 Bacteria 10825
898 Ga0501083_0022502 3300049744 Bacteria 4373
899 Ga0501083_0123613 3300049744 Bacteria 1697
900 Ga0501083_0282246 3300049744 Bacteria 1080
901 Ga0501035_0003384 3300049822 Bacteria 15258
902 Ga0501035_0006634 3300049822 Bacteria 10832
903 Ga0501035_0049015 3300049822 Bacteria 3786
904 Ga0501035_0168317 3300049822 Bacteria 1894
905 Ga0501035_0185937 3300049822 Bacteria 1788
906 Ga0501035_0192746 3300049822 Bacteria 1752
907 Ga0501044_0004084 3300049823 Bacteria 16368
908 Ga0501044_0035518 3300049823 Bacteria 5219
909 Ga0501044_0109515 3300049823 Bacteria 2771
910 Ga0501044_0148916 3300049823 Bacteria 2324
911 Ga0501044_0312515 3300049823 Bacteria 1497
912 Ga0501045_0000342 3300049824 Bacteria 27580
913 Ga0501045_0007152 3300049824 Bacteria 7742
914 Ga0501045_0011600 3300049824 Bacteria 6190
915 Ga0501045_0012748 3300049824 Bacteria 5922
916 Ga0501045_0082664 3300049824 Bacteria 2368
917 Ga0501045_0378105 3300049824 Bacteria 1054
918 nmdc:mga06z11_36123_c1 3300050494 Bacteria 2437
919 nmdc:mga04h51_1057_c1 3300050495 Bacteria 6337
920 nmdc:mga05p37_2109_c1 3300050507 Bacteria 23230
921 nmdc:mga05p37_302572_c1 3300050507 Bacteria 1899
922 nmdc:mga05p37_42056_c1 3300050507 Bacteria 5614
923 nmdc:mga05p37_46934_c1 3300050507 Bacteria 5312
924 nmdc:mga05p37_550379_c1 3300050507 Bacteria 1314
925 nmdc:mga05p37_705347_c1 3300050507 Bacteria 1120
926 nmdc:mga05p37_854937_c1 3300050507 Bacteria 987
927 nmdc:mga09592_1_c1 3300050508 Bacteria 201102
928 nmdc:mga09592_436536_c1 3300050508 Bacteria 1130
929 nmdc:mga09592_55171_c1 3300050508 Bacteria 3358
930 nmdc:mga09592_60941_c1 3300050508 Bacteria 3191
931 nmdc:mga0qj67_12_c3 3300050509 Bacteria 26384
932 nmdc:mga0qj67_37339_c1 3300050509 Bacteria 3805
933 nmdc:mga0qj67_6956_c1 3300050509 Bacteria 8328
934 nmdc:mga0qj67_74946_c1 3300050509 Bacteria 2704
935 nmdc:mga06r32_18140_c1 3300050510 Bacteria 6438
936 nmdc:mga06r32_5652_c1 3300050510 Bacteria 3737
937 nmdc:mga06r32_69469_c1 3300050510 Bacteria 3405
938 nmdc:mga06r32_7_c1 3300050510 Bacteria 117700
939 nmdc:mga08y16_488186_c1 3300050511 Bacteria 1253
940 nmdc:mga08y16_59203_c1 3300050511 Bacteria 4002
941 nmdc:mga08y16_611392_c1 3300050511 Bacteria 1098
942 nmdc:mga0n895_149698_c1 3300050512 Bacteria 2364
943 nmdc:mga0n895_52613_c1 3300050512 Bacteria 3998
944 nmdc:mga0rr50_4547_c1 3300050513 Bacteria 8164
945 nmdc:mga08x19_3216_c1 3300050514 Bacteria 9794
946 nmdc:mga08x19_35671_c1 3300050514 Bacteria 3147
947 nmdc:mga0a205_415971_c1 3300050515 Bacteria 1207
948 nmdc:mga0a205_51398_c1 3300050515 Bacteria 3979
949 nmdc:mga0a205_9843_c1 3300050515 Bacteria 8770
950 Ga0495601_0018762 3300053077 Bacteria 4211
951 Ga0495601_0082731 3300053077 Bacteria 2061
952 Ga0495601_0119368 3300053077 Bacteria 1712
953 Ga0495601_0243095 3300053077 Bacteria 1175
954 Ga0495612_0064256 3300053078 Bacteria 1523
955 Ga0495612_0093363 3300053078 Bacteria 1276
956 Ga0495595_0008912 3300053084 Bacteria 4134
957 Ga0495595_0021864 3300053084 Bacteria 2800
958 Ga0495595_0025606 3300053084 Bacteria 2616
959 Ga0495595_0039792 3300053084 Bacteria 2146
960 Ga0495619_0032529 3300053085 Bacteria 3385
961 Ga0495619_0033910 3300053085 Bacteria 3316
962 Ga0495619_0049148 3300053085 Bacteria 2781
963 Ga0495619_0218074 3300053085 Bacteria 1321
964 Ga0495619_0263873 3300053085 Bacteria 1193
965 Ga0495619_0287562 3300053085 Bacteria 1139
966 Ga0500616_0003740 3300053153 Bacteria 11351
967 Ga0501084_0006421 3300054114 Bacteria 9665
968 Ga0501084_0016597 3300054114 Bacteria 6114
969 Ga0501084_0019434 3300054114 Bacteria 5660
970 Ga0501084_0025101 3300054114 Bacteria 4972
971 Ga0501084_0064260 3300054114 Bacteria 3072
972 Ga0501082_0001187 3300060353 Bacteria 22887
973 Ga0501082_0014400 3300060353 Bacteria 6806
974 Ga0501082_0016828 3300060353 Bacteria 6296
975 Ga0501082_0024223 3300060353 Bacteria 5233
976 Ga0501082_0030043 3300060353 Bacteria 4682
977 Ga0501082_0031215 3300060353 Bacteria 4593
978 Ga0501082_0084054 3300060353 Bacteria 2746
979 Ga0530510_0001247 3300061734 Bacteria 16980
980 Ga0530510_0018086 3300061734 Bacteria 4996
981 Ga0530510_0046592 3300061734 Bacteria 3132
982 Ga0530510_0108722 3300061734 Bacteria 2030
983 Ga0530510_0128935 3300061734 Bacteria 1860
984 Ga0530510_0220798 3300061734 Bacteria 1408
985 Ga0530510_0300213 3300061734 Bacteria 1202

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005981 Ga0081538_10027367 Ga0081538_100273674 203
2 3300046690 Ga0495624_0179061 Ga0495624_0179061_440_1192 209
3 3300049573 Ga0501037_0217418 Ga0501037_0217418_663_1295 210
4 3300046462 Ga0495651_0168540 Ga0495651_0168540_773_1417 211
5 3300046543 Ga0495645_0200787 Ga0495645_0200787_119_763 211
6 3300025899 Ga0207642_10122093 Ga0207642_101220932 215
7 3300025931 Ga0207644_10439478 Ga0207644_104394782 225
8 3300049586 Ga0501070_0126720 Ga0501070_0126720_903_1682 225
9 3300049822 Ga0501035_0192746 Ga0501035_0192746_538_1317 225
10 3300020080 Ga0206350_11291229 Ga0206350_112912291 227
11 3300048912 Ga0496109_0243426 Ga0496109_0243426_166_882 227
12 3300050510 nmdc:mga06r32_5652_c1 nmdc:mga06r32_5652_c1_1321_2133 228
13 3300042005 Ga0439448_0009788 Ga0439448_0009788_1364_2062 229
14 3300042008 Ga0439450_002169 Ga0439450_002169_1493_2191 229
15 3300042439 Ga0439464_0010275 Ga0439464_0010275_1405_2103 229
16 3300035089 Ga0373944_0006609 Ga0373944_0006609_1542_2354 230
17 3300035111 Ga0373923_0013805 Ga0373923_0013805_596_1408 230
18 3300035116 Ga0373945_0000406 Ga0373945_0000406_1902_2714 230
19 3300035117 Ga0373953_0046096 Ga0373953_0046096_232_1044 230
20 3300035118 Ga0373954_0012652 Ga0373954_0012652_1279_2091 230
21 3300035120 Ga0373957_0013534 Ga0373957_0013534_884_1696 230
22 3300035170 Ga0373943_0002294 Ga0373943_0002294_6171_6983 230
23 3300035171 Ga0373946_0004299 Ga0373946_0004299_2747_3559 230
24 3300035172 Ga0373955_0003081 Ga0373955_0003081_975_1787 230
25 3300035410 Ga0373924_0022153 Ga0373924_0022153_793_1605 230
26 3300035692 Ga0373935_0024869 Ga0373935_0024869_969_1781 230
27 3300035695 Ga0373927_0001584 Ga0373927_0001584_8893_9705 230
28 3300035724 Ga0373933_0099988 Ga0373933_0099988_230_1042 230
29 3300035725 Ga0373947_0003709 Ga0373947_0003709_3583_4395 230
30 3300036401 Ga0373937_0080373 Ga0373937_0080373_1775_2587 230
31 3300037068 Ga0373925_0003875 Ga0373925_0003875_1909_2721 230
32 3300046454 Ga0495592_0002442 Ga0495592_0002442_12063_12875 230
33 3300046455 Ga0495603_0001819 Ga0495603_0001819_1117_1929 230
34 3300046459 Ga0495629_0001430 Ga0495629_0001430_2090_2902 230
35 3300046461 Ga0495641_0001557 Ga0495641_0001557_12451_13263 230
36 3300046463 Ga0495653_0096349 Ga0495653_0096349_1143_1955 230
37 3300046472 Ga0495580_0003337 Ga0495580_0003337_10691_11503 230
38 3300046473 Ga0495582_0000900 Ga0495582_0000900_843_1655 230
39 3300046475 Ga0495639_0004240 Ga0495639_0004240_4537_5349 230
40 3300046476 Ga0495662_0002002 Ga0495662_0002002_3277_4089 230
41 3300046477 Ga0495664_0050545 Ga0495664_0050545_195_1007 230
42 3300046499 Ga0495594_0003058 Ga0495594_0003058_6886_7698 230
43 3300046511 Ga0495608_0012462 Ga0495608_0012462_4228_5040 230
44 3300046514 Ga0495618_0047943 Ga0495618_0047943_696_1508 230
45 3300046516 Ga0495628_0017377 Ga0495628_0017377_4047_4859 230
46 3300046517 Ga0495630_0002461 Ga0495630_0002461_804_1616 230
47 3300046526 Ga0495666_0000587 Ga0495666_0000587_4626_5438 230
48 3300046529 Ga0495652_0062438 Ga0495652_0062438_704_1516 230
49 3300046531 Ga0495665_0003481 Ga0495665_0003481_3199_4011 230
50 3300046533 Ga0495640_0001550 Ga0495640_0001550_1480_2292 230
51 3300046535 Ga0495586_0024228 Ga0495586_0024228_901_1713 230
52 3300046559 Ga0495667_0002840 Ga0495667_0002840_10428_11240 230
53 3300046663 Ga0495635_0009654 Ga0495635_0009654_4047_4859 230
54 3300046678 Ga0495599_0001462 Ga0495599_0001462_10856_11668 230
55 3300046679 Ga0495623_0009736 Ga0495623_0009736_4901_5713 230
56 3300046680 Ga0495646_0013612 Ga0495646_0013612_2705_3517 230
57 3300046681 Ga0495647_0008098 Ga0495647_0008098_1130_1942 230
58 3300046683 Ga0495658_0001467 Ga0495658_0001467_2889_3701 230
59 3300046689 Ga0495613_0018971 Ga0495613_0018971_1280_2092 230
60 3300046690 Ga0495624_0024307 Ga0495624_0024307_830_1642 230
61 3300046809 Ga0495600_0013523 Ga0495600_0013523_300_1112 230
62 3300047315 Ga0495581_0001384 Ga0495581_0001384_10976_11788 230
63 3300047317 Ga0495604_0047486 Ga0495604_0047486_1044_1856 230
64 3300047319 Ga0495674_0005276 Ga0495674_0005276_1280_2092 230
65 3300047322 Ga0495680_0045187 Ga0495680_0045187_2208_3020 230
66 3300047444 Ga0495675_0019329 Ga0495675_0019329_2021_2833 230
67 3300047673 Ga0495593_0001170 Ga0495593_0001170_13497_14309 230
68 3300048088 Ga0495602_0008563 Ga0495602_0008563_4456_5268 230
69 3300048089 Ga0495614_0013002 Ga0495614_0013002_1728_2540 230
70 3300053084 Ga0495595_0008912 Ga0495595_0008912_2806_3618 230
71 3300053085 Ga0495619_0033910 Ga0495619_0033910_1909_2721 230
72 3300006846 Ga0075430_100000755 Ga0075430_10000075518 231
73 3300048915 Ga0496112_0544230 Ga0496112_0544230_31_786 231
74 3300048917 Ga0496114_0319993 Ga0496114_0319993_45_800 231
75 3300050509 nmdc:mga0qj67_6956_c1 nmdc:mga0qj67_6956_c1_7310_8164 231
76 3300025910 Ga0207684_10354854 Ga0207684_103548541 232
77 3300049823 Ga0501044_0035518 Ga0501044_0035518_2606_3346 232
78 3300005364 Ga0070673_100049920 Ga0070673_1000499204 233
79 3300005842 Ga0068858_100000551 Ga0068858_10000055113 233
80 3300009098 Ga0105245_10350362 Ga0105245_103503622 233
81 3300025927 Ga0207687_10252510 Ga0207687_102525101 233
82 3300025936 Ga0207670_10002309 Ga0207670_100023094 233
83 3300025960 Ga0207651_10030130 Ga0207651_100301304 233
84 3300026035 Ga0207703_10000232 Ga0207703_1000023238 233
85 3300049569 Ga0501032_0039674 Ga0501032_0039674_1699_2439 233
86 3300049572 Ga0501036_0060563 Ga0501036_0060563_1138_1878 233
87 3300049574 Ga0501038_0002544 Ga0501038_0002544_6895_7635 233
88 3300049580 Ga0501046_0031079 Ga0501046_0031079_1515_2255 233
89 3300049581 Ga0501047_0029065 Ga0501047_0029065_3290_4030 233
90 3300049744 Ga0501083_0022502 Ga0501083_0022502_485_1225 233
91 3300049822 Ga0501035_0006634 Ga0501035_0006634_4557_5297 233
92 3300060353 Ga0501082_0016828 Ga0501082_0016828_2606_3346 233
93 3300005518 Ga0070699_100010943 Ga0070699_1000109438 234
94 3300026121 Ga0207683_10473150 Ga0207683_104731502 234
95 3300037466 Ga0395898_0086697 Ga0395898_0086697_1575_2327 234
96 3300037471 Ga0395905_0153750 Ga0395905_0153750_936_1688 234
97 3300038443 Ga0395901_0075388 Ga0395901_0075388_634_1386 234
98 3300009094 Ga0111539_10346858 Ga0111539_103468582 235
99 3300049744 Ga0501083_0123613 Ga0501083_0123613_929_1669 235
100 3300005327 Ga0070658_10431688 Ga0070658_104316882 236
101 3300005719 Ga0068861_100112996 Ga0068861_1001129961 236
102 3300026118 Ga0207675_100045735 Ga0207675_1000457355 236
103 3300037466 Ga0395898_0090933 Ga0395898_0090933_23_748 236
104 3300037471 Ga0395905_0338789 Ga0395905_0338789_261_1022 236
105 3300046529 Ga0495652_0214104 Ga0495652_0214104_278_1090 236
106 iso_pu_bacteria 2643221690 2644505203 236
107 3300005329 Ga0070683_100002447 Ga0070683_10000244714 237
108 3300005435 Ga0070714_100014534 Ga0070714_1000145342 237
109 3300005445 Ga0070708_100005830 Ga0070708_1000058301 237
110 3300005535 Ga0070684_100059444 Ga0070684_1000594444 237
111 3300013105 Ga0157369_10274812 Ga0157369_102748122 237
112 3300020070 Ga0206356_11150109 Ga0206356_111501091 237
113 3300020082 Ga0206353_10331881 Ga0206353_103318812 237
114 3300025921 Ga0207652_10116272 Ga0207652_101162723 237
115 3300025929 Ga0207664_10015632 Ga0207664_100156322 237
116 3300025944 Ga0207661_10036293 Ga0207661_100362934 237
117 3300027512 Ga0209179_1027653 Ga0209179_10276531 237
118 3300035116 Ga0373945_0100388 Ga0373945_0100388_279_1076 237
119 3300037853 Ga0436364_0162021 Ga0436364_0162021_381_1244 238
120 3300049593 Ga0501077_0103918 Ga0501077_0103918_598_1335 238
121 3300049742 Ga0501080_0878481 Ga0501080_0878481_15_752 238
122 iso_pu_bacteria 2884994152 2884996714 238
123 3300005337 Ga0070682_100193124 Ga0070682_1001931242 239
124 3300005340 Ga0070689_100206095 Ga0070689_1002060952 239
125 3300005364 Ga0070673_100201967 Ga0070673_1002019673 239
126 3300005543 Ga0070672_100155535 Ga0070672_1001555353 239
127 3300005563 Ga0068855_100010217 Ga0068855_1000102174 239
128 3300005577 Ga0068857_100624301 Ga0068857_1006243012 239
129 3300005981 Ga0081538_10031177 Ga0081538_100311774 239
130 3300007788 Ga0099795_10042866 Ga0099795_100428662 239
131 3300013306 Ga0163162_10085237 Ga0163162_100852373 239
132 3300025901 Ga0207688_10013197 Ga0207688_100131972 239
133 3300025901 Ga0207688_10014998 Ga0207688_100149985 239
134 3300025927 Ga0207687_10146681 Ga0207687_101466813 239
135 3300025949 Ga0207667_10025772 Ga0207667_100257724 239
136 3300025960 Ga0207651_10148042 Ga0207651_101480422 239
137 3300025961 Ga0207712_10205745 Ga0207712_102057452 239
138 3300026116 Ga0207674_10842922 Ga0207674_108429222 239
139 3300026142 Ga0207698_10383538 Ga0207698_103835382 239
140 3300028379 Ga0268266_10443857 Ga0268266_104438571 239
141 3300031901 Ga0307406_10296544 Ga0307406_102965442 239
142 3300031911 Ga0307412_10101515 Ga0307412_101015152 239
143 3300032002 Ga0307416_100019981 Ga0307416_1000199814 239
144 3300035092 Ga0373952_0061045 Ga0373952_0061045_42_875 239
145 3300046492 Ga0495585_0118674 Ga0495585_0118674_181_924 239
146 3300046691 Ga0495670_0163212 Ga0495670_0163212_414_1157 239
147 3300048905 Ga0496102_0244036 Ga0496102_0244036_331_1152 239
148 3300049568 Ga0501031_0157707 Ga0501031_0157707_547_1290 239
149 3300049570 Ga0501033_0098336 Ga0501033_0098336_722_1465 239
150 3300049572 Ga0501036_0136008 Ga0501036_0136008_674_1417 239
151 3300049573 Ga0501037_0453959 Ga0501037_0453959_109_852 239
152 3300049574 Ga0501038_0221224 Ga0501038_0221224_212_955 239
153 3300049575 Ga0501039_0036426 Ga0501039_0036426_1038_1781 239
154 3300049576 Ga0501040_0004560 Ga0501040_0004560_3569_4312 239
155 3300049577 Ga0501041_0070628 Ga0501041_0070628_713_1456 239
156 3300049580 Ga0501046_0037972 Ga0501046_0037972_295_1038 239
157 3300049582 Ga0501048_0095229 Ga0501048_0095229_943_1686 239
158 3300049584 Ga0501068_0131115 Ga0501068_0131115_732_1475 239
159 3300049587 Ga0501071_0025912 Ga0501071_0025912_1019_1762 239
160 3300049588 Ga0501072_0016025 Ga0501072_0016025_4466_5209 239
161 3300049591 Ga0501075_0011861 Ga0501075_0011861_1410_2153 239
162 3300049591 Ga0501075_0428980 Ga0501075_0428980_192_935 239
163 3300049592 Ga0501076_0162526 Ga0501076_0162526_398_1141 239
164 3300049593 Ga0501077_0019315 Ga0501077_0019315_631_1374 239
165 3300049741 Ga0501079_0043610 Ga0501079_0043610_2007_2750 239
166 3300049743 Ga0501081_0021613 Ga0501081_0021613_1212_1955 239
167 3300049743 Ga0501081_0229248 Ga0501081_0229248_569_1312 239
168 3300049824 Ga0501045_0082664 Ga0501045_0082664_986_1729 239
169 3300049824 Ga0501045_0378105 Ga0501045_0378105_15_758 239
170 3300054114 Ga0501084_0016597 Ga0501084_0016597_690_1433 239
171 3300060353 Ga0501082_0024223 Ga0501082_0024223_1666_2409 239
172 3300061734 Ga0530510_0220798 Ga0530510_0220798_644_1387 239
173 3300005564 Ga0070664_100084380 Ga0070664_1000843802 240
174 3300006844 Ga0075428_100008819 Ga0075428_1000088195 240
175 3300006846 Ga0075430_100006823 Ga0075430_1000068238 240
176 3300006847 Ga0075431_100077452 Ga0075431_1000774524 240
177 3300006847 Ga0075431_100444421 Ga0075431_1004444212 240
178 3300006880 Ga0075429_100000518 Ga0075429_1000005184 240
179 3300009147 Ga0114129_10000440 Ga0114129_1000044013 240
180 3300009551 Ga0105238_10456293 Ga0105238_104562932 240
181 3300013307 Ga0157372_10148994 Ga0157372_101489944 240
182 3300026088 Ga0207641_10406862 Ga0207641_104068622 240
183 3300035113 Ga0373936_0009126 Ga0373936_0009126_334_1134 240
184 3300036401 Ga0373937_0046021 Ga0373937_0046021_2378_3178 240
185 3300046455 Ga0495603_0072515 Ga0495603_0072515_638_1387 240
186 3300046455 Ga0495603_0141673 Ga0495603_0141673_76_825 240
187 3300046462 Ga0495651_0032072 Ga0495651_0032072_815_1615 240
188 3300046463 Ga0495653_0028649 Ga0495653_0028649_340_1140 240
189 3300046559 Ga0495667_0001583 Ga0495667_0001583_2590_3390 240
190 3300046615 Ga0495656_0165988 Ga0495656_0165988_152_898 240
191 3300046663 Ga0495635_0040666 Ga0495635_0040666_2388_3188 240
192 3300046674 Ga0495588_0049698 Ga0495588_0049698_234_983 240
193 3300046683 Ga0495658_0238336 Ga0495658_0238336_143_949 240
194 3300046809 Ga0495600_0084208 Ga0495600_0084208_1256_2056 240
195 3300047322 Ga0495680_0007615 Ga0495680_0007615_6426_7226 240
196 3300047471 Ga0495684_0040840 Ga0495684_0040840_2620_3420 240
197 3300048905 Ga0496102_0292353 Ga0496102_0292353_42_848 240
198 3300048911 Ga0496108_0544960 Ga0496108_0544960_255_998 240
199 3300048912 Ga0496109_0363850 Ga0496109_0363850_138_944 240
200 3300048917 Ga0496114_0199626 Ga0496114_0199626_964_1704 240
201 3300049572 Ga0501036_0326930 Ga0501036_0326930_20_751 240
202 3300049577 Ga0501041_0166888 Ga0501041_0166888_343_1074 240
203 3300049578 Ga0501042_0106636 Ga0501042_0106636_475_1242 240
204 3300049578 Ga0501042_0333612 Ga0501042_0333612_214_981 240
205 3300049582 Ga0501048_0159296 Ga0501048_0159296_738_1505 240
206 3300049588 Ga0501072_0033774 Ga0501072_0033774_1971_2738 240
207 3300049588 Ga0501072_0285634 Ga0501072_0285634_122_889 240
208 3300049591 Ga0501075_0338034 Ga0501075_0338034_171_902 240
209 3300049592 Ga0501076_0036830 Ga0501076_0036830_2119_2886 240
210 3300049593 Ga0501077_0308238 Ga0501077_0308238_149_916 240
211 3300049741 Ga0501079_0115151 Ga0501079_0115151_74_805 240
212 3300049741 Ga0501079_0192763 Ga0501079_0192763_564_1331 240
213 3300049743 Ga0501081_0350997 Ga0501081_0350997_20_787 240
214 3300050507 nmdc:mga05p37_2109_c1 nmdc:mga05p37_2109_c1_9001_9765 240
215 3300050507 nmdc:mga05p37_854937_c1 nmdc:mga05p37_854937_c1_11_820 240
216 3300050508 nmdc:mga09592_1_c1 nmdc:mga09592_1_c1_70037_70801 240
217 3300050509 nmdc:mga0qj67_12_c3 nmdc:mga0qj67_12_c3_1092_1856 240
218 3300050510 nmdc:mga06r32_7_c1 nmdc:mga06r32_7_c1_7383_8147 240
219 3300060353 Ga0501082_0084054 Ga0501082_0084054_1828_2595 240
220 3300061734 Ga0530510_0018086 Ga0530510_0018086_2243_3010 240
221 3300061734 Ga0530510_0108722 Ga0530510_0108722_278_1045 240
222 3300013105 Ga0157369_10057659 Ga0157369_100576594 241
223 3300025922 Ga0207646_10025433 Ga0207646_100254332 241
224 3300037418 Ga0395900_0169054 Ga0395900_0169054_261_1013 241
225 3300038443 Ga0395901_0171986 Ga0395901_0171986_1205_2113 241
226 3300046517 Ga0495630_0284226 Ga0495630_0284226_197_943 241
227 3300048912 Ga0496109_0128552 Ga0496109_0128552_855_1601 241
228 3300005434 Ga0070709_10128004 Ga0070709_101280042 242
229 3300005436 Ga0070713_100017046 Ga0070713_1000170464 242
230 3300005437 Ga0070710_10053899 Ga0070710_100538993 242
231 3300005440 Ga0070705_100306982 Ga0070705_1003069822 242
232 3300007076 Ga0075435_100090162 Ga0075435_1000901623 242
233 3300009098 Ga0105245_10209359 Ga0105245_102093592 242
234 3300009177 Ga0105248_10675838 Ga0105248_106758382 242
235 3300011119 Ga0105246_10241604 Ga0105246_102416042 242
236 3300025928 Ga0207700_10110690 Ga0207700_101106903 242
237 3300025929 Ga0207664_10017475 Ga0207664_100174754 242
238 3300028800 Ga0265338_10150390 Ga0265338_101503903 242
239 3300037312 Ga0395899_0009014 Ga0395899_0009014_6229_7053 242
240 3300037418 Ga0395900_0000728 Ga0395900_0000728_13934_14758 242
241 3300037466 Ga0395898_0038489 Ga0395898_0038489_416_1240 242
242 3300037471 Ga0395905_0004578 Ga0395905_0004578_5270_6094 242
243 3300038443 Ga0395901_0323363 Ga0395901_0323363_356_1180 242
244 3300048904 Ga0496101_0038896 Ga0496101_0038896_1032_1853 242
245 3300048907 Ga0496104_0416754 Ga0496104_0416754_84_878 242
246 3300048912 Ga0496109_0019319 Ga0496109_0019319_72_893 242
247 3300050515 nmdc:mga0a205_415971_c1 nmdc:mga0a205_415971_c1_68_889 242
248 3300005329 Ga0070683_100023996 Ga0070683_1000239966 243
249 3300005435 Ga0070714_100272121 Ga0070714_1002721211 243
250 3300005444 Ga0070694_100214927 Ga0070694_1002149271 243
251 3300005455 Ga0070663_100206341 Ga0070663_1002063411 243
252 3300005535 Ga0070684_100067391 Ga0070684_1000673916 243
253 3300005564 Ga0070664_100129328 Ga0070664_1001293284 243
254 3300005564 Ga0070664_100872487 Ga0070664_1008724871 243
255 3300005577 Ga0068857_100179797 Ga0068857_1001797972 243
256 3300005618 Ga0068864_100069738 Ga0068864_1000697386 243
257 3300005841 Ga0068863_100063255 Ga0068863_1000632555 243
258 3300005842 Ga0068858_100117837 Ga0068858_1001178372 243
259 3300006175 Ga0070712_100111938 Ga0070712_1001119382 243
260 3300009177 Ga0105248_10122385 Ga0105248_101223852 243
261 3300014325 Ga0163163_10004571 Ga0163163_100045717 243
262 3300014968 Ga0157379_10170292 Ga0157379_101702922 243
263 3300025915 Ga0207693_10115974 Ga0207693_101159743 243
264 3300025941 Ga0207711_10007526 Ga0207711_100075263 243
265 3300025944 Ga0207661_10029219 Ga0207661_100292195 243
266 3300026035 Ga0207703_10065849 Ga0207703_100658492 243
267 3300026116 Ga0207674_10023560 Ga0207674_100235604 243
268 3300031995 Ga0307409_100258319 Ga0307409_1002583192 243
269 3300046459 Ga0495629_0263381 Ga0495629_0263381_63_890 243
270 3300046511 Ga0495608_0122797 Ga0495608_0122797_841_1617 243
271 3300048907 Ga0496104_0021280 Ga0496104_0021280_1411_2196 243
272 3300048908 Ga0496105_0050944 Ga0496105_0050944_85_870 243
273 3300048911 Ga0496108_0005257 Ga0496108_0005257_5190_5975 243
274 3300048913 Ga0496110_0051691 Ga0496110_0051691_2051_2836 243
275 3300048915 Ga0496112_0378567 Ga0496112_0378567_189_974 243
276 3300048916 Ga0496113_0006089 Ga0496113_0006089_2638_3423 243
277 3300053077 Ga0495601_0119368 Ga0495601_0119368_730_1506 243
278 3300053085 Ga0495619_0263873 Ga0495619_0263873_197_973 243
279 3300005445 Ga0070708_100002228 Ga0070708_10000222813 244
280 3300005467 Ga0070706_100009587 Ga0070706_1000095877 244
281 3300005467 Ga0070706_100022514 Ga0070706_1000225146 244
282 3300005468 Ga0070707_100007797 Ga0070707_1000077978 244
283 3300005468 Ga0070707_100912696 Ga0070707_1009126961 244
284 3300005471 Ga0070698_100003498 Ga0070698_10000349813 244
285 3300005471 Ga0070698_100017226 Ga0070698_1000172266 244
286 3300005471 Ga0070698_100178834 Ga0070698_1001788342 244
287 3300005518 Ga0070699_100047694 Ga0070699_1000476944 244
288 3300005616 Ga0068852_100089488 Ga0068852_1000894885 244
289 3300006028 Ga0070717_10003028 Ga0070717_1000302811 244
290 3300009174 Ga0105241_10180901 Ga0105241_101809012 244
291 3300025910 Ga0207684_10003011 Ga0207684_1000301116 244
292 3300025910 Ga0207684_10043339 Ga0207684_100433394 244
293 3300025922 Ga0207646_10040912 Ga0207646_100409122 244
294 3300032002 Ga0307416_100206499 Ga0307416_1002064992 244
295 3300048917 Ga0496114_0069477 Ga0496114_0069477_1321_2094 244
296 3300025901 Ga0207688_10198827 Ga0207688_101988271 245
297 3300046543 Ga0495645_0225925 Ga0495645_0225925_66_887 245
298 3300048908 Ga0496105_0555171 Ga0496105_0555171_11_814 245
299 3300048917 Ga0496114_0011659 Ga0496114_0011659_5778_6566 245
300 3300049570 Ga0501033_0150222 Ga0501033_0150222_195_980 245
301 3300049572 Ga0501036_0101931 Ga0501036_0101931_253_1038 245
302 3300049576 Ga0501040_0130703 Ga0501040_0130703_210_995 245
303 3300049577 Ga0501041_0253473 Ga0501041_0253473_58_843 245
304 3300049580 Ga0501046_0095804 Ga0501046_0095804_1230_2015 245
305 3300049582 Ga0501048_0112367 Ga0501048_0112367_841_1626 245
306 3300049584 Ga0501068_0461702 Ga0501068_0461702_16_801 245
307 3300049586 Ga0501070_0199897 Ga0501070_0199897_626_1432 245
308 3300049587 Ga0501071_0116468 Ga0501071_0116468_861_1646 245
309 3300049588 Ga0501072_0209267 Ga0501072_0209267_163_948 245
310 3300049590 Ga0501074_0243016 Ga0501074_0243016_323_1108 245
311 3300049591 Ga0501075_0059596 Ga0501075_0059596_945_1730 245
312 3300049592 Ga0501076_0006666 Ga0501076_0006666_198_983 245
313 3300049593 Ga0501077_0119163 Ga0501077_0119163_166_951 245
314 3300049741 Ga0501079_0044397 Ga0501079_0044397_2339_3124 245
315 3300049742 Ga0501080_0295822 Ga0501080_0295822_158_943 245
316 3300049824 Ga0501045_0007152 Ga0501045_0007152_547_1332 245
317 3300054114 Ga0501084_0064260 Ga0501084_0064260_883_1668 245
318 3300060353 Ga0501082_0030043 Ga0501082_0030043_2505_3290 245
319 3300061734 Ga0530510_0001247 Ga0530510_0001247_14073_14858 245
320 3300005330 Ga0070690_100129205 Ga0070690_1001292052 246
321 3300005336 Ga0070680_100425661 Ga0070680_1004256611 246
322 3300005355 Ga0070671_100200799 Ga0070671_1002007992 246
323 3300005364 Ga0070673_100209167 Ga0070673_1002091672 246
324 3300005437 Ga0070710_10028450 Ga0070710_100284502 246
325 3300005539 Ga0068853_100275342 Ga0068853_1002753422 246
326 3300005545 Ga0070695_100140392 Ga0070695_1001403923 246
327 3300005549 Ga0070704_100370248 Ga0070704_1003702482 246
328 3300005577 Ga0068857_100222935 Ga0068857_1002229352 246
329 3300005614 Ga0068856_100216277 Ga0068856_1002162773 246
330 3300005615 Ga0070702_100196895 Ga0070702_1001968952 246
331 3300005617 Ga0068859_100924034 Ga0068859_1009240341 246
332 3300005618 Ga0068864_100298068 Ga0068864_1002980682 246
333 3300005841 Ga0068863_100234987 Ga0068863_1002349872 246
334 3300005843 Ga0068860_100367791 Ga0068860_1003677912 246
335 3300006931 Ga0097620_100924039 Ga0097620_1009240391 246
336 3300009093 Ga0105240_10640263 Ga0105240_106402631 246
337 3300009101 Ga0105247_10372543 Ga0105247_103725431 246
338 3300014325 Ga0163163_10132387 Ga0163163_101323872 246
339 3300021388 Ga0213875_10011897 Ga0213875_100118976 246
340 3300025898 Ga0207692_10178010 Ga0207692_101780102 246
341 3300025915 Ga0207693_10025458 Ga0207693_100254582 246
342 3300025919 Ga0207657_10040905 Ga0207657_100409052 246
343 3300025922 Ga0207646_10464482 Ga0207646_104644821 246
344 3300025928 Ga0207700_10088166 Ga0207700_100881663 246
345 3300025945 Ga0207679_10636367 Ga0207679_106363671 246
346 3300026041 Ga0207639_10245698 Ga0207639_102456982 246
347 3300026078 Ga0207702_10229391 Ga0207702_102293912 246
348 3300026095 Ga0207676_10242267 Ga0207676_102422672 246
349 3300028381 Ga0268264_10079604 Ga0268264_100796043 246
350 3300037853 Ga0436364_0913146 Ga0436364_0913146_1993_2760 246
351 3300045976 Ga0466967_0315184 Ga0466967_0315184_396_1265 246
352 3300046454 Ga0495592_0153827 Ga0495592_0153827_60_857 246
353 3300048903 Ga0496100_0034092 Ga0496100_0034092_345_1178 246
354 3300048905 Ga0496102_0110247 Ga0496102_0110247_175_1008 246
355 3300048908 Ga0496105_0023370 Ga0496105_0023370_3370_4203 246
356 3300048911 Ga0496108_0039119 Ga0496108_0039119_845_1678 246
357 3300048912 Ga0496109_0032477 Ga0496109_0032477_3366_4199 246
358 3300048913 Ga0496110_0028189 Ga0496110_0028189_3129_3962 246
359 3300048914 Ga0496111_0031532 Ga0496111_0031532_2677_3510 246
360 3300048915 Ga0496112_0070761 Ga0496112_0070761_1387_2220 246
361 3300048917 Ga0496114_0013605 Ga0496114_0013605_3495_4328 246
362 3300048918 Ga0496115_0154469 Ga0496115_0154469_123_956 246
363 3300048928 Ga0496125_0000074 Ga0496125_0000074_107247_108086 246
364 3300053077 Ga0495601_0082731 Ga0495601_0082731_1156_1977 246
365 3300005288 Ga0065714_10028532 Ga0065714_100285321 247
366 3300005334 Ga0068869_100240303 Ga0068869_1002403032 247
367 3300005338 Ga0068868_100220539 Ga0068868_1002205392 247
368 3300005341 Ga0070691_10009567 Ga0070691_100095673 247
369 3300005341 Ga0070691_10169231 Ga0070691_101692312 247
370 3300005435 Ga0070714_100000933 Ga0070714_1000009335 247
371 3300005435 Ga0070714_100036934 Ga0070714_1000369341 247
372 3300005436 Ga0070713_100031913 Ga0070713_1000319137 247
373 3300005436 Ga0070713_100236913 Ga0070713_1002369132 247
374 3300005436 Ga0070713_100380571 Ga0070713_1003805712 247
375 3300005439 Ga0070711_100040371 Ga0070711_1000403712 247
376 3300005439 Ga0070711_100216626 Ga0070711_1002166261 247
377 3300005457 Ga0070662_100330273 Ga0070662_1003302732 247
378 3300005548 Ga0070665_100062479 Ga0070665_1000624795 247
379 3300005563 Ga0068855_100261130 Ga0068855_1002611303 247
380 3300005564 Ga0070664_100147418 Ga0070664_1001474182 247
381 3300005578 Ga0068854_100129413 Ga0068854_1001294131 247
382 3300005614 Ga0068856_100391874 Ga0068856_1003918742 247
383 3300005843 Ga0068860_100121928 Ga0068860_1001219282 247
384 3300005981 Ga0081538_10009646 Ga0081538_100096466 247
385 3300006028 Ga0070717_10196231 Ga0070717_101962313 247
386 3300006173 Ga0070716_100134376 Ga0070716_1001343763 247
387 3300006175 Ga0070712_100031376 Ga0070712_1000313765 247
388 3300006175 Ga0070712_100562507 Ga0070712_1005625071 247
389 3300006844 Ga0075428_100540373 Ga0075428_1005403732 247
390 3300006847 Ga0075431_100183579 Ga0075431_1001835792 247
391 3300006852 Ga0075433_10091088 Ga0075433_100910882 247
392 3300006871 Ga0075434_100062311 Ga0075434_1000623114 247
393 3300007076 Ga0075435_100029557 Ga0075435_1000295576 247
394 3300009093 Ga0105240_10166293 Ga0105240_101662933 247
395 3300009094 Ga0111539_10017234 Ga0111539_1001723414 247
396 3300009094 Ga0111539_10282141 Ga0111539_102821412 247
397 3300009147 Ga0114129_10009535 Ga0114129_1000953512 247
398 3300009176 Ga0105242_10122871 Ga0105242_101228712 247
399 3300009553 Ga0105249_10363037 Ga0105249_103630372 247
400 3300010375 Ga0105239_10516066 Ga0105239_105160661 247
401 3300013296 Ga0157374_10613859 Ga0157374_106138591 247
402 3300013307 Ga0157372_10821169 Ga0157372_108211692 247
403 3300014745 Ga0157377_10209723 Ga0157377_102097232 247
404 3300014968 Ga0157379_10037611 Ga0157379_100376112 247
405 3300014969 Ga0157376_10425034 Ga0157376_104250341 247
406 3300021388 Ga0213875_10035250 Ga0213875_100352502 247
407 3300025915 Ga0207693_10043582 Ga0207693_100435823 247
408 3300025915 Ga0207693_10150964 Ga0207693_101509641 247
409 3300025916 Ga0207663_10039511 Ga0207663_100395113 247
410 3300025916 Ga0207663_10129364 Ga0207663_101293642 247
411 3300025927 Ga0207687_10099571 Ga0207687_100995713 247
412 3300025928 Ga0207700_10004691 Ga0207700_100046918 247
413 3300025928 Ga0207700_10364539 Ga0207700_103645391 247
414 3300025929 Ga0207664_10072274 Ga0207664_100722742 247
415 3300025929 Ga0207664_10073313 Ga0207664_100733133 247
416 3300025929 Ga0207664_10585117 Ga0207664_105851171 247
417 3300025933 Ga0207706_10013188 Ga0207706_100131885 247
418 3300025934 Ga0207686_10110563 Ga0207686_101105632 247
419 3300025939 Ga0207665_10001127 Ga0207665_100011275 247
420 3300025942 Ga0207689_10211301 Ga0207689_102113012 247
421 3300025949 Ga0207667_10329952 Ga0207667_103299522 247
422 3300025981 Ga0207640_10098671 Ga0207640_100986711 247
423 3300026023 Ga0207677_10186888 Ga0207677_101868882 247
424 3300026088 Ga0207641_10260395 Ga0207641_102603952 247
425 3300026095 Ga0207676_10526415 Ga0207676_105264151 247
426 3300026142 Ga0207698_10033868 Ga0207698_100338683 247
427 3300028379 Ga0268266_10254979 Ga0268266_102549792 247
428 3300035086 Ga0373934_0000008 Ga0373934_0000008_71215_72018 247
429 3300035086 Ga0373934_0001843 Ga0373934_0001843_205_1011 247
430 3300035111 Ga0373923_0006700 Ga0373923_0006700_22_825 247
431 3300035117 Ga0373953_0000057 Ga0373953_0000057_2458_3261 247
432 3300035118 Ga0373954_0002289 Ga0373954_0002289_1786_2589 247
433 3300035118 Ga0373954_0036913 Ga0373954_0036913_176_982 247
434 3300035119 Ga0373956_0013197 Ga0373956_0013197_2423_3226 247
435 3300035119 Ga0373956_0031980 Ga0373956_0031980_1297_2103 247
436 3300035120 Ga0373957_0000164 Ga0373957_0000164_15980_16786 247
437 3300035172 Ga0373955_0000660 Ga0373955_0000660_10941_11744 247
438 3300035172 Ga0373955_0001687 Ga0373955_0001687_193_999 247
439 3300035410 Ga0373924_0002548 Ga0373924_0002548_425_1228 247
440 3300035410 Ga0373924_0015285 Ga0373924_0015285_1913_2719 247
441 3300035691 Ga0373931_0289311 Ga0373931_0289311_57_890 247
442 3300035724 Ga0373933_0000150 Ga0373933_0000150_37776_38579 247
443 3300035724 Ga0373933_0001027 Ga0373933_0001027_194_1000 247
444 3300036401 Ga0373937_0000002 Ga0373937_0000002_290014_290817 247
445 3300036401 Ga0373937_0055004 Ga0373937_0055004_2642_3448 247
446 3300036401 Ga0373937_0254108 Ga0373937_0254108_101_898 247
447 3300037312 Ga0395899_0060446 Ga0395899_0060446_1477_2268 247
448 3300037853 Ga0436364_0047523 Ga0436364_0047523_173_952 247
449 3300037853 Ga0436364_0525292 Ga0436364_0525292_461_1249 247
450 3300039437 Ga0436365_1203819 Ga0436365_1203819_115_903 247
451 3300046454 Ga0495592_0000003 Ga0495592_0000003_186654_187457 247
452 3300046454 Ga0495592_0001690 Ga0495592_0001690_177_983 247
453 3300046462 Ga0495651_0000031 Ga0495651_0000031_13314_14117 247
454 3300046462 Ga0495651_0001698 Ga0495651_0001698_15979_16785 247
455 3300046463 Ga0495653_0022055 Ga0495653_0022055_2234_3037 247
456 3300046463 Ga0495653_0029406 Ga0495653_0029406_3392_4198 247
457 3300046511 Ga0495608_0000018 Ga0495608_0000018_186650_187453 247
458 3300046511 Ga0495608_0001179 Ga0495608_0001179_1754_2560 247
459 3300046516 Ga0495628_0005767 Ga0495628_0005767_3180_3983 247
460 3300046516 Ga0495628_0007721 Ga0495628_0007721_8286_9092 247
461 3300046529 Ga0495652_0000013 Ga0495652_0000013_6808_7611 247
462 3300046529 Ga0495652_0003007 Ga0495652_0003007_15980_16786 247
463 3300046535 Ga0495586_0191857 Ga0495586_0191857_290_1087 247
464 3300046536 Ga0495587_0000014 Ga0495587_0000014_186638_187441 247
465 3300046536 Ga0495587_0001222 Ga0495587_0001222_15981_16787 247
466 3300046543 Ga0495645_0099184 Ga0495645_0099184_888_1691 247
467 3300046559 Ga0495667_0000014 Ga0495667_0000014_13311_14114 247
468 3300046559 Ga0495667_0004627 Ga0495667_0004627_8302_9108 247
469 3300046675 Ga0495657_0000012 Ga0495657_0000012_10735_11538 247
470 3300046675 Ga0495657_0002083 Ga0495657_0002083_15977_16783 247
471 3300046678 Ga0495599_0000071 Ga0495599_0000071_63227_64030 247
472 3300046678 Ga0495599_0003420 Ga0495599_0003420_208_1014 247
473 3300046679 Ga0495623_0000066 Ga0495623_0000066_10739_11542 247
474 3300046680 Ga0495646_0051900 Ga0495646_0051900_1149_1952 247
475 3300046680 Ga0495646_0073924 Ga0495646_0073924_1036_1842 247
476 3300046809 Ga0495600_0011397 Ga0495600_0011397_2254_3057 247
477 3300046809 Ga0495600_0188913 Ga0495600_0188913_177_983 247
478 3300047317 Ga0495604_0000054 Ga0495604_0000054_93416_94219 247
479 3300047317 Ga0495604_0001896 Ga0495604_0001896_15974_16780 247
480 3300047322 Ga0495680_0000003 Ga0495680_0000003_164569_165372 247
481 3300047322 Ga0495680_0002973 Ga0495680_0002973_15936_16742 247
482 3300047444 Ga0495675_0000406 Ga0495675_0000406_22170_22973 247
483 3300047444 Ga0495675_0001024 Ga0495675_0001024_15964_16770 247
484 3300048088 Ga0495602_0000014 Ga0495602_0000014_185667_186470 247
485 3300048088 Ga0495602_0003146 Ga0495602_0003146_205_1011 247
486 3300048907 Ga0496104_0108427 Ga0496104_0108427_246_1022 247
487 3300048912 Ga0496109_0258151 Ga0496109_0258151_820_1596 247
488 3300048915 Ga0496112_0083395 Ga0496112_0083395_186_962 247
489 3300049573 Ga0501037_0122721 Ga0501037_0122721_575_1324 247
490 3300049575 Ga0501039_0232363 Ga0501039_0232363_346_1095 247
491 3300049581 Ga0501047_0102106 Ga0501047_0102106_299_1048 247
492 3300049582 Ga0501048_0266940 Ga0501048_0266940_30_779 247
493 3300049586 Ga0501070_0154626 Ga0501070_0154626_87_836 247
494 3300049742 Ga0501080_0094830 Ga0501080_0094830_810_1559 247
495 3300049822 Ga0501035_0049015 Ga0501035_0049015_1709_2458 247
496 3300049823 Ga0501044_0312515 Ga0501044_0312515_284_1033 247
497 3300050507 nmdc:mga05p37_42056_c1 nmdc:mga05p37_42056_c1_3258_4058 247
498 3300050507 nmdc:mga05p37_705347_c1 nmdc:mga05p37_705347_c1_314_1096 247
499 3300050508 nmdc:mga09592_436536_c1 nmdc:mga09592_436536_c1_279_1079 247
500 3300050512 nmdc:mga0n895_52613_c1 nmdc:mga0n895_52613_c1_2154_2954 247
501 3300050513 nmdc:mga0rr50_4547_c1 nmdc:mga0rr50_4547_c1_1045_1845 247
502 3300050514 nmdc:mga08x19_3216_c1 nmdc:mga08x19_3216_c1_5841_6641 247
503 3300050515 nmdc:mga0a205_51398_c1 nmdc:mga0a205_51398_c1_172_972 247
504 3300053077 Ga0495601_0243095 Ga0495601_0243095_200_1006 247
505 3300053084 Ga0495595_0039792 Ga0495595_0039792_177_983 247
506 3300053085 Ga0495619_0287562 Ga0495619_0287562_167_970 247
507 3300005356 Ga0070674_100024274 Ga0070674_1000242742 248
508 3300005434 Ga0070709_10113308 Ga0070709_101133082 248
509 3300005467 Ga0070706_100183715 Ga0070706_1001837152 248
510 3300005536 Ga0070697_100093464 Ga0070697_1000934643 248
511 3300006175 Ga0070712_100193921 Ga0070712_1001939212 248
512 3300009098 Ga0105245_10840429 Ga0105245_108404291 248
513 3300009176 Ga0105242_10550945 Ga0105242_105509451 248
514 3300025910 Ga0207684_10504020 Ga0207684_105040201 248
515 3300025916 Ga0207663_10289641 Ga0207663_102896412 248
516 3300035242 Ga0373962_0043395 Ga0373962_0043395_20_889 248
517 3300037312 Ga0395899_0075670 Ga0395899_0075670_704_1501 248
518 3300044694 Ga0466963_0193594 Ga0466963_0193594_52_843 248
519 3300048904 Ga0496101_0044109 Ga0496101_0044109_23_868 248
520 3300048907 Ga0496104_0109429 Ga0496104_0109429_1574_2419 248
521 3300049568 Ga0501031_0005785 Ga0501031_0005785_2539_3387 248
522 3300049569 Ga0501032_0030399 Ga0501032_0030399_567_1415 248
523 3300049570 Ga0501033_0188427 Ga0501033_0188427_137_985 248
524 3300049571 Ga0501034_0020392 Ga0501034_0020392_5162_6010 248
525 3300049573 Ga0501037_0025622 Ga0501037_0025622_997_1845 248
526 3300049574 Ga0501038_0003748 Ga0501038_0003748_8516_9364 248
527 3300049579 Ga0501043_0005784 Ga0501043_0005784_2769_3617 248
528 3300049580 Ga0501046_0098345 Ga0501046_0098345_206_1054 248
529 3300049581 Ga0501047_0013200 Ga0501047_0013200_4273_5121 248
530 3300049582 Ga0501048_0000090 Ga0501048_0000090_8761_9609 248
531 3300049823 Ga0501044_0109515 Ga0501044_0109515_1460_2308 248
532 iso_pu_bacteria 2675903059 2676480995 248
533 iso_pu_bacteria 2808606375 2808917862 248
534 3300005468 Ga0070707_100075214 Ga0070707_1000752142 249
535 3300005518 Ga0070699_100161924 Ga0070699_1001619243 249
536 3300005518 Ga0070699_100228815 Ga0070699_1002288152 249
537 3300006175 Ga0070712_100024746 Ga0070712_1000247465 249
538 3300006175 Ga0070712_100136991 Ga0070712_1001369912 249
539 3300037418 Ga0395900_0002127 Ga0395900_0002127_16611_17408 249
540 3300039450 Ga0436363_1086998 Ga0436363_1086998_193_993 249
541 3300045976 Ga0466967_0169965 Ga0466967_0169965_1063_1896 249
542 3300061734 Ga0530510_0128935 Ga0530510_0128935_1053_1805 249
543 3300005336 Ga0070680_100012407 Ga0070680_1000124075 250
544 3300005337 Ga0070682_100053667 Ga0070682_1000536672 250
545 3300005467 Ga0070706_100204395 Ga0070706_1002043953 250
546 3300005468 Ga0070707_100120691 Ga0070707_1001206911 250
547 3300005471 Ga0070698_100022472 Ga0070698_1000224723 250
548 3300005518 Ga0070699_100476636 Ga0070699_1004766362 250
549 3300006028 Ga0070717_10300840 Ga0070717_103008402 250
550 3300025910 Ga0207684_10026867 Ga0207684_100268673 250
551 3300025922 Ga0207646_10045105 Ga0207646_100451054 250
552 3300028563 Ga0265319_1001666 Ga0265319_100166610 250
553 3300028573 Ga0265334_10009965 Ga0265334_100099653 250
554 3300028800 Ga0265338_10085687 Ga0265338_100856873 250
555 3300031240 Ga0265320_10044210 Ga0265320_100442102 250
556 3300031241 Ga0265325_10005794 Ga0265325_100057945 250
557 3300031247 Ga0265340_10036050 Ga0265340_100360503 250
558 3300031249 Ga0265339_10022369 Ga0265339_100223695 250
559 3300031344 Ga0265316_10147223 Ga0265316_101472232 250
560 3300031595 Ga0265313_10089254 Ga0265313_100892542 250
561 3300035111 Ga0373923_0010520 Ga0373923_0010520_323_1120 250
562 3300035118 Ga0373954_0016934 Ga0373954_0016934_2326_3123 250
563 3300035172 Ga0373955_0072480 Ga0373955_0072480_216_1013 250
564 3300035724 Ga0373933_0153041 Ga0373933_0153041_46_843 250
565 3300036401 Ga0373937_0072237 Ga0373937_0072237_34_846 250
566 3300036401 Ga0373937_0113483 Ga0373937_0113483_989_1786 250
567 3300037418 Ga0395900_0320023 Ga0395900_0320023_330_1112 250
568 3300044694 Ga0466963_0281326 Ga0466963_0281326_35_862 250
569 3300046462 Ga0495651_0057937 Ga0495651_0057937_1682_2494 250
570 3300046462 Ga0495651_0258442 Ga0495651_0258442_250_1053 250
571 3300046462 Ga0495651_0277913 Ga0495651_0277913_12_809 250
572 3300046463 Ga0495653_0083777 Ga0495653_0083777_1036_1848 250
573 3300046477 Ga0495664_0024750 Ga0495664_0024750_1215_2027 250
574 3300046477 Ga0495664_0394726 Ga0495664_0394726_14_811 250
575 3300046511 Ga0495608_0145977 Ga0495608_0145977_161_973 250
576 3300046514 Ga0495618_0305259 Ga0495618_0305259_160_957 250
577 3300046516 Ga0495628_0112881 Ga0495628_0112881_1137_1934 250
578 3300046516 Ga0495628_0115522 Ga0495628_0115522_930_1742 250
579 3300046517 Ga0495630_0154107 Ga0495630_0154107_435_1232 250
580 3300046529 Ga0495652_0021496 Ga0495652_0021496_4348_5160 250
581 3300046536 Ga0495587_0068648 Ga0495587_0068648_136_933 250
582 3300046559 Ga0495667_0109181 Ga0495667_0109181_749_1546 250
583 3300046663 Ga0495635_0062708 Ga0495635_0062708_1508_2320 250
584 3300046663 Ga0495635_0115917 Ga0495635_0115917_736_1533 250
585 3300046675 Ga0495657_0044769 Ga0495657_0044769_1613_2425 250
586 3300046678 Ga0495599_0040865 Ga0495599_0040865_1743_2540 250
587 3300046678 Ga0495599_0099750 Ga0495599_0099750_605_1417 250
588 3300046680 Ga0495646_0180353 Ga0495646_0180353_106_903 250
589 3300046689 Ga0495613_0117004 Ga0495613_0117004_421_1218 250
590 3300046809 Ga0495600_0054273 Ga0495600_0054273_565_1362 250
591 3300047317 Ga0495604_0265760 Ga0495604_0265760_130_927 250
592 3300047319 Ga0495674_0059826 Ga0495674_0059826_2488_3285 250
593 3300047321 Ga0495676_0102103 Ga0495676_0102103_676_1473 250
594 3300047322 Ga0495680_0023739 Ga0495680_0023739_1680_2492 250
595 3300047322 Ga0495680_0052617 Ga0495680_0052617_2348_3145 250
596 3300048088 Ga0495602_0113889 Ga0495602_0113889_633_1445 250
597 3300049569 Ga0501032_0271987 Ga0501032_0271987_221_1063 250
598 3300049572 Ga0501036_0011171 Ga0501036_0011171_5479_6360 250
599 3300049574 Ga0501038_0039457 Ga0501038_0039457_1206_1988 250
600 3300049575 Ga0501039_0009217 Ga0501039_0009217_5671_6453 250
601 3300049576 Ga0501040_0035744 Ga0501040_0035744_660_1541 250
602 3300049576 Ga0501040_0046914 Ga0501040_0046914_1732_2514 250
603 3300049578 Ga0501042_0006280 Ga0501042_0006280_3477_4259 250
604 3300049582 Ga0501048_0082200 Ga0501048_0082200_555_1337 250
605 3300049584 Ga0501068_0350852 Ga0501068_0350852_52_834 250
606 3300049588 Ga0501072_0014252 Ga0501072_0014252_3703_4485 250
607 3300049589 Ga0501073_0462637 Ga0501073_0462637_51_833 250
608 3300049590 Ga0501074_0343933 Ga0501074_0343933_124_927 250
609 3300049591 Ga0501075_0004638 Ga0501075_0004638_6508_7290 250
610 3300049592 Ga0501076_0022716 Ga0501076_0022716_3789_4571 250
611 3300049593 Ga0501077_0002491 Ga0501077_0002491_3014_3796 250
612 3300049743 Ga0501081_0026133 Ga0501081_0026133_1004_1786 250
613 3300049743 Ga0501081_0231687 Ga0501081_0231687_508_1317 250
614 3300049823 Ga0501044_0148916 Ga0501044_0148916_1211_2053 250
615 3300049824 Ga0501045_0012748 Ga0501045_0012748_2919_3701 250
616 3300054114 Ga0501084_0025101 Ga0501084_0025101_2679_3461 250
617 3300060353 Ga0501082_0014400 Ga0501082_0014400_5341_6123 250
618 iso_pu_bacteria 2808606365 2808872615 250
619 iso_pu_bacteria 2883821847 2883822955 250
620 3300005335 Ga0070666_10137103 Ga0070666_101371032 251
621 3300005338 Ga0068868_100235958 Ga0068868_1002359581 251
622 3300005434 Ga0070709_10000701 Ga0070709_100007017 251
623 3300005434 Ga0070709_10051088 Ga0070709_100510883 251
624 3300005437 Ga0070710_10000411 Ga0070710_1000041110 251
625 3300005439 Ga0070711_100002526 Ga0070711_1000025265 251
626 3300005981 Ga0081538_10001009 Ga0081538_100010097 251
627 3300006028 Ga0070717_10042057 Ga0070717_100420574 251
628 3300006058 Ga0075432_10053240 Ga0075432_100532401 251
629 3300006173 Ga0070716_100000316 Ga0070716_10000031618 251
630 3300006175 Ga0070712_100001872 Ga0070712_1000018723 251
631 3300006844 Ga0075428_100747199 Ga0075428_1007471991 251
632 3300009148 Ga0105243_10082368 Ga0105243_100823682 251
633 3300009177 Ga0105248_10601460 Ga0105248_106014602 251
634 3300013104 Ga0157370_10092292 Ga0157370_100922923 251
635 3300014968 Ga0157379_10114298 Ga0157379_101142983 251
636 3300025898 Ga0207692_10000708 Ga0207692_100007087 251
637 3300025903 Ga0207680_10048298 Ga0207680_100482982 251
638 3300025906 Ga0207699_10000918 Ga0207699_100009186 251
639 3300025915 Ga0207693_10009326 Ga0207693_100093265 251
640 3300025928 Ga0207700_10000662 Ga0207700_100006626 251
641 3300025929 Ga0207664_10001227 Ga0207664_100012276 251
642 3300025939 Ga0207665_10000242 Ga0207665_1000024224 251
643 3300026121 Ga0207683_10222386 Ga0207683_102223861 251
644 3300031548 Ga0307408_100267379 Ga0307408_1002673792 251
645 3300031852 Ga0307410_10006039 Ga0307410_100060397 251
646 3300031903 Ga0307407_10009971 Ga0307407_100099714 251
647 3300031995 Ga0307409_100168798 Ga0307409_1001687982 251
648 3300032002 Ga0307416_100592414 Ga0307416_1005924142 251
649 3300035113 Ga0373936_0019325 Ga0373936_0019325_380_1258 251
650 3300035117 Ga0373953_0059519 Ga0373953_0059519_193_1071 251
651 3300035120 Ga0373957_0000836 Ga0373957_0000836_7162_8040 251
652 3300035172 Ga0373955_0047077 Ga0373955_0047077_390_1268 251
653 3300035410 Ga0373924_0020410 Ga0373924_0020410_1458_2336 251
654 3300035692 Ga0373935_0200250 Ga0373935_0200250_172_1050 251
655 3300035724 Ga0373933_0131273 Ga0373933_0131273_265_1143 251
656 3300035725 Ga0373947_0175820 Ga0373947_0175820_483_1361 251
657 3300036401 Ga0373937_0283181 Ga0373937_0283181_242_1120 251
658 3300037068 Ga0373925_0079378 Ga0373925_0079378_320_1198 251
659 3300046454 Ga0495592_0110313 Ga0495592_0110313_73_951 251
660 3300046459 Ga0495629_0155247 Ga0495629_0155247_429_1307 251
661 3300046460 Ga0495638_0078207 Ga0495638_0078207_332_1096 251
662 3300046462 Ga0495651_0074425 Ga0495651_0074425_1244_2122 251
663 3300046463 Ga0495653_0109074 Ga0495653_0109074_179_1057 251
664 3300046473 Ga0495582_0034330 Ga0495582_0034330_1856_2734 251
665 3300046476 Ga0495662_0017641 Ga0495662_0017641_318_1196 251
666 3300046477 Ga0495664_0131509 Ga0495664_0131509_145_1023 251
667 3300046511 Ga0495608_0035937 Ga0495608_0035937_1687_2565 251
668 3300046514 Ga0495618_0122996 Ga0495618_0122996_287_1165 251
669 3300046533 Ga0495640_0077283 Ga0495640_0077283_714_1592 251
670 3300046536 Ga0495587_0030451 Ga0495587_0030451_272_1150 251
671 3300046559 Ga0495667_0096230 Ga0495667_0096230_860_1738 251
672 3300046642 Ga0495634_0020643 Ga0495634_0020643_273_1151 251
673 3300046678 Ga0495599_0088226 Ga0495599_0088226_75_953 251
674 3300046679 Ga0495623_0020840 Ga0495623_0020840_107_985 251
675 3300046680 Ga0495646_0082200 Ga0495646_0082200_423_1301 251
676 3300046683 Ga0495658_0026533 Ga0495658_0026533_435_1313 251
677 3300046689 Ga0495613_0150575 Ga0495613_0150575_345_1223 251
678 3300046809 Ga0495600_0034947 Ga0495600_0034947_611_1489 251
679 3300047315 Ga0495581_0035219 Ga0495581_0035219_659_1537 251
680 3300047321 Ga0495676_0181609 Ga0495676_0181609_561_1439 251
681 3300047322 Ga0495680_0032570 Ga0495680_0032570_2415_3293 251
682 3300047444 Ga0495675_0204279 Ga0495675_0204279_223_1101 251
683 3300047471 Ga0495684_0060711 Ga0495684_0060711_327_1205 251
684 3300048088 Ga0495602_0186852 Ga0495602_0186852_46_924 251
685 3300048904 Ga0496101_0335949 Ga0496101_0335949_366_1169 251
686 3300048917 Ga0496114_0345250 Ga0496114_0345250_499_1302 251
687 3300049568 Ga0501031_0024185 Ga0501031_0024185_158_1042 251
688 3300049574 Ga0501038_0005612 Ga0501038_0005612_3062_3946 251
689 3300049576 Ga0501040_0001937 Ga0501040_0001937_7965_8849 251
690 3300049582 Ga0501048_0016989 Ga0501048_0016989_2980_3864 251
691 3300049584 Ga0501068_0079893 Ga0501068_0079893_1063_1947 251
692 3300049588 Ga0501072_0078480 Ga0501072_0078480_202_1086 251
693 3300049590 Ga0501074_0019890 Ga0501074_0019890_199_1083 251
694 3300049591 Ga0501075_0032259 Ga0501075_0032259_205_1089 251
695 3300049743 Ga0501081_0003946 Ga0501081_0003946_1830_2714 251
696 3300049744 Ga0501083_0282246 Ga0501083_0282246_77_961 251
697 3300049822 Ga0501035_0185937 Ga0501035_0185937_415_1299 251
698 3300049824 Ga0501045_0011600 Ga0501045_0011600_2961_3845 251
699 3300053078 Ga0495612_0064256 Ga0495612_0064256_585_1463 251
700 3300053084 Ga0495595_0025606 Ga0495595_0025606_1679_2557 251
701 3300053085 Ga0495619_0218074 Ga0495619_0218074_223_1101 251
702 3300054114 Ga0501084_0019434 Ga0501084_0019434_2709_3593 251
703 3300060353 Ga0501082_0031215 Ga0501082_0031215_1857_2741 251
704 3300005435 Ga0070714_100111427 Ga0070714_1001114272 252
705 3300005436 Ga0070713_100017740 Ga0070713_1000177408 252
706 3300006871 Ga0075434_100011783 Ga0075434_1000117834 252
707 3300007076 Ga0075435_100021448 Ga0075435_1000214487 252
708 3300009147 Ga0114129_10361442 Ga0114129_103614423 252
709 3300025898 Ga0207692_10107647 Ga0207692_101076472 252
710 3300025906 Ga0207699_10181130 Ga0207699_101811301 252
711 3300025928 Ga0207700_10005292 Ga0207700_100052929 252
712 3300025929 Ga0207664_10035879 Ga0207664_100358792 252
713 3300031616 Ga0307508_10010752 Ga0307508_100107522 252
714 3300046543 Ga0495645_0054136 Ga0495645_0054136_651_1478 252
715 3300021388 Ga0213875_10001641 Ga0213875_1000164118 253
716 3300031731 Ga0307405_10310188 Ga0307405_103101882 253
717 3300035086 Ga0373934_0046557 Ga0373934_0046557_451_1269 253
718 3300035111 Ga0373923_0005382 Ga0373923_0005382_2032_2850 253
719 3300035113 Ga0373936_0002996 Ga0373936_0002996_2985_3803 253
720 3300035113 Ga0373936_0122412 Ga0373936_0122412_202_1014 253
721 3300035118 Ga0373954_0062170 Ga0373954_0062170_282_1100 253
722 3300035118 Ga0373954_0099620 Ga0373954_0099620_446_1330 253
723 3300035119 Ga0373956_0005479 Ga0373956_0005479_2451_3269 253
724 3300035170 Ga0373943_0040035 Ga0373943_0040035_43_927 253
725 3300035410 Ga0373924_0006314 Ga0373924_0006314_16_834 253
726 3300035692 Ga0373935_0028094 Ga0373935_0028094_2032_2850 253
727 3300035695 Ga0373927_0165752 Ga0373927_0165752_44_928 253
728 3300035724 Ga0373933_0097095 Ga0373933_0097095_343_1161 253
729 3300036401 Ga0373937_0038707 Ga0373937_0038707_3480_4298 253
730 3300036401 Ga0373937_0300395 Ga0373937_0300395_397_1275 253
731 3300037418 Ga0395900_0024834 Ga0395900_0024834_1715_2491 253
732 3300037853 Ga0436364_0553397 Ga0436364_0553397_2878_3738 253
733 3300038443 Ga0395901_0004408 Ga0395901_0004408_9423_10199 253
734 3300042993 Ga0439440_0010001 Ga0439440_0010001_372_1175 253
735 3300046461 Ga0495641_0056815 Ga0495641_0056815_664_1482 253
736 3300046462 Ga0495651_0044372 Ga0495651_0044372_2032_2850 253
737 3300046473 Ga0495582_0002973 Ga0495582_0002973_5516_6334 253
738 3300046475 Ga0495639_0063947 Ga0495639_0063947_171_989 253
739 3300046476 Ga0495662_0004321 Ga0495662_0004321_4947_5765 253
740 3300046477 Ga0495664_0087529 Ga0495664_0087529_35_853 253
741 3300046511 Ga0495608_0074240 Ga0495608_0074240_1018_1836 253
742 3300046514 Ga0495618_0175575 Ga0495618_0175575_35_853 253
743 3300046516 Ga0495628_0050820 Ga0495628_0050820_1928_2746 253
744 3300046529 Ga0495652_0119182 Ga0495652_0119182_627_1445 253
745 3300046531 Ga0495665_0005814 Ga0495665_0005814_1325_2143 253
746 3300046535 Ga0495586_0032966 Ga0495586_0032966_1929_2747 253
747 3300046536 Ga0495587_0268481 Ga0495587_0268481_24_842 253
748 3300046543 Ga0495645_0010064 Ga0495645_0010064_1623_2441 253
749 3300046642 Ga0495634_0102267 Ga0495634_0102267_405_1223 253
750 3300046663 Ga0495635_0032021 Ga0495635_0032021_2451_3269 253
751 3300046675 Ga0495657_0007964 Ga0495657_0007964_3825_4643 253
752 3300046678 Ga0495599_0075304 Ga0495599_0075304_626_1444 253
753 3300046679 Ga0495623_0035880 Ga0495623_0035880_1133_1951 253
754 3300046680 Ga0495646_0010588 Ga0495646_0010588_2005_2823 253
755 3300046683 Ga0495658_0263171 Ga0495658_0263171_154_972 253
756 3300046689 Ga0495613_0048343 Ga0495613_0048343_115_933 253
757 3300046690 Ga0495624_0063452 Ga0495624_0063452_1280_2098 253
758 3300047315 Ga0495581_0052815 Ga0495581_0052815_1318_2136 253
759 3300047319 Ga0495674_0158922 Ga0495674_0158922_664_1482 253
760 3300047471 Ga0495684_0047171 Ga0495684_0047171_2451_3269 253
761 3300048089 Ga0495614_0016302 Ga0495614_0016302_1779_2597 253
762 3300048908 Ga0496105_0072964 Ga0496105_0072964_691_1533 253
763 3300048912 Ga0496109_0087190 Ga0496109_0087190_681_1523 253
764 3300048913 Ga0496110_0109059 Ga0496110_0109059_162_1004 253
765 3300048918 Ga0496115_0229223 Ga0496115_0229223_36_878 253
766 3300049586 Ga0501070_0002854 Ga0501070_0002854_1057_1986 253
767 3300049742 Ga0501080_0167277 Ga0501080_0167277_770_1699 253
768 3300050512 nmdc:mga0n895_149698_c1 nmdc:mga0n895_149698_c1_726_1526 253
769 3300053077 Ga0495601_0018762 Ga0495601_0018762_406_1224 253
770 3300053078 Ga0495612_0093363 Ga0495612_0093363_66_884 253
771 3300053084 Ga0495595_0021864 Ga0495595_0021864_409_1227 253
772 3300053085 Ga0495619_0032529 Ga0495619_0032529_626_1444 253
773 3300053153 Ga0500616_0003740 Ga0500616_0003740_7615_8412 253
774 3300021388 Ga0213875_10009989 Ga0213875_100099896 254
775 3300024225 Ga0224572_1017956 Ga0224572_10179562 254
776 3300028563 Ga0265319_1028149 Ga0265319_10281492 254
777 3300028577 Ga0265318_10001695 Ga0265318_100016958 254
778 3300031995 Ga0307409_100216504 Ga0307409_1002165042 254
779 3300037853 Ga0436364_0910455 Ga0436364_0910455_2300_3091 254
780 3300044694 Ga0466963_0104837 Ga0466963_0104837_94_1002 254
781 3300045976 Ga0466967_0000799 Ga0466967_0000799_7353_8222 254
782 3300049569 Ga0501032_0000108 Ga0501032_0000108_35913_36773 254
783 3300049570 Ga0501033_0000164 Ga0501033_0000164_42262_43122 254
784 3300049571 Ga0501034_0003397 Ga0501034_0003397_14255_15115 254
785 3300049572 Ga0501036_0001671 Ga0501036_0001671_14661_15521 254
786 3300049573 Ga0501037_0007348 Ga0501037_0007348_135_995 254
787 3300049574 Ga0501038_0000161 Ga0501038_0000161_20559_21419 254
788 3300049575 Ga0501039_0001976 Ga0501039_0001976_141_1001 254
789 3300049576 Ga0501040_0215696 Ga0501040_0215696_198_1058 254
790 3300049578 Ga0501042_0185078 Ga0501042_0185078_665_1483 254
791 3300049579 Ga0501043_0000221 Ga0501043_0000221_43855_44715 254
792 3300049580 Ga0501046_0000414 Ga0501046_0000414_33784_34644 254
793 3300049581 Ga0501047_0004081 Ga0501047_0004081_9436_10296 254
794 3300049582 Ga0501048_0001170 Ga0501048_0001170_8372_9232 254
795 3300049583 Ga0501067_0009083 Ga0501067_0009083_2485_3345 254
796 3300049585 Ga0501069_0001513 Ga0501069_0001513_5887_6747 254
797 3300049586 Ga0501070_0001610 Ga0501070_0001610_4563_5423 254
798 3300049590 Ga0501074_0000924 Ga0501074_0000924_16080_16940 254
799 3300049592 Ga0501076_0270765 Ga0501076_0270765_257_1117 254
800 3300049744 Ga0501083_0003637 Ga0501083_0003637_686_1546 254
801 3300049822 Ga0501035_0003384 Ga0501035_0003384_8685_9545 254
802 3300049823 Ga0501044_0004084 Ga0501044_0004084_8462_9322 254
803 3300054114 Ga0501084_0006421 Ga0501084_0006421_3673_4533 254
804 3300005535 Ga0070684_100126215 Ga0070684_1001262153 255
805 3300005985 Ga0081539_10008348 Ga0081539_100083481 255
806 3300025915 Ga0207693_10325511 Ga0207693_103255112 255
807 3300030522 Ga0307512_10009621 Ga0307512_100096217 255
808 3300049585 Ga0501069_0052427 Ga0501069_0052427_29_952 255
809 3300005983 Ga0081540_1010306 Ga0081540_10103065 256
810 3300005985 Ga0081539_10029700 Ga0081539_100297005 256
811 3300006042 Ga0075368_10001498 Ga0075368_100014982 256
812 3300006178 Ga0075367_10000161 Ga0075367_1000016124 256
813 3300025885 Ga0207653_10025778 Ga0207653_100257783 256
814 3300027866 Ga0209813_10054016 Ga0209813_100540161 256
815 3300038443 Ga0395901_0101464 Ga0395901_0101464_1909_2718 256
816 3300050494 nmdc:mga06z11_36123_c1 nmdc:mga06z11_36123_c1_435_1331 256
817 3300050495 nmdc:mga04h51_1057_c1 nmdc:mga04h51_1057_c1_245_1141 256
818 3300005981 Ga0081538_10043437 Ga0081538_100434374 257
819 3300037853 Ga0436364_1051289 Ga0436364_1051289_1003_1812 257
820 3300050514 nmdc:mga08x19_35671_c1 nmdc:mga08x19_35671_c1_1902_2771 257
821 3300003373 JGI25407J50210_10026255 JGI25407J50210_100262551 258
822 3300005616 Ga0068852_100368253 Ga0068852_1003682532 258
823 3300005840 Ga0068870_10014788 Ga0068870_100147883 258
824 3300005842 Ga0068858_100653739 Ga0068858_1006537391 258
825 3300005981 Ga0081538_10000336 Ga0081538_1000033621 258
826 3300013105 Ga0157369_10076989 Ga0157369_100769894 258
827 3300014325 Ga0163163_10178095 Ga0163163_101780952 258
828 3300025908 Ga0207643_10006930 Ga0207643_100069305 258
829 3300025925 Ga0207650_10201397 Ga0207650_102013973 258
830 3300049570 Ga0501033_0108179 Ga0501033_0108179_1050_1946 258
831 3300049822 Ga0501035_0168317 Ga0501035_0168317_42_938 258
832 iso_pu_bacteria 2799112218 2799186426 258
833 3300006844 Ga0075428_100067912 Ga0075428_1000679122 259
834 3300006846 Ga0075430_100042918 Ga0075430_1000429183 259
835 3300006847 Ga0075431_100070701 Ga0075431_1000707014 259
836 3300006880 Ga0075429_100032146 Ga0075429_1000321464 259
837 3300009094 Ga0111539_10548579 Ga0111539_105485792 259
838 3300009147 Ga0114129_10393954 Ga0114129_103939542 259
839 3300009147 Ga0114129_10407784 Ga0114129_104077842 259
840 3300027907 Ga0207428_10307592 Ga0207428_103075922 259
841 3300050507 nmdc:mga05p37_550379_c1 nmdc:mga05p37_550379_c1_314_1195 259
842 3300050508 nmdc:mga09592_55171_c1 nmdc:mga09592_55171_c1_1516_2397 259
843 3300050509 nmdc:mga0qj67_74946_c1 nmdc:mga0qj67_74946_c1_135_1016 259
844 3300050510 nmdc:mga06r32_18140_c1 nmdc:mga06r32_18140_c1_5057_5938 259
845 3300050511 nmdc:mga08y16_611392_c1 nmdc:mga08y16_611392_c1_57_938 259
846 3300041999 Ga0439433_0000431 Ga0439433_0000431_2979_3800 260
847 3300042002 Ga0439442_002517 Ga0439442_002517_811_1632 260
848 3300042156 Ga0439446_0006770 Ga0439446_0006770_1771_2592 260
849 3300048907 Ga0496104_0000722 Ga0496104_0000722_12741_13589 260
850 3300048910 Ga0496107_0143703 Ga0496107_0143703_55_909 260
851 3300048917 Ga0496114_0061195 Ga0496114_0061195_1232_2086 260
852 3300050511 nmdc:mga08y16_488186_c1 nmdc:mga08y16_488186_c1_347_1207 260
853 3300005327 Ga0070658_10180420 Ga0070658_101804202 261
854 3300014325 Ga0163163_10745178 Ga0163163_107451781 261
855 3300025908 Ga0207643_10049781 Ga0207643_100497814 261
856 3300031731 Ga0307405_10010719 Ga0307405_100107194 261
857 3300031824 Ga0307413_10265286 Ga0307413_102652862 261
858 3300031852 Ga0307410_10045905 Ga0307410_100459054 261
859 3300031901 Ga0307406_10157953 Ga0307406_101579532 261
860 3300031903 Ga0307407_10000233 Ga0307407_1000023315 261
861 3300032002 Ga0307416_100003770 Ga0307416_1000037704 261
862 3300032005 Ga0307411_10049442 Ga0307411_100494424 261
863 3300042461 Ga0439460_0003952 Ga0439460_0003952_806_1660 261
864 3300050507 nmdc:mga05p37_302572_c1 nmdc:mga05p37_302572_c1_504_1325 261
865 3300025942 Ga0207689_10131963 Ga0207689_101319633 262
866 3300025944 Ga0207661_10435719 Ga0207661_104357192 262
867 3300044694 Ga0466963_0069603 Ga0466963_0069603_550_1383 262
868 3300045976 Ga0466967_0039141 Ga0466967_0039141_677_1510 262
869 3300048907 Ga0496104_0020574 Ga0496104_0020574_5040_5888 262
870 3300048908 Ga0496105_0361653 Ga0496105_0361653_161_1009 262
871 3300048911 Ga0496108_0022746 Ga0496108_0022746_1760_2608 262
872 3300048912 Ga0496109_0003779 Ga0496109_0003779_11055_11903 262
873 3300048913 Ga0496110_0010416 Ga0496110_0010416_178_1026 262
874 3300048914 Ga0496111_0002767 Ga0496111_0002767_1360_2208 262
875 3300048916 Ga0496113_0095449 Ga0496113_0095449_1274_2122 262
876 3300061734 Ga0530510_0300213 Ga0530510_0300213_323_1147 262
877 3300026035 Ga0207703_10428403 Ga0207703_104284031 263
878 3300042438 Ga0439459_0022074 Ga0439459_0022074_107_976 263
879 3300048912 Ga0496109_0005143 Ga0496109_0005143_7087_7917 263
880 3300048913 Ga0496110_0378805 Ga0496110_0378805_390_1220 263
881 3300005985 Ga0081539_10026756 Ga0081539_100267564 264
882 3300031995 Ga0307409_100033193 Ga0307409_1000331936 264
883 3300005985 Ga0081539_10037336 Ga0081539_100373364 265
884 3300033179 Ga0307507_10020421 Ga0307507_100204211 265
885 3300046454 Ga0495592_0009147 Ga0495592_0009147_2628_3548 265
886 3300046459 Ga0495629_0041055 Ga0495629_0041055_21_941 265
887 3300046473 Ga0495582_0135691 Ga0495582_0135691_179_1099 265
888 3300046476 Ga0495662_0003716 Ga0495662_0003716_5730_6650 265
889 3300046477 Ga0495664_0037535 Ga0495664_0037535_1919_2839 265
890 3300046514 Ga0495618_0044785 Ga0495618_0044785_399_1319 265
891 3300046536 Ga0495587_0004895 Ga0495587_0004895_6044_6964 265
892 3300046642 Ga0495634_0015156 Ga0495634_0015156_272_1192 265
893 3300046663 Ga0495635_0002971 Ga0495635_0002971_2189_3109 265
894 3300046675 Ga0495657_0002488 Ga0495657_0002488_6960_7880 265
895 3300046679 Ga0495623_0209598 Ga0495623_0209598_16_936 265
896 3300046680 Ga0495646_0002179 Ga0495646_0002179_2777_3697 265
897 3300046683 Ga0495658_0025839 Ga0495658_0025839_1472_2392 265
898 3300046809 Ga0495600_0042054 Ga0495600_0042054_272_1192 265
899 3300047317 Ga0495604_0004151 Ga0495604_0004151_7485_8405 265
900 3300047321 Ga0495676_0009620 Ga0495676_0009620_3305_4225 265
901 3300047673 Ga0495593_0003493 Ga0495593_0003493_6164_7084 265
902 3300048089 Ga0495614_0000979 Ga0495614_0000979_3241_4161 265
903 3300049568 Ga0501031_0035251 Ga0501031_0035251_355_1170 265
904 3300049570 Ga0501033_0006788 Ga0501033_0006788_7574_8389 265
905 3300049574 Ga0501038_0012178 Ga0501038_0012178_2285_3100 265
906 3300049575 Ga0501039_0014708 Ga0501039_0014708_4380_5195 265
907 3300049576 Ga0501040_0016228 Ga0501040_0016228_2831_3646 265
908 3300049577 Ga0501041_0004430 Ga0501041_0004430_6701_7516 265
909 3300049580 Ga0501046_0000945 Ga0501046_0000945_21580_22395 265
910 3300049582 Ga0501048_0015701 Ga0501048_0015701_309_1124 265
911 3300049591 Ga0501075_0000524 Ga0501075_0000524_4052_4867 265
912 3300049592 Ga0501076_0015358 Ga0501076_0015358_3525_4340 265
913 3300049743 Ga0501081_0022951 Ga0501081_0022951_433_1248 265
914 3300049824 Ga0501045_0000342 Ga0501045_0000342_5084_5899 265
915 3300060353 Ga0501082_0001187 Ga0501082_0001187_589_1404 265
916 3300061734 Ga0530510_0046592 Ga0530510_0046592_2200_3015 265
917 3300046689 Ga0495613_0001226 Ga0495613_0001226_9625_10545 268
918 3300053085 Ga0495619_0049148 Ga0495619_0049148_584_1504 268
919 iso_pu_bacteria 2784746768 2785368584 268
920 3300005937 Ga0081455_10096526 Ga0081455_100965264 269
921 3300005981 Ga0081538_10021539 Ga0081538_100215392 270
922 3300046690 Ga0495624_0096144 Ga0495624_0096144_35_955 270
923 3300005981 Ga0081538_10006601 Ga0081538_100066017 272
924 3300031730 Ga0307516_10001550 Ga0307516_1000155022 272
925 3300033180 Ga0307510_10042591 Ga0307510_100425916 272
926 3300046452 Ga0495617_078920 Ga0495617_078920_74_967 272
927 3300046455 Ga0495603_0032222 Ga0495603_0032222_2002_2895 272
928 3300046459 Ga0495629_0171078 Ga0495629_0171078_393_1286 272
929 3300046474 Ga0495605_0005430 Ga0495605_0005430_2227_3120 272
930 3300046492 Ga0495585_0014007 Ga0495585_0014007_2141_3034 272
931 3300046499 Ga0495594_0008442 Ga0495594_0008442_3106_3999 272
932 3300046501 Ga0495607_0039083 Ga0495607_0039083_1531_2424 272
933 3300046506 Ga0495583_0006670 Ga0495583_0006670_2115_3008 272
934 3300046507 Ga0495606_0014087 Ga0495606_0014087_1933_2826 272
935 3300046512 Ga0495610_0034389 Ga0495610_0034389_158_1051 272
936 3300046515 Ga0495620_0004863 Ga0495620_0004863_4546_5439 272
937 3300046518 Ga0495631_0022562 Ga0495631_0022562_1950_2843 272
938 3300046526 Ga0495666_0001571 Ga0495666_0001571_289_1182 272
939 3300046542 Ga0495597_0063195 Ga0495597_0063195_692_1585 272
940 3300046557 Ga0495622_0001625 Ga0495622_0001625_7460_8353 272
941 3300046616 Ga0495668_0006862 Ga0495668_0006862_1939_2832 272
942 3300046660 Ga0495625_0005158 Ga0495625_0005158_1828_2721 272
943 3300046690 Ga0495624_0090033 Ga0495624_0090033_576_1469 272
944 3300046810 Ga0495660_0001825 Ga0495660_0001825_6686_7579 272
945 3300047321 Ga0495676_0052211 Ga0495676_0052211_934_1827 272
946 3300047323 Ga0495683_0004421 Ga0495683_0004421_4349_5242 272
947 3300047447 Ga0495685_010177 Ga0495685_010177_934_1827 272
948 3300047472 Ga0495686_0235339 Ga0495686_0235339_119_1012 272
949 3300048089 Ga0495614_0026085 Ga0495614_0026085_384_1277 272
950 3300048091 Ga0495626_0077053 Ga0495626_0077053_564_1457 272
951 3300003373 JGI25407J50210_10027708 JGI25407J50210_100277082 273
952 3300005981 Ga0081538_10159762 Ga0081538_101597621 273
953 3300047447 Ga0495685_020744 Ga0495685_020744_1326_2219 273
954 3300006846 Ga0075430_100056542 Ga0075430_1000565422 274
955 3300006847 Ga0075431_100130426 Ga0075431_1001304261 274
956 3300006852 Ga0075433_10014254 Ga0075433_100142546 274
957 3300006880 Ga0075429_100020176 Ga0075429_1000201766 274
958 3300009094 Ga0111539_10003901 Ga0111539_100039018 274
959 3300027907 Ga0207428_10034425 Ga0207428_100344253 274
960 3300050507 nmdc:mga05p37_46934_c1 nmdc:mga05p37_46934_c1_1094_1960 274
961 3300050508 nmdc:mga09592_60941_c1 nmdc:mga09592_60941_c1_1094_1960 274
962 3300050509 nmdc:mga0qj67_37339_c1 nmdc:mga0qj67_37339_c1_1232_2098 274
963 3300050510 nmdc:mga06r32_69469_c1 nmdc:mga06r32_69469_c1_1705_2571 274
964 3300050511 nmdc:mga08y16_59203_c1 nmdc:mga08y16_59203_c1_1778_2644 274
965 3300050515 nmdc:mga0a205_9843_c1 nmdc:mga0a205_9843_c1_5159_6025 274
966 3300005981 Ga0081538_10000556 Ga0081538_1000055620 276
967 3300032002 Ga0307416_100013836 Ga0307416_1000138365 276
968 3300032004 Ga0307414_10167045 Ga0307414_101670452 276
969 3300032126 Ga0307415_100005171 Ga0307415_1000051717 276
970 3300005981 Ga0081538_10102767 Ga0081538_101027672 277
971 3300031903 Ga0307407_10062285 Ga0307407_100622852 277
972 3300031911 Ga0307412_10108067 Ga0307412_101080671 277
973 3300032005 Ga0307411_10058446 Ga0307411_100584465 277
974 3300037418 Ga0395900_0243967 Ga0395900_0243967_69_941 277
975 3300009094 Ga0111539_10370663 Ga0111539_103706632 278
976 3300031548 Ga0307408_100277958 Ga0307408_1002779582 278
977 3300031731 Ga0307405_10325169 Ga0307405_103251692 278
978 3300031852 Ga0307410_10073917 Ga0307410_100739171 278
979 3300031995 Ga0307409_100003046 Ga0307409_1000030464 278
980 3300032002 Ga0307416_100085957 Ga0307416_1000859573 278
981 3300032002 Ga0307416_100345875 Ga0307416_1003458752 278
982 3300032126 Ga0307415_100036005 Ga0307415_1000360054 278
983 3300042005 Ga0439448_0032520 Ga0439448_0032520_529_1407 278
984 3300042012 Ga0439455_0007276 Ga0439455_0007276_372_1250 278
985 3300042016 Ga0439463_001816 Ga0439463_001816_2759_3637 278
986 3300042439 Ga0439464_0001242 Ga0439464_0001242_840_1718 278
987 3300042993 Ga0439440_0000085 Ga0439440_0000085_1928_2806 278
988 3300031731 Ga0307405_10045762 Ga0307405_100457624 280
989 3300031901 Ga0307406_10025356 Ga0307406_100253564 280
990 3300031995 Ga0307409_100077230 Ga0307409_1000772303 280
991 3300032126 Ga0307415_100003679 Ga0307415_1000036797 280
992 3300003203 JGI25406J46586_10003631 JGI25406J46586_100036315 286
993 3300005985 Ga0081539_10003891 Ga0081539_100038915 286

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

72

185

0.93

PF08241

Methyltransf_11

Methyltransferase domain

95

182

0.91

PF13649

Methyltransf_25

Methyltransferase domain

94

178

0.89

PF13847

Methyltransf_31

Methyltransferase domain

88

223

0.87

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

82

190

0.84

PF13489

Methyltransf_23

Methyltransferase domain

77

221

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kok-assembly1.cif.gz_B pavine n-methyltransferase in complex with tetrahydropapaverine and s-adenosylhomocysteine ph 7.25 0.9074 77 194
7v6h-assembly2.cif.gz_B crystal structure of the spnl 0.8935 80 247
5dpl-assembly1.cif.gz_B the structure of pkmt2 from rickettsia typhi in complex with adohcy 0.8839 85 192
2yxe-assembly1.cif.gz_B crystal structure of l-isoaspartyl protein carboxyl methyltranferase 0.8783 82 190
6gkz-assembly1.cif.gz_A crystal structure of coclaurine n-methyltransferase (cnmt) bound to n-methylheliamine and sah 0.877 77 194
ID Description Score Start End Superfamily
af_Q4E3J0_145_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9896 84 147 3.40.50.150
af_Q55DF6_53_245_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9546 82 140 3.40.50.150
af_C0H5A2_481_622_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.949 85 142 3.40.50.150
af_K7LTE4_237_888_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9472 82 145 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9456 80 145 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1Z4T6Q9-F1-model_v4 deleted 0.9762 81 188
AF-J7T967-F1-model_v4 deleted 0.9713 70 200
AF-A0A2H0AUX0-F1-model_v4 Methyltransferase domain-containing protein 0.9707 82 140 GO:0016020
AF-A0A838J840-F1-model_v4 Arsenite methyltransferase (EC 2.1.1.137) 0.9667 61 162 GO:0008168
GO:0032259
AF-A0A848UHI9-F1-model_v4 Arsenite methyltransferase (EC 2.1.1.137) 0.9601 83 257 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
78.93 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map