F487673
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 993 | 354 | 985 | 260 |
Family's Representative Sequence
| Representative Sequence | 3300005616|Ga0068852_100368253|Ga0068852_1003682532 |
| Length | 298 |
| Sequence | MSDTEIREQVRQRYAAAAVAVSARGADALTVLDDCCSPAANASCCGSTGEVDAAFGAGLYSADEHGELPVEAVAASLGCGNPTAVAELRAGERVLDLGSGGGIDVLLSARRVGPTGYAYGVDMTDEMLALANANKAKAGIDNVEFRAVDVVISNCVVNLSTDKPAVLAEMFRVLTPGGRIGISDVVAEDHLSPADRAERGSYVGCIAGALSRQEYLDGLAAVGFADAEVIFTHEAAPGMHSAIVRAVKPVTAASETAVFQRMATASAXXXXPLASEPLTPAAGQLSAAACCSTNEQDR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 2 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 3 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 4 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 5 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 6 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 7 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 8 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 11 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 66 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 105 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 106 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 152 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 153 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 154 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 156 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 158 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 159 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 161 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 162 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 164 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 165 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 167 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 168 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 169 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 170 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 174 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 175 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 176 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 177 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 178 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 180 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 181 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 183 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 184 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 185 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 188 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 192 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 193 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 196 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 197 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 198 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 201 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 202 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 203 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 204 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 205 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 206 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 207 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 208 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 209 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 210 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 211 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 212 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 213 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 214 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 215 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 216 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 217 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 218 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 219 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 291 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 292 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 293 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 294 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 297 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 298 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 299 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 300 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 301 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 302 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 303 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 337 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 338 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 352 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.89 |
| Metatranscriptomes | 0.3 |
| Isolates | 0.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.6 |
| Nodule | 0 |
| Rhizoplane | 5.44 |
| Rhizosphere | 91.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10003631 | 3300003203 | Bacteria | 7235 |
| 2 | JGI25407J50210_10026255 | 3300003373 | Unclassified | 1510 |
| 3 | JGI25407J50210_10027708 | 3300003373 | Bacteria | 1469 |
| 4 | Ga0065714_10028532 | 3300005288 | Bacteria | 1288 |
| 5 | Ga0070658_10180420 | 3300005327 | Bacteria | 1776 |
| 6 | Ga0070658_10431688 | 3300005327 | Bacteria | 1134 |
| 7 | Ga0070683_100002447 | 3300005329 | Bacteria | 14774 |
| 8 | Ga0070683_100023996 | 3300005329 | Bacteria | 5459 |
| 9 | Ga0070690_100129205 | 3300005330 | Bacteria | 1704 |
| 10 | Ga0068869_100240303 | 3300005334 | Bacteria | 1443 |
| 11 | Ga0070666_10137103 | 3300005335 | Bacteria | 1703 |
| 12 | Ga0070680_100012407 | 3300005336 | Bacteria | 6620 |
| 13 | Ga0070680_100425661 | 3300005336 | Bacteria | 1133 |
| 14 | Ga0070682_100053667 | 3300005337 | Bacteria | 2527 |
| 15 | Ga0070682_100193124 | 3300005337 | Bacteria | 1431 |
| 16 | Ga0068868_100220539 | 3300005338 | Bacteria | 1587 |
| 17 | Ga0068868_100235958 | 3300005338 | Bacteria | 1535 |
| 18 | Ga0070689_100206095 | 3300005340 | Bacteria | 1608 |
| 19 | Ga0070691_10009567 | 3300005341 | Bacteria | 4425 |
| 20 | Ga0070691_10169231 | 3300005341 | Bacteria | 1131 |
| 21 | Ga0070671_100200799 | 3300005355 | Bacteria | 1690 |
| 22 | Ga0070674_100024274 | 3300005356 | Bacteria | 3934 |
| 23 | Ga0070673_100049920 | 3300005364 | Bacteria | 3269 |
| 24 | Ga0070673_100201967 | 3300005364 | Bacteria | 1712 |
| 25 | Ga0070673_100209167 | 3300005364 | Bacteria | 1684 |
| 26 | Ga0070709_10000701 | 3300005434 | Bacteria | 19084 |
| 27 | Ga0070709_10051088 | 3300005434 | Bacteria | 2593 |
| 28 | Ga0070709_10113308 | 3300005434 | Bacteria | 1826 |
| 29 | Ga0070709_10128004 | 3300005434 | Bacteria | 1730 |
| 30 | Ga0070714_100000933 | 3300005435 | Bacteria | 20761 |
| 31 | Ga0070714_100014534 | 3300005435 | Bacteria | 6327 |
| 32 | Ga0070714_100036934 | 3300005435 | Bacteria | 4102 |
| 33 | Ga0070714_100111427 | 3300005435 | Bacteria | 2423 |
| 34 | Ga0070714_100272121 | 3300005435 | Bacteria | 1571 |
| 35 | Ga0070713_100017046 | 3300005436 | Bacteria | 5480 |
| 36 | Ga0070713_100017740 | 3300005436 | Bacteria | 5395 |
| 37 | Ga0070713_100031913 | 3300005436 | Bacteria | 4201 |
| 38 | Ga0070713_100236913 | 3300005436 | Bacteria | 1660 |
| 39 | Ga0070713_100380571 | 3300005436 | Bacteria | 1315 |
| 40 | Ga0070710_10000411 | 3300005437 | Bacteria | 20167 |
| 41 | Ga0070710_10028450 | 3300005437 | Bacteria | 2990 |
| 42 | Ga0070710_10053899 | 3300005437 | Bacteria | 2267 |
| 43 | Ga0070711_100002526 | 3300005439 | Bacteria | 10461 |
| 44 | Ga0070711_100040371 | 3300005439 | Bacteria | 3147 |
| 45 | Ga0070711_100216626 | 3300005439 | Bacteria | 1486 |
| 46 | Ga0070705_100306982 | 3300005440 | Bacteria | 1140 |
| 47 | Ga0070694_100214927 | 3300005444 | Bacteria | 1440 |
| 48 | Ga0070708_100002228 | 3300005445 | Bacteria | 14985 |
| 49 | Ga0070708_100005830 | 3300005445 | Bacteria | 9776 |
| 50 | Ga0070663_100206341 | 3300005455 | Bacteria | 1536 |
| 51 | Ga0070662_100330273 | 3300005457 | Bacteria | 1246 |
| 52 | Ga0070706_100009587 | 3300005467 | Bacteria | 9005 |
| 53 | Ga0070706_100022514 | 3300005467 | Bacteria | 5800 |
| 54 | Ga0070706_100183715 | 3300005467 | Bacteria | 1953 |
| 55 | Ga0070706_100204395 | 3300005467 | Bacteria | 1845 |
| 56 | Ga0070707_100007797 | 3300005468 | Bacteria | 9944 |
| 57 | Ga0070707_100075214 | 3300005468 | Bacteria | 3257 |
| 58 | Ga0070707_100120691 | 3300005468 | Bacteria | 2545 |
| 59 | Ga0070707_100912696 | 3300005468 | Bacteria | 843 |
| 60 | Ga0070698_100003498 | 3300005471 | Bacteria | 17291 |
| 61 | Ga0070698_100017226 | 3300005471 | Bacteria | 7612 |
| 62 | Ga0070698_100022472 | 3300005471 | Bacteria | 6598 |
| 63 | Ga0070698_100178834 | 3300005471 | Bacteria | 2060 |
| 64 | Ga0070699_100010943 | 3300005518 | Bacteria | 7847 |
| 65 | Ga0070699_100047694 | 3300005518 | Bacteria | 3706 |
| 66 | Ga0070699_100161924 | 3300005518 | Bacteria | 1980 |
| 67 | Ga0070699_100228815 | 3300005518 | Bacteria | 1658 |
| 68 | Ga0070699_100476636 | 3300005518 | Bacteria | 1132 |
| 69 | Ga0070684_100059444 | 3300005535 | Bacteria | 3342 |
| 70 | Ga0070684_100067391 | 3300005535 | Bacteria | 3144 |
| 71 | Ga0070684_100126215 | 3300005535 | Bacteria | 2305 |
| 72 | Ga0070697_100093464 | 3300005536 | Bacteria | 2490 |
| 73 | Ga0068853_100275342 | 3300005539 | Bacteria | 1550 |
| 74 | Ga0070672_100155535 | 3300005543 | Bacteria | 1894 |
| 75 | Ga0070695_100140392 | 3300005545 | Bacteria | 1675 |
| 76 | Ga0070665_100062479 | 3300005548 | Bacteria | 3734 |
| 77 | Ga0070704_100370248 | 3300005549 | Bacteria | 1214 |
| 78 | Ga0068855_100010217 | 3300005563 | Bacteria | 11316 |
| 79 | Ga0068855_100261130 | 3300005563 | Bacteria | 1929 |
| 80 | Ga0070664_100084380 | 3300005564 | Bacteria | 2742 |
| 81 | Ga0070664_100129328 | 3300005564 | Bacteria | 2217 |
| 82 | Ga0070664_100147418 | 3300005564 | Bacteria | 2076 |
| 83 | Ga0070664_100872487 | 3300005564 | Bacteria | 843 |
| 84 | Ga0068857_100179797 | 3300005577 | Bacteria | 1925 |
| 85 | Ga0068857_100222935 | 3300005577 | Bacteria | 1723 |
| 86 | Ga0068857_100624301 | 3300005577 | Bacteria | 1020 |
| 87 | Ga0068854_100129413 | 3300005578 | Bacteria | 1926 |
| 88 | Ga0068856_100216277 | 3300005614 | Bacteria | 1931 |
| 89 | Ga0068856_100391874 | 3300005614 | Bacteria | 1408 |
| 90 | Ga0070702_100196895 | 3300005615 | Bacteria | 1330 |
| 91 | Ga0068852_100089488 | 3300005616 | Bacteria | 2751 |
| 92 | Ga0068852_100368253 | 3300005616 | Bacteria | 1407 |
| 93 | Ga0068859_100924034 | 3300005617 | Bacteria | 957 |
| 94 | Ga0068864_100069738 | 3300005618 | Bacteria | 3057 |
| 95 | Ga0068864_100298068 | 3300005618 | Bacteria | 1509 |
| 96 | Ga0068861_100112996 | 3300005719 | Bacteria | 2178 |
| 97 | Ga0068870_10014788 | 3300005840 | Bacteria | 3693 |
| 98 | Ga0068863_100063255 | 3300005841 | Bacteria | 3499 |
| 99 | Ga0068863_100234987 | 3300005841 | Bacteria | 1769 |
| 100 | Ga0068858_100000551 | 3300005842 | Bacteria | 39065 |
| 101 | Ga0068858_100117837 | 3300005842 | Bacteria | 2482 |
| 102 | Ga0068858_100653739 | 3300005842 | Bacteria | 1021 |
| 103 | Ga0068860_100121928 | 3300005843 | Bacteria | 2497 |
| 104 | Ga0068860_100367791 | 3300005843 | Bacteria | 1418 |
| 105 | Ga0081455_10096526 | 3300005937 | Bacteria | 2383 |
| 106 | Ga0081538_10000336 | 3300005981 | Bacteria | 53233 |
| 107 | Ga0081538_10000556 | 3300005981 | Bacteria | 41334 |
| 108 | Ga0081538_10001009 | 3300005981 | Bacteria | 30023 |
| 109 | Ga0081538_10006601 | 3300005981 | Bacteria | 10180 |
| 110 | Ga0081538_10009646 | 3300005981 | Bacteria | 8025 |
| 111 | Ga0081538_10021539 | 3300005981 | Bacteria | 4700 |
| 112 | Ga0081538_10027367 | 3300005981 | Bacteria | 3955 |
| 113 | Ga0081538_10031177 | 3300005981 | Bacteria | 3602 |
| 114 | Ga0081538_10043437 | 3300005981 | Bacteria | 2822 |
| 115 | Ga0081538_10102767 | 3300005981 | Bacteria | 1432 |
| 116 | Ga0081538_10159762 | 3300005981 | Bacteria | 1004 |
| 117 | Ga0081540_1010306 | 3300005983 | Bacteria | 6340 |
| 118 | Ga0081539_10003891 | 3300005985 | Bacteria | 17409 |
| 119 | Ga0081539_10008348 | 3300005985 | Bacteria | 9050 |
| 120 | Ga0081539_10026756 | 3300005985 | Bacteria | 3670 |
| 121 | Ga0081539_10029700 | 3300005985 | Bacteria | 3409 |
| 122 | Ga0081539_10037336 | 3300005985 | Bacteria | 2895 |
| 123 | Ga0070717_10003028 | 3300006028 | Bacteria | 11974 |
| 124 | Ga0070717_10042057 | 3300006028 | Bacteria | 3727 |
| 125 | Ga0070717_10196231 | 3300006028 | Bacteria | 1766 |
| 126 | Ga0070717_10300840 | 3300006028 | Bacteria | 1426 |
| 127 | Ga0075368_10001498 | 3300006042 | Bacteria | 7482 |
| 128 | Ga0075432_10053240 | 3300006058 | Bacteria | 1431 |
| 129 | Ga0070716_100000316 | 3300006173 | Bacteria | 19449 |
| 130 | Ga0070716_100134376 | 3300006173 | Bacteria | 1568 |
| 131 | Ga0070712_100001872 | 3300006175 | Bacteria | 12845 |
| 132 | Ga0070712_100024746 | 3300006175 | Bacteria | 3983 |
| 133 | Ga0070712_100031376 | 3300006175 | Bacteria | 3579 |
| 134 | Ga0070712_100111938 | 3300006175 | Bacteria | 2039 |
| 135 | Ga0070712_100136991 | 3300006175 | Bacteria | 1863 |
| 136 | Ga0070712_100193921 | 3300006175 | Bacteria | 1591 |
| 137 | Ga0070712_100562507 | 3300006175 | Bacteria | 962 |
| 138 | Ga0075367_10000161 | 3300006178 | Bacteria | 21029 |
| 139 | Ga0075428_100008819 | 3300006844 | Bacteria | 11192 |
| 140 | Ga0075428_100067912 | 3300006844 | Bacteria | 3901 |
| 141 | Ga0075428_100540373 | 3300006844 | Bacteria | 1246 |
| 142 | Ga0075428_100747199 | 3300006844 | Bacteria | 1041 |
| 143 | Ga0075430_100000755 | 3300006846 | Bacteria | 24936 |
| 144 | Ga0075430_100006823 | 3300006846 | Bacteria | 9622 |
| 145 | Ga0075430_100042918 | 3300006846 | Bacteria | 3823 |
| 146 | Ga0075430_100056542 | 3300006846 | Bacteria | 3299 |
| 147 | Ga0075431_100070701 | 3300006847 | Bacteria | 3601 |
| 148 | Ga0075431_100077452 | 3300006847 | Bacteria | 3432 |
| 149 | Ga0075431_100130426 | 3300006847 | Bacteria | 2593 |
| 150 | Ga0075431_100183579 | 3300006847 | Bacteria | 2146 |
| 151 | Ga0075431_100444421 | 3300006847 | Bacteria | 1293 |
| 152 | Ga0075433_10014254 | 3300006852 | Bacteria | 6491 |
| 153 | Ga0075433_10091088 | 3300006852 | Bacteria | 2695 |
| 154 | Ga0075434_100011783 | 3300006871 | Bacteria | 8262 |
| 155 | Ga0075434_100062311 | 3300006871 | Bacteria | 3712 |
| 156 | Ga0075429_100000518 | 3300006880 | Bacteria | 29269 |
| 157 | Ga0075429_100020176 | 3300006880 | Bacteria | 5779 |
| 158 | Ga0075429_100032146 | 3300006880 | Bacteria | 4561 |
| 159 | Ga0097620_100924039 | 3300006931 | Bacteria | 957 |
| 160 | Ga0075435_100021448 | 3300007076 | Bacteria | 4969 |
| 161 | Ga0075435_100029557 | 3300007076 | Bacteria | 4301 |
| 162 | Ga0075435_100090162 | 3300007076 | Bacteria | 2529 |
| 163 | Ga0099795_10042866 | 3300007788 | Bacteria | 1617 |
| 164 | Ga0105240_10166293 | 3300009093 | Bacteria | 2616 |
| 165 | Ga0105240_10640263 | 3300009093 | Bacteria | 1166 |
| 166 | Ga0111539_10003901 | 3300009094 | Bacteria | 19612 |
| 167 | Ga0111539_10017234 | 3300009094 | Bacteria | 8939 |
| 168 | Ga0111539_10282141 | 3300009094 | Bacteria | 1933 |
| 169 | Ga0111539_10346858 | 3300009094 | Bacteria | 1728 |
| 170 | Ga0111539_10370663 | 3300009094 | Bacteria | 1667 |
| 171 | Ga0111539_10548579 | 3300009094 | Bacteria | 1346 |
| 172 | Ga0105245_10209359 | 3300009098 | Bacteria | 1876 |
| 173 | Ga0105245_10350362 | 3300009098 | Bacteria | 1463 |
| 174 | Ga0105245_10840429 | 3300009098 | Bacteria | 958 |
| 175 | Ga0105247_10372543 | 3300009101 | Bacteria | 1010 |
| 176 | Ga0114129_10000440 | 3300009147 | Bacteria | 49341 |
| 177 | Ga0114129_10009535 | 3300009147 | Bacteria | 13850 |
| 178 | Ga0114129_10361442 | 3300009147 | Bacteria | 1921 |
| 179 | Ga0114129_10393954 | 3300009147 | Bacteria | 1826 |
| 180 | Ga0114129_10407784 | 3300009147 | Bacteria | 1790 |
| 181 | Ga0105243_10082368 | 3300009148 | Bacteria | 2629 |
| 182 | Ga0105241_10180901 | 3300009174 | Bacteria | 1749 |
| 183 | Ga0105242_10122871 | 3300009176 | Bacteria | 2231 |
| 184 | Ga0105242_10550945 | 3300009176 | Bacteria | 1106 |
| 185 | Ga0105248_10122385 | 3300009177 | Bacteria | 2935 |
| 186 | Ga0105248_10601460 | 3300009177 | Bacteria | 1241 |
| 187 | Ga0105248_10675838 | 3300009177 | Bacteria | 1165 |
| 188 | Ga0105238_10456293 | 3300009551 | Bacteria | 1275 |
| 189 | Ga0105249_10363037 | 3300009553 | Bacteria | 1470 |
| 190 | Ga0105239_10516066 | 3300010375 | Bacteria | 1359 |
| 191 | Ga0105246_10241604 | 3300011119 | Bacteria | 1428 |
| 192 | Ga0157370_10092292 | 3300013104 | Bacteria | 2842 |
| 193 | Ga0157369_10057659 | 3300013105 | Bacteria | 4189 |
| 194 | Ga0157369_10076989 | 3300013105 | Bacteria | 3576 |
| 195 | Ga0157369_10274812 | 3300013105 | Bacteria | 1755 |
| 196 | Ga0157374_10613859 | 3300013296 | Bacteria | 1098 |
| 197 | Ga0163162_10085237 | 3300013306 | Bacteria | 3236 |
| 198 | Ga0157372_10148994 | 3300013307 | Bacteria | 2699 |
| 199 | Ga0157372_10821169 | 3300013307 | Bacteria | 1080 |
| 200 | Ga0163163_10004571 | 3300014325 | Bacteria | 11812 |
| 201 | Ga0163163_10132387 | 3300014325 | Bacteria | 2534 |
| 202 | Ga0163163_10178095 | 3300014325 | Bacteria | 2173 |
| 203 | Ga0163163_10745178 | 3300014325 | Bacteria | 1043 |
| 204 | Ga0157377_10209723 | 3300014745 | Bacteria | 1241 |
| 205 | Ga0157379_10037611 | 3300014968 | Bacteria | 4317 |
| 206 | Ga0157379_10114298 | 3300014968 | Bacteria | 2426 |
| 207 | Ga0157379_10170292 | 3300014968 | Bacteria | 1966 |
| 208 | Ga0157376_10425034 | 3300014969 | Bacteria | 1290 |
| 209 | Ga0206356_11150109 | 3300020070 | Bacteria | 804 |
| 210 | Ga0206350_11291229 | 3300020080 | Bacteria | 1388 |
| 211 | Ga0206353_10331881 | 3300020082 | Bacteria | 2165 |
| 212 | Ga0213875_10001641 | 3300021388 | Bacteria | 14126 |
| 213 | Ga0213875_10009989 | 3300021388 | Bacteria | 4775 |
| 214 | Ga0213875_10011897 | 3300021388 | Bacteria | 4314 |
| 215 | Ga0213875_10035250 | 3300021388 | Bacteria | 2361 |
| 216 | Ga0224572_1017956 | 3300024225 | Bacteria | 1359 |
| 217 | Ga0207653_10025778 | 3300025885 | Bacteria | 1882 |
| 218 | Ga0207692_10000708 | 3300025898 | Bacteria | 11730 |
| 219 | Ga0207692_10107647 | 3300025898 | Bacteria | 1541 |
| 220 | Ga0207692_10178010 | 3300025898 | Bacteria | 1237 |
| 221 | Ga0207642_10122093 | 3300025899 | Bacteria | 1346 |
| 222 | Ga0207688_10013197 | 3300025901 | Bacteria | 4491 |
| 223 | Ga0207688_10014998 | 3300025901 | Bacteria | 4204 |
| 224 | Ga0207688_10198827 | 3300025901 | Bacteria | 1201 |
| 225 | Ga0207680_10048298 | 3300025903 | Bacteria | 2527 |
| 226 | Ga0207699_10000918 | 3300025906 | Bacteria | 14073 |
| 227 | Ga0207699_10181130 | 3300025906 | Bacteria | 1416 |
| 228 | Ga0207643_10006930 | 3300025908 | Bacteria | 6076 |
| 229 | Ga0207643_10049781 | 3300025908 | Bacteria | 2375 |
| 230 | Ga0207684_10003011 | 3300025910 | Bacteria | 16706 |
| 231 | Ga0207684_10026867 | 3300025910 | Bacteria | 4909 |
| 232 | Ga0207684_10043339 | 3300025910 | Bacteria | 3815 |
| 233 | Ga0207684_10354854 | 3300025910 | Bacteria | 1262 |
| 234 | Ga0207684_10504020 | 3300025910 | Bacteria | 1037 |
| 235 | Ga0207693_10009326 | 3300025915 | Bacteria | 8001 |
| 236 | Ga0207693_10025458 | 3300025915 | Bacteria | 4692 |
| 237 | Ga0207693_10043582 | 3300025915 | Bacteria | 3529 |
| 238 | Ga0207693_10115974 | 3300025915 | Bacteria | 2103 |
| 239 | Ga0207693_10150964 | 3300025915 | Bacteria | 1827 |
| 240 | Ga0207693_10325511 | 3300025915 | Bacteria | 1203 |
| 241 | Ga0207663_10039511 | 3300025916 | Bacteria | 2860 |
| 242 | Ga0207663_10129364 | 3300025916 | Bacteria | 1742 |
| 243 | Ga0207663_10289641 | 3300025916 | Bacteria | 1219 |
| 244 | Ga0207657_10040905 | 3300025919 | Bacteria | 4103 |
| 245 | Ga0207652_10116272 | 3300025921 | Bacteria | 2376 |
| 246 | Ga0207646_10025433 | 3300025922 | Bacteria | 5415 |
| 247 | Ga0207646_10040912 | 3300025922 | Bacteria | 4167 |
| 248 | Ga0207646_10045105 | 3300025922 | Bacteria | 3958 |
| 249 | Ga0207646_10464482 | 3300025922 | Bacteria | 1141 |
| 250 | Ga0207650_10201397 | 3300025925 | Bacteria | 1595 |
| 251 | Ga0207687_10099571 | 3300025927 | Bacteria | 2136 |
| 252 | Ga0207687_10146681 | 3300025927 | Bacteria | 1796 |
| 253 | Ga0207687_10252510 | 3300025927 | Bacteria | 1402 |
| 254 | Ga0207700_10000662 | 3300025928 | Bacteria | 20159 |
| 255 | Ga0207700_10004691 | 3300025928 | Bacteria | 8100 |
| 256 | Ga0207700_10005292 | 3300025928 | Bacteria | 7696 |
| 257 | Ga0207700_10088166 | 3300025928 | Bacteria | 2442 |
| 258 | Ga0207700_10110690 | 3300025928 | Bacteria | 2209 |
| 259 | Ga0207700_10364539 | 3300025928 | Bacteria | 1260 |
| 260 | Ga0207664_10001227 | 3300025929 | Bacteria | 16980 |
| 261 | Ga0207664_10015632 | 3300025929 | Bacteria | 5515 |
| 262 | Ga0207664_10017475 | 3300025929 | Bacteria | 5260 |
| 263 | Ga0207664_10035879 | 3300025929 | Bacteria | 3829 |
| 264 | Ga0207664_10072274 | 3300025929 | Bacteria | 2781 |
| 265 | Ga0207664_10073313 | 3300025929 | Bacteria | 2762 |
| 266 | Ga0207664_10585117 | 3300025929 | Bacteria | 1002 |
| 267 | Ga0207644_10439478 | 3300025931 | Bacteria | 1071 |
| 268 | Ga0207706_10013188 | 3300025933 | Bacteria | 7520 |
| 269 | Ga0207686_10110563 | 3300025934 | Bacteria | 1852 |
| 270 | Ga0207670_10002309 | 3300025936 | Bacteria | 9993 |
| 271 | Ga0207665_10000242 | 3300025939 | Bacteria | 37438 |
| 272 | Ga0207665_10001127 | 3300025939 | Bacteria | 17970 |
| 273 | Ga0207711_10007526 | 3300025941 | Bacteria | 9108 |
| 274 | Ga0207689_10131963 | 3300025942 | Bacteria | 2056 |
| 275 | Ga0207689_10211301 | 3300025942 | Bacteria | 1603 |
| 276 | Ga0207661_10029219 | 3300025944 | Bacteria | 4231 |
| 277 | Ga0207661_10036293 | 3300025944 | Bacteria | 3846 |
| 278 | Ga0207661_10435719 | 3300025944 | Bacteria | 1192 |
| 279 | Ga0207679_10636367 | 3300025945 | Bacteria | 964 |
| 280 | Ga0207667_10025772 | 3300025949 | Bacteria | 6432 |
| 281 | Ga0207667_10329952 | 3300025949 | Bacteria | 1558 |
| 282 | Ga0207651_10030130 | 3300025960 | Bacteria | 3450 |
| 283 | Ga0207651_10148042 | 3300025960 | Bacteria | 1824 |
| 284 | Ga0207712_10205745 | 3300025961 | Bacteria | 1564 |
| 285 | Ga0207640_10098671 | 3300025981 | Bacteria | 2043 |
| 286 | Ga0207677_10186888 | 3300026023 | Bacteria | 1635 |
| 287 | Ga0207703_10000232 | 3300026035 | Bacteria | 63879 |
| 288 | Ga0207703_10065849 | 3300026035 | Bacteria | 2979 |
| 289 | Ga0207703_10428403 | 3300026035 | Bacteria | 1232 |
| 290 | Ga0207639_10245698 | 3300026041 | Bacteria | 1558 |
| 291 | Ga0207702_10229391 | 3300026078 | Bacteria | 1734 |
| 292 | Ga0207641_10260395 | 3300026088 | Bacteria | 1624 |
| 293 | Ga0207641_10406862 | 3300026088 | Bacteria | 1308 |
| 294 | Ga0207676_10242267 | 3300026095 | Bacteria | 1618 |
| 295 | Ga0207676_10526415 | 3300026095 | Bacteria | 1126 |
| 296 | Ga0207674_10023560 | 3300026116 | Bacteria | 6592 |
| 297 | Ga0207674_10842922 | 3300026116 | Bacteria | 884 |
| 298 | Ga0207675_100045735 | 3300026118 | Bacteria | 4089 |
| 299 | Ga0207683_10222386 | 3300026121 | Bacteria | 1720 |
| 300 | Ga0207683_10473150 | 3300026121 | Bacteria | 1156 |
| 301 | Ga0207698_10033868 | 3300026142 | Bacteria | 3716 |
| 302 | Ga0207698_10383538 | 3300026142 | Bacteria | 1338 |
| 303 | Ga0209179_1027653 | 3300027512 | Bacteria | 1145 |
| 304 | Ga0209813_10054016 | 3300027866 | Bacteria | 1264 |
| 305 | Ga0207428_10034425 | 3300027907 | Bacteria | 4151 |
| 306 | Ga0207428_10307592 | 3300027907 | Bacteria | 1172 |
| 307 | Ga0268266_10254979 | 3300028379 | Bacteria | 1624 |
| 308 | Ga0268266_10443857 | 3300028379 | Bacteria | 1233 |
| 309 | Ga0268264_10079604 | 3300028381 | Bacteria | 2796 |
| 310 | Ga0265319_1001666 | 3300028563 | Bacteria | 12856 |
| 311 | Ga0265319_1028149 | 3300028563 | Bacteria | 1984 |
| 312 | Ga0265334_10009965 | 3300028573 | Bacteria | 4017 |
| 313 | Ga0265318_10001695 | 3300028577 | Bacteria | 12649 |
| 314 | Ga0265338_10085687 | 3300028800 | Bacteria | 2625 |
| 315 | Ga0265338_10150390 | 3300028800 | Bacteria | 1810 |
| 316 | Ga0307512_10009621 | 3300030522 | Bacteria | 9294 |
| 317 | Ga0265320_10044210 | 3300031240 | Bacteria | 2196 |
| 318 | Ga0265325_10005794 | 3300031241 | Bacteria | 7575 |
| 319 | Ga0265340_10036050 | 3300031247 | Bacteria | 2453 |
| 320 | Ga0265339_10022369 | 3300031249 | Bacteria | 3664 |
| 321 | Ga0265316_10147223 | 3300031344 | Bacteria | 1765 |
| 322 | Ga0307408_100267379 | 3300031548 | Bacteria | 1418 |
| 323 | Ga0307408_100277958 | 3300031548 | Bacteria | 1393 |
| 324 | Ga0265313_10089254 | 3300031595 | Bacteria | 1387 |
| 325 | Ga0307508_10010752 | 3300031616 | Bacteria | 8368 |
| 326 | Ga0307516_10001550 | 3300031730 | Bacteria | 31620 |
| 327 | Ga0307405_10010719 | 3300031731 | Bacteria | 4765 |
| 328 | Ga0307405_10045762 | 3300031731 | Bacteria | 2684 |
| 329 | Ga0307405_10310188 | 3300031731 | Bacteria | 1201 |
| 330 | Ga0307405_10325169 | 3300031731 | Bacteria | 1176 |
| 331 | Ga0307413_10265286 | 3300031824 | Bacteria | 1282 |
| 332 | Ga0307410_10006039 | 3300031852 | Bacteria | 6490 |
| 333 | Ga0307410_10045905 | 3300031852 | Bacteria | 2912 |
| 334 | Ga0307410_10073917 | 3300031852 | Bacteria | 2372 |
| 335 | Ga0307406_10025356 | 3300031901 | Bacteria | 3550 |
| 336 | Ga0307406_10157953 | 3300031901 | Bacteria | 1626 |
| 337 | Ga0307406_10296544 | 3300031901 | Bacteria | 1240 |
| 338 | Ga0307407_10000233 | 3300031903 | Bacteria | 16468 |
| 339 | Ga0307407_10009971 | 3300031903 | Bacteria | 4454 |
| 340 | Ga0307407_10062285 | 3300031903 | Bacteria | 2184 |
| 341 | Ga0307412_10101515 | 3300031911 | Bacteria | 2036 |
| 342 | Ga0307412_10108067 | 3300031911 | Bacteria | 1981 |
| 343 | Ga0307409_100003046 | 3300031995 | Bacteria | 8963 |
| 344 | Ga0307409_100033193 | 3300031995 | Bacteria | 3753 |
| 345 | Ga0307409_100077230 | 3300031995 | Bacteria | 2674 |
| 346 | Ga0307409_100168798 | 3300031995 | Bacteria | 1923 |
| 347 | Ga0307409_100216504 | 3300031995 | Bacteria | 1726 |
| 348 | Ga0307409_100258319 | 3300031995 | Bacteria | 1597 |
| 349 | Ga0307416_100003770 | 3300032002 | Bacteria | 8992 |
| 350 | Ga0307416_100013836 | 3300032002 | Bacteria | 5500 |
| 351 | Ga0307416_100019981 | 3300032002 | Bacteria | 4766 |
| 352 | Ga0307416_100085957 | 3300032002 | Bacteria | 2679 |
| 353 | Ga0307416_100206499 | 3300032002 | Bacteria | 1869 |
| 354 | Ga0307416_100345875 | 3300032002 | Bacteria | 1502 |
| 355 | Ga0307416_100592414 | 3300032002 | Bacteria | 1187 |
| 356 | Ga0307414_10167045 | 3300032004 | Bacteria | 1755 |
| 357 | Ga0307411_10049442 | 3300032005 | Bacteria | 2732 |
| 358 | Ga0307411_10058446 | 3300032005 | Bacteria | 2552 |
| 359 | Ga0307415_100003679 | 3300032126 | Bacteria | 7846 |
| 360 | Ga0307415_100005171 | 3300032126 | Bacteria | 6888 |
| 361 | Ga0307415_100036005 | 3300032126 | Bacteria | 3239 |
| 362 | Ga0307507_10020421 | 3300033179 | Bacteria | 7418 |
| 363 | Ga0307510_10042591 | 3300033180 | Bacteria | 4946 |
| 364 | Ga0373934_0000008 | 3300035086 | Bacteria | 74071 |
| 365 | Ga0373934_0001843 | 3300035086 | Bacteria | 7794 |
| 366 | Ga0373934_0046557 | 3300035086 | Bacteria | 1715 |
| 367 | Ga0373944_0006609 | 3300035089 | Bacteria | 3079 |
| 368 | Ga0373952_0061045 | 3300035092 | Bacteria | 922 |
| 369 | Ga0373923_0005382 | 3300035111 | Bacteria | 4344 |
| 370 | Ga0373923_0006700 | 3300035111 | Bacteria | 4003 |
| 371 | Ga0373923_0010520 | 3300035111 | Bacteria | 3369 |
| 372 | Ga0373923_0013805 | 3300035111 | Bacteria | 3018 |
| 373 | Ga0373936_0002996 | 3300035113 | Bacteria | 6314 |
| 374 | Ga0373936_0009126 | 3300035113 | Bacteria | 3738 |
| 375 | Ga0373936_0019325 | 3300035113 | Bacteria | 2640 |
| 376 | Ga0373936_0122412 | 3300035113 | Bacteria | 1112 |
| 377 | Ga0373945_0000406 | 3300035116 | Bacteria | 12356 |
| 378 | Ga0373945_0100388 | 3300035116 | Bacteria | 1132 |
| 379 | Ga0373953_0000057 | 3300035117 | Bacteria | 28552 |
| 380 | Ga0373953_0046096 | 3300035117 | Bacteria | 1749 |
| 381 | Ga0373953_0059519 | 3300035117 | Bacteria | 1559 |
| 382 | Ga0373954_0002289 | 3300035118 | Bacteria | 7974 |
| 383 | Ga0373954_0012652 | 3300035118 | Bacteria | 3754 |
| 384 | Ga0373954_0016934 | 3300035118 | Bacteria | 3270 |
| 385 | Ga0373954_0036913 | 3300035118 | Bacteria | 2269 |
| 386 | Ga0373954_0062170 | 3300035118 | Bacteria | 1763 |
| 387 | Ga0373954_0099620 | 3300035118 | Bacteria | 1401 |
| 388 | Ga0373956_0005479 | 3300035119 | Bacteria | 5080 |
| 389 | Ga0373956_0013197 | 3300035119 | Bacteria | 3436 |
| 390 | Ga0373956_0031980 | 3300035119 | Bacteria | 2307 |
| 391 | Ga0373957_0000164 | 3300035120 | Bacteria | 16962 |
| 392 | Ga0373957_0000836 | 3300035120 | Bacteria | 8053 |
| 393 | Ga0373957_0013534 | 3300035120 | Bacteria | 2769 |
| 394 | Ga0373943_0002294 | 3300035170 | Bacteria | 8689 |
| 395 | Ga0373943_0040035 | 3300035170 | Bacteria | 2261 |
| 396 | Ga0373946_0004299 | 3300035171 | Bacteria | 5089 |
| 397 | Ga0373955_0000660 | 3300035172 | Bacteria | 14675 |
| 398 | Ga0373955_0001687 | 3300035172 | Bacteria | 9445 |
| 399 | Ga0373955_0003081 | 3300035172 | Bacteria | 7295 |
| 400 | Ga0373955_0047077 | 3300035172 | Bacteria | 2334 |
| 401 | Ga0373955_0072480 | 3300035172 | Bacteria | 1929 |
| 402 | Ga0373962_0043395 | 3300035242 | Bacteria | 1275 |
| 403 | Ga0373924_0002548 | 3300035410 | Bacteria | 6150 |
| 404 | Ga0373924_0006314 | 3300035410 | Bacteria | 4240 |
| 405 | Ga0373924_0015285 | 3300035410 | Bacteria | 2916 |
| 406 | Ga0373924_0020410 | 3300035410 | Bacteria | 2575 |
| 407 | Ga0373924_0022153 | 3300035410 | Bacteria | 2482 |
| 408 | Ga0373931_0289311 | 3300035691 | Bacteria | 1008 |
| 409 | Ga0373935_0024869 | 3300035692 | Bacteria | 3688 |
| 410 | Ga0373935_0028094 | 3300035692 | Bacteria | 3476 |
| 411 | Ga0373935_0200250 | 3300035692 | Bacteria | 1379 |
| 412 | Ga0373927_0001584 | 3300035695 | Bacteria | 17074 |
| 413 | Ga0373927_0165752 | 3300035695 | Bacteria | 1448 |
| 414 | Ga0373933_0000150 | 3300035724 | Bacteria | 45663 |
| 415 | Ga0373933_0001027 | 3300035724 | Bacteria | 16979 |
| 416 | Ga0373933_0097095 | 3300035724 | Bacteria | 1824 |
| 417 | Ga0373933_0099988 | 3300035724 | Bacteria | 1798 |
| 418 | Ga0373933_0131273 | 3300035724 | Bacteria | 1575 |
| 419 | Ga0373933_0153041 | 3300035724 | Bacteria | 1461 |
| 420 | Ga0373947_0003709 | 3300035725 | Bacteria | 9023 |
| 421 | Ga0373947_0175820 | 3300035725 | Bacteria | 1391 |
| 422 | Ga0373937_0000002 | 3300036401 | Bacteria | 304133 |
| 423 | Ga0373937_0038707 | 3300036401 | Bacteria | 4345 |
| 424 | Ga0373937_0046021 | 3300036401 | Bacteria | 3988 |
| 425 | Ga0373937_0055004 | 3300036401 | Bacteria | 3652 |
| 426 | Ga0373937_0072237 | 3300036401 | Bacteria | 3182 |
| 427 | Ga0373937_0080373 | 3300036401 | Bacteria | 3014 |
| 428 | Ga0373937_0113483 | 3300036401 | Bacteria | 2521 |
| 429 | Ga0373937_0254108 | 3300036401 | Bacteria | 1657 |
| 430 | Ga0373937_0283181 | 3300036401 | Bacteria | 1565 |
| 431 | Ga0373937_0300395 | 3300036401 | Bacteria | 1517 |
| 432 | Ga0373925_0003875 | 3300037068 | Bacteria | 11439 |
| 433 | Ga0373925_0079378 | 3300037068 | Bacteria | 2493 |
| 434 | Ga0395899_0009014 | 3300037312 | Bacteria | 7668 |
| 435 | Ga0395899_0060446 | 3300037312 | Bacteria | 2792 |
| 436 | Ga0395899_0075670 | 3300037312 | Bacteria | 2458 |
| 437 | Ga0395900_0000728 | 3300037418 | Bacteria | 43848 |
| 438 | Ga0395900_0002127 | 3300037418 | Bacteria | 22170 |
| 439 | Ga0395900_0024834 | 3300037418 | Bacteria | 6134 |
| 440 | Ga0395900_0169054 | 3300037418 | Bacteria | 2227 |
| 441 | Ga0395900_0243967 | 3300037418 | Bacteria | 1801 |
| 442 | Ga0395900_0320023 | 3300037418 | Bacteria | 1532 |
| 443 | Ga0395898_0038489 | 3300037466 | Bacteria | 4739 |
| 444 | Ga0395898_0086697 | 3300037466 | Bacteria | 3017 |
| 445 | Ga0395898_0090933 | 3300037466 | Bacteria | 2937 |
| 446 | Ga0395905_0004578 | 3300037471 | Bacteria | 14307 |
| 447 | Ga0395905_0153750 | 3300037471 | Bacteria | 2164 |
| 448 | Ga0395905_0338789 | 3300037471 | Bacteria | 1395 |
| 449 | Ga0436364_0047523 | 3300037853 | Bacteria | 1908 |
| 450 | Ga0436364_0162021 | 3300037853 | Bacteria | 1304 |
| 451 | Ga0436364_0525292 | 3300037853 | Bacteria | 2264 |
| 452 | Ga0436364_0553397 | 3300037853 | Bacteria | 8828 |
| 453 | Ga0436364_0910455 | 3300037853 | Bacteria | 7448 |
| 454 | Ga0436364_0913146 | 3300037853 | Bacteria | 22722 |
| 455 | Ga0436364_1051289 | 3300037853 | Bacteria | 3964 |
| 456 | Ga0395901_0004408 | 3300038443 | Bacteria | 14188 |
| 457 | Ga0395901_0075388 | 3300038443 | Bacteria | 3519 |
| 458 | Ga0395901_0101464 | 3300038443 | Bacteria | 3019 |
| 459 | Ga0395901_0171986 | 3300038443 | Bacteria | 2273 |
| 460 | Ga0395901_0323363 | 3300038443 | Bacteria | 1595 |
| 461 | Ga0436365_1203819 | 3300039437 | Bacteria | 913 |
| 462 | Ga0436363_1086998 | 3300039450 | Bacteria | 1045 |
| 463 | Ga0439433_0000431 | 3300041999 | Bacteria | 7652 |
| 464 | Ga0439442_002517 | 3300042002 | Bacteria | 3598 |
| 465 | Ga0439448_0009788 | 3300042005 | Bacteria | 2830 |
| 466 | Ga0439448_0032520 | 3300042005 | Bacteria | 1660 |
| 467 | Ga0439450_002169 | 3300042008 | Bacteria | 3036 |
| 468 | Ga0439455_0007276 | 3300042012 | Bacteria | 2336 |
| 469 | Ga0439463_001816 | 3300042016 | Bacteria | 5554 |
| 470 | Ga0439446_0006770 | 3300042156 | Bacteria | 3000 |
| 471 | Ga0439459_0022074 | 3300042438 | Bacteria | 1229 |
| 472 | Ga0439464_0001242 | 3300042439 | Bacteria | 5927 |
| 473 | Ga0439464_0010275 | 3300042439 | Bacteria | 2470 |
| 474 | Ga0439460_0003952 | 3300042461 | Bacteria | 3602 |
| 475 | Ga0439440_0000085 | 3300042993 | Bacteria | 11972 |
| 476 | Ga0439440_0010001 | 3300042993 | Bacteria | 1973 |
| 477 | Ga0466963_0069603 | 3300044694 | Bacteria | 2365 |
| 478 | Ga0466963_0104837 | 3300044694 | Bacteria | 1938 |
| 479 | Ga0466963_0193594 | 3300044694 | Bacteria | 1421 |
| 480 | Ga0466963_0281326 | 3300044694 | Bacteria | 1169 |
| 481 | Ga0466967_0000799 | 3300045976 | Bacteria | 16449 |
| 482 | Ga0466967_0039141 | 3300045976 | Bacteria | 4073 |
| 483 | Ga0466967_0169965 | 3300045976 | Bacteria | 2050 |
| 484 | Ga0466967_0315184 | 3300045976 | Bacteria | 1507 |
| 485 | Ga0495617_078920 | 3300046452 | Bacteria | 1079 |
| 486 | Ga0495592_0000003 | 3300046454 | Bacteria | 200744 |
| 487 | Ga0495592_0001690 | 3300046454 | Bacteria | 15487 |
| 488 | Ga0495592_0002442 | 3300046454 | Bacteria | 13102 |
| 489 | Ga0495592_0009147 | 3300046454 | Bacteria | 7454 |
| 490 | Ga0495592_0110313 | 3300046454 | Bacteria | 1947 |
| 491 | Ga0495592_0153827 | 3300046454 | Bacteria | 1588 |
| 492 | Ga0495603_0001819 | 3300046455 | Bacteria | 12591 |
| 493 | Ga0495603_0032222 | 3300046455 | Bacteria | 3154 |
| 494 | Ga0495603_0072515 | 3300046455 | Bacteria | 2023 |
| 495 | Ga0495603_0141673 | 3300046455 | Bacteria | 1398 |
| 496 | Ga0495629_0001430 | 3300046459 | Bacteria | 18824 |
| 497 | Ga0495629_0041055 | 3300046459 | Bacteria | 3255 |
| 498 | Ga0495629_0155247 | 3300046459 | Bacteria | 1590 |
| 499 | Ga0495629_0171078 | 3300046459 | Bacteria | 1507 |
| 500 | Ga0495629_0263381 | 3300046459 | Bacteria | 1185 |
| 501 | Ga0495638_0078207 | 3300046460 | Bacteria | 2013 |
| 502 | Ga0495641_0001557 | 3300046461 | Bacteria | 19435 |
| 503 | Ga0495641_0056815 | 3300046461 | Bacteria | 1773 |
| 504 | Ga0495651_0000031 | 3300046462 | Bacteria | 103122 |
| 505 | Ga0495651_0001698 | 3300046462 | Bacteria | 16989 |
| 506 | Ga0495651_0032072 | 3300046462 | Bacteria | 4099 |
| 507 | Ga0495651_0044372 | 3300046462 | Bacteria | 3446 |
| 508 | Ga0495651_0057937 | 3300046462 | Bacteria | 2973 |
| 509 | Ga0495651_0074425 | 3300046462 | Bacteria | 2576 |
| 510 | Ga0495651_0168540 | 3300046462 | Bacteria | 1562 |
| 511 | Ga0495651_0258442 | 3300046462 | Bacteria | 1186 |
| 512 | Ga0495651_0277913 | 3300046462 | Bacteria | 1132 |
| 513 | Ga0495653_0022055 | 3300046463 | Bacteria | 5154 |
| 514 | Ga0495653_0028649 | 3300046463 | Bacteria | 4452 |
| 515 | Ga0495653_0029406 | 3300046463 | Bacteria | 4386 |
| 516 | Ga0495653_0083777 | 3300046463 | Bacteria | 2350 |
| 517 | Ga0495653_0096349 | 3300046463 | Bacteria | 2151 |
| 518 | Ga0495653_0109074 | 3300046463 | Bacteria | 1992 |
| 519 | Ga0495580_0003337 | 3300046472 | Bacteria | 13724 |
| 520 | Ga0495582_0000900 | 3300046473 | Bacteria | 16539 |
| 521 | Ga0495582_0002973 | 3300046473 | Bacteria | 9497 |
| 522 | Ga0495582_0034330 | 3300046473 | Bacteria | 2788 |
| 523 | Ga0495582_0135691 | 3300046473 | Bacteria | 1392 |
| 524 | Ga0495605_0005430 | 3300046474 | Bacteria | 7422 |
| 525 | Ga0495639_0004240 | 3300046475 | Bacteria | 6152 |
| 526 | Ga0495639_0063947 | 3300046475 | Bacteria | 1690 |
| 527 | Ga0495662_0002002 | 3300046476 | Bacteria | 10211 |
| 528 | Ga0495662_0003716 | 3300046476 | Bacteria | 7689 |
| 529 | Ga0495662_0004321 | 3300046476 | Bacteria | 7147 |
| 530 | Ga0495662_0017641 | 3300046476 | Bacteria | 3455 |
| 531 | Ga0495664_0024750 | 3300046477 | Bacteria | 3490 |
| 532 | Ga0495664_0037535 | 3300046477 | Bacteria | 2859 |
| 533 | Ga0495664_0050545 | 3300046477 | Bacteria | 2468 |
| 534 | Ga0495664_0087529 | 3300046477 | Bacteria | 1871 |
| 535 | Ga0495664_0131509 | 3300046477 | Bacteria | 1515 |
| 536 | Ga0495664_0394726 | 3300046477 | Bacteria | 831 |
| 537 | Ga0495585_0014007 | 3300046492 | Bacteria | 4683 |
| 538 | Ga0495585_0118674 | 3300046492 | Bacteria | 1401 |
| 539 | Ga0495594_0003058 | 3300046499 | Bacteria | 8669 |
| 540 | Ga0495594_0008442 | 3300046499 | Bacteria | 5308 |
| 541 | Ga0495607_0039083 | 3300046501 | Bacteria | 2836 |
| 542 | Ga0495583_0006670 | 3300046506 | Bacteria | 7485 |
| 543 | Ga0495606_0014087 | 3300046507 | Bacteria | 6263 |
| 544 | Ga0495608_0000018 | 3300046511 | Bacteria | 192512 |
| 545 | Ga0495608_0001179 | 3300046511 | Bacteria | 18539 |
| 546 | Ga0495608_0012462 | 3300046511 | Bacteria | 5899 |
| 547 | Ga0495608_0035937 | 3300046511 | Bacteria | 3337 |
| 548 | Ga0495608_0074240 | 3300046511 | Bacteria | 2216 |
| 549 | Ga0495608_0122797 | 3300046511 | Bacteria | 1665 |
| 550 | Ga0495608_0145977 | 3300046511 | Bacteria | 1509 |
| 551 | Ga0495610_0034389 | 3300046512 | Bacteria | 2611 |
| 552 | Ga0495618_0044785 | 3300046514 | Bacteria | 2790 |
| 553 | Ga0495618_0047943 | 3300046514 | Bacteria | 2696 |
| 554 | Ga0495618_0122996 | 3300046514 | Bacteria | 1661 |
| 555 | Ga0495618_0175575 | 3300046514 | Bacteria | 1362 |
| 556 | Ga0495618_0305259 | 3300046514 | Bacteria | 988 |
| 557 | Ga0495620_0004863 | 3300046515 | Bacteria | 7537 |
| 558 | Ga0495628_0005767 | 3300046516 | Bacteria | 10848 |
| 559 | Ga0495628_0007721 | 3300046516 | Bacteria | 9285 |
| 560 | Ga0495628_0017377 | 3300046516 | Bacteria | 5991 |
| 561 | Ga0495628_0050820 | 3300046516 | Bacteria | 3278 |
| 562 | Ga0495628_0112881 | 3300046516 | Bacteria | 2089 |
| 563 | Ga0495628_0115522 | 3300046516 | Bacteria | 2061 |
| 564 | Ga0495630_0002461 | 3300046517 | Bacteria | 12824 |
| 565 | Ga0495630_0154107 | 3300046517 | Bacteria | 1749 |
| 566 | Ga0495630_0284226 | 3300046517 | Bacteria | 1264 |
| 567 | Ga0495631_0022562 | 3300046518 | Bacteria | 2926 |
| 568 | Ga0495666_0000587 | 3300046526 | Bacteria | 16270 |
| 569 | Ga0495666_0001571 | 3300046526 | Bacteria | 11239 |
| 570 | Ga0495652_0000013 | 3300046529 | Bacteria | 238164 |
| 571 | Ga0495652_0003007 | 3300046529 | Bacteria | 16913 |
| 572 | Ga0495652_0021496 | 3300046529 | Bacteria | 5735 |
| 573 | Ga0495652_0062438 | 3300046529 | Bacteria | 3141 |
| 574 | Ga0495652_0119182 | 3300046529 | Bacteria | 2108 |
| 575 | Ga0495652_0214104 | 3300046529 | Bacteria | 1452 |
| 576 | Ga0495665_0003481 | 3300046531 | Bacteria | 8547 |
| 577 | Ga0495665_0005814 | 3300046531 | Bacteria | 6654 |
| 578 | Ga0495640_0001550 | 3300046533 | Bacteria | 18099 |
| 579 | Ga0495640_0077283 | 3300046533 | Bacteria | 2219 |
| 580 | Ga0495586_0024228 | 3300046535 | Bacteria | 3242 |
| 581 | Ga0495586_0032966 | 3300046535 | Bacteria | 2779 |
| 582 | Ga0495586_0191857 | 3300046535 | Bacteria | 1157 |
| 583 | Ga0495587_0000014 | 3300046536 | Bacteria | 192100 |
| 584 | Ga0495587_0001222 | 3300046536 | Bacteria | 16991 |
| 585 | Ga0495587_0004895 | 3300046536 | Bacteria | 8782 |
| 586 | Ga0495587_0030451 | 3300046536 | Bacteria | 3272 |
| 587 | Ga0495587_0068648 | 3300046536 | Bacteria | 2064 |
| 588 | Ga0495587_0268481 | 3300046536 | Bacteria | 957 |
| 589 | Ga0495597_0063195 | 3300046542 | Bacteria | 1609 |
| 590 | Ga0495645_0010064 | 3300046543 | Bacteria | 6625 |
| 591 | Ga0495645_0054136 | 3300046543 | Bacteria | 2916 |
| 592 | Ga0495645_0099184 | 3300046543 | Bacteria | 2073 |
| 593 | Ga0495645_0200787 | 3300046543 | Bacteria | 1353 |
| 594 | Ga0495645_0225925 | 3300046543 | Bacteria | 1256 |
| 595 | Ga0495622_0001625 | 3300046557 | Bacteria | 11092 |
| 596 | Ga0495667_0000014 | 3300046559 | Bacteria | 200767 |
| 597 | Ga0495667_0001583 | 3300046559 | Bacteria | 15111 |
| 598 | Ga0495667_0002840 | 3300046559 | Bacteria | 11580 |
| 599 | Ga0495667_0004627 | 3300046559 | Bacteria | 9301 |
| 600 | Ga0495667_0096230 | 3300046559 | Bacteria | 1916 |
| 601 | Ga0495667_0109181 | 3300046559 | Bacteria | 1787 |
| 602 | Ga0495656_0165988 | 3300046615 | Bacteria | 1076 |
| 603 | Ga0495668_0006862 | 3300046616 | Bacteria | 7381 |
| 604 | Ga0495634_0015156 | 3300046642 | Bacteria | 5541 |
| 605 | Ga0495634_0020643 | 3300046642 | Bacteria | 4668 |
| 606 | Ga0495634_0102267 | 3300046642 | Bacteria | 1850 |
| 607 | Ga0495625_0005158 | 3300046660 | Bacteria | 12053 |
| 608 | Ga0495635_0002971 | 3300046663 | Bacteria | 11634 |
| 609 | Ga0495635_0009654 | 3300046663 | Bacteria | 6747 |
| 610 | Ga0495635_0032021 | 3300046663 | Bacteria | 3649 |
| 611 | Ga0495635_0040666 | 3300046663 | Bacteria | 3213 |
| 612 | Ga0495635_0062708 | 3300046663 | Bacteria | 2553 |
| 613 | Ga0495635_0115917 | 3300046663 | Bacteria | 1828 |
| 614 | Ga0495588_0049698 | 3300046674 | Bacteria | 2157 |
| 615 | Ga0495657_0000012 | 3300046675 | Bacteria | 197154 |
| 616 | Ga0495657_0002083 | 3300046675 | Bacteria | 16990 |
| 617 | Ga0495657_0002488 | 3300046675 | Bacteria | 15491 |
| 618 | Ga0495657_0007964 | 3300046675 | Bacteria | 8122 |
| 619 | Ga0495657_0044769 | 3300046675 | Bacteria | 3008 |
| 620 | Ga0495599_0000071 | 3300046678 | Bacteria | 70833 |
| 621 | Ga0495599_0001462 | 3300046678 | Bacteria | 13570 |
| 622 | Ga0495599_0003420 | 3300046678 | Bacteria | 9288 |
| 623 | Ga0495599_0040865 | 3300046678 | Bacteria | 2912 |
| 624 | Ga0495599_0075304 | 3300046678 | Bacteria | 2107 |
| 625 | Ga0495599_0088226 | 3300046678 | Bacteria | 1936 |
| 626 | Ga0495599_0099750 | 3300046678 | Bacteria | 1810 |
| 627 | Ga0495623_0000066 | 3300046679 | Bacteria | 64935 |
| 628 | Ga0495623_0009736 | 3300046679 | Bacteria | 6237 |
| 629 | Ga0495623_0020840 | 3300046679 | Bacteria | 4237 |
| 630 | Ga0495623_0035880 | 3300046679 | Bacteria | 3177 |
| 631 | Ga0495623_0209598 | 3300046679 | Bacteria | 1116 |
| 632 | Ga0495646_0002179 | 3300046680 | Bacteria | 11931 |
| 633 | Ga0495646_0010588 | 3300046680 | Bacteria | 5859 |
| 634 | Ga0495646_0013612 | 3300046680 | Bacteria | 5170 |
| 635 | Ga0495646_0051900 | 3300046680 | Bacteria | 2480 |
| 636 | Ga0495646_0073924 | 3300046680 | Bacteria | 2002 |
| 637 | Ga0495646_0082200 | 3300046680 | Bacteria | 1874 |
| 638 | Ga0495646_0180353 | 3300046680 | Bacteria | 1159 |
| 639 | Ga0495647_0008098 | 3300046681 | Bacteria | 3532 |
| 640 | Ga0495658_0001467 | 3300046683 | Bacteria | 12419 |
| 641 | Ga0495658_0025839 | 3300046683 | Bacteria | 3143 |
| 642 | Ga0495658_0026533 | 3300046683 | Bacteria | 3106 |
| 643 | Ga0495658_0238336 | 3300046683 | Bacteria | 1142 |
| 644 | Ga0495658_0263171 | 3300046683 | Bacteria | 1086 |
| 645 | Ga0495613_0001226 | 3300046689 | Bacteria | 19608 |
| 646 | Ga0495613_0018971 | 3300046689 | Bacteria | 5124 |
| 647 | Ga0495613_0048343 | 3300046689 | Bacteria | 3141 |
| 648 | Ga0495613_0117004 | 3300046689 | Bacteria | 1917 |
| 649 | Ga0495613_0150575 | 3300046689 | Bacteria | 1659 |
| 650 | Ga0495624_0024307 | 3300046690 | Bacteria | 3987 |
| 651 | Ga0495624_0063452 | 3300046690 | Bacteria | 2309 |
| 652 | Ga0495624_0090033 | 3300046690 | Bacteria | 1893 |
| 653 | Ga0495624_0096144 | 3300046690 | Bacteria | 1825 |
| 654 | Ga0495624_0179061 | 3300046690 | Bacteria | 1292 |
| 655 | Ga0495670_0163212 | 3300046691 | Bacteria | 1171 |
| 656 | Ga0495600_0011397 | 3300046809 | Bacteria | 5537 |
| 657 | Ga0495600_0013523 | 3300046809 | Bacteria | 5131 |
| 658 | Ga0495600_0034947 | 3300046809 | Bacteria | 3263 |
| 659 | Ga0495600_0042054 | 3300046809 | Bacteria | 2978 |
| 660 | Ga0495600_0054273 | 3300046809 | Bacteria | 2617 |
| 661 | Ga0495600_0084208 | 3300046809 | Bacteria | 2075 |
| 662 | Ga0495600_0188913 | 3300046809 | Bacteria | 1325 |
| 663 | Ga0495660_0001825 | 3300046810 | Bacteria | 13981 |
| 664 | Ga0495581_0001384 | 3300047315 | Bacteria | 13413 |
| 665 | Ga0495581_0035219 | 3300047315 | Bacteria | 2896 |
| 666 | Ga0495581_0052815 | 3300047315 | Bacteria | 2348 |
| 667 | Ga0495604_0000054 | 3300047317 | Bacteria | 101084 |
| 668 | Ga0495604_0001896 | 3300047317 | Bacteria | 16984 |
| 669 | Ga0495604_0004151 | 3300047317 | Bacteria | 11503 |
| 670 | Ga0495604_0047486 | 3300047317 | Bacteria | 3343 |
| 671 | Ga0495604_0265760 | 3300047317 | Bacteria | 1164 |
| 672 | Ga0495674_0005276 | 3300047319 | Bacteria | 12391 |
| 673 | Ga0495674_0059826 | 3300047319 | Bacteria | 3326 |
| 674 | Ga0495674_0158922 | 3300047319 | Bacteria | 1891 |
| 675 | Ga0495676_0009620 | 3300047321 | Bacteria | 8796 |
| 676 | Ga0495676_0052211 | 3300047321 | Bacteria | 3264 |
| 677 | Ga0495676_0102103 | 3300047321 | Bacteria | 2120 |
| 678 | Ga0495676_0181609 | 3300047321 | Bacteria | 1474 |
| 679 | Ga0495680_0000003 | 3300047322 | Bacteria | 172246 |
| 680 | Ga0495680_0002973 | 3300047322 | Bacteria | 16946 |
| 681 | Ga0495680_0007615 | 3300047322 | Bacteria | 9897 |
| 682 | Ga0495680_0023739 | 3300047322 | Bacteria | 5096 |
| 683 | Ga0495680_0032570 | 3300047322 | Bacteria | 4228 |
| 684 | Ga0495680_0045187 | 3300047322 | Bacteria | 3478 |
| 685 | Ga0495680_0052617 | 3300047322 | Bacteria | 3173 |
| 686 | Ga0495683_0004421 | 3300047323 | Bacteria | 7981 |
| 687 | Ga0495675_0000406 | 3300047444 | Bacteria | 29682 |
| 688 | Ga0495675_0001024 | 3300047444 | Bacteria | 16977 |
| 689 | Ga0495675_0019329 | 3300047444 | Bacteria | 4326 |
| 690 | Ga0495675_0204279 | 3300047444 | Bacteria | 1201 |
| 691 | Ga0495685_010177 | 3300047447 | Bacteria | 3152 |
| 692 | Ga0495685_020744 | 3300047447 | Bacteria | 2259 |
| 693 | Ga0495684_0040840 | 3300047471 | Bacteria | 3555 |
| 694 | Ga0495684_0047171 | 3300047471 | Bacteria | 3295 |
| 695 | Ga0495684_0060711 | 3300047471 | Bacteria | 2877 |
| 696 | Ga0495686_0235339 | 3300047472 | Bacteria | 1035 |
| 697 | Ga0495593_0001170 | 3300047673 | Bacteria | 15332 |
| 698 | Ga0495593_0003493 | 3300047673 | Bacteria | 9405 |
| 699 | Ga0495602_0000014 | 3300048088 | Bacteria | 193335 |
| 700 | Ga0495602_0003146 | 3300048088 | Bacteria | 16991 |
| 701 | Ga0495602_0008563 | 3300048088 | Bacteria | 10683 |
| 702 | Ga0495602_0113889 | 3300048088 | Bacteria | 2191 |
| 703 | Ga0495602_0186852 | 3300048088 | Bacteria | 1592 |
| 704 | Ga0495614_0000979 | 3300048089 | Bacteria | 12148 |
| 705 | Ga0495614_0013002 | 3300048089 | Bacteria | 3649 |
| 706 | Ga0495614_0016302 | 3300048089 | Bacteria | 3235 |
| 707 | Ga0495614_0026085 | 3300048089 | Bacteria | 2518 |
| 708 | Ga0495626_0077053 | 3300048091 | Bacteria | 1487 |
| 709 | Ga0496100_0034092 | 3300048903 | Bacteria | 3191 |
| 710 | Ga0496101_0038896 | 3300048904 | Bacteria | 3380 |
| 711 | Ga0496101_0044109 | 3300048904 | Bacteria | 3190 |
| 712 | Ga0496101_0335949 | 3300048904 | Bacteria | 1186 |
| 713 | Ga0496102_0110247 | 3300048905 | Bacteria | 2565 |
| 714 | Ga0496102_0244036 | 3300048905 | Bacteria | 1694 |
| 715 | Ga0496102_0292353 | 3300048905 | Bacteria | 1536 |
| 716 | Ga0496104_0000722 | 3300048907 | Bacteria | 28422 |
| 717 | Ga0496104_0020574 | 3300048907 | Bacteria | 6050 |
| 718 | Ga0496104_0021280 | 3300048907 | Bacteria | 5952 |
| 719 | Ga0496104_0108427 | 3300048907 | Bacteria | 2661 |
| 720 | Ga0496104_0109429 | 3300048907 | Bacteria | 2648 |
| 721 | Ga0496104_0416754 | 3300048907 | Bacteria | 1255 |
| 722 | Ga0496105_0023370 | 3300048908 | Bacteria | 5012 |
| 723 | Ga0496105_0050944 | 3300048908 | Bacteria | 3421 |
| 724 | Ga0496105_0072964 | 3300048908 | Bacteria | 2836 |
| 725 | Ga0496105_0361653 | 3300048908 | Bacteria | 1158 |
| 726 | Ga0496105_0555171 | 3300048908 | Bacteria | 896 |
| 727 | Ga0496107_0143703 | 3300048910 | Bacteria | 1764 |
| 728 | Ga0496108_0005257 | 3300048911 | Bacteria | 10456 |
| 729 | Ga0496108_0022746 | 3300048911 | Bacteria | 5156 |
| 730 | Ga0496108_0039119 | 3300048911 | Bacteria | 3953 |
| 731 | Ga0496108_0544960 | 3300048911 | Bacteria | 1012 |
| 732 | Ga0496109_0003779 | 3300048912 | Bacteria | 12640 |
| 733 | Ga0496109_0005143 | 3300048912 | Bacteria | 10918 |
| 734 | Ga0496109_0019319 | 3300048912 | Bacteria | 6005 |
| 735 | Ga0496109_0032477 | 3300048912 | Bacteria | 4692 |
| 736 | Ga0496109_0087190 | 3300048912 | Bacteria | 2883 |
| 737 | Ga0496109_0128552 | 3300048912 | Bacteria | 2364 |
| 738 | Ga0496109_0243426 | 3300048912 | Bacteria | 1693 |
| 739 | Ga0496109_0258151 | 3300048912 | Bacteria | 1641 |
| 740 | Ga0496109_0363850 | 3300048912 | Bacteria | 1366 |
| 741 | Ga0496110_0010416 | 3300048913 | Bacteria | 7559 |
| 742 | Ga0496110_0028189 | 3300048913 | Bacteria | 4820 |
| 743 | Ga0496110_0051691 | 3300048913 | Bacteria | 3611 |
| 744 | Ga0496110_0109059 | 3300048913 | Bacteria | 2486 |
| 745 | Ga0496110_0378805 | 3300048913 | Bacteria | 1289 |
| 746 | Ga0496111_0002767 | 3300048914 | Bacteria | 10671 |
| 747 | Ga0496111_0031532 | 3300048914 | Bacteria | 3776 |
| 748 | Ga0496112_0070761 | 3300048915 | Bacteria | 3448 |
| 749 | Ga0496112_0083395 | 3300048915 | Bacteria | 3161 |
| 750 | Ga0496112_0378567 | 3300048915 | Bacteria | 1356 |
| 751 | Ga0496112_0544230 | 3300048915 | Bacteria | 1095 |
| 752 | Ga0496113_0006089 | 3300048916 | Bacteria | 7607 |
| 753 | Ga0496113_0095449 | 3300048916 | Bacteria | 2298 |
| 754 | Ga0496114_0011659 | 3300048917 | Bacteria | 7031 |
| 755 | Ga0496114_0013605 | 3300048917 | Bacteria | 6525 |
| 756 | Ga0496114_0061195 | 3300048917 | Bacteria | 3148 |
| 757 | Ga0496114_0069477 | 3300048917 | Bacteria | 2958 |
| 758 | Ga0496114_0199626 | 3300048917 | Bacteria | 1752 |
| 759 | Ga0496114_0319993 | 3300048917 | Bacteria | 1371 |
| 760 | Ga0496114_0345250 | 3300048917 | Bacteria | 1316 |
| 761 | Ga0496115_0154469 | 3300048918 | Bacteria | 1895 |
| 762 | Ga0496115_0229223 | 3300048918 | Bacteria | 1532 |
| 763 | Ga0496125_0000074 | 3300048928 | Bacteria | 235549 |
| 764 | Ga0501031_0005785 | 3300049568 | Bacteria | 8057 |
| 765 | Ga0501031_0024185 | 3300049568 | Bacteria | 3960 |
| 766 | Ga0501031_0035251 | 3300049568 | Bacteria | 3264 |
| 767 | Ga0501031_0157707 | 3300049568 | Bacteria | 1483 |
| 768 | Ga0501032_0000108 | 3300049569 | Bacteria | 71059 |
| 769 | Ga0501032_0030399 | 3300049569 | Bacteria | 3706 |
| 770 | Ga0501032_0039674 | 3300049569 | Bacteria | 3202 |
| 771 | Ga0501032_0271987 | 3300049569 | Bacteria | 1098 |
| 772 | Ga0501033_0000164 | 3300049570 | Bacteria | 63459 |
| 773 | Ga0501033_0006788 | 3300049570 | Bacteria | 8936 |
| 774 | Ga0501033_0098336 | 3300049570 | Bacteria | 2137 |
| 775 | Ga0501033_0108179 | 3300049570 | Bacteria | 2025 |
| 776 | Ga0501033_0150222 | 3300049570 | Bacteria | 1681 |
| 777 | Ga0501033_0188427 | 3300049570 | Bacteria | 1477 |
| 778 | Ga0501034_0003397 | 3300049571 | Bacteria | 18185 |
| 779 | Ga0501034_0020392 | 3300049571 | Bacteria | 6767 |
| 780 | Ga0501036_0001671 | 3300049572 | Bacteria | 17198 |
| 781 | Ga0501036_0011171 | 3300049572 | Bacteria | 7430 |
| 782 | Ga0501036_0060563 | 3300049572 | Bacteria | 3207 |
| 783 | Ga0501036_0101931 | 3300049572 | Bacteria | 2428 |
| 784 | Ga0501036_0136008 | 3300049572 | Bacteria | 2074 |
| 785 | Ga0501036_0326930 | 3300049572 | Bacteria | 1281 |
| 786 | Ga0501037_0007348 | 3300049573 | Bacteria | 8057 |
| 787 | Ga0501037_0025622 | 3300049573 | Bacteria | 4357 |
| 788 | Ga0501037_0122721 | 3300049573 | Bacteria | 1867 |
| 789 | Ga0501037_0217418 | 3300049573 | Bacteria | 1345 |
| 790 | Ga0501037_0453959 | 3300049573 | Bacteria | 874 |
| 791 | Ga0501038_0000161 | 3300049574 | Bacteria | 57288 |
| 792 | Ga0501038_0002544 | 3300049574 | Bacteria | 16995 |
| 793 | Ga0501038_0003748 | 3300049574 | Bacteria | 14146 |
| 794 | Ga0501038_0005612 | 3300049574 | Bacteria | 11643 |
| 795 | Ga0501038_0012178 | 3300049574 | Bacteria | 7853 |
| 796 | Ga0501038_0039457 | 3300049574 | Bacteria | 4130 |
| 797 | Ga0501038_0221224 | 3300049574 | Bacteria | 1510 |
| 798 | Ga0501039_0001976 | 3300049575 | Bacteria | 15199 |
| 799 | Ga0501039_0009217 | 3300049575 | Bacteria | 7521 |
| 800 | Ga0501039_0014708 | 3300049575 | Bacteria | 5986 |
| 801 | Ga0501039_0036426 | 3300049575 | Bacteria | 3797 |
| 802 | Ga0501039_0232363 | 3300049575 | Bacteria | 1450 |
| 803 | Ga0501040_0001937 | 3300049576 | Bacteria | 13308 |
| 804 | Ga0501040_0004560 | 3300049576 | Bacteria | 8993 |
| 805 | Ga0501040_0016228 | 3300049576 | Bacteria | 4925 |
| 806 | Ga0501040_0035744 | 3300049576 | Bacteria | 3370 |
| 807 | Ga0501040_0046914 | 3300049576 | Bacteria | 2949 |
| 808 | Ga0501040_0130703 | 3300049576 | Bacteria | 1765 |
| 809 | Ga0501040_0215696 | 3300049576 | Bacteria | 1365 |
| 810 | Ga0501041_0004430 | 3300049577 | Bacteria | 8123 |
| 811 | Ga0501041_0070628 | 3300049577 | Bacteria | 2143 |
| 812 | Ga0501041_0166888 | 3300049577 | Bacteria | 1377 |
| 813 | Ga0501041_0253473 | 3300049577 | Bacteria | 1106 |
| 814 | Ga0501042_0006280 | 3300049578 | Bacteria | 7712 |
| 815 | Ga0501042_0106636 | 3300049578 | Bacteria | 2017 |
| 816 | Ga0501042_0185078 | 3300049578 | Bacteria | 1502 |
| 817 | Ga0501042_0333612 | 3300049578 | Bacteria | 1096 |
| 818 | Ga0501043_0000221 | 3300049579 | Bacteria | 51649 |
| 819 | Ga0501043_0005784 | 3300049579 | Bacteria | 9952 |
| 820 | Ga0501046_0000414 | 3300049580 | Bacteria | 42564 |
| 821 | Ga0501046_0000945 | 3300049580 | Bacteria | 28480 |
| 822 | Ga0501046_0031079 | 3300049580 | Bacteria | 4332 |
| 823 | Ga0501046_0037972 | 3300049580 | Bacteria | 3868 |
| 824 | Ga0501046_0095804 | 3300049580 | Bacteria | 2280 |
| 825 | Ga0501046_0098345 | 3300049580 | Bacteria | 2247 |
| 826 | Ga0501047_0004081 | 3300049581 | Bacteria | 13739 |
| 827 | Ga0501047_0013200 | 3300049581 | Bacteria | 7823 |
| 828 | Ga0501047_0029065 | 3300049581 | Bacteria | 5331 |
| 829 | Ga0501047_0102106 | 3300049581 | Bacteria | 2747 |
| 830 | Ga0501048_0000090 | 3300049582 | Bacteria | 48441 |
| 831 | Ga0501048_0001170 | 3300049582 | Bacteria | 19793 |
| 832 | Ga0501048_0015701 | 3300049582 | Bacteria | 5587 |
| 833 | Ga0501048_0016989 | 3300049582 | Bacteria | 5363 |
| 834 | Ga0501048_0082200 | 3300049582 | Bacteria | 2272 |
| 835 | Ga0501048_0095229 | 3300049582 | Bacteria | 2099 |
| 836 | Ga0501048_0112367 | 3300049582 | Bacteria | 1924 |
| 837 | Ga0501048_0159296 | 3300049582 | Bacteria | 1597 |
| 838 | Ga0501048_0266940 | 3300049582 | Bacteria | 1216 |
| 839 | Ga0501067_0009083 | 3300049583 | Bacteria | 5505 |
| 840 | Ga0501068_0079893 | 3300049584 | Bacteria | 2005 |
| 841 | Ga0501068_0131115 | 3300049584 | Bacteria | 1567 |
| 842 | Ga0501068_0350852 | 3300049584 | Bacteria | 948 |
| 843 | Ga0501068_0461702 | 3300049584 | Bacteria | 822 |
| 844 | Ga0501069_0001513 | 3300049585 | Bacteria | 11507 |
| 845 | Ga0501069_0052427 | 3300049585 | Bacteria | 2272 |
| 846 | Ga0501070_0001610 | 3300049586 | Bacteria | 20037 |
| 847 | Ga0501070_0002854 | 3300049586 | Bacteria | 15068 |
| 848 | Ga0501070_0126720 | 3300049586 | Bacteria | 2110 |
| 849 | Ga0501070_0154626 | 3300049586 | Bacteria | 1892 |
| 850 | Ga0501070_0199897 | 3300049586 | Bacteria | 1642 |
| 851 | Ga0501071_0025912 | 3300049587 | Bacteria | 4111 |
| 852 | Ga0501071_0116468 | 3300049587 | Bacteria | 1978 |
| 853 | Ga0501072_0014252 | 3300049588 | Bacteria | 6091 |
| 854 | Ga0501072_0016025 | 3300049588 | Bacteria | 5747 |
| 855 | Ga0501072_0033774 | 3300049588 | Bacteria | 4009 |
| 856 | Ga0501072_0078480 | 3300049588 | Bacteria | 2614 |
| 857 | Ga0501072_0209267 | 3300049588 | Bacteria | 1554 |
| 858 | Ga0501072_0285634 | 3300049588 | Bacteria | 1312 |
| 859 | Ga0501073_0462637 | 3300049589 | Bacteria | 877 |
| 860 | Ga0501074_0000924 | 3300049590 | Bacteria | 18846 |
| 861 | Ga0501074_0019890 | 3300049590 | Bacteria | 4876 |
| 862 | Ga0501074_0243016 | 3300049590 | Bacteria | 1280 |
| 863 | Ga0501074_0343933 | 3300049590 | Bacteria | 1059 |
| 864 | Ga0501075_0000524 | 3300049591 | Bacteria | 23176 |
| 865 | Ga0501075_0004638 | 3300049591 | Bacteria | 9326 |
| 866 | Ga0501075_0011861 | 3300049591 | Bacteria | 6182 |
| 867 | Ga0501075_0032259 | 3300049591 | Bacteria | 3891 |
| 868 | Ga0501075_0059596 | 3300049591 | Bacteria | 2876 |
| 869 | Ga0501075_0338034 | 3300049591 | Bacteria | 1147 |
| 870 | Ga0501075_0428980 | 3300049591 | Bacteria | 1008 |
| 871 | Ga0501076_0006666 | 3300049592 | Bacteria | 8376 |
| 872 | Ga0501076_0015358 | 3300049592 | Bacteria | 5786 |
| 873 | Ga0501076_0022716 | 3300049592 | Bacteria | 4823 |
| 874 | Ga0501076_0036830 | 3300049592 | Bacteria | 3835 |
| 875 | Ga0501076_0162526 | 3300049592 | Bacteria | 1819 |
| 876 | Ga0501076_0270765 | 3300049592 | Bacteria | 1391 |
| 877 | Ga0501077_0002491 | 3300049593 | Bacteria | 11029 |
| 878 | Ga0501077_0019315 | 3300049593 | Bacteria | 4310 |
| 879 | Ga0501077_0103918 | 3300049593 | Bacteria | 1800 |
| 880 | Ga0501077_0119163 | 3300049593 | Bacteria | 1672 |
| 881 | Ga0501077_0308238 | 3300049593 | Bacteria | 1009 |
| 882 | Ga0501079_0043610 | 3300049741 | Bacteria | 3462 |
| 883 | Ga0501079_0044397 | 3300049741 | Bacteria | 3430 |
| 884 | Ga0501079_0115151 | 3300049741 | Bacteria | 2090 |
| 885 | Ga0501079_0192763 | 3300049741 | Bacteria | 1591 |
| 886 | Ga0501080_0094830 | 3300049742 | Bacteria | 2771 |
| 887 | Ga0501080_0167277 | 3300049742 | Bacteria | 2029 |
| 888 | Ga0501080_0295822 | 3300049742 | Bacteria | 1469 |
| 889 | Ga0501080_0878481 | 3300049742 | Bacteria | 782 |
| 890 | Ga0501081_0003946 | 3300049743 | Bacteria | 9505 |
| 891 | Ga0501081_0021613 | 3300049743 | Bacteria | 4294 |
| 892 | Ga0501081_0022951 | 3300049743 | Bacteria | 4178 |
| 893 | Ga0501081_0026133 | 3300049743 | Bacteria | 3933 |
| 894 | Ga0501081_0229248 | 3300049743 | Bacteria | 1352 |
| 895 | Ga0501081_0231687 | 3300049743 | Bacteria | 1345 |
| 896 | Ga0501081_0350997 | 3300049743 | Bacteria | 1087 |
| 897 | Ga0501083_0003637 | 3300049744 | Bacteria | 10825 |
| 898 | Ga0501083_0022502 | 3300049744 | Bacteria | 4373 |
| 899 | Ga0501083_0123613 | 3300049744 | Bacteria | 1697 |
| 900 | Ga0501083_0282246 | 3300049744 | Bacteria | 1080 |
| 901 | Ga0501035_0003384 | 3300049822 | Bacteria | 15258 |
| 902 | Ga0501035_0006634 | 3300049822 | Bacteria | 10832 |
| 903 | Ga0501035_0049015 | 3300049822 | Bacteria | 3786 |
| 904 | Ga0501035_0168317 | 3300049822 | Bacteria | 1894 |
| 905 | Ga0501035_0185937 | 3300049822 | Bacteria | 1788 |
| 906 | Ga0501035_0192746 | 3300049822 | Bacteria | 1752 |
| 907 | Ga0501044_0004084 | 3300049823 | Bacteria | 16368 |
| 908 | Ga0501044_0035518 | 3300049823 | Bacteria | 5219 |
| 909 | Ga0501044_0109515 | 3300049823 | Bacteria | 2771 |
| 910 | Ga0501044_0148916 | 3300049823 | Bacteria | 2324 |
| 911 | Ga0501044_0312515 | 3300049823 | Bacteria | 1497 |
| 912 | Ga0501045_0000342 | 3300049824 | Bacteria | 27580 |
| 913 | Ga0501045_0007152 | 3300049824 | Bacteria | 7742 |
| 914 | Ga0501045_0011600 | 3300049824 | Bacteria | 6190 |
| 915 | Ga0501045_0012748 | 3300049824 | Bacteria | 5922 |
| 916 | Ga0501045_0082664 | 3300049824 | Bacteria | 2368 |
| 917 | Ga0501045_0378105 | 3300049824 | Bacteria | 1054 |
| 918 | nmdc:mga06z11_36123_c1 | 3300050494 | Bacteria | 2437 |
| 919 | nmdc:mga04h51_1057_c1 | 3300050495 | Bacteria | 6337 |
| 920 | nmdc:mga05p37_2109_c1 | 3300050507 | Bacteria | 23230 |
| 921 | nmdc:mga05p37_302572_c1 | 3300050507 | Bacteria | 1899 |
| 922 | nmdc:mga05p37_42056_c1 | 3300050507 | Bacteria | 5614 |
| 923 | nmdc:mga05p37_46934_c1 | 3300050507 | Bacteria | 5312 |
| 924 | nmdc:mga05p37_550379_c1 | 3300050507 | Bacteria | 1314 |
| 925 | nmdc:mga05p37_705347_c1 | 3300050507 | Bacteria | 1120 |
| 926 | nmdc:mga05p37_854937_c1 | 3300050507 | Bacteria | 987 |
| 927 | nmdc:mga09592_1_c1 | 3300050508 | Bacteria | 201102 |
| 928 | nmdc:mga09592_436536_c1 | 3300050508 | Bacteria | 1130 |
| 929 | nmdc:mga09592_55171_c1 | 3300050508 | Bacteria | 3358 |
| 930 | nmdc:mga09592_60941_c1 | 3300050508 | Bacteria | 3191 |
| 931 | nmdc:mga0qj67_12_c3 | 3300050509 | Bacteria | 26384 |
| 932 | nmdc:mga0qj67_37339_c1 | 3300050509 | Bacteria | 3805 |
| 933 | nmdc:mga0qj67_6956_c1 | 3300050509 | Bacteria | 8328 |
| 934 | nmdc:mga0qj67_74946_c1 | 3300050509 | Bacteria | 2704 |
| 935 | nmdc:mga06r32_18140_c1 | 3300050510 | Bacteria | 6438 |
| 936 | nmdc:mga06r32_5652_c1 | 3300050510 | Bacteria | 3737 |
| 937 | nmdc:mga06r32_69469_c1 | 3300050510 | Bacteria | 3405 |
| 938 | nmdc:mga06r32_7_c1 | 3300050510 | Bacteria | 117700 |
| 939 | nmdc:mga08y16_488186_c1 | 3300050511 | Bacteria | 1253 |
| 940 | nmdc:mga08y16_59203_c1 | 3300050511 | Bacteria | 4002 |
| 941 | nmdc:mga08y16_611392_c1 | 3300050511 | Bacteria | 1098 |
| 942 | nmdc:mga0n895_149698_c1 | 3300050512 | Bacteria | 2364 |
| 943 | nmdc:mga0n895_52613_c1 | 3300050512 | Bacteria | 3998 |
| 944 | nmdc:mga0rr50_4547_c1 | 3300050513 | Bacteria | 8164 |
| 945 | nmdc:mga08x19_3216_c1 | 3300050514 | Bacteria | 9794 |
| 946 | nmdc:mga08x19_35671_c1 | 3300050514 | Bacteria | 3147 |
| 947 | nmdc:mga0a205_415971_c1 | 3300050515 | Bacteria | 1207 |
| 948 | nmdc:mga0a205_51398_c1 | 3300050515 | Bacteria | 3979 |
| 949 | nmdc:mga0a205_9843_c1 | 3300050515 | Bacteria | 8770 |
| 950 | Ga0495601_0018762 | 3300053077 | Bacteria | 4211 |
| 951 | Ga0495601_0082731 | 3300053077 | Bacteria | 2061 |
| 952 | Ga0495601_0119368 | 3300053077 | Bacteria | 1712 |
| 953 | Ga0495601_0243095 | 3300053077 | Bacteria | 1175 |
| 954 | Ga0495612_0064256 | 3300053078 | Bacteria | 1523 |
| 955 | Ga0495612_0093363 | 3300053078 | Bacteria | 1276 |
| 956 | Ga0495595_0008912 | 3300053084 | Bacteria | 4134 |
| 957 | Ga0495595_0021864 | 3300053084 | Bacteria | 2800 |
| 958 | Ga0495595_0025606 | 3300053084 | Bacteria | 2616 |
| 959 | Ga0495595_0039792 | 3300053084 | Bacteria | 2146 |
| 960 | Ga0495619_0032529 | 3300053085 | Bacteria | 3385 |
| 961 | Ga0495619_0033910 | 3300053085 | Bacteria | 3316 |
| 962 | Ga0495619_0049148 | 3300053085 | Bacteria | 2781 |
| 963 | Ga0495619_0218074 | 3300053085 | Bacteria | 1321 |
| 964 | Ga0495619_0263873 | 3300053085 | Bacteria | 1193 |
| 965 | Ga0495619_0287562 | 3300053085 | Bacteria | 1139 |
| 966 | Ga0500616_0003740 | 3300053153 | Bacteria | 11351 |
| 967 | Ga0501084_0006421 | 3300054114 | Bacteria | 9665 |
| 968 | Ga0501084_0016597 | 3300054114 | Bacteria | 6114 |
| 969 | Ga0501084_0019434 | 3300054114 | Bacteria | 5660 |
| 970 | Ga0501084_0025101 | 3300054114 | Bacteria | 4972 |
| 971 | Ga0501084_0064260 | 3300054114 | Bacteria | 3072 |
| 972 | Ga0501082_0001187 | 3300060353 | Bacteria | 22887 |
| 973 | Ga0501082_0014400 | 3300060353 | Bacteria | 6806 |
| 974 | Ga0501082_0016828 | 3300060353 | Bacteria | 6296 |
| 975 | Ga0501082_0024223 | 3300060353 | Bacteria | 5233 |
| 976 | Ga0501082_0030043 | 3300060353 | Bacteria | 4682 |
| 977 | Ga0501082_0031215 | 3300060353 | Bacteria | 4593 |
| 978 | Ga0501082_0084054 | 3300060353 | Bacteria | 2746 |
| 979 | Ga0530510_0001247 | 3300061734 | Bacteria | 16980 |
| 980 | Ga0530510_0018086 | 3300061734 | Bacteria | 4996 |
| 981 | Ga0530510_0046592 | 3300061734 | Bacteria | 3132 |
| 982 | Ga0530510_0108722 | 3300061734 | Bacteria | 2030 |
| 983 | Ga0530510_0128935 | 3300061734 | Bacteria | 1860 |
| 984 | Ga0530510_0220798 | 3300061734 | Bacteria | 1408 |
| 985 | Ga0530510_0300213 | 3300061734 | Bacteria | 1202 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005981 | Ga0081538_10027367 | Ga0081538_100273674 | 203 |
| 2 | 3300046690 | Ga0495624_0179061 | Ga0495624_0179061_440_1192 | 209 |
| 3 | 3300049573 | Ga0501037_0217418 | Ga0501037_0217418_663_1295 | 210 |
| 4 | 3300046462 | Ga0495651_0168540 | Ga0495651_0168540_773_1417 | 211 |
| 5 | 3300046543 | Ga0495645_0200787 | Ga0495645_0200787_119_763 | 211 |
| 6 | 3300025899 | Ga0207642_10122093 | Ga0207642_101220932 | 215 |
| 7 | 3300025931 | Ga0207644_10439478 | Ga0207644_104394782 | 225 |
| 8 | 3300049586 | Ga0501070_0126720 | Ga0501070_0126720_903_1682 | 225 |
| 9 | 3300049822 | Ga0501035_0192746 | Ga0501035_0192746_538_1317 | 225 |
| 10 | 3300020080 | Ga0206350_11291229 | Ga0206350_112912291 | 227 |
| 11 | 3300048912 | Ga0496109_0243426 | Ga0496109_0243426_166_882 | 227 |
| 12 | 3300050510 | nmdc:mga06r32_5652_c1 | nmdc:mga06r32_5652_c1_1321_2133 | 228 |
| 13 | 3300042005 | Ga0439448_0009788 | Ga0439448_0009788_1364_2062 | 229 |
| 14 | 3300042008 | Ga0439450_002169 | Ga0439450_002169_1493_2191 | 229 |
| 15 | 3300042439 | Ga0439464_0010275 | Ga0439464_0010275_1405_2103 | 229 |
| 16 | 3300035089 | Ga0373944_0006609 | Ga0373944_0006609_1542_2354 | 230 |
| 17 | 3300035111 | Ga0373923_0013805 | Ga0373923_0013805_596_1408 | 230 |
| 18 | 3300035116 | Ga0373945_0000406 | Ga0373945_0000406_1902_2714 | 230 |
| 19 | 3300035117 | Ga0373953_0046096 | Ga0373953_0046096_232_1044 | 230 |
| 20 | 3300035118 | Ga0373954_0012652 | Ga0373954_0012652_1279_2091 | 230 |
| 21 | 3300035120 | Ga0373957_0013534 | Ga0373957_0013534_884_1696 | 230 |
| 22 | 3300035170 | Ga0373943_0002294 | Ga0373943_0002294_6171_6983 | 230 |
| 23 | 3300035171 | Ga0373946_0004299 | Ga0373946_0004299_2747_3559 | 230 |
| 24 | 3300035172 | Ga0373955_0003081 | Ga0373955_0003081_975_1787 | 230 |
| 25 | 3300035410 | Ga0373924_0022153 | Ga0373924_0022153_793_1605 | 230 |
| 26 | 3300035692 | Ga0373935_0024869 | Ga0373935_0024869_969_1781 | 230 |
| 27 | 3300035695 | Ga0373927_0001584 | Ga0373927_0001584_8893_9705 | 230 |
| 28 | 3300035724 | Ga0373933_0099988 | Ga0373933_0099988_230_1042 | 230 |
| 29 | 3300035725 | Ga0373947_0003709 | Ga0373947_0003709_3583_4395 | 230 |
| 30 | 3300036401 | Ga0373937_0080373 | Ga0373937_0080373_1775_2587 | 230 |
| 31 | 3300037068 | Ga0373925_0003875 | Ga0373925_0003875_1909_2721 | 230 |
| 32 | 3300046454 | Ga0495592_0002442 | Ga0495592_0002442_12063_12875 | 230 |
| 33 | 3300046455 | Ga0495603_0001819 | Ga0495603_0001819_1117_1929 | 230 |
| 34 | 3300046459 | Ga0495629_0001430 | Ga0495629_0001430_2090_2902 | 230 |
| 35 | 3300046461 | Ga0495641_0001557 | Ga0495641_0001557_12451_13263 | 230 |
| 36 | 3300046463 | Ga0495653_0096349 | Ga0495653_0096349_1143_1955 | 230 |
| 37 | 3300046472 | Ga0495580_0003337 | Ga0495580_0003337_10691_11503 | 230 |
| 38 | 3300046473 | Ga0495582_0000900 | Ga0495582_0000900_843_1655 | 230 |
| 39 | 3300046475 | Ga0495639_0004240 | Ga0495639_0004240_4537_5349 | 230 |
| 40 | 3300046476 | Ga0495662_0002002 | Ga0495662_0002002_3277_4089 | 230 |
| 41 | 3300046477 | Ga0495664_0050545 | Ga0495664_0050545_195_1007 | 230 |
| 42 | 3300046499 | Ga0495594_0003058 | Ga0495594_0003058_6886_7698 | 230 |
| 43 | 3300046511 | Ga0495608_0012462 | Ga0495608_0012462_4228_5040 | 230 |
| 44 | 3300046514 | Ga0495618_0047943 | Ga0495618_0047943_696_1508 | 230 |
| 45 | 3300046516 | Ga0495628_0017377 | Ga0495628_0017377_4047_4859 | 230 |
| 46 | 3300046517 | Ga0495630_0002461 | Ga0495630_0002461_804_1616 | 230 |
| 47 | 3300046526 | Ga0495666_0000587 | Ga0495666_0000587_4626_5438 | 230 |
| 48 | 3300046529 | Ga0495652_0062438 | Ga0495652_0062438_704_1516 | 230 |
| 49 | 3300046531 | Ga0495665_0003481 | Ga0495665_0003481_3199_4011 | 230 |
| 50 | 3300046533 | Ga0495640_0001550 | Ga0495640_0001550_1480_2292 | 230 |
| 51 | 3300046535 | Ga0495586_0024228 | Ga0495586_0024228_901_1713 | 230 |
| 52 | 3300046559 | Ga0495667_0002840 | Ga0495667_0002840_10428_11240 | 230 |
| 53 | 3300046663 | Ga0495635_0009654 | Ga0495635_0009654_4047_4859 | 230 |
| 54 | 3300046678 | Ga0495599_0001462 | Ga0495599_0001462_10856_11668 | 230 |
| 55 | 3300046679 | Ga0495623_0009736 | Ga0495623_0009736_4901_5713 | 230 |
| 56 | 3300046680 | Ga0495646_0013612 | Ga0495646_0013612_2705_3517 | 230 |
| 57 | 3300046681 | Ga0495647_0008098 | Ga0495647_0008098_1130_1942 | 230 |
| 58 | 3300046683 | Ga0495658_0001467 | Ga0495658_0001467_2889_3701 | 230 |
| 59 | 3300046689 | Ga0495613_0018971 | Ga0495613_0018971_1280_2092 | 230 |
| 60 | 3300046690 | Ga0495624_0024307 | Ga0495624_0024307_830_1642 | 230 |
| 61 | 3300046809 | Ga0495600_0013523 | Ga0495600_0013523_300_1112 | 230 |
| 62 | 3300047315 | Ga0495581_0001384 | Ga0495581_0001384_10976_11788 | 230 |
| 63 | 3300047317 | Ga0495604_0047486 | Ga0495604_0047486_1044_1856 | 230 |
| 64 | 3300047319 | Ga0495674_0005276 | Ga0495674_0005276_1280_2092 | 230 |
| 65 | 3300047322 | Ga0495680_0045187 | Ga0495680_0045187_2208_3020 | 230 |
| 66 | 3300047444 | Ga0495675_0019329 | Ga0495675_0019329_2021_2833 | 230 |
| 67 | 3300047673 | Ga0495593_0001170 | Ga0495593_0001170_13497_14309 | 230 |
| 68 | 3300048088 | Ga0495602_0008563 | Ga0495602_0008563_4456_5268 | 230 |
| 69 | 3300048089 | Ga0495614_0013002 | Ga0495614_0013002_1728_2540 | 230 |
| 70 | 3300053084 | Ga0495595_0008912 | Ga0495595_0008912_2806_3618 | 230 |
| 71 | 3300053085 | Ga0495619_0033910 | Ga0495619_0033910_1909_2721 | 230 |
| 72 | 3300006846 | Ga0075430_100000755 | Ga0075430_10000075518 | 231 |
| 73 | 3300048915 | Ga0496112_0544230 | Ga0496112_0544230_31_786 | 231 |
| 74 | 3300048917 | Ga0496114_0319993 | Ga0496114_0319993_45_800 | 231 |
| 75 | 3300050509 | nmdc:mga0qj67_6956_c1 | nmdc:mga0qj67_6956_c1_7310_8164 | 231 |
| 76 | 3300025910 | Ga0207684_10354854 | Ga0207684_103548541 | 232 |
| 77 | 3300049823 | Ga0501044_0035518 | Ga0501044_0035518_2606_3346 | 232 |
| 78 | 3300005364 | Ga0070673_100049920 | Ga0070673_1000499204 | 233 |
| 79 | 3300005842 | Ga0068858_100000551 | Ga0068858_10000055113 | 233 |
| 80 | 3300009098 | Ga0105245_10350362 | Ga0105245_103503622 | 233 |
| 81 | 3300025927 | Ga0207687_10252510 | Ga0207687_102525101 | 233 |
| 82 | 3300025936 | Ga0207670_10002309 | Ga0207670_100023094 | 233 |
| 83 | 3300025960 | Ga0207651_10030130 | Ga0207651_100301304 | 233 |
| 84 | 3300026035 | Ga0207703_10000232 | Ga0207703_1000023238 | 233 |
| 85 | 3300049569 | Ga0501032_0039674 | Ga0501032_0039674_1699_2439 | 233 |
| 86 | 3300049572 | Ga0501036_0060563 | Ga0501036_0060563_1138_1878 | 233 |
| 87 | 3300049574 | Ga0501038_0002544 | Ga0501038_0002544_6895_7635 | 233 |
| 88 | 3300049580 | Ga0501046_0031079 | Ga0501046_0031079_1515_2255 | 233 |
| 89 | 3300049581 | Ga0501047_0029065 | Ga0501047_0029065_3290_4030 | 233 |
| 90 | 3300049744 | Ga0501083_0022502 | Ga0501083_0022502_485_1225 | 233 |
| 91 | 3300049822 | Ga0501035_0006634 | Ga0501035_0006634_4557_5297 | 233 |
| 92 | 3300060353 | Ga0501082_0016828 | Ga0501082_0016828_2606_3346 | 233 |
| 93 | 3300005518 | Ga0070699_100010943 | Ga0070699_1000109438 | 234 |
| 94 | 3300026121 | Ga0207683_10473150 | Ga0207683_104731502 | 234 |
| 95 | 3300037466 | Ga0395898_0086697 | Ga0395898_0086697_1575_2327 | 234 |
| 96 | 3300037471 | Ga0395905_0153750 | Ga0395905_0153750_936_1688 | 234 |
| 97 | 3300038443 | Ga0395901_0075388 | Ga0395901_0075388_634_1386 | 234 |
| 98 | 3300009094 | Ga0111539_10346858 | Ga0111539_103468582 | 235 |
| 99 | 3300049744 | Ga0501083_0123613 | Ga0501083_0123613_929_1669 | 235 |
| 100 | 3300005327 | Ga0070658_10431688 | Ga0070658_104316882 | 236 |
| 101 | 3300005719 | Ga0068861_100112996 | Ga0068861_1001129961 | 236 |
| 102 | 3300026118 | Ga0207675_100045735 | Ga0207675_1000457355 | 236 |
| 103 | 3300037466 | Ga0395898_0090933 | Ga0395898_0090933_23_748 | 236 |
| 104 | 3300037471 | Ga0395905_0338789 | Ga0395905_0338789_261_1022 | 236 |
| 105 | 3300046529 | Ga0495652_0214104 | Ga0495652_0214104_278_1090 | 236 |
| 106 | iso_pu_bacteria | 2643221690 | 2644505203 | 236 |
| 107 | 3300005329 | Ga0070683_100002447 | Ga0070683_10000244714 | 237 |
| 108 | 3300005435 | Ga0070714_100014534 | Ga0070714_1000145342 | 237 |
| 109 | 3300005445 | Ga0070708_100005830 | Ga0070708_1000058301 | 237 |
| 110 | 3300005535 | Ga0070684_100059444 | Ga0070684_1000594444 | 237 |
| 111 | 3300013105 | Ga0157369_10274812 | Ga0157369_102748122 | 237 |
| 112 | 3300020070 | Ga0206356_11150109 | Ga0206356_111501091 | 237 |
| 113 | 3300020082 | Ga0206353_10331881 | Ga0206353_103318812 | 237 |
| 114 | 3300025921 | Ga0207652_10116272 | Ga0207652_101162723 | 237 |
| 115 | 3300025929 | Ga0207664_10015632 | Ga0207664_100156322 | 237 |
| 116 | 3300025944 | Ga0207661_10036293 | Ga0207661_100362934 | 237 |
| 117 | 3300027512 | Ga0209179_1027653 | Ga0209179_10276531 | 237 |
| 118 | 3300035116 | Ga0373945_0100388 | Ga0373945_0100388_279_1076 | 237 |
| 119 | 3300037853 | Ga0436364_0162021 | Ga0436364_0162021_381_1244 | 238 |
| 120 | 3300049593 | Ga0501077_0103918 | Ga0501077_0103918_598_1335 | 238 |
| 121 | 3300049742 | Ga0501080_0878481 | Ga0501080_0878481_15_752 | 238 |
| 122 | iso_pu_bacteria | 2884994152 | 2884996714 | 238 |
| 123 | 3300005337 | Ga0070682_100193124 | Ga0070682_1001931242 | 239 |
| 124 | 3300005340 | Ga0070689_100206095 | Ga0070689_1002060952 | 239 |
| 125 | 3300005364 | Ga0070673_100201967 | Ga0070673_1002019673 | 239 |
| 126 | 3300005543 | Ga0070672_100155535 | Ga0070672_1001555353 | 239 |
| 127 | 3300005563 | Ga0068855_100010217 | Ga0068855_1000102174 | 239 |
| 128 | 3300005577 | Ga0068857_100624301 | Ga0068857_1006243012 | 239 |
| 129 | 3300005981 | Ga0081538_10031177 | Ga0081538_100311774 | 239 |
| 130 | 3300007788 | Ga0099795_10042866 | Ga0099795_100428662 | 239 |
| 131 | 3300013306 | Ga0163162_10085237 | Ga0163162_100852373 | 239 |
| 132 | 3300025901 | Ga0207688_10013197 | Ga0207688_100131972 | 239 |
| 133 | 3300025901 | Ga0207688_10014998 | Ga0207688_100149985 | 239 |
| 134 | 3300025927 | Ga0207687_10146681 | Ga0207687_101466813 | 239 |
| 135 | 3300025949 | Ga0207667_10025772 | Ga0207667_100257724 | 239 |
| 136 | 3300025960 | Ga0207651_10148042 | Ga0207651_101480422 | 239 |
| 137 | 3300025961 | Ga0207712_10205745 | Ga0207712_102057452 | 239 |
| 138 | 3300026116 | Ga0207674_10842922 | Ga0207674_108429222 | 239 |
| 139 | 3300026142 | Ga0207698_10383538 | Ga0207698_103835382 | 239 |
| 140 | 3300028379 | Ga0268266_10443857 | Ga0268266_104438571 | 239 |
| 141 | 3300031901 | Ga0307406_10296544 | Ga0307406_102965442 | 239 |
| 142 | 3300031911 | Ga0307412_10101515 | Ga0307412_101015152 | 239 |
| 143 | 3300032002 | Ga0307416_100019981 | Ga0307416_1000199814 | 239 |
| 144 | 3300035092 | Ga0373952_0061045 | Ga0373952_0061045_42_875 | 239 |
| 145 | 3300046492 | Ga0495585_0118674 | Ga0495585_0118674_181_924 | 239 |
| 146 | 3300046691 | Ga0495670_0163212 | Ga0495670_0163212_414_1157 | 239 |
| 147 | 3300048905 | Ga0496102_0244036 | Ga0496102_0244036_331_1152 | 239 |
| 148 | 3300049568 | Ga0501031_0157707 | Ga0501031_0157707_547_1290 | 239 |
| 149 | 3300049570 | Ga0501033_0098336 | Ga0501033_0098336_722_1465 | 239 |
| 150 | 3300049572 | Ga0501036_0136008 | Ga0501036_0136008_674_1417 | 239 |
| 151 | 3300049573 | Ga0501037_0453959 | Ga0501037_0453959_109_852 | 239 |
| 152 | 3300049574 | Ga0501038_0221224 | Ga0501038_0221224_212_955 | 239 |
| 153 | 3300049575 | Ga0501039_0036426 | Ga0501039_0036426_1038_1781 | 239 |
| 154 | 3300049576 | Ga0501040_0004560 | Ga0501040_0004560_3569_4312 | 239 |
| 155 | 3300049577 | Ga0501041_0070628 | Ga0501041_0070628_713_1456 | 239 |
| 156 | 3300049580 | Ga0501046_0037972 | Ga0501046_0037972_295_1038 | 239 |
| 157 | 3300049582 | Ga0501048_0095229 | Ga0501048_0095229_943_1686 | 239 |
| 158 | 3300049584 | Ga0501068_0131115 | Ga0501068_0131115_732_1475 | 239 |
| 159 | 3300049587 | Ga0501071_0025912 | Ga0501071_0025912_1019_1762 | 239 |
| 160 | 3300049588 | Ga0501072_0016025 | Ga0501072_0016025_4466_5209 | 239 |
| 161 | 3300049591 | Ga0501075_0011861 | Ga0501075_0011861_1410_2153 | 239 |
| 162 | 3300049591 | Ga0501075_0428980 | Ga0501075_0428980_192_935 | 239 |
| 163 | 3300049592 | Ga0501076_0162526 | Ga0501076_0162526_398_1141 | 239 |
| 164 | 3300049593 | Ga0501077_0019315 | Ga0501077_0019315_631_1374 | 239 |
| 165 | 3300049741 | Ga0501079_0043610 | Ga0501079_0043610_2007_2750 | 239 |
| 166 | 3300049743 | Ga0501081_0021613 | Ga0501081_0021613_1212_1955 | 239 |
| 167 | 3300049743 | Ga0501081_0229248 | Ga0501081_0229248_569_1312 | 239 |
| 168 | 3300049824 | Ga0501045_0082664 | Ga0501045_0082664_986_1729 | 239 |
| 169 | 3300049824 | Ga0501045_0378105 | Ga0501045_0378105_15_758 | 239 |
| 170 | 3300054114 | Ga0501084_0016597 | Ga0501084_0016597_690_1433 | 239 |
| 171 | 3300060353 | Ga0501082_0024223 | Ga0501082_0024223_1666_2409 | 239 |
| 172 | 3300061734 | Ga0530510_0220798 | Ga0530510_0220798_644_1387 | 239 |
| 173 | 3300005564 | Ga0070664_100084380 | Ga0070664_1000843802 | 240 |
| 174 | 3300006844 | Ga0075428_100008819 | Ga0075428_1000088195 | 240 |
| 175 | 3300006846 | Ga0075430_100006823 | Ga0075430_1000068238 | 240 |
| 176 | 3300006847 | Ga0075431_100077452 | Ga0075431_1000774524 | 240 |
| 177 | 3300006847 | Ga0075431_100444421 | Ga0075431_1004444212 | 240 |
| 178 | 3300006880 | Ga0075429_100000518 | Ga0075429_1000005184 | 240 |
| 179 | 3300009147 | Ga0114129_10000440 | Ga0114129_1000044013 | 240 |
| 180 | 3300009551 | Ga0105238_10456293 | Ga0105238_104562932 | 240 |
| 181 | 3300013307 | Ga0157372_10148994 | Ga0157372_101489944 | 240 |
| 182 | 3300026088 | Ga0207641_10406862 | Ga0207641_104068622 | 240 |
| 183 | 3300035113 | Ga0373936_0009126 | Ga0373936_0009126_334_1134 | 240 |
| 184 | 3300036401 | Ga0373937_0046021 | Ga0373937_0046021_2378_3178 | 240 |
| 185 | 3300046455 | Ga0495603_0072515 | Ga0495603_0072515_638_1387 | 240 |
| 186 | 3300046455 | Ga0495603_0141673 | Ga0495603_0141673_76_825 | 240 |
| 187 | 3300046462 | Ga0495651_0032072 | Ga0495651_0032072_815_1615 | 240 |
| 188 | 3300046463 | Ga0495653_0028649 | Ga0495653_0028649_340_1140 | 240 |
| 189 | 3300046559 | Ga0495667_0001583 | Ga0495667_0001583_2590_3390 | 240 |
| 190 | 3300046615 | Ga0495656_0165988 | Ga0495656_0165988_152_898 | 240 |
| 191 | 3300046663 | Ga0495635_0040666 | Ga0495635_0040666_2388_3188 | 240 |
| 192 | 3300046674 | Ga0495588_0049698 | Ga0495588_0049698_234_983 | 240 |
| 193 | 3300046683 | Ga0495658_0238336 | Ga0495658_0238336_143_949 | 240 |
| 194 | 3300046809 | Ga0495600_0084208 | Ga0495600_0084208_1256_2056 | 240 |
| 195 | 3300047322 | Ga0495680_0007615 | Ga0495680_0007615_6426_7226 | 240 |
| 196 | 3300047471 | Ga0495684_0040840 | Ga0495684_0040840_2620_3420 | 240 |
| 197 | 3300048905 | Ga0496102_0292353 | Ga0496102_0292353_42_848 | 240 |
| 198 | 3300048911 | Ga0496108_0544960 | Ga0496108_0544960_255_998 | 240 |
| 199 | 3300048912 | Ga0496109_0363850 | Ga0496109_0363850_138_944 | 240 |
| 200 | 3300048917 | Ga0496114_0199626 | Ga0496114_0199626_964_1704 | 240 |
| 201 | 3300049572 | Ga0501036_0326930 | Ga0501036_0326930_20_751 | 240 |
| 202 | 3300049577 | Ga0501041_0166888 | Ga0501041_0166888_343_1074 | 240 |
| 203 | 3300049578 | Ga0501042_0106636 | Ga0501042_0106636_475_1242 | 240 |
| 204 | 3300049578 | Ga0501042_0333612 | Ga0501042_0333612_214_981 | 240 |
| 205 | 3300049582 | Ga0501048_0159296 | Ga0501048_0159296_738_1505 | 240 |
| 206 | 3300049588 | Ga0501072_0033774 | Ga0501072_0033774_1971_2738 | 240 |
| 207 | 3300049588 | Ga0501072_0285634 | Ga0501072_0285634_122_889 | 240 |
| 208 | 3300049591 | Ga0501075_0338034 | Ga0501075_0338034_171_902 | 240 |
| 209 | 3300049592 | Ga0501076_0036830 | Ga0501076_0036830_2119_2886 | 240 |
| 210 | 3300049593 | Ga0501077_0308238 | Ga0501077_0308238_149_916 | 240 |
| 211 | 3300049741 | Ga0501079_0115151 | Ga0501079_0115151_74_805 | 240 |
| 212 | 3300049741 | Ga0501079_0192763 | Ga0501079_0192763_564_1331 | 240 |
| 213 | 3300049743 | Ga0501081_0350997 | Ga0501081_0350997_20_787 | 240 |
| 214 | 3300050507 | nmdc:mga05p37_2109_c1 | nmdc:mga05p37_2109_c1_9001_9765 | 240 |
| 215 | 3300050507 | nmdc:mga05p37_854937_c1 | nmdc:mga05p37_854937_c1_11_820 | 240 |
| 216 | 3300050508 | nmdc:mga09592_1_c1 | nmdc:mga09592_1_c1_70037_70801 | 240 |
| 217 | 3300050509 | nmdc:mga0qj67_12_c3 | nmdc:mga0qj67_12_c3_1092_1856 | 240 |
| 218 | 3300050510 | nmdc:mga06r32_7_c1 | nmdc:mga06r32_7_c1_7383_8147 | 240 |
| 219 | 3300060353 | Ga0501082_0084054 | Ga0501082_0084054_1828_2595 | 240 |
| 220 | 3300061734 | Ga0530510_0018086 | Ga0530510_0018086_2243_3010 | 240 |
| 221 | 3300061734 | Ga0530510_0108722 | Ga0530510_0108722_278_1045 | 240 |
| 222 | 3300013105 | Ga0157369_10057659 | Ga0157369_100576594 | 241 |
| 223 | 3300025922 | Ga0207646_10025433 | Ga0207646_100254332 | 241 |
| 224 | 3300037418 | Ga0395900_0169054 | Ga0395900_0169054_261_1013 | 241 |
| 225 | 3300038443 | Ga0395901_0171986 | Ga0395901_0171986_1205_2113 | 241 |
| 226 | 3300046517 | Ga0495630_0284226 | Ga0495630_0284226_197_943 | 241 |
| 227 | 3300048912 | Ga0496109_0128552 | Ga0496109_0128552_855_1601 | 241 |
| 228 | 3300005434 | Ga0070709_10128004 | Ga0070709_101280042 | 242 |
| 229 | 3300005436 | Ga0070713_100017046 | Ga0070713_1000170464 | 242 |
| 230 | 3300005437 | Ga0070710_10053899 | Ga0070710_100538993 | 242 |
| 231 | 3300005440 | Ga0070705_100306982 | Ga0070705_1003069822 | 242 |
| 232 | 3300007076 | Ga0075435_100090162 | Ga0075435_1000901623 | 242 |
| 233 | 3300009098 | Ga0105245_10209359 | Ga0105245_102093592 | 242 |
| 234 | 3300009177 | Ga0105248_10675838 | Ga0105248_106758382 | 242 |
| 235 | 3300011119 | Ga0105246_10241604 | Ga0105246_102416042 | 242 |
| 236 | 3300025928 | Ga0207700_10110690 | Ga0207700_101106903 | 242 |
| 237 | 3300025929 | Ga0207664_10017475 | Ga0207664_100174754 | 242 |
| 238 | 3300028800 | Ga0265338_10150390 | Ga0265338_101503903 | 242 |
| 239 | 3300037312 | Ga0395899_0009014 | Ga0395899_0009014_6229_7053 | 242 |
| 240 | 3300037418 | Ga0395900_0000728 | Ga0395900_0000728_13934_14758 | 242 |
| 241 | 3300037466 | Ga0395898_0038489 | Ga0395898_0038489_416_1240 | 242 |
| 242 | 3300037471 | Ga0395905_0004578 | Ga0395905_0004578_5270_6094 | 242 |
| 243 | 3300038443 | Ga0395901_0323363 | Ga0395901_0323363_356_1180 | 242 |
| 244 | 3300048904 | Ga0496101_0038896 | Ga0496101_0038896_1032_1853 | 242 |
| 245 | 3300048907 | Ga0496104_0416754 | Ga0496104_0416754_84_878 | 242 |
| 246 | 3300048912 | Ga0496109_0019319 | Ga0496109_0019319_72_893 | 242 |
| 247 | 3300050515 | nmdc:mga0a205_415971_c1 | nmdc:mga0a205_415971_c1_68_889 | 242 |
| 248 | 3300005329 | Ga0070683_100023996 | Ga0070683_1000239966 | 243 |
| 249 | 3300005435 | Ga0070714_100272121 | Ga0070714_1002721211 | 243 |
| 250 | 3300005444 | Ga0070694_100214927 | Ga0070694_1002149271 | 243 |
| 251 | 3300005455 | Ga0070663_100206341 | Ga0070663_1002063411 | 243 |
| 252 | 3300005535 | Ga0070684_100067391 | Ga0070684_1000673916 | 243 |
| 253 | 3300005564 | Ga0070664_100129328 | Ga0070664_1001293284 | 243 |
| 254 | 3300005564 | Ga0070664_100872487 | Ga0070664_1008724871 | 243 |
| 255 | 3300005577 | Ga0068857_100179797 | Ga0068857_1001797972 | 243 |
| 256 | 3300005618 | Ga0068864_100069738 | Ga0068864_1000697386 | 243 |
| 257 | 3300005841 | Ga0068863_100063255 | Ga0068863_1000632555 | 243 |
| 258 | 3300005842 | Ga0068858_100117837 | Ga0068858_1001178372 | 243 |
| 259 | 3300006175 | Ga0070712_100111938 | Ga0070712_1001119382 | 243 |
| 260 | 3300009177 | Ga0105248_10122385 | Ga0105248_101223852 | 243 |
| 261 | 3300014325 | Ga0163163_10004571 | Ga0163163_100045717 | 243 |
| 262 | 3300014968 | Ga0157379_10170292 | Ga0157379_101702922 | 243 |
| 263 | 3300025915 | Ga0207693_10115974 | Ga0207693_101159743 | 243 |
| 264 | 3300025941 | Ga0207711_10007526 | Ga0207711_100075263 | 243 |
| 265 | 3300025944 | Ga0207661_10029219 | Ga0207661_100292195 | 243 |
| 266 | 3300026035 | Ga0207703_10065849 | Ga0207703_100658492 | 243 |
| 267 | 3300026116 | Ga0207674_10023560 | Ga0207674_100235604 | 243 |
| 268 | 3300031995 | Ga0307409_100258319 | Ga0307409_1002583192 | 243 |
| 269 | 3300046459 | Ga0495629_0263381 | Ga0495629_0263381_63_890 | 243 |
| 270 | 3300046511 | Ga0495608_0122797 | Ga0495608_0122797_841_1617 | 243 |
| 271 | 3300048907 | Ga0496104_0021280 | Ga0496104_0021280_1411_2196 | 243 |
| 272 | 3300048908 | Ga0496105_0050944 | Ga0496105_0050944_85_870 | 243 |
| 273 | 3300048911 | Ga0496108_0005257 | Ga0496108_0005257_5190_5975 | 243 |
| 274 | 3300048913 | Ga0496110_0051691 | Ga0496110_0051691_2051_2836 | 243 |
| 275 | 3300048915 | Ga0496112_0378567 | Ga0496112_0378567_189_974 | 243 |
| 276 | 3300048916 | Ga0496113_0006089 | Ga0496113_0006089_2638_3423 | 243 |
| 277 | 3300053077 | Ga0495601_0119368 | Ga0495601_0119368_730_1506 | 243 |
| 278 | 3300053085 | Ga0495619_0263873 | Ga0495619_0263873_197_973 | 243 |
| 279 | 3300005445 | Ga0070708_100002228 | Ga0070708_10000222813 | 244 |
| 280 | 3300005467 | Ga0070706_100009587 | Ga0070706_1000095877 | 244 |
| 281 | 3300005467 | Ga0070706_100022514 | Ga0070706_1000225146 | 244 |
| 282 | 3300005468 | Ga0070707_100007797 | Ga0070707_1000077978 | 244 |
| 283 | 3300005468 | Ga0070707_100912696 | Ga0070707_1009126961 | 244 |
| 284 | 3300005471 | Ga0070698_100003498 | Ga0070698_10000349813 | 244 |
| 285 | 3300005471 | Ga0070698_100017226 | Ga0070698_1000172266 | 244 |
| 286 | 3300005471 | Ga0070698_100178834 | Ga0070698_1001788342 | 244 |
| 287 | 3300005518 | Ga0070699_100047694 | Ga0070699_1000476944 | 244 |
| 288 | 3300005616 | Ga0068852_100089488 | Ga0068852_1000894885 | 244 |
| 289 | 3300006028 | Ga0070717_10003028 | Ga0070717_1000302811 | 244 |
| 290 | 3300009174 | Ga0105241_10180901 | Ga0105241_101809012 | 244 |
| 291 | 3300025910 | Ga0207684_10003011 | Ga0207684_1000301116 | 244 |
| 292 | 3300025910 | Ga0207684_10043339 | Ga0207684_100433394 | 244 |
| 293 | 3300025922 | Ga0207646_10040912 | Ga0207646_100409122 | 244 |
| 294 | 3300032002 | Ga0307416_100206499 | Ga0307416_1002064992 | 244 |
| 295 | 3300048917 | Ga0496114_0069477 | Ga0496114_0069477_1321_2094 | 244 |
| 296 | 3300025901 | Ga0207688_10198827 | Ga0207688_101988271 | 245 |
| 297 | 3300046543 | Ga0495645_0225925 | Ga0495645_0225925_66_887 | 245 |
| 298 | 3300048908 | Ga0496105_0555171 | Ga0496105_0555171_11_814 | 245 |
| 299 | 3300048917 | Ga0496114_0011659 | Ga0496114_0011659_5778_6566 | 245 |
| 300 | 3300049570 | Ga0501033_0150222 | Ga0501033_0150222_195_980 | 245 |
| 301 | 3300049572 | Ga0501036_0101931 | Ga0501036_0101931_253_1038 | 245 |
| 302 | 3300049576 | Ga0501040_0130703 | Ga0501040_0130703_210_995 | 245 |
| 303 | 3300049577 | Ga0501041_0253473 | Ga0501041_0253473_58_843 | 245 |
| 304 | 3300049580 | Ga0501046_0095804 | Ga0501046_0095804_1230_2015 | 245 |
| 305 | 3300049582 | Ga0501048_0112367 | Ga0501048_0112367_841_1626 | 245 |
| 306 | 3300049584 | Ga0501068_0461702 | Ga0501068_0461702_16_801 | 245 |
| 307 | 3300049586 | Ga0501070_0199897 | Ga0501070_0199897_626_1432 | 245 |
| 308 | 3300049587 | Ga0501071_0116468 | Ga0501071_0116468_861_1646 | 245 |
| 309 | 3300049588 | Ga0501072_0209267 | Ga0501072_0209267_163_948 | 245 |
| 310 | 3300049590 | Ga0501074_0243016 | Ga0501074_0243016_323_1108 | 245 |
| 311 | 3300049591 | Ga0501075_0059596 | Ga0501075_0059596_945_1730 | 245 |
| 312 | 3300049592 | Ga0501076_0006666 | Ga0501076_0006666_198_983 | 245 |
| 313 | 3300049593 | Ga0501077_0119163 | Ga0501077_0119163_166_951 | 245 |
| 314 | 3300049741 | Ga0501079_0044397 | Ga0501079_0044397_2339_3124 | 245 |
| 315 | 3300049742 | Ga0501080_0295822 | Ga0501080_0295822_158_943 | 245 |
| 316 | 3300049824 | Ga0501045_0007152 | Ga0501045_0007152_547_1332 | 245 |
| 317 | 3300054114 | Ga0501084_0064260 | Ga0501084_0064260_883_1668 | 245 |
| 318 | 3300060353 | Ga0501082_0030043 | Ga0501082_0030043_2505_3290 | 245 |
| 319 | 3300061734 | Ga0530510_0001247 | Ga0530510_0001247_14073_14858 | 245 |
| 320 | 3300005330 | Ga0070690_100129205 | Ga0070690_1001292052 | 246 |
| 321 | 3300005336 | Ga0070680_100425661 | Ga0070680_1004256611 | 246 |
| 322 | 3300005355 | Ga0070671_100200799 | Ga0070671_1002007992 | 246 |
| 323 | 3300005364 | Ga0070673_100209167 | Ga0070673_1002091672 | 246 |
| 324 | 3300005437 | Ga0070710_10028450 | Ga0070710_100284502 | 246 |
| 325 | 3300005539 | Ga0068853_100275342 | Ga0068853_1002753422 | 246 |
| 326 | 3300005545 | Ga0070695_100140392 | Ga0070695_1001403923 | 246 |
| 327 | 3300005549 | Ga0070704_100370248 | Ga0070704_1003702482 | 246 |
| 328 | 3300005577 | Ga0068857_100222935 | Ga0068857_1002229352 | 246 |
| 329 | 3300005614 | Ga0068856_100216277 | Ga0068856_1002162773 | 246 |
| 330 | 3300005615 | Ga0070702_100196895 | Ga0070702_1001968952 | 246 |
| 331 | 3300005617 | Ga0068859_100924034 | Ga0068859_1009240341 | 246 |
| 332 | 3300005618 | Ga0068864_100298068 | Ga0068864_1002980682 | 246 |
| 333 | 3300005841 | Ga0068863_100234987 | Ga0068863_1002349872 | 246 |
| 334 | 3300005843 | Ga0068860_100367791 | Ga0068860_1003677912 | 246 |
| 335 | 3300006931 | Ga0097620_100924039 | Ga0097620_1009240391 | 246 |
| 336 | 3300009093 | Ga0105240_10640263 | Ga0105240_106402631 | 246 |
| 337 | 3300009101 | Ga0105247_10372543 | Ga0105247_103725431 | 246 |
| 338 | 3300014325 | Ga0163163_10132387 | Ga0163163_101323872 | 246 |
| 339 | 3300021388 | Ga0213875_10011897 | Ga0213875_100118976 | 246 |
| 340 | 3300025898 | Ga0207692_10178010 | Ga0207692_101780102 | 246 |
| 341 | 3300025915 | Ga0207693_10025458 | Ga0207693_100254582 | 246 |
| 342 | 3300025919 | Ga0207657_10040905 | Ga0207657_100409052 | 246 |
| 343 | 3300025922 | Ga0207646_10464482 | Ga0207646_104644821 | 246 |
| 344 | 3300025928 | Ga0207700_10088166 | Ga0207700_100881663 | 246 |
| 345 | 3300025945 | Ga0207679_10636367 | Ga0207679_106363671 | 246 |
| 346 | 3300026041 | Ga0207639_10245698 | Ga0207639_102456982 | 246 |
| 347 | 3300026078 | Ga0207702_10229391 | Ga0207702_102293912 | 246 |
| 348 | 3300026095 | Ga0207676_10242267 | Ga0207676_102422672 | 246 |
| 349 | 3300028381 | Ga0268264_10079604 | Ga0268264_100796043 | 246 |
| 350 | 3300037853 | Ga0436364_0913146 | Ga0436364_0913146_1993_2760 | 246 |
| 351 | 3300045976 | Ga0466967_0315184 | Ga0466967_0315184_396_1265 | 246 |
| 352 | 3300046454 | Ga0495592_0153827 | Ga0495592_0153827_60_857 | 246 |
| 353 | 3300048903 | Ga0496100_0034092 | Ga0496100_0034092_345_1178 | 246 |
| 354 | 3300048905 | Ga0496102_0110247 | Ga0496102_0110247_175_1008 | 246 |
| 355 | 3300048908 | Ga0496105_0023370 | Ga0496105_0023370_3370_4203 | 246 |
| 356 | 3300048911 | Ga0496108_0039119 | Ga0496108_0039119_845_1678 | 246 |
| 357 | 3300048912 | Ga0496109_0032477 | Ga0496109_0032477_3366_4199 | 246 |
| 358 | 3300048913 | Ga0496110_0028189 | Ga0496110_0028189_3129_3962 | 246 |
| 359 | 3300048914 | Ga0496111_0031532 | Ga0496111_0031532_2677_3510 | 246 |
| 360 | 3300048915 | Ga0496112_0070761 | Ga0496112_0070761_1387_2220 | 246 |
| 361 | 3300048917 | Ga0496114_0013605 | Ga0496114_0013605_3495_4328 | 246 |
| 362 | 3300048918 | Ga0496115_0154469 | Ga0496115_0154469_123_956 | 246 |
| 363 | 3300048928 | Ga0496125_0000074 | Ga0496125_0000074_107247_108086 | 246 |
| 364 | 3300053077 | Ga0495601_0082731 | Ga0495601_0082731_1156_1977 | 246 |
| 365 | 3300005288 | Ga0065714_10028532 | Ga0065714_100285321 | 247 |
| 366 | 3300005334 | Ga0068869_100240303 | Ga0068869_1002403032 | 247 |
| 367 | 3300005338 | Ga0068868_100220539 | Ga0068868_1002205392 | 247 |
| 368 | 3300005341 | Ga0070691_10009567 | Ga0070691_100095673 | 247 |
| 369 | 3300005341 | Ga0070691_10169231 | Ga0070691_101692312 | 247 |
| 370 | 3300005435 | Ga0070714_100000933 | Ga0070714_1000009335 | 247 |
| 371 | 3300005435 | Ga0070714_100036934 | Ga0070714_1000369341 | 247 |
| 372 | 3300005436 | Ga0070713_100031913 | Ga0070713_1000319137 | 247 |
| 373 | 3300005436 | Ga0070713_100236913 | Ga0070713_1002369132 | 247 |
| 374 | 3300005436 | Ga0070713_100380571 | Ga0070713_1003805712 | 247 |
| 375 | 3300005439 | Ga0070711_100040371 | Ga0070711_1000403712 | 247 |
| 376 | 3300005439 | Ga0070711_100216626 | Ga0070711_1002166261 | 247 |
| 377 | 3300005457 | Ga0070662_100330273 | Ga0070662_1003302732 | 247 |
| 378 | 3300005548 | Ga0070665_100062479 | Ga0070665_1000624795 | 247 |
| 379 | 3300005563 | Ga0068855_100261130 | Ga0068855_1002611303 | 247 |
| 380 | 3300005564 | Ga0070664_100147418 | Ga0070664_1001474182 | 247 |
| 381 | 3300005578 | Ga0068854_100129413 | Ga0068854_1001294131 | 247 |
| 382 | 3300005614 | Ga0068856_100391874 | Ga0068856_1003918742 | 247 |
| 383 | 3300005843 | Ga0068860_100121928 | Ga0068860_1001219282 | 247 |
| 384 | 3300005981 | Ga0081538_10009646 | Ga0081538_100096466 | 247 |
| 385 | 3300006028 | Ga0070717_10196231 | Ga0070717_101962313 | 247 |
| 386 | 3300006173 | Ga0070716_100134376 | Ga0070716_1001343763 | 247 |
| 387 | 3300006175 | Ga0070712_100031376 | Ga0070712_1000313765 | 247 |
| 388 | 3300006175 | Ga0070712_100562507 | Ga0070712_1005625071 | 247 |
| 389 | 3300006844 | Ga0075428_100540373 | Ga0075428_1005403732 | 247 |
| 390 | 3300006847 | Ga0075431_100183579 | Ga0075431_1001835792 | 247 |
| 391 | 3300006852 | Ga0075433_10091088 | Ga0075433_100910882 | 247 |
| 392 | 3300006871 | Ga0075434_100062311 | Ga0075434_1000623114 | 247 |
| 393 | 3300007076 | Ga0075435_100029557 | Ga0075435_1000295576 | 247 |
| 394 | 3300009093 | Ga0105240_10166293 | Ga0105240_101662933 | 247 |
| 395 | 3300009094 | Ga0111539_10017234 | Ga0111539_1001723414 | 247 |
| 396 | 3300009094 | Ga0111539_10282141 | Ga0111539_102821412 | 247 |
| 397 | 3300009147 | Ga0114129_10009535 | Ga0114129_1000953512 | 247 |
| 398 | 3300009176 | Ga0105242_10122871 | Ga0105242_101228712 | 247 |
| 399 | 3300009553 | Ga0105249_10363037 | Ga0105249_103630372 | 247 |
| 400 | 3300010375 | Ga0105239_10516066 | Ga0105239_105160661 | 247 |
| 401 | 3300013296 | Ga0157374_10613859 | Ga0157374_106138591 | 247 |
| 402 | 3300013307 | Ga0157372_10821169 | Ga0157372_108211692 | 247 |
| 403 | 3300014745 | Ga0157377_10209723 | Ga0157377_102097232 | 247 |
| 404 | 3300014968 | Ga0157379_10037611 | Ga0157379_100376112 | 247 |
| 405 | 3300014969 | Ga0157376_10425034 | Ga0157376_104250341 | 247 |
| 406 | 3300021388 | Ga0213875_10035250 | Ga0213875_100352502 | 247 |
| 407 | 3300025915 | Ga0207693_10043582 | Ga0207693_100435823 | 247 |
| 408 | 3300025915 | Ga0207693_10150964 | Ga0207693_101509641 | 247 |
| 409 | 3300025916 | Ga0207663_10039511 | Ga0207663_100395113 | 247 |
| 410 | 3300025916 | Ga0207663_10129364 | Ga0207663_101293642 | 247 |
| 411 | 3300025927 | Ga0207687_10099571 | Ga0207687_100995713 | 247 |
| 412 | 3300025928 | Ga0207700_10004691 | Ga0207700_100046918 | 247 |
| 413 | 3300025928 | Ga0207700_10364539 | Ga0207700_103645391 | 247 |
| 414 | 3300025929 | Ga0207664_10072274 | Ga0207664_100722742 | 247 |
| 415 | 3300025929 | Ga0207664_10073313 | Ga0207664_100733133 | 247 |
| 416 | 3300025929 | Ga0207664_10585117 | Ga0207664_105851171 | 247 |
| 417 | 3300025933 | Ga0207706_10013188 | Ga0207706_100131885 | 247 |
| 418 | 3300025934 | Ga0207686_10110563 | Ga0207686_101105632 | 247 |
| 419 | 3300025939 | Ga0207665_10001127 | Ga0207665_100011275 | 247 |
| 420 | 3300025942 | Ga0207689_10211301 | Ga0207689_102113012 | 247 |
| 421 | 3300025949 | Ga0207667_10329952 | Ga0207667_103299522 | 247 |
| 422 | 3300025981 | Ga0207640_10098671 | Ga0207640_100986711 | 247 |
| 423 | 3300026023 | Ga0207677_10186888 | Ga0207677_101868882 | 247 |
| 424 | 3300026088 | Ga0207641_10260395 | Ga0207641_102603952 | 247 |
| 425 | 3300026095 | Ga0207676_10526415 | Ga0207676_105264151 | 247 |
| 426 | 3300026142 | Ga0207698_10033868 | Ga0207698_100338683 | 247 |
| 427 | 3300028379 | Ga0268266_10254979 | Ga0268266_102549792 | 247 |
| 428 | 3300035086 | Ga0373934_0000008 | Ga0373934_0000008_71215_72018 | 247 |
| 429 | 3300035086 | Ga0373934_0001843 | Ga0373934_0001843_205_1011 | 247 |
| 430 | 3300035111 | Ga0373923_0006700 | Ga0373923_0006700_22_825 | 247 |
| 431 | 3300035117 | Ga0373953_0000057 | Ga0373953_0000057_2458_3261 | 247 |
| 432 | 3300035118 | Ga0373954_0002289 | Ga0373954_0002289_1786_2589 | 247 |
| 433 | 3300035118 | Ga0373954_0036913 | Ga0373954_0036913_176_982 | 247 |
| 434 | 3300035119 | Ga0373956_0013197 | Ga0373956_0013197_2423_3226 | 247 |
| 435 | 3300035119 | Ga0373956_0031980 | Ga0373956_0031980_1297_2103 | 247 |
| 436 | 3300035120 | Ga0373957_0000164 | Ga0373957_0000164_15980_16786 | 247 |
| 437 | 3300035172 | Ga0373955_0000660 | Ga0373955_0000660_10941_11744 | 247 |
| 438 | 3300035172 | Ga0373955_0001687 | Ga0373955_0001687_193_999 | 247 |
| 439 | 3300035410 | Ga0373924_0002548 | Ga0373924_0002548_425_1228 | 247 |
| 440 | 3300035410 | Ga0373924_0015285 | Ga0373924_0015285_1913_2719 | 247 |
| 441 | 3300035691 | Ga0373931_0289311 | Ga0373931_0289311_57_890 | 247 |
| 442 | 3300035724 | Ga0373933_0000150 | Ga0373933_0000150_37776_38579 | 247 |
| 443 | 3300035724 | Ga0373933_0001027 | Ga0373933_0001027_194_1000 | 247 |
| 444 | 3300036401 | Ga0373937_0000002 | Ga0373937_0000002_290014_290817 | 247 |
| 445 | 3300036401 | Ga0373937_0055004 | Ga0373937_0055004_2642_3448 | 247 |
| 446 | 3300036401 | Ga0373937_0254108 | Ga0373937_0254108_101_898 | 247 |
| 447 | 3300037312 | Ga0395899_0060446 | Ga0395899_0060446_1477_2268 | 247 |
| 448 | 3300037853 | Ga0436364_0047523 | Ga0436364_0047523_173_952 | 247 |
| 449 | 3300037853 | Ga0436364_0525292 | Ga0436364_0525292_461_1249 | 247 |
| 450 | 3300039437 | Ga0436365_1203819 | Ga0436365_1203819_115_903 | 247 |
| 451 | 3300046454 | Ga0495592_0000003 | Ga0495592_0000003_186654_187457 | 247 |
| 452 | 3300046454 | Ga0495592_0001690 | Ga0495592_0001690_177_983 | 247 |
| 453 | 3300046462 | Ga0495651_0000031 | Ga0495651_0000031_13314_14117 | 247 |
| 454 | 3300046462 | Ga0495651_0001698 | Ga0495651_0001698_15979_16785 | 247 |
| 455 | 3300046463 | Ga0495653_0022055 | Ga0495653_0022055_2234_3037 | 247 |
| 456 | 3300046463 | Ga0495653_0029406 | Ga0495653_0029406_3392_4198 | 247 |
| 457 | 3300046511 | Ga0495608_0000018 | Ga0495608_0000018_186650_187453 | 247 |
| 458 | 3300046511 | Ga0495608_0001179 | Ga0495608_0001179_1754_2560 | 247 |
| 459 | 3300046516 | Ga0495628_0005767 | Ga0495628_0005767_3180_3983 | 247 |
| 460 | 3300046516 | Ga0495628_0007721 | Ga0495628_0007721_8286_9092 | 247 |
| 461 | 3300046529 | Ga0495652_0000013 | Ga0495652_0000013_6808_7611 | 247 |
| 462 | 3300046529 | Ga0495652_0003007 | Ga0495652_0003007_15980_16786 | 247 |
| 463 | 3300046535 | Ga0495586_0191857 | Ga0495586_0191857_290_1087 | 247 |
| 464 | 3300046536 | Ga0495587_0000014 | Ga0495587_0000014_186638_187441 | 247 |
| 465 | 3300046536 | Ga0495587_0001222 | Ga0495587_0001222_15981_16787 | 247 |
| 466 | 3300046543 | Ga0495645_0099184 | Ga0495645_0099184_888_1691 | 247 |
| 467 | 3300046559 | Ga0495667_0000014 | Ga0495667_0000014_13311_14114 | 247 |
| 468 | 3300046559 | Ga0495667_0004627 | Ga0495667_0004627_8302_9108 | 247 |
| 469 | 3300046675 | Ga0495657_0000012 | Ga0495657_0000012_10735_11538 | 247 |
| 470 | 3300046675 | Ga0495657_0002083 | Ga0495657_0002083_15977_16783 | 247 |
| 471 | 3300046678 | Ga0495599_0000071 | Ga0495599_0000071_63227_64030 | 247 |
| 472 | 3300046678 | Ga0495599_0003420 | Ga0495599_0003420_208_1014 | 247 |
| 473 | 3300046679 | Ga0495623_0000066 | Ga0495623_0000066_10739_11542 | 247 |
| 474 | 3300046680 | Ga0495646_0051900 | Ga0495646_0051900_1149_1952 | 247 |
| 475 | 3300046680 | Ga0495646_0073924 | Ga0495646_0073924_1036_1842 | 247 |
| 476 | 3300046809 | Ga0495600_0011397 | Ga0495600_0011397_2254_3057 | 247 |
| 477 | 3300046809 | Ga0495600_0188913 | Ga0495600_0188913_177_983 | 247 |
| 478 | 3300047317 | Ga0495604_0000054 | Ga0495604_0000054_93416_94219 | 247 |
| 479 | 3300047317 | Ga0495604_0001896 | Ga0495604_0001896_15974_16780 | 247 |
| 480 | 3300047322 | Ga0495680_0000003 | Ga0495680_0000003_164569_165372 | 247 |
| 481 | 3300047322 | Ga0495680_0002973 | Ga0495680_0002973_15936_16742 | 247 |
| 482 | 3300047444 | Ga0495675_0000406 | Ga0495675_0000406_22170_22973 | 247 |
| 483 | 3300047444 | Ga0495675_0001024 | Ga0495675_0001024_15964_16770 | 247 |
| 484 | 3300048088 | Ga0495602_0000014 | Ga0495602_0000014_185667_186470 | 247 |
| 485 | 3300048088 | Ga0495602_0003146 | Ga0495602_0003146_205_1011 | 247 |
| 486 | 3300048907 | Ga0496104_0108427 | Ga0496104_0108427_246_1022 | 247 |
| 487 | 3300048912 | Ga0496109_0258151 | Ga0496109_0258151_820_1596 | 247 |
| 488 | 3300048915 | Ga0496112_0083395 | Ga0496112_0083395_186_962 | 247 |
| 489 | 3300049573 | Ga0501037_0122721 | Ga0501037_0122721_575_1324 | 247 |
| 490 | 3300049575 | Ga0501039_0232363 | Ga0501039_0232363_346_1095 | 247 |
| 491 | 3300049581 | Ga0501047_0102106 | Ga0501047_0102106_299_1048 | 247 |
| 492 | 3300049582 | Ga0501048_0266940 | Ga0501048_0266940_30_779 | 247 |
| 493 | 3300049586 | Ga0501070_0154626 | Ga0501070_0154626_87_836 | 247 |
| 494 | 3300049742 | Ga0501080_0094830 | Ga0501080_0094830_810_1559 | 247 |
| 495 | 3300049822 | Ga0501035_0049015 | Ga0501035_0049015_1709_2458 | 247 |
| 496 | 3300049823 | Ga0501044_0312515 | Ga0501044_0312515_284_1033 | 247 |
| 497 | 3300050507 | nmdc:mga05p37_42056_c1 | nmdc:mga05p37_42056_c1_3258_4058 | 247 |
| 498 | 3300050507 | nmdc:mga05p37_705347_c1 | nmdc:mga05p37_705347_c1_314_1096 | 247 |
| 499 | 3300050508 | nmdc:mga09592_436536_c1 | nmdc:mga09592_436536_c1_279_1079 | 247 |
| 500 | 3300050512 | nmdc:mga0n895_52613_c1 | nmdc:mga0n895_52613_c1_2154_2954 | 247 |
| 501 | 3300050513 | nmdc:mga0rr50_4547_c1 | nmdc:mga0rr50_4547_c1_1045_1845 | 247 |
| 502 | 3300050514 | nmdc:mga08x19_3216_c1 | nmdc:mga08x19_3216_c1_5841_6641 | 247 |
| 503 | 3300050515 | nmdc:mga0a205_51398_c1 | nmdc:mga0a205_51398_c1_172_972 | 247 |
| 504 | 3300053077 | Ga0495601_0243095 | Ga0495601_0243095_200_1006 | 247 |
| 505 | 3300053084 | Ga0495595_0039792 | Ga0495595_0039792_177_983 | 247 |
| 506 | 3300053085 | Ga0495619_0287562 | Ga0495619_0287562_167_970 | 247 |
| 507 | 3300005356 | Ga0070674_100024274 | Ga0070674_1000242742 | 248 |
| 508 | 3300005434 | Ga0070709_10113308 | Ga0070709_101133082 | 248 |
| 509 | 3300005467 | Ga0070706_100183715 | Ga0070706_1001837152 | 248 |
| 510 | 3300005536 | Ga0070697_100093464 | Ga0070697_1000934643 | 248 |
| 511 | 3300006175 | Ga0070712_100193921 | Ga0070712_1001939212 | 248 |
| 512 | 3300009098 | Ga0105245_10840429 | Ga0105245_108404291 | 248 |
| 513 | 3300009176 | Ga0105242_10550945 | Ga0105242_105509451 | 248 |
| 514 | 3300025910 | Ga0207684_10504020 | Ga0207684_105040201 | 248 |
| 515 | 3300025916 | Ga0207663_10289641 | Ga0207663_102896412 | 248 |
| 516 | 3300035242 | Ga0373962_0043395 | Ga0373962_0043395_20_889 | 248 |
| 517 | 3300037312 | Ga0395899_0075670 | Ga0395899_0075670_704_1501 | 248 |
| 518 | 3300044694 | Ga0466963_0193594 | Ga0466963_0193594_52_843 | 248 |
| 519 | 3300048904 | Ga0496101_0044109 | Ga0496101_0044109_23_868 | 248 |
| 520 | 3300048907 | Ga0496104_0109429 | Ga0496104_0109429_1574_2419 | 248 |
| 521 | 3300049568 | Ga0501031_0005785 | Ga0501031_0005785_2539_3387 | 248 |
| 522 | 3300049569 | Ga0501032_0030399 | Ga0501032_0030399_567_1415 | 248 |
| 523 | 3300049570 | Ga0501033_0188427 | Ga0501033_0188427_137_985 | 248 |
| 524 | 3300049571 | Ga0501034_0020392 | Ga0501034_0020392_5162_6010 | 248 |
| 525 | 3300049573 | Ga0501037_0025622 | Ga0501037_0025622_997_1845 | 248 |
| 526 | 3300049574 | Ga0501038_0003748 | Ga0501038_0003748_8516_9364 | 248 |
| 527 | 3300049579 | Ga0501043_0005784 | Ga0501043_0005784_2769_3617 | 248 |
| 528 | 3300049580 | Ga0501046_0098345 | Ga0501046_0098345_206_1054 | 248 |
| 529 | 3300049581 | Ga0501047_0013200 | Ga0501047_0013200_4273_5121 | 248 |
| 530 | 3300049582 | Ga0501048_0000090 | Ga0501048_0000090_8761_9609 | 248 |
| 531 | 3300049823 | Ga0501044_0109515 | Ga0501044_0109515_1460_2308 | 248 |
| 532 | iso_pu_bacteria | 2675903059 | 2676480995 | 248 |
| 533 | iso_pu_bacteria | 2808606375 | 2808917862 | 248 |
| 534 | 3300005468 | Ga0070707_100075214 | Ga0070707_1000752142 | 249 |
| 535 | 3300005518 | Ga0070699_100161924 | Ga0070699_1001619243 | 249 |
| 536 | 3300005518 | Ga0070699_100228815 | Ga0070699_1002288152 | 249 |
| 537 | 3300006175 | Ga0070712_100024746 | Ga0070712_1000247465 | 249 |
| 538 | 3300006175 | Ga0070712_100136991 | Ga0070712_1001369912 | 249 |
| 539 | 3300037418 | Ga0395900_0002127 | Ga0395900_0002127_16611_17408 | 249 |
| 540 | 3300039450 | Ga0436363_1086998 | Ga0436363_1086998_193_993 | 249 |
| 541 | 3300045976 | Ga0466967_0169965 | Ga0466967_0169965_1063_1896 | 249 |
| 542 | 3300061734 | Ga0530510_0128935 | Ga0530510_0128935_1053_1805 | 249 |
| 543 | 3300005336 | Ga0070680_100012407 | Ga0070680_1000124075 | 250 |
| 544 | 3300005337 | Ga0070682_100053667 | Ga0070682_1000536672 | 250 |
| 545 | 3300005467 | Ga0070706_100204395 | Ga0070706_1002043953 | 250 |
| 546 | 3300005468 | Ga0070707_100120691 | Ga0070707_1001206911 | 250 |
| 547 | 3300005471 | Ga0070698_100022472 | Ga0070698_1000224723 | 250 |
| 548 | 3300005518 | Ga0070699_100476636 | Ga0070699_1004766362 | 250 |
| 549 | 3300006028 | Ga0070717_10300840 | Ga0070717_103008402 | 250 |
| 550 | 3300025910 | Ga0207684_10026867 | Ga0207684_100268673 | 250 |
| 551 | 3300025922 | Ga0207646_10045105 | Ga0207646_100451054 | 250 |
| 552 | 3300028563 | Ga0265319_1001666 | Ga0265319_100166610 | 250 |
| 553 | 3300028573 | Ga0265334_10009965 | Ga0265334_100099653 | 250 |
| 554 | 3300028800 | Ga0265338_10085687 | Ga0265338_100856873 | 250 |
| 555 | 3300031240 | Ga0265320_10044210 | Ga0265320_100442102 | 250 |
| 556 | 3300031241 | Ga0265325_10005794 | Ga0265325_100057945 | 250 |
| 557 | 3300031247 | Ga0265340_10036050 | Ga0265340_100360503 | 250 |
| 558 | 3300031249 | Ga0265339_10022369 | Ga0265339_100223695 | 250 |
| 559 | 3300031344 | Ga0265316_10147223 | Ga0265316_101472232 | 250 |
| 560 | 3300031595 | Ga0265313_10089254 | Ga0265313_100892542 | 250 |
| 561 | 3300035111 | Ga0373923_0010520 | Ga0373923_0010520_323_1120 | 250 |
| 562 | 3300035118 | Ga0373954_0016934 | Ga0373954_0016934_2326_3123 | 250 |
| 563 | 3300035172 | Ga0373955_0072480 | Ga0373955_0072480_216_1013 | 250 |
| 564 | 3300035724 | Ga0373933_0153041 | Ga0373933_0153041_46_843 | 250 |
| 565 | 3300036401 | Ga0373937_0072237 | Ga0373937_0072237_34_846 | 250 |
| 566 | 3300036401 | Ga0373937_0113483 | Ga0373937_0113483_989_1786 | 250 |
| 567 | 3300037418 | Ga0395900_0320023 | Ga0395900_0320023_330_1112 | 250 |
| 568 | 3300044694 | Ga0466963_0281326 | Ga0466963_0281326_35_862 | 250 |
| 569 | 3300046462 | Ga0495651_0057937 | Ga0495651_0057937_1682_2494 | 250 |
| 570 | 3300046462 | Ga0495651_0258442 | Ga0495651_0258442_250_1053 | 250 |
| 571 | 3300046462 | Ga0495651_0277913 | Ga0495651_0277913_12_809 | 250 |
| 572 | 3300046463 | Ga0495653_0083777 | Ga0495653_0083777_1036_1848 | 250 |
| 573 | 3300046477 | Ga0495664_0024750 | Ga0495664_0024750_1215_2027 | 250 |
| 574 | 3300046477 | Ga0495664_0394726 | Ga0495664_0394726_14_811 | 250 |
| 575 | 3300046511 | Ga0495608_0145977 | Ga0495608_0145977_161_973 | 250 |
| 576 | 3300046514 | Ga0495618_0305259 | Ga0495618_0305259_160_957 | 250 |
| 577 | 3300046516 | Ga0495628_0112881 | Ga0495628_0112881_1137_1934 | 250 |
| 578 | 3300046516 | Ga0495628_0115522 | Ga0495628_0115522_930_1742 | 250 |
| 579 | 3300046517 | Ga0495630_0154107 | Ga0495630_0154107_435_1232 | 250 |
| 580 | 3300046529 | Ga0495652_0021496 | Ga0495652_0021496_4348_5160 | 250 |
| 581 | 3300046536 | Ga0495587_0068648 | Ga0495587_0068648_136_933 | 250 |
| 582 | 3300046559 | Ga0495667_0109181 | Ga0495667_0109181_749_1546 | 250 |
| 583 | 3300046663 | Ga0495635_0062708 | Ga0495635_0062708_1508_2320 | 250 |
| 584 | 3300046663 | Ga0495635_0115917 | Ga0495635_0115917_736_1533 | 250 |
| 585 | 3300046675 | Ga0495657_0044769 | Ga0495657_0044769_1613_2425 | 250 |
| 586 | 3300046678 | Ga0495599_0040865 | Ga0495599_0040865_1743_2540 | 250 |
| 587 | 3300046678 | Ga0495599_0099750 | Ga0495599_0099750_605_1417 | 250 |
| 588 | 3300046680 | Ga0495646_0180353 | Ga0495646_0180353_106_903 | 250 |
| 589 | 3300046689 | Ga0495613_0117004 | Ga0495613_0117004_421_1218 | 250 |
| 590 | 3300046809 | Ga0495600_0054273 | Ga0495600_0054273_565_1362 | 250 |
| 591 | 3300047317 | Ga0495604_0265760 | Ga0495604_0265760_130_927 | 250 |
| 592 | 3300047319 | Ga0495674_0059826 | Ga0495674_0059826_2488_3285 | 250 |
| 593 | 3300047321 | Ga0495676_0102103 | Ga0495676_0102103_676_1473 | 250 |
| 594 | 3300047322 | Ga0495680_0023739 | Ga0495680_0023739_1680_2492 | 250 |
| 595 | 3300047322 | Ga0495680_0052617 | Ga0495680_0052617_2348_3145 | 250 |
| 596 | 3300048088 | Ga0495602_0113889 | Ga0495602_0113889_633_1445 | 250 |
| 597 | 3300049569 | Ga0501032_0271987 | Ga0501032_0271987_221_1063 | 250 |
| 598 | 3300049572 | Ga0501036_0011171 | Ga0501036_0011171_5479_6360 | 250 |
| 599 | 3300049574 | Ga0501038_0039457 | Ga0501038_0039457_1206_1988 | 250 |
| 600 | 3300049575 | Ga0501039_0009217 | Ga0501039_0009217_5671_6453 | 250 |
| 601 | 3300049576 | Ga0501040_0035744 | Ga0501040_0035744_660_1541 | 250 |
| 602 | 3300049576 | Ga0501040_0046914 | Ga0501040_0046914_1732_2514 | 250 |
| 603 | 3300049578 | Ga0501042_0006280 | Ga0501042_0006280_3477_4259 | 250 |
| 604 | 3300049582 | Ga0501048_0082200 | Ga0501048_0082200_555_1337 | 250 |
| 605 | 3300049584 | Ga0501068_0350852 | Ga0501068_0350852_52_834 | 250 |
| 606 | 3300049588 | Ga0501072_0014252 | Ga0501072_0014252_3703_4485 | 250 |
| 607 | 3300049589 | Ga0501073_0462637 | Ga0501073_0462637_51_833 | 250 |
| 608 | 3300049590 | Ga0501074_0343933 | Ga0501074_0343933_124_927 | 250 |
| 609 | 3300049591 | Ga0501075_0004638 | Ga0501075_0004638_6508_7290 | 250 |
| 610 | 3300049592 | Ga0501076_0022716 | Ga0501076_0022716_3789_4571 | 250 |
| 611 | 3300049593 | Ga0501077_0002491 | Ga0501077_0002491_3014_3796 | 250 |
| 612 | 3300049743 | Ga0501081_0026133 | Ga0501081_0026133_1004_1786 | 250 |
| 613 | 3300049743 | Ga0501081_0231687 | Ga0501081_0231687_508_1317 | 250 |
| 614 | 3300049823 | Ga0501044_0148916 | Ga0501044_0148916_1211_2053 | 250 |
| 615 | 3300049824 | Ga0501045_0012748 | Ga0501045_0012748_2919_3701 | 250 |
| 616 | 3300054114 | Ga0501084_0025101 | Ga0501084_0025101_2679_3461 | 250 |
| 617 | 3300060353 | Ga0501082_0014400 | Ga0501082_0014400_5341_6123 | 250 |
| 618 | iso_pu_bacteria | 2808606365 | 2808872615 | 250 |
| 619 | iso_pu_bacteria | 2883821847 | 2883822955 | 250 |
| 620 | 3300005335 | Ga0070666_10137103 | Ga0070666_101371032 | 251 |
| 621 | 3300005338 | Ga0068868_100235958 | Ga0068868_1002359581 | 251 |
| 622 | 3300005434 | Ga0070709_10000701 | Ga0070709_100007017 | 251 |
| 623 | 3300005434 | Ga0070709_10051088 | Ga0070709_100510883 | 251 |
| 624 | 3300005437 | Ga0070710_10000411 | Ga0070710_1000041110 | 251 |
| 625 | 3300005439 | Ga0070711_100002526 | Ga0070711_1000025265 | 251 |
| 626 | 3300005981 | Ga0081538_10001009 | Ga0081538_100010097 | 251 |
| 627 | 3300006028 | Ga0070717_10042057 | Ga0070717_100420574 | 251 |
| 628 | 3300006058 | Ga0075432_10053240 | Ga0075432_100532401 | 251 |
| 629 | 3300006173 | Ga0070716_100000316 | Ga0070716_10000031618 | 251 |
| 630 | 3300006175 | Ga0070712_100001872 | Ga0070712_1000018723 | 251 |
| 631 | 3300006844 | Ga0075428_100747199 | Ga0075428_1007471991 | 251 |
| 632 | 3300009148 | Ga0105243_10082368 | Ga0105243_100823682 | 251 |
| 633 | 3300009177 | Ga0105248_10601460 | Ga0105248_106014602 | 251 |
| 634 | 3300013104 | Ga0157370_10092292 | Ga0157370_100922923 | 251 |
| 635 | 3300014968 | Ga0157379_10114298 | Ga0157379_101142983 | 251 |
| 636 | 3300025898 | Ga0207692_10000708 | Ga0207692_100007087 | 251 |
| 637 | 3300025903 | Ga0207680_10048298 | Ga0207680_100482982 | 251 |
| 638 | 3300025906 | Ga0207699_10000918 | Ga0207699_100009186 | 251 |
| 639 | 3300025915 | Ga0207693_10009326 | Ga0207693_100093265 | 251 |
| 640 | 3300025928 | Ga0207700_10000662 | Ga0207700_100006626 | 251 |
| 641 | 3300025929 | Ga0207664_10001227 | Ga0207664_100012276 | 251 |
| 642 | 3300025939 | Ga0207665_10000242 | Ga0207665_1000024224 | 251 |
| 643 | 3300026121 | Ga0207683_10222386 | Ga0207683_102223861 | 251 |
| 644 | 3300031548 | Ga0307408_100267379 | Ga0307408_1002673792 | 251 |
| 645 | 3300031852 | Ga0307410_10006039 | Ga0307410_100060397 | 251 |
| 646 | 3300031903 | Ga0307407_10009971 | Ga0307407_100099714 | 251 |
| 647 | 3300031995 | Ga0307409_100168798 | Ga0307409_1001687982 | 251 |
| 648 | 3300032002 | Ga0307416_100592414 | Ga0307416_1005924142 | 251 |
| 649 | 3300035113 | Ga0373936_0019325 | Ga0373936_0019325_380_1258 | 251 |
| 650 | 3300035117 | Ga0373953_0059519 | Ga0373953_0059519_193_1071 | 251 |
| 651 | 3300035120 | Ga0373957_0000836 | Ga0373957_0000836_7162_8040 | 251 |
| 652 | 3300035172 | Ga0373955_0047077 | Ga0373955_0047077_390_1268 | 251 |
| 653 | 3300035410 | Ga0373924_0020410 | Ga0373924_0020410_1458_2336 | 251 |
| 654 | 3300035692 | Ga0373935_0200250 | Ga0373935_0200250_172_1050 | 251 |
| 655 | 3300035724 | Ga0373933_0131273 | Ga0373933_0131273_265_1143 | 251 |
| 656 | 3300035725 | Ga0373947_0175820 | Ga0373947_0175820_483_1361 | 251 |
| 657 | 3300036401 | Ga0373937_0283181 | Ga0373937_0283181_242_1120 | 251 |
| 658 | 3300037068 | Ga0373925_0079378 | Ga0373925_0079378_320_1198 | 251 |
| 659 | 3300046454 | Ga0495592_0110313 | Ga0495592_0110313_73_951 | 251 |
| 660 | 3300046459 | Ga0495629_0155247 | Ga0495629_0155247_429_1307 | 251 |
| 661 | 3300046460 | Ga0495638_0078207 | Ga0495638_0078207_332_1096 | 251 |
| 662 | 3300046462 | Ga0495651_0074425 | Ga0495651_0074425_1244_2122 | 251 |
| 663 | 3300046463 | Ga0495653_0109074 | Ga0495653_0109074_179_1057 | 251 |
| 664 | 3300046473 | Ga0495582_0034330 | Ga0495582_0034330_1856_2734 | 251 |
| 665 | 3300046476 | Ga0495662_0017641 | Ga0495662_0017641_318_1196 | 251 |
| 666 | 3300046477 | Ga0495664_0131509 | Ga0495664_0131509_145_1023 | 251 |
| 667 | 3300046511 | Ga0495608_0035937 | Ga0495608_0035937_1687_2565 | 251 |
| 668 | 3300046514 | Ga0495618_0122996 | Ga0495618_0122996_287_1165 | 251 |
| 669 | 3300046533 | Ga0495640_0077283 | Ga0495640_0077283_714_1592 | 251 |
| 670 | 3300046536 | Ga0495587_0030451 | Ga0495587_0030451_272_1150 | 251 |
| 671 | 3300046559 | Ga0495667_0096230 | Ga0495667_0096230_860_1738 | 251 |
| 672 | 3300046642 | Ga0495634_0020643 | Ga0495634_0020643_273_1151 | 251 |
| 673 | 3300046678 | Ga0495599_0088226 | Ga0495599_0088226_75_953 | 251 |
| 674 | 3300046679 | Ga0495623_0020840 | Ga0495623_0020840_107_985 | 251 |
| 675 | 3300046680 | Ga0495646_0082200 | Ga0495646_0082200_423_1301 | 251 |
| 676 | 3300046683 | Ga0495658_0026533 | Ga0495658_0026533_435_1313 | 251 |
| 677 | 3300046689 | Ga0495613_0150575 | Ga0495613_0150575_345_1223 | 251 |
| 678 | 3300046809 | Ga0495600_0034947 | Ga0495600_0034947_611_1489 | 251 |
| 679 | 3300047315 | Ga0495581_0035219 | Ga0495581_0035219_659_1537 | 251 |
| 680 | 3300047321 | Ga0495676_0181609 | Ga0495676_0181609_561_1439 | 251 |
| 681 | 3300047322 | Ga0495680_0032570 | Ga0495680_0032570_2415_3293 | 251 |
| 682 | 3300047444 | Ga0495675_0204279 | Ga0495675_0204279_223_1101 | 251 |
| 683 | 3300047471 | Ga0495684_0060711 | Ga0495684_0060711_327_1205 | 251 |
| 684 | 3300048088 | Ga0495602_0186852 | Ga0495602_0186852_46_924 | 251 |
| 685 | 3300048904 | Ga0496101_0335949 | Ga0496101_0335949_366_1169 | 251 |
| 686 | 3300048917 | Ga0496114_0345250 | Ga0496114_0345250_499_1302 | 251 |
| 687 | 3300049568 | Ga0501031_0024185 | Ga0501031_0024185_158_1042 | 251 |
| 688 | 3300049574 | Ga0501038_0005612 | Ga0501038_0005612_3062_3946 | 251 |
| 689 | 3300049576 | Ga0501040_0001937 | Ga0501040_0001937_7965_8849 | 251 |
| 690 | 3300049582 | Ga0501048_0016989 | Ga0501048_0016989_2980_3864 | 251 |
| 691 | 3300049584 | Ga0501068_0079893 | Ga0501068_0079893_1063_1947 | 251 |
| 692 | 3300049588 | Ga0501072_0078480 | Ga0501072_0078480_202_1086 | 251 |
| 693 | 3300049590 | Ga0501074_0019890 | Ga0501074_0019890_199_1083 | 251 |
| 694 | 3300049591 | Ga0501075_0032259 | Ga0501075_0032259_205_1089 | 251 |
| 695 | 3300049743 | Ga0501081_0003946 | Ga0501081_0003946_1830_2714 | 251 |
| 696 | 3300049744 | Ga0501083_0282246 | Ga0501083_0282246_77_961 | 251 |
| 697 | 3300049822 | Ga0501035_0185937 | Ga0501035_0185937_415_1299 | 251 |
| 698 | 3300049824 | Ga0501045_0011600 | Ga0501045_0011600_2961_3845 | 251 |
| 699 | 3300053078 | Ga0495612_0064256 | Ga0495612_0064256_585_1463 | 251 |
| 700 | 3300053084 | Ga0495595_0025606 | Ga0495595_0025606_1679_2557 | 251 |
| 701 | 3300053085 | Ga0495619_0218074 | Ga0495619_0218074_223_1101 | 251 |
| 702 | 3300054114 | Ga0501084_0019434 | Ga0501084_0019434_2709_3593 | 251 |
| 703 | 3300060353 | Ga0501082_0031215 | Ga0501082_0031215_1857_2741 | 251 |
| 704 | 3300005435 | Ga0070714_100111427 | Ga0070714_1001114272 | 252 |
| 705 | 3300005436 | Ga0070713_100017740 | Ga0070713_1000177408 | 252 |
| 706 | 3300006871 | Ga0075434_100011783 | Ga0075434_1000117834 | 252 |
| 707 | 3300007076 | Ga0075435_100021448 | Ga0075435_1000214487 | 252 |
| 708 | 3300009147 | Ga0114129_10361442 | Ga0114129_103614423 | 252 |
| 709 | 3300025898 | Ga0207692_10107647 | Ga0207692_101076472 | 252 |
| 710 | 3300025906 | Ga0207699_10181130 | Ga0207699_101811301 | 252 |
| 711 | 3300025928 | Ga0207700_10005292 | Ga0207700_100052929 | 252 |
| 712 | 3300025929 | Ga0207664_10035879 | Ga0207664_100358792 | 252 |
| 713 | 3300031616 | Ga0307508_10010752 | Ga0307508_100107522 | 252 |
| 714 | 3300046543 | Ga0495645_0054136 | Ga0495645_0054136_651_1478 | 252 |
| 715 | 3300021388 | Ga0213875_10001641 | Ga0213875_1000164118 | 253 |
| 716 | 3300031731 | Ga0307405_10310188 | Ga0307405_103101882 | 253 |
| 717 | 3300035086 | Ga0373934_0046557 | Ga0373934_0046557_451_1269 | 253 |
| 718 | 3300035111 | Ga0373923_0005382 | Ga0373923_0005382_2032_2850 | 253 |
| 719 | 3300035113 | Ga0373936_0002996 | Ga0373936_0002996_2985_3803 | 253 |
| 720 | 3300035113 | Ga0373936_0122412 | Ga0373936_0122412_202_1014 | 253 |
| 721 | 3300035118 | Ga0373954_0062170 | Ga0373954_0062170_282_1100 | 253 |
| 722 | 3300035118 | Ga0373954_0099620 | Ga0373954_0099620_446_1330 | 253 |
| 723 | 3300035119 | Ga0373956_0005479 | Ga0373956_0005479_2451_3269 | 253 |
| 724 | 3300035170 | Ga0373943_0040035 | Ga0373943_0040035_43_927 | 253 |
| 725 | 3300035410 | Ga0373924_0006314 | Ga0373924_0006314_16_834 | 253 |
| 726 | 3300035692 | Ga0373935_0028094 | Ga0373935_0028094_2032_2850 | 253 |
| 727 | 3300035695 | Ga0373927_0165752 | Ga0373927_0165752_44_928 | 253 |
| 728 | 3300035724 | Ga0373933_0097095 | Ga0373933_0097095_343_1161 | 253 |
| 729 | 3300036401 | Ga0373937_0038707 | Ga0373937_0038707_3480_4298 | 253 |
| 730 | 3300036401 | Ga0373937_0300395 | Ga0373937_0300395_397_1275 | 253 |
| 731 | 3300037418 | Ga0395900_0024834 | Ga0395900_0024834_1715_2491 | 253 |
| 732 | 3300037853 | Ga0436364_0553397 | Ga0436364_0553397_2878_3738 | 253 |
| 733 | 3300038443 | Ga0395901_0004408 | Ga0395901_0004408_9423_10199 | 253 |
| 734 | 3300042993 | Ga0439440_0010001 | Ga0439440_0010001_372_1175 | 253 |
| 735 | 3300046461 | Ga0495641_0056815 | Ga0495641_0056815_664_1482 | 253 |
| 736 | 3300046462 | Ga0495651_0044372 | Ga0495651_0044372_2032_2850 | 253 |
| 737 | 3300046473 | Ga0495582_0002973 | Ga0495582_0002973_5516_6334 | 253 |
| 738 | 3300046475 | Ga0495639_0063947 | Ga0495639_0063947_171_989 | 253 |
| 739 | 3300046476 | Ga0495662_0004321 | Ga0495662_0004321_4947_5765 | 253 |
| 740 | 3300046477 | Ga0495664_0087529 | Ga0495664_0087529_35_853 | 253 |
| 741 | 3300046511 | Ga0495608_0074240 | Ga0495608_0074240_1018_1836 | 253 |
| 742 | 3300046514 | Ga0495618_0175575 | Ga0495618_0175575_35_853 | 253 |
| 743 | 3300046516 | Ga0495628_0050820 | Ga0495628_0050820_1928_2746 | 253 |
| 744 | 3300046529 | Ga0495652_0119182 | Ga0495652_0119182_627_1445 | 253 |
| 745 | 3300046531 | Ga0495665_0005814 | Ga0495665_0005814_1325_2143 | 253 |
| 746 | 3300046535 | Ga0495586_0032966 | Ga0495586_0032966_1929_2747 | 253 |
| 747 | 3300046536 | Ga0495587_0268481 | Ga0495587_0268481_24_842 | 253 |
| 748 | 3300046543 | Ga0495645_0010064 | Ga0495645_0010064_1623_2441 | 253 |
| 749 | 3300046642 | Ga0495634_0102267 | Ga0495634_0102267_405_1223 | 253 |
| 750 | 3300046663 | Ga0495635_0032021 | Ga0495635_0032021_2451_3269 | 253 |
| 751 | 3300046675 | Ga0495657_0007964 | Ga0495657_0007964_3825_4643 | 253 |
| 752 | 3300046678 | Ga0495599_0075304 | Ga0495599_0075304_626_1444 | 253 |
| 753 | 3300046679 | Ga0495623_0035880 | Ga0495623_0035880_1133_1951 | 253 |
| 754 | 3300046680 | Ga0495646_0010588 | Ga0495646_0010588_2005_2823 | 253 |
| 755 | 3300046683 | Ga0495658_0263171 | Ga0495658_0263171_154_972 | 253 |
| 756 | 3300046689 | Ga0495613_0048343 | Ga0495613_0048343_115_933 | 253 |
| 757 | 3300046690 | Ga0495624_0063452 | Ga0495624_0063452_1280_2098 | 253 |
| 758 | 3300047315 | Ga0495581_0052815 | Ga0495581_0052815_1318_2136 | 253 |
| 759 | 3300047319 | Ga0495674_0158922 | Ga0495674_0158922_664_1482 | 253 |
| 760 | 3300047471 | Ga0495684_0047171 | Ga0495684_0047171_2451_3269 | 253 |
| 761 | 3300048089 | Ga0495614_0016302 | Ga0495614_0016302_1779_2597 | 253 |
| 762 | 3300048908 | Ga0496105_0072964 | Ga0496105_0072964_691_1533 | 253 |
| 763 | 3300048912 | Ga0496109_0087190 | Ga0496109_0087190_681_1523 | 253 |
| 764 | 3300048913 | Ga0496110_0109059 | Ga0496110_0109059_162_1004 | 253 |
| 765 | 3300048918 | Ga0496115_0229223 | Ga0496115_0229223_36_878 | 253 |
| 766 | 3300049586 | Ga0501070_0002854 | Ga0501070_0002854_1057_1986 | 253 |
| 767 | 3300049742 | Ga0501080_0167277 | Ga0501080_0167277_770_1699 | 253 |
| 768 | 3300050512 | nmdc:mga0n895_149698_c1 | nmdc:mga0n895_149698_c1_726_1526 | 253 |
| 769 | 3300053077 | Ga0495601_0018762 | Ga0495601_0018762_406_1224 | 253 |
| 770 | 3300053078 | Ga0495612_0093363 | Ga0495612_0093363_66_884 | 253 |
| 771 | 3300053084 | Ga0495595_0021864 | Ga0495595_0021864_409_1227 | 253 |
| 772 | 3300053085 | Ga0495619_0032529 | Ga0495619_0032529_626_1444 | 253 |
| 773 | 3300053153 | Ga0500616_0003740 | Ga0500616_0003740_7615_8412 | 253 |
| 774 | 3300021388 | Ga0213875_10009989 | Ga0213875_100099896 | 254 |
| 775 | 3300024225 | Ga0224572_1017956 | Ga0224572_10179562 | 254 |
| 776 | 3300028563 | Ga0265319_1028149 | Ga0265319_10281492 | 254 |
| 777 | 3300028577 | Ga0265318_10001695 | Ga0265318_100016958 | 254 |
| 778 | 3300031995 | Ga0307409_100216504 | Ga0307409_1002165042 | 254 |
| 779 | 3300037853 | Ga0436364_0910455 | Ga0436364_0910455_2300_3091 | 254 |
| 780 | 3300044694 | Ga0466963_0104837 | Ga0466963_0104837_94_1002 | 254 |
| 781 | 3300045976 | Ga0466967_0000799 | Ga0466967_0000799_7353_8222 | 254 |
| 782 | 3300049569 | Ga0501032_0000108 | Ga0501032_0000108_35913_36773 | 254 |
| 783 | 3300049570 | Ga0501033_0000164 | Ga0501033_0000164_42262_43122 | 254 |
| 784 | 3300049571 | Ga0501034_0003397 | Ga0501034_0003397_14255_15115 | 254 |
| 785 | 3300049572 | Ga0501036_0001671 | Ga0501036_0001671_14661_15521 | 254 |
| 786 | 3300049573 | Ga0501037_0007348 | Ga0501037_0007348_135_995 | 254 |
| 787 | 3300049574 | Ga0501038_0000161 | Ga0501038_0000161_20559_21419 | 254 |
| 788 | 3300049575 | Ga0501039_0001976 | Ga0501039_0001976_141_1001 | 254 |
| 789 | 3300049576 | Ga0501040_0215696 | Ga0501040_0215696_198_1058 | 254 |
| 790 | 3300049578 | Ga0501042_0185078 | Ga0501042_0185078_665_1483 | 254 |
| 791 | 3300049579 | Ga0501043_0000221 | Ga0501043_0000221_43855_44715 | 254 |
| 792 | 3300049580 | Ga0501046_0000414 | Ga0501046_0000414_33784_34644 | 254 |
| 793 | 3300049581 | Ga0501047_0004081 | Ga0501047_0004081_9436_10296 | 254 |
| 794 | 3300049582 | Ga0501048_0001170 | Ga0501048_0001170_8372_9232 | 254 |
| 795 | 3300049583 | Ga0501067_0009083 | Ga0501067_0009083_2485_3345 | 254 |
| 796 | 3300049585 | Ga0501069_0001513 | Ga0501069_0001513_5887_6747 | 254 |
| 797 | 3300049586 | Ga0501070_0001610 | Ga0501070_0001610_4563_5423 | 254 |
| 798 | 3300049590 | Ga0501074_0000924 | Ga0501074_0000924_16080_16940 | 254 |
| 799 | 3300049592 | Ga0501076_0270765 | Ga0501076_0270765_257_1117 | 254 |
| 800 | 3300049744 | Ga0501083_0003637 | Ga0501083_0003637_686_1546 | 254 |
| 801 | 3300049822 | Ga0501035_0003384 | Ga0501035_0003384_8685_9545 | 254 |
| 802 | 3300049823 | Ga0501044_0004084 | Ga0501044_0004084_8462_9322 | 254 |
| 803 | 3300054114 | Ga0501084_0006421 | Ga0501084_0006421_3673_4533 | 254 |
| 804 | 3300005535 | Ga0070684_100126215 | Ga0070684_1001262153 | 255 |
| 805 | 3300005985 | Ga0081539_10008348 | Ga0081539_100083481 | 255 |
| 806 | 3300025915 | Ga0207693_10325511 | Ga0207693_103255112 | 255 |
| 807 | 3300030522 | Ga0307512_10009621 | Ga0307512_100096217 | 255 |
| 808 | 3300049585 | Ga0501069_0052427 | Ga0501069_0052427_29_952 | 255 |
| 809 | 3300005983 | Ga0081540_1010306 | Ga0081540_10103065 | 256 |
| 810 | 3300005985 | Ga0081539_10029700 | Ga0081539_100297005 | 256 |
| 811 | 3300006042 | Ga0075368_10001498 | Ga0075368_100014982 | 256 |
| 812 | 3300006178 | Ga0075367_10000161 | Ga0075367_1000016124 | 256 |
| 813 | 3300025885 | Ga0207653_10025778 | Ga0207653_100257783 | 256 |
| 814 | 3300027866 | Ga0209813_10054016 | Ga0209813_100540161 | 256 |
| 815 | 3300038443 | Ga0395901_0101464 | Ga0395901_0101464_1909_2718 | 256 |
| 816 | 3300050494 | nmdc:mga06z11_36123_c1 | nmdc:mga06z11_36123_c1_435_1331 | 256 |
| 817 | 3300050495 | nmdc:mga04h51_1057_c1 | nmdc:mga04h51_1057_c1_245_1141 | 256 |
| 818 | 3300005981 | Ga0081538_10043437 | Ga0081538_100434374 | 257 |
| 819 | 3300037853 | Ga0436364_1051289 | Ga0436364_1051289_1003_1812 | 257 |
| 820 | 3300050514 | nmdc:mga08x19_35671_c1 | nmdc:mga08x19_35671_c1_1902_2771 | 257 |
| 821 | 3300003373 | JGI25407J50210_10026255 | JGI25407J50210_100262551 | 258 |
| 822 | 3300005616 | Ga0068852_100368253 | Ga0068852_1003682532 | 258 |
| 823 | 3300005840 | Ga0068870_10014788 | Ga0068870_100147883 | 258 |
| 824 | 3300005842 | Ga0068858_100653739 | Ga0068858_1006537391 | 258 |
| 825 | 3300005981 | Ga0081538_10000336 | Ga0081538_1000033621 | 258 |
| 826 | 3300013105 | Ga0157369_10076989 | Ga0157369_100769894 | 258 |
| 827 | 3300014325 | Ga0163163_10178095 | Ga0163163_101780952 | 258 |
| 828 | 3300025908 | Ga0207643_10006930 | Ga0207643_100069305 | 258 |
| 829 | 3300025925 | Ga0207650_10201397 | Ga0207650_102013973 | 258 |
| 830 | 3300049570 | Ga0501033_0108179 | Ga0501033_0108179_1050_1946 | 258 |
| 831 | 3300049822 | Ga0501035_0168317 | Ga0501035_0168317_42_938 | 258 |
| 832 | iso_pu_bacteria | 2799112218 | 2799186426 | 258 |
| 833 | 3300006844 | Ga0075428_100067912 | Ga0075428_1000679122 | 259 |
| 834 | 3300006846 | Ga0075430_100042918 | Ga0075430_1000429183 | 259 |
| 835 | 3300006847 | Ga0075431_100070701 | Ga0075431_1000707014 | 259 |
| 836 | 3300006880 | Ga0075429_100032146 | Ga0075429_1000321464 | 259 |
| 837 | 3300009094 | Ga0111539_10548579 | Ga0111539_105485792 | 259 |
| 838 | 3300009147 | Ga0114129_10393954 | Ga0114129_103939542 | 259 |
| 839 | 3300009147 | Ga0114129_10407784 | Ga0114129_104077842 | 259 |
| 840 | 3300027907 | Ga0207428_10307592 | Ga0207428_103075922 | 259 |
| 841 | 3300050507 | nmdc:mga05p37_550379_c1 | nmdc:mga05p37_550379_c1_314_1195 | 259 |
| 842 | 3300050508 | nmdc:mga09592_55171_c1 | nmdc:mga09592_55171_c1_1516_2397 | 259 |
| 843 | 3300050509 | nmdc:mga0qj67_74946_c1 | nmdc:mga0qj67_74946_c1_135_1016 | 259 |
| 844 | 3300050510 | nmdc:mga06r32_18140_c1 | nmdc:mga06r32_18140_c1_5057_5938 | 259 |
| 845 | 3300050511 | nmdc:mga08y16_611392_c1 | nmdc:mga08y16_611392_c1_57_938 | 259 |
| 846 | 3300041999 | Ga0439433_0000431 | Ga0439433_0000431_2979_3800 | 260 |
| 847 | 3300042002 | Ga0439442_002517 | Ga0439442_002517_811_1632 | 260 |
| 848 | 3300042156 | Ga0439446_0006770 | Ga0439446_0006770_1771_2592 | 260 |
| 849 | 3300048907 | Ga0496104_0000722 | Ga0496104_0000722_12741_13589 | 260 |
| 850 | 3300048910 | Ga0496107_0143703 | Ga0496107_0143703_55_909 | 260 |
| 851 | 3300048917 | Ga0496114_0061195 | Ga0496114_0061195_1232_2086 | 260 |
| 852 | 3300050511 | nmdc:mga08y16_488186_c1 | nmdc:mga08y16_488186_c1_347_1207 | 260 |
| 853 | 3300005327 | Ga0070658_10180420 | Ga0070658_101804202 | 261 |
| 854 | 3300014325 | Ga0163163_10745178 | Ga0163163_107451781 | 261 |
| 855 | 3300025908 | Ga0207643_10049781 | Ga0207643_100497814 | 261 |
| 856 | 3300031731 | Ga0307405_10010719 | Ga0307405_100107194 | 261 |
| 857 | 3300031824 | Ga0307413_10265286 | Ga0307413_102652862 | 261 |
| 858 | 3300031852 | Ga0307410_10045905 | Ga0307410_100459054 | 261 |
| 859 | 3300031901 | Ga0307406_10157953 | Ga0307406_101579532 | 261 |
| 860 | 3300031903 | Ga0307407_10000233 | Ga0307407_1000023315 | 261 |
| 861 | 3300032002 | Ga0307416_100003770 | Ga0307416_1000037704 | 261 |
| 862 | 3300032005 | Ga0307411_10049442 | Ga0307411_100494424 | 261 |
| 863 | 3300042461 | Ga0439460_0003952 | Ga0439460_0003952_806_1660 | 261 |
| 864 | 3300050507 | nmdc:mga05p37_302572_c1 | nmdc:mga05p37_302572_c1_504_1325 | 261 |
| 865 | 3300025942 | Ga0207689_10131963 | Ga0207689_101319633 | 262 |
| 866 | 3300025944 | Ga0207661_10435719 | Ga0207661_104357192 | 262 |
| 867 | 3300044694 | Ga0466963_0069603 | Ga0466963_0069603_550_1383 | 262 |
| 868 | 3300045976 | Ga0466967_0039141 | Ga0466967_0039141_677_1510 | 262 |
| 869 | 3300048907 | Ga0496104_0020574 | Ga0496104_0020574_5040_5888 | 262 |
| 870 | 3300048908 | Ga0496105_0361653 | Ga0496105_0361653_161_1009 | 262 |
| 871 | 3300048911 | Ga0496108_0022746 | Ga0496108_0022746_1760_2608 | 262 |
| 872 | 3300048912 | Ga0496109_0003779 | Ga0496109_0003779_11055_11903 | 262 |
| 873 | 3300048913 | Ga0496110_0010416 | Ga0496110_0010416_178_1026 | 262 |
| 874 | 3300048914 | Ga0496111_0002767 | Ga0496111_0002767_1360_2208 | 262 |
| 875 | 3300048916 | Ga0496113_0095449 | Ga0496113_0095449_1274_2122 | 262 |
| 876 | 3300061734 | Ga0530510_0300213 | Ga0530510_0300213_323_1147 | 262 |
| 877 | 3300026035 | Ga0207703_10428403 | Ga0207703_104284031 | 263 |
| 878 | 3300042438 | Ga0439459_0022074 | Ga0439459_0022074_107_976 | 263 |
| 879 | 3300048912 | Ga0496109_0005143 | Ga0496109_0005143_7087_7917 | 263 |
| 880 | 3300048913 | Ga0496110_0378805 | Ga0496110_0378805_390_1220 | 263 |
| 881 | 3300005985 | Ga0081539_10026756 | Ga0081539_100267564 | 264 |
| 882 | 3300031995 | Ga0307409_100033193 | Ga0307409_1000331936 | 264 |
| 883 | 3300005985 | Ga0081539_10037336 | Ga0081539_100373364 | 265 |
| 884 | 3300033179 | Ga0307507_10020421 | Ga0307507_100204211 | 265 |
| 885 | 3300046454 | Ga0495592_0009147 | Ga0495592_0009147_2628_3548 | 265 |
| 886 | 3300046459 | Ga0495629_0041055 | Ga0495629_0041055_21_941 | 265 |
| 887 | 3300046473 | Ga0495582_0135691 | Ga0495582_0135691_179_1099 | 265 |
| 888 | 3300046476 | Ga0495662_0003716 | Ga0495662_0003716_5730_6650 | 265 |
| 889 | 3300046477 | Ga0495664_0037535 | Ga0495664_0037535_1919_2839 | 265 |
| 890 | 3300046514 | Ga0495618_0044785 | Ga0495618_0044785_399_1319 | 265 |
| 891 | 3300046536 | Ga0495587_0004895 | Ga0495587_0004895_6044_6964 | 265 |
| 892 | 3300046642 | Ga0495634_0015156 | Ga0495634_0015156_272_1192 | 265 |
| 893 | 3300046663 | Ga0495635_0002971 | Ga0495635_0002971_2189_3109 | 265 |
| 894 | 3300046675 | Ga0495657_0002488 | Ga0495657_0002488_6960_7880 | 265 |
| 895 | 3300046679 | Ga0495623_0209598 | Ga0495623_0209598_16_936 | 265 |
| 896 | 3300046680 | Ga0495646_0002179 | Ga0495646_0002179_2777_3697 | 265 |
| 897 | 3300046683 | Ga0495658_0025839 | Ga0495658_0025839_1472_2392 | 265 |
| 898 | 3300046809 | Ga0495600_0042054 | Ga0495600_0042054_272_1192 | 265 |
| 899 | 3300047317 | Ga0495604_0004151 | Ga0495604_0004151_7485_8405 | 265 |
| 900 | 3300047321 | Ga0495676_0009620 | Ga0495676_0009620_3305_4225 | 265 |
| 901 | 3300047673 | Ga0495593_0003493 | Ga0495593_0003493_6164_7084 | 265 |
| 902 | 3300048089 | Ga0495614_0000979 | Ga0495614_0000979_3241_4161 | 265 |
| 903 | 3300049568 | Ga0501031_0035251 | Ga0501031_0035251_355_1170 | 265 |
| 904 | 3300049570 | Ga0501033_0006788 | Ga0501033_0006788_7574_8389 | 265 |
| 905 | 3300049574 | Ga0501038_0012178 | Ga0501038_0012178_2285_3100 | 265 |
| 906 | 3300049575 | Ga0501039_0014708 | Ga0501039_0014708_4380_5195 | 265 |
| 907 | 3300049576 | Ga0501040_0016228 | Ga0501040_0016228_2831_3646 | 265 |
| 908 | 3300049577 | Ga0501041_0004430 | Ga0501041_0004430_6701_7516 | 265 |
| 909 | 3300049580 | Ga0501046_0000945 | Ga0501046_0000945_21580_22395 | 265 |
| 910 | 3300049582 | Ga0501048_0015701 | Ga0501048_0015701_309_1124 | 265 |
| 911 | 3300049591 | Ga0501075_0000524 | Ga0501075_0000524_4052_4867 | 265 |
| 912 | 3300049592 | Ga0501076_0015358 | Ga0501076_0015358_3525_4340 | 265 |
| 913 | 3300049743 | Ga0501081_0022951 | Ga0501081_0022951_433_1248 | 265 |
| 914 | 3300049824 | Ga0501045_0000342 | Ga0501045_0000342_5084_5899 | 265 |
| 915 | 3300060353 | Ga0501082_0001187 | Ga0501082_0001187_589_1404 | 265 |
| 916 | 3300061734 | Ga0530510_0046592 | Ga0530510_0046592_2200_3015 | 265 |
| 917 | 3300046689 | Ga0495613_0001226 | Ga0495613_0001226_9625_10545 | 268 |
| 918 | 3300053085 | Ga0495619_0049148 | Ga0495619_0049148_584_1504 | 268 |
| 919 | iso_pu_bacteria | 2784746768 | 2785368584 | 268 |
| 920 | 3300005937 | Ga0081455_10096526 | Ga0081455_100965264 | 269 |
| 921 | 3300005981 | Ga0081538_10021539 | Ga0081538_100215392 | 270 |
| 922 | 3300046690 | Ga0495624_0096144 | Ga0495624_0096144_35_955 | 270 |
| 923 | 3300005981 | Ga0081538_10006601 | Ga0081538_100066017 | 272 |
| 924 | 3300031730 | Ga0307516_10001550 | Ga0307516_1000155022 | 272 |
| 925 | 3300033180 | Ga0307510_10042591 | Ga0307510_100425916 | 272 |
| 926 | 3300046452 | Ga0495617_078920 | Ga0495617_078920_74_967 | 272 |
| 927 | 3300046455 | Ga0495603_0032222 | Ga0495603_0032222_2002_2895 | 272 |
| 928 | 3300046459 | Ga0495629_0171078 | Ga0495629_0171078_393_1286 | 272 |
| 929 | 3300046474 | Ga0495605_0005430 | Ga0495605_0005430_2227_3120 | 272 |
| 930 | 3300046492 | Ga0495585_0014007 | Ga0495585_0014007_2141_3034 | 272 |
| 931 | 3300046499 | Ga0495594_0008442 | Ga0495594_0008442_3106_3999 | 272 |
| 932 | 3300046501 | Ga0495607_0039083 | Ga0495607_0039083_1531_2424 | 272 |
| 933 | 3300046506 | Ga0495583_0006670 | Ga0495583_0006670_2115_3008 | 272 |
| 934 | 3300046507 | Ga0495606_0014087 | Ga0495606_0014087_1933_2826 | 272 |
| 935 | 3300046512 | Ga0495610_0034389 | Ga0495610_0034389_158_1051 | 272 |
| 936 | 3300046515 | Ga0495620_0004863 | Ga0495620_0004863_4546_5439 | 272 |
| 937 | 3300046518 | Ga0495631_0022562 | Ga0495631_0022562_1950_2843 | 272 |
| 938 | 3300046526 | Ga0495666_0001571 | Ga0495666_0001571_289_1182 | 272 |
| 939 | 3300046542 | Ga0495597_0063195 | Ga0495597_0063195_692_1585 | 272 |
| 940 | 3300046557 | Ga0495622_0001625 | Ga0495622_0001625_7460_8353 | 272 |
| 941 | 3300046616 | Ga0495668_0006862 | Ga0495668_0006862_1939_2832 | 272 |
| 942 | 3300046660 | Ga0495625_0005158 | Ga0495625_0005158_1828_2721 | 272 |
| 943 | 3300046690 | Ga0495624_0090033 | Ga0495624_0090033_576_1469 | 272 |
| 944 | 3300046810 | Ga0495660_0001825 | Ga0495660_0001825_6686_7579 | 272 |
| 945 | 3300047321 | Ga0495676_0052211 | Ga0495676_0052211_934_1827 | 272 |
| 946 | 3300047323 | Ga0495683_0004421 | Ga0495683_0004421_4349_5242 | 272 |
| 947 | 3300047447 | Ga0495685_010177 | Ga0495685_010177_934_1827 | 272 |
| 948 | 3300047472 | Ga0495686_0235339 | Ga0495686_0235339_119_1012 | 272 |
| 949 | 3300048089 | Ga0495614_0026085 | Ga0495614_0026085_384_1277 | 272 |
| 950 | 3300048091 | Ga0495626_0077053 | Ga0495626_0077053_564_1457 | 272 |
| 951 | 3300003373 | JGI25407J50210_10027708 | JGI25407J50210_100277082 | 273 |
| 952 | 3300005981 | Ga0081538_10159762 | Ga0081538_101597621 | 273 |
| 953 | 3300047447 | Ga0495685_020744 | Ga0495685_020744_1326_2219 | 273 |
| 954 | 3300006846 | Ga0075430_100056542 | Ga0075430_1000565422 | 274 |
| 955 | 3300006847 | Ga0075431_100130426 | Ga0075431_1001304261 | 274 |
| 956 | 3300006852 | Ga0075433_10014254 | Ga0075433_100142546 | 274 |
| 957 | 3300006880 | Ga0075429_100020176 | Ga0075429_1000201766 | 274 |
| 958 | 3300009094 | Ga0111539_10003901 | Ga0111539_100039018 | 274 |
| 959 | 3300027907 | Ga0207428_10034425 | Ga0207428_100344253 | 274 |
| 960 | 3300050507 | nmdc:mga05p37_46934_c1 | nmdc:mga05p37_46934_c1_1094_1960 | 274 |
| 961 | 3300050508 | nmdc:mga09592_60941_c1 | nmdc:mga09592_60941_c1_1094_1960 | 274 |
| 962 | 3300050509 | nmdc:mga0qj67_37339_c1 | nmdc:mga0qj67_37339_c1_1232_2098 | 274 |
| 963 | 3300050510 | nmdc:mga06r32_69469_c1 | nmdc:mga06r32_69469_c1_1705_2571 | 274 |
| 964 | 3300050511 | nmdc:mga08y16_59203_c1 | nmdc:mga08y16_59203_c1_1778_2644 | 274 |
| 965 | 3300050515 | nmdc:mga0a205_9843_c1 | nmdc:mga0a205_9843_c1_5159_6025 | 274 |
| 966 | 3300005981 | Ga0081538_10000556 | Ga0081538_1000055620 | 276 |
| 967 | 3300032002 | Ga0307416_100013836 | Ga0307416_1000138365 | 276 |
| 968 | 3300032004 | Ga0307414_10167045 | Ga0307414_101670452 | 276 |
| 969 | 3300032126 | Ga0307415_100005171 | Ga0307415_1000051717 | 276 |
| 970 | 3300005981 | Ga0081538_10102767 | Ga0081538_101027672 | 277 |
| 971 | 3300031903 | Ga0307407_10062285 | Ga0307407_100622852 | 277 |
| 972 | 3300031911 | Ga0307412_10108067 | Ga0307412_101080671 | 277 |
| 973 | 3300032005 | Ga0307411_10058446 | Ga0307411_100584465 | 277 |
| 974 | 3300037418 | Ga0395900_0243967 | Ga0395900_0243967_69_941 | 277 |
| 975 | 3300009094 | Ga0111539_10370663 | Ga0111539_103706632 | 278 |
| 976 | 3300031548 | Ga0307408_100277958 | Ga0307408_1002779582 | 278 |
| 977 | 3300031731 | Ga0307405_10325169 | Ga0307405_103251692 | 278 |
| 978 | 3300031852 | Ga0307410_10073917 | Ga0307410_100739171 | 278 |
| 979 | 3300031995 | Ga0307409_100003046 | Ga0307409_1000030464 | 278 |
| 980 | 3300032002 | Ga0307416_100085957 | Ga0307416_1000859573 | 278 |
| 981 | 3300032002 | Ga0307416_100345875 | Ga0307416_1003458752 | 278 |
| 982 | 3300032126 | Ga0307415_100036005 | Ga0307415_1000360054 | 278 |
| 983 | 3300042005 | Ga0439448_0032520 | Ga0439448_0032520_529_1407 | 278 |
| 984 | 3300042012 | Ga0439455_0007276 | Ga0439455_0007276_372_1250 | 278 |
| 985 | 3300042016 | Ga0439463_001816 | Ga0439463_001816_2759_3637 | 278 |
| 986 | 3300042439 | Ga0439464_0001242 | Ga0439464_0001242_840_1718 | 278 |
| 987 | 3300042993 | Ga0439440_0000085 | Ga0439440_0000085_1928_2806 | 278 |
| 988 | 3300031731 | Ga0307405_10045762 | Ga0307405_100457624 | 280 |
| 989 | 3300031901 | Ga0307406_10025356 | Ga0307406_100253564 | 280 |
| 990 | 3300031995 | Ga0307409_100077230 | Ga0307409_1000772303 | 280 |
| 991 | 3300032126 | Ga0307415_100003679 | Ga0307415_1000036797 | 280 |
| 992 | 3300003203 | JGI25406J46586_10003631 | JGI25406J46586_100036315 | 286 |
| 993 | 3300005985 | Ga0081539_10003891 | Ga0081539_100038915 | 286 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5kok-assembly1.cif.gz_B | pavine n-methyltransferase in complex with tetrahydropapaverine and s-adenosylhomocysteine ph 7.25 | 0.9074 | 77 | 194 |
| 7v6h-assembly2.cif.gz_B | crystal structure of the spnl | 0.8935 | 80 | 247 |
| 5dpl-assembly1.cif.gz_B | the structure of pkmt2 from rickettsia typhi in complex with adohcy | 0.8839 | 85 | 192 |
| 2yxe-assembly1.cif.gz_B | crystal structure of l-isoaspartyl protein carboxyl methyltranferase | 0.8783 | 82 | 190 |
| 6gkz-assembly1.cif.gz_A | crystal structure of coclaurine n-methyltransferase (cnmt) bound to n-methylheliamine and sah | 0.877 | 77 | 194 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4E3J0_145_404_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9896 | 84 | 147 | 3.40.50.150 |
| af_Q55DF6_53_245_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9546 | 82 | 140 | 3.40.50.150 |
| af_C0H5A2_481_622_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.949 | 85 | 142 | 3.40.50.150 |
| af_K7LTE4_237_888_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9472 | 82 | 145 | 3.40.50.150 |
| af_A0A1D6EFY7_537_616_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9456 | 80 | 145 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Z4T6Q9-F1-model_v4 | deleted | 0.9762 | 81 | 188 |
|
| AF-J7T967-F1-model_v4 | deleted | 0.9713 | 70 | 200 |
|
| AF-A0A2H0AUX0-F1-model_v4 | Methyltransferase domain-containing protein | 0.9707 | 82 | 140 |
GO:0016020
|
| AF-A0A838J840-F1-model_v4 | Arsenite methyltransferase (EC 2.1.1.137) | 0.9667 | 61 | 162 |
GO:0008168
GO:0032259 |
| AF-A0A848UHI9-F1-model_v4 | Arsenite methyltransferase (EC 2.1.1.137) | 0.9601 | 83 | 257 |
GO:0008168
GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar