F487660

General Info

Members Datasets Scaffolds Average Seq Length
992 348 961 307

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10006162|Ga0114129_100061628
Length 364
Sequence LLIAPSHDEAVHRRIGEIAYIGQGNELGALTAQAGAGFISGYADKSGHLYQLYEDAMTAAQELNQAGRYELSHLRSLEAEAIHIIREVAAEFERPVLLFSGGKDSIVMLHLALKAFRPGRLPFPVMHVDTGHNFDEVLQTRDELVEEAGVRLIVAKVQDDIDAGRVVETIPSRNPLQTVTLLRAIRENKFDAAFGGARRDEEKARAKERVFSFRDEFGQWDPKAQRPELWNLYNGRHHKGEHIRVFPLSNWTEFDIWSYIGAEKIKLPSIYYAHPRNVFQRDGMLLAVHRYLQPRKDEEVVEKTVRFRTVGDVTCTGCVESLAGTVSEVIAETAVSRLTERGATRADDRISEAGMEDRKREGYF

Samples

Sample ID Description Type Environment
1 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
2 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
3 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
4 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
5 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
6 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
7 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
8 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
9 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
10 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
11 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
12 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
13 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
14 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
15 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
16 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
17 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
18 2922554459 Rhodococcus sp. 66b Isolate Unclassified
19 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
20 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
21 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
22 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
23 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
24 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
25 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
26 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
27 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
28 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
29 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
30 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
31 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
32 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
92 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
97 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
100 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
101 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
102 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
103 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
104 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
105 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
106 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
142 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
143 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
201 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
209 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
210 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
211 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
220 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
221 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
224 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
225 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
226 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
227 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
228 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
229 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
230 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
231 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
232 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
233 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
234 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
235 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
240 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
241 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
242 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
243 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
244 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
245 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
248 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
249 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
250 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
251 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
252 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
253 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
254 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
255 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
256 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
258 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
259 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
262 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
263 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
264 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
268 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
269 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
270 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
271 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
272 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
273 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
286 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
287 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
291 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
292 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
293 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
294 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
295 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
296 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
297 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
298 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
299 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
300 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
301 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
302 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
314 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
315 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
316 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
317 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
318 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
319 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
323 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
324 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
325 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
326 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
327 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
328 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
329 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
330 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
331 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
332 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
333 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
334 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
335 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
336 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
337 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
338 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
339 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
340 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
341 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
342 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
343 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
344 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
345 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
346 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
347 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
348 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.37
Metatranscriptomes 0.5
Isolates 3.12

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 11.79
Nodule 0.1
Rhizoplane 13
Rhizosphere 65.32
Stem 0
Stem Tuber 0
Unclassified 9.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1005481 3300000546 Bacteria 1384
2 JGI24739J22299_10030285 3300001989 Bacteria 1877
3 JGI24743J22301_10027850 3300001991 Bacteria 1104
4 JGI24745J21846_1001298 3300002073 Bacteria 2413
5 JGI24738J21930_10011412 3300002075 Bacteria 1954
6 JGI24738J21930_10028872 3300002075 Bacteria 1134
7 JGI24744J21845_10006363 3300002077 Bacteria 2451
8 JGI24744J21845_10011916 3300002077 Bacteria 1770
9 JGI24744J21845_10012948 3300002077 Bacteria 1685
10 JGI24034J26672_10003685 3300002239 Bacteria 2141
11 JGI24742J22300_10003451 3300002244 Bacteria 2564
12 JGI25406J46586_10006739 3300003203 Bacteria 5279
13 Ga0055540_1000207 3300003792 Bacteria 56613
14 Ga0055540_1002158 3300003792 Bacteria 10719
15 Ga0055540_1003118 3300003792 Bacteria 8221
16 Ga0055540_1003933 3300003792 Bacteria 6946
17 Ga0055540_1004158 3300003792 Bacteria 6684
18 Ga0055540_1011522 3300003792 Bacteria 2843
19 Ga0070676_10042659 3300005328 Bacteria 2635
20 Ga0070683_100033202 3300005329 Bacteria 4704
21 Ga0070690_100032667 3300005330 Bacteria 3252
22 Ga0070690_100106991 3300005330 Bacteria 1861
23 Ga0068869_100004264 3300005334 Bacteria 8873
24 Ga0068869_100033087 3300005334 Bacteria 3648
25 Ga0068869_100123533 3300005334 Bacteria 1983
26 Ga0070666_10007434 3300005335 Bacteria 6754
27 Ga0070666_10011131 3300005335 Bacteria 5639
28 Ga0070680_100078971 3300005336 Bacteria 2712
29 Ga0070680_100263000 3300005336 Bacteria 1460
30 Ga0070682_100004029 3300005337 Bacteria 8164
31 Ga0070682_100008585 3300005337 Bacteria 5768
32 Ga0070682_100053750 3300005337 Bacteria 2525
33 Ga0070682_100070849 3300005337 Bacteria 2230
34 Ga0070682_100135875 3300005337 Bacteria 1670
35 Ga0068868_100001267 3300005338 Bacteria 17394
36 Ga0068868_100006676 3300005338 Bacteria 8189
37 Ga0068868_100017252 3300005338 Bacteria 5374
38 Ga0068868_100071887 3300005338 Bacteria 2759
39 Ga0068868_100089792 3300005338 Bacteria 2474
40 Ga0070689_100003095 3300005340 Bacteria 10976
41 Ga0070689_100068048 3300005340 Bacteria 2777
42 Ga0070691_10001945 3300005341 Bacteria 9083
43 Ga0070691_10028379 3300005341 Bacteria 2614
44 Ga0070691_10182162 3300005341 Bacteria 1094
45 Ga0070687_100024588 3300005343 Bacteria 2878
46 Ga0070661_100106368 3300005344 Bacteria 2092
47 Ga0070668_100000264 3300005347 Bacteria 34698
48 Ga0070668_100003162 3300005347 Bacteria 12133
49 Ga0070668_100029947 3300005347 Bacteria 4136
50 Ga0070668_100034759 3300005347 Bacteria 3841
51 Ga0070668_100066744 3300005347 Bacteria 2792
52 Ga0070669_100000918 3300005353 Bacteria 21431
53 Ga0070669_100002624 3300005353 Bacteria 12996
54 Ga0070671_100008676 3300005355 Bacteria 8154
55 Ga0070671_100119251 3300005355 Bacteria 2220
56 Ga0070674_100004841 3300005356 Bacteria 7718
57 Ga0070674_100006933 3300005356 Bacteria 6644
58 Ga0070674_100070662 3300005356 Bacteria 2467
59 Ga0070674_100086627 3300005356 Bacteria 2250
60 Ga0070688_100008911 3300005365 Bacteria 5464
61 Ga0070688_100021334 3300005365 Bacteria 3783
62 Ga0070688_100055259 3300005365 Bacteria 2490
63 Ga0070659_100020849 3300005366 Bacteria 4984
64 Ga0070659_100022293 3300005366 Bacteria 4834
65 Ga0070659_100090496 3300005366 Bacteria 2452
66 Ga0070659_100218123 3300005366 Bacteria 1574
67 Ga0070659_100237137 3300005366 Bacteria 1508
68 Ga0070659_100337250 3300005366 Bacteria 1262
69 Ga0070667_100000033 3300005367 Bacteria 175463
70 Ga0070667_100000962 3300005367 Bacteria 26520
71 Ga0070667_100003398 3300005367 Bacteria 13558
72 Ga0070667_100010764 3300005367 Bacteria 7559
73 Ga0070709_10001138 3300005434 Bacteria 14658
74 Ga0070709_10002108 3300005434 Bacteria 10762
75 Ga0070709_10021799 3300005434 Bacteria 3738
76 Ga0070714_100078214 3300005435 Bacteria 2874
77 Ga0070714_100715552 3300005435 Bacteria 967
78 Ga0070713_100091785 3300005436 Bacteria 2613
79 Ga0070710_10003343 3300005437 Bacteria 7603
80 Ga0070710_10023520 3300005437 Bacteria 3240
81 Ga0070701_10000460 3300005438 Bacteria 13890
82 Ga0070701_10000574 3300005438 Bacteria 12789
83 Ga0070701_10062632 3300005438 Bacteria 1966
84 Ga0070711_100001370 3300005439 Bacteria 13312
85 Ga0070711_100002323 3300005439 Bacteria 10808
86 Ga0070711_100018251 3300005439 Bacteria 4476
87 Ga0070711_100055304 3300005439 Bacteria 2741
88 Ga0070705_100005812 3300005440 Bacteria 6029
89 Ga0070705_100007460 3300005440 Bacteria 5381
90 Ga0070705_100108413 3300005440 Bacteria 1769
91 Ga0070705_100166087 3300005440 Bacteria 1480
92 Ga0070705_100328586 3300005440 Bacteria 1107
93 Ga0070700_100007425 3300005441 Bacteria 5918
94 Ga0070700_100040878 3300005441 Bacteria 2841
95 Ga0070700_100092465 3300005441 Bacteria 1976
96 Ga0070700_100302577 3300005441 Bacteria 1168
97 Ga0070694_100004527 3300005444 Bacteria 8359
98 Ga0070663_100005728 3300005455 Bacteria 7409
99 Ga0070663_100013531 3300005455 Bacteria 5207
100 Ga0070663_100058847 3300005455 Bacteria 2760
101 Ga0070663_100316966 3300005455 Bacteria 1253
102 Ga0070678_100003144 3300005456 Bacteria 9139
103 Ga0070678_100046533 3300005456 Bacteria 3111
104 Ga0070678_100104239 3300005456 Bacteria 2205
105 Ga0070678_100271034 3300005456 Bacteria 1431
106 Ga0070662_100002522 3300005457 Bacteria 11280
107 Ga0070662_100026632 3300005457 Bacteria 4006
108 Ga0070662_100276979 3300005457 Bacteria 1356
109 Ga0068867_100002753 3300005459 Bacteria 12389
110 Ga0068867_100004361 3300005459 Bacteria 9961
111 Ga0068867_100073218 3300005459 Bacteria 2565
112 Ga0070685_10077040 3300005466 Bacteria 1990
113 Ga0070684_100176252 3300005535 Bacteria 1943
114 Ga0070697_100349457 3300005536 Bacteria 1277
115 Ga0068853_100007969 3300005539 Bacteria 8494
116 Ga0068853_100016526 3300005539 Bacteria 6075
117 Ga0068853_100241552 3300005539 Bacteria 1655
118 Ga0068853_100426088 3300005539 Bacteria 1245
119 Ga0070672_100171258 3300005543 Bacteria 1806
120 Ga0070672_100314505 3300005543 Bacteria 1330
121 Ga0070686_100028584 3300005544 Bacteria 3383
122 Ga0070686_100144414 3300005544 Bacteria 1660
123 Ga0070695_100016576 3300005545 Bacteria 4462
124 Ga0070695_100081041 3300005545 Bacteria 2147
125 Ga0070695_100215410 3300005545 Bacteria 1381
126 Ga0070696_100002819 3300005546 Bacteria 11548
127 Ga0070696_100041777 3300005546 Bacteria 3169
128 Ga0070696_100096529 3300005546 Bacteria 2112
129 Ga0070693_100024104 3300005547 Bacteria 3259
130 Ga0070693_100058270 3300005547 Bacteria 2235
131 Ga0070693_100084523 3300005547 Bacteria 1900
132 Ga0070665_100002721 3300005548 Bacteria 19164
133 Ga0070665_100002910 3300005548 Bacteria 18501
134 Ga0070665_100006270 3300005548 Bacteria 12155
135 Ga0070665_100034345 3300005548 Bacteria 5100
136 Ga0070665_100067775 3300005548 Bacteria 3579
137 Ga0070665_100550018 3300005548 Bacteria 1166
138 Ga0070704_100000324 3300005549 Bacteria 21508
139 Ga0070704_100009039 3300005549 Bacteria 6007
140 Ga0068855_100752964 3300005563 Bacteria 1039
141 Ga0070664_100306518 3300005564 Bacteria 1436
142 Ga0068854_100001133 3300005578 Bacteria 16029
143 Ga0068854_100001503 3300005578 Bacteria 14107
144 Ga0068854_100076388 3300005578 Bacteria 2461
145 Ga0070702_100001907 3300005615 Bacteria 8753
146 Ga0070702_100031367 3300005615 Bacteria 2907
147 Ga0070702_100074665 3300005615 Bacteria 2012
148 Ga0070702_100167430 3300005615 Bacteria 1426
149 Ga0068852_100155361 3300005616 Bacteria 2131
150 Ga0068852_100548741 3300005616 Bacteria 1156
151 Ga0068859_100000300 3300005617 Bacteria 49281
152 Ga0068859_100001798 3300005617 Bacteria 21835
153 Ga0068859_100005012 3300005617 Bacteria 13446
154 Ga0068859_100007033 3300005617 Bacteria 11425
155 Ga0068864_100583880 3300005618 Bacteria 1083
156 Ga0068866_10000937 3300005718 Bacteria 12824
157 Ga0068866_10009714 3300005718 Bacteria 4096
158 Ga0068861_100000649 3300005719 Bacteria 20679
159 Ga0068861_100006110 3300005719 Bacteria 8195
160 Ga0068861_100015616 3300005719 Bacteria 5356
161 Ga0068861_100074095 3300005719 Bacteria 2646
162 Ga0068861_100586243 3300005719 Bacteria 1021
163 Ga0068863_100002210 3300005841 Bacteria 19325
164 Ga0068863_100003284 3300005841 Bacteria 15965
165 Ga0068863_100049338 3300005841 Bacteria 3991
166 Ga0068863_100170736 3300005841 Bacteria 2086
167 Ga0068863_100244078 3300005841 Bacteria 1734
168 Ga0068858_100001026 3300005842 Bacteria 28813
169 Ga0068858_100007303 3300005842 Bacteria 10703
170 Ga0068858_100015480 3300005842 Bacteria 7172
171 Ga0068858_100046133 3300005842 Bacteria 4040
172 Ga0068858_100048229 3300005842 Bacteria 3947
173 Ga0068858_100351993 3300005842 Bacteria 1411
174 Ga0068860_100000010 3300005843 Bacteria 359114
175 Ga0068860_100000156 3300005843 Bacteria 111148
176 Ga0068860_100003057 3300005843 Bacteria 17284
177 Ga0068860_100006774 3300005843 Bacteria 11490
178 Ga0068860_100600377 3300005843 Bacteria 1106
179 Ga0068862_100000008 3300005844 Bacteria 305510
180 Ga0068862_100000019 3300005844 Bacteria 229485
181 Ga0068862_100000958 3300005844 Bacteria 27782
182 Ga0081455_10049454 3300005937 Bacteria 3624
183 Ga0081538_10053133 3300005981 Bacteria 2412
184 Ga0070717_10182747 3300006028 Bacteria 1829
185 Ga0075365_10008111 3300006038 Bacteria 5934
186 Ga0075365_10021929 3300006038 Bacteria 3993
187 Ga0075365_10094207 3300006038 Bacteria 2043
188 Ga0075365_10110383 3300006038 Bacteria 1890
189 Ga0075365_10119641 3300006038 Bacteria 1816
190 Ga0075365_10130137 3300006038 Bacteria 1741
191 Ga0075365_10197090 3300006038 Bacteria 1410
192 Ga0075363_100000999 3300006048 Bacteria 10124
193 Ga0075363_100001651 3300006048 Bacteria 8628
194 Ga0075363_100002029 3300006048 Bacteria 8079
195 Ga0075363_100007545 3300006048 Bacteria 5009
196 Ga0075363_100021077 3300006048 Bacteria 3277
197 Ga0075363_100022089 3300006048 Bacteria 3213
198 Ga0075363_100033998 3300006048 Bacteria 2660
199 Ga0075363_100144439 3300006048 Bacteria 1341
200 Ga0075363_100169229 3300006048 Bacteria 1240
201 Ga0075364_10005619 3300006051 Bacteria 7313
202 Ga0075364_10006900 3300006051 Bacteria 6703
203 Ga0075364_10008064 3300006051 Bacteria 6280
204 Ga0075364_10009026 3300006051 Bacteria 5972
205 Ga0075364_10011101 3300006051 Bacteria 5468
206 Ga0075364_10019067 3300006051 Bacteria 4303
207 Ga0075364_10070776 3300006051 Bacteria 2297
208 Ga0075364_10120684 3300006051 Bacteria 1754
209 Ga0075364_10154487 3300006051 Bacteria 1547
210 Ga0075364_10241968 3300006051 Bacteria 1226
211 Ga0075364_10311812 3300006051 Bacteria 1071
212 Ga0070715_10005624 3300006163 Bacteria 4195
213 Ga0070715_10008709 3300006163 Bacteria 3547
214 Ga0070715_10016832 3300006163 Bacteria 2756
215 Ga0070716_100002154 3300006173 Bacteria 9054
216 Ga0070716_100006278 3300006173 Bacteria 5801
217 Ga0070716_100007540 3300006173 Bacteria 5365
218 Ga0070712_100000675 3300006175 Bacteria 20175
219 Ga0070712_100002027 3300006175 Bacteria 12411
220 Ga0070712_100023582 3300006175 Bacteria 4067
221 Ga0075362_10066951 3300006177 Bacteria 1633
222 Ga0075367_10097939 3300006178 Bacteria 1790
223 Ga0075367_10153107 3300006178 Bacteria 1431
224 Ga0075367_10158497 3300006178 Bacteria 1407
225 Ga0075369_10000666 3300006186 Bacteria 10924
226 Ga0075369_10002769 3300006186 Bacteria 6295
227 Ga0075369_10003013 3300006186 Bacteria 6095
228 Ga0075369_10007392 3300006186 Bacteria 4181
229 Ga0075369_10009178 3300006186 Bacteria 3833
230 Ga0075369_10017850 3300006186 Bacteria 2883
231 Ga0075369_10033004 3300006186 Bacteria 2193
232 Ga0075369_10038362 3300006186 Bacteria 2043
233 Ga0075369_10065419 3300006186 Bacteria 1593
234 Ga0075370_10002984 3300006353 Bacteria 7961
235 Ga0075370_10014517 3300006353 Bacteria 4204
236 Ga0075370_10031123 3300006353 Bacteria 2978
237 Ga0075370_10100405 3300006353 Bacteria 1674
238 Ga0075370_10107482 3300006353 Bacteria 1618
239 Ga0075370_10125557 3300006353 Bacteria 1496
240 Ga0075370_10127155 3300006353 Bacteria 1486
241 Ga0075428_100000609 3300006844 Bacteria 36516
242 Ga0075428_100003982 3300006844 Bacteria 16206
243 Ga0075430_100003543 3300006846 Bacteria 13073
244 Ga0075430_100043225 3300006846 Bacteria 3809
245 Ga0075431_100013631 3300006847 Bacteria 8215
246 Ga0075433_10056618 3300006852 Bacteria 3425
247 Ga0075434_100020986 3300006871 Bacteria 6345
248 Ga0068865_100000988 3300006881 Bacteria 16295
249 Ga0068865_100002876 3300006881 Bacteria 10258
250 Ga0097620_100000300 3300006931 Bacteria 49281
251 Ga0097620_100001798 3300006931 Bacteria 21835
252 Ga0097620_100005012 3300006931 Bacteria 13446
253 Ga0097620_100007032 3300006931 Bacteria 11425
254 Ga0105240_10144161 3300009093 Bacteria 2844
255 Ga0105240_10312736 3300009093 Bacteria 1793
256 Ga0105240_10350170 3300009093 Bacteria 1676
257 Ga0111539_10314605 3300009094 Bacteria 1822
258 Ga0111539_10637365 3300009094 Bacteria 1241
259 Ga0105245_10035734 3300009098 Bacteria 4410
260 Ga0105245_10072200 3300009098 Bacteria 3135
261 Ga0105245_10105760 3300009098 Bacteria 2610
262 Ga0105245_10355261 3300009098 Bacteria 1453
263 Ga0105245_10559017 3300009098 Bacteria 1167
264 Ga0105247_10000019 3300009101 Bacteria 245170
265 Ga0105247_10000023 3300009101 Bacteria 215645
266 Ga0105247_10000265 3300009101 Bacteria 48548
267 Ga0105247_10000517 3300009101 Bacteria 31617
268 Ga0105247_10072375 3300009101 Bacteria 2158
269 Ga0105247_10194313 3300009101 Bacteria 1360
270 Ga0114129_10006162 3300009147 Bacteria 17016
271 Ga0114129_10014863 3300009147 Bacteria 11091
272 Ga0114129_10804511 3300009147 Bacteria 1199
273 Ga0105243_10001541 3300009148 Bacteria 20148
274 Ga0105243_10004543 3300009148 Bacteria 10964
275 Ga0105243_10176933 3300009148 Bacteria 1852
276 Ga0105241_10020745 3300009174 Bacteria 4856
277 Ga0105241_10049089 3300009174 Bacteria 3213
278 Ga0105241_10425441 3300009174 Bacteria 1170
279 Ga0105242_10000329 3300009176 Bacteria 38103
280 Ga0105242_10002252 3300009176 Bacteria 15219
281 Ga0105248_10000188 3300009177 Bacteria 71887
282 Ga0105248_10000409 3300009177 Bacteria 49854
283 Ga0105248_10006313 3300009177 Bacteria 13005
284 Ga0105248_10007260 3300009177 Bacteria 12161
285 Ga0105248_10065705 3300009177 Bacteria 4073
286 Ga0105237_10000587 3300009545 Bacteria 50736
287 Ga0105237_10013063 3300009545 Bacteria 8720
288 Ga0105237_10038233 3300009545 Bacteria 4847
289 Ga0105237_10047482 3300009545 Bacteria 4317
290 Ga0105237_10047948 3300009545 Bacteria 4295
291 Ga0105237_10347126 3300009545 Bacteria 1488
292 Ga0105238_10343149 3300009551 Bacteria 1482
293 Ga0105238_10391130 3300009551 Bacteria 1383
294 Ga0105249_10000019 3300009553 Bacteria 273807
295 Ga0105249_10000033 3300009553 Bacteria 213834
296 Ga0105249_10000892 3300009553 Bacteria 26445
297 Ga0105249_10010119 3300009553 Bacteria 8280
298 Ga0105239_10003372 3300010375 Bacteria 19606
299 Ga0105239_10038691 3300010375 Bacteria 5227
300 Ga0105239_10072566 3300010375 Bacteria 3784
301 Ga0105239_10073218 3300010375 Bacteria 3767
302 Ga0105239_10247895 3300010375 Bacteria 2000
303 Ga0105246_10063567 3300011119 Bacteria 2575
304 Ga0105246_10334608 3300011119 Bacteria 1235
305 Ga0105246_10381369 3300011119 Bacteria 1165
306 Ga0157370_10016874 3300013104 Bacteria 7381
307 Ga0157370_10334804 3300013104 Bacteria 1395
308 Ga0157369_10520420 3300013105 Bacteria 1230
309 Ga0157374_10082396 3300013296 Bacteria 3054
310 Ga0157374_10301541 3300013296 Bacteria 1585
311 Ga0157374_10348673 3300013296 Bacteria 1471
312 Ga0157378_10000356 3300013297 Bacteria 45048
313 Ga0157378_10003135 3300013297 Bacteria 14694
314 Ga0163162_10002067 3300013306 Bacteria 18862
315 Ga0163162_10025798 3300013306 Bacteria 5809
316 Ga0163162_10305174 3300013306 Bacteria 1724
317 Ga0157372_10043924 3300013307 Bacteria 4950
318 Ga0157372_10059963 3300013307 Bacteria 4257
319 Ga0157372_10110237 3300013307 Bacteria 3152
320 Ga0157372_10183567 3300013307 Bacteria 2422
321 Ga0157375_10000760 3300013308 Bacteria 28299
322 Ga0157375_10009045 3300013308 Bacteria 8721
323 Ga0157375_10068732 3300013308 Bacteria 3546
324 Ga0157375_10071536 3300013308 Bacteria 3482
325 Ga0163163_10020081 3300014325 Bacteria 6288
326 Ga0163163_10172358 3300014325 Bacteria 2210
327 Ga0157380_10001266 3300014326 Bacteria 16403
328 Ga0157380_10001851 3300014326 Bacteria 13990
329 Ga0157380_10142729 3300014326 Bacteria 2059
330 Ga0157377_10011682 3300014745 Bacteria 4391
331 Ga0157379_10004806 3300014968 Bacteria 11610
332 Ga0157379_10019019 3300014968 Bacteria 6064
333 Ga0157379_10476367 3300014968 Bacteria 1155
334 Ga0157376_10057926 3300014969 Bacteria 3243
335 Ga0157376_10426916 3300014969 Bacteria 1287
336 Ga0163161_10000976 3300017792 Bacteria 21866
337 Ga0163161_10018358 3300017792 Bacteria 4902
338 Ga0197907_10477761 3300020069 Bacteria 4810
339 Ga0206356_10088465 3300020070 Bacteria 7376
340 Ga0206354_10569538 3300020081 Bacteria 5177
341 Ga0206353_10019350 3300020082 Bacteria 3941
342 Ga0213876_10011942 3300021384 Bacteria 4628
343 Ga0213875_10001995 3300021388 Bacteria 12605
344 Ga0213875_10017345 3300021388 Bacteria 3479
345 Ga0213875_10026986 3300021388 Bacteria 2732
346 Ga0213875_10084560 3300021388 Bacteria 1480
347 Ga0224712_10000628 3300022467 Bacteria 7202
348 Ga0209051_1000158 3300025303 Bacteria 127723
349 Ga0209051_1000949 3300025303 Bacteria 28423
350 Ga0209051_1000993 3300025303 Bacteria 27270
351 Ga0209051_1001572 3300025303 Bacteria 18855
352 Ga0209051_1002496 3300025303 Bacteria 13115
353 Ga0209051_1006734 3300025303 Bacteria 6414
354 Ga0209051_1024452 3300025303 Bacteria 2483
355 Ga0209051_1056120 3300025303 Bacteria 1273
356 Ga0207692_10024473 3300025898 Bacteria 2807
357 Ga0207692_10024928 3300025898 Bacteria 2788
358 Ga0207642_10000822 3300025899 Bacteria 9667
359 Ga0207642_10000917 3300025899 Bacteria 9224
360 Ga0207710_10000036 3300025900 Bacteria 245176
361 Ga0207710_10000343 3300025900 Bacteria 34190
362 Ga0207710_10002308 3300025900 Bacteria 8913
363 Ga0207710_10009402 3300025900 Bacteria 4114
364 Ga0207710_10017219 3300025900 Bacteria 3064
365 Ga0207710_10065713 3300025900 Bacteria 1654
366 Ga0207688_10000235 3300025901 Bacteria 25164
367 Ga0207688_10004987 3300025901 Bacteria 7225
368 Ga0207688_10007726 3300025901 Bacteria 5858
369 Ga0207688_10020294 3300025901 Bacteria 3628
370 Ga0207688_10063138 3300025901 Bacteria 2089
371 Ga0207688_10121521 3300025901 Bacteria 1524
372 Ga0207680_10049693 3300025903 Bacteria 2497
373 Ga0207685_10002069 3300025905 Bacteria 4484
374 Ga0207685_10055002 3300025905 Bacteria 1552
375 Ga0207685_10116243 3300025905 Bacteria 1167
376 Ga0207699_10095925 3300025906 Bacteria 1871
377 Ga0207645_10046109 3300025907 Bacteria 2785
378 Ga0207645_10117281 3300025907 Bacteria 1727
379 Ga0207705_10000352 3300025909 Bacteria 41499
380 Ga0207654_10008666 3300025911 Bacteria 5155
381 Ga0207695_10144529 3300025913 Bacteria 2324
382 Ga0207671_10007683 3300025914 Bacteria 9309
383 Ga0207671_10061121 3300025914 Bacteria 2795
384 Ga0207671_10066856 3300025914 Bacteria 2676
385 Ga0207671_10080894 3300025914 Bacteria 2436
386 Ga0207693_10002003 3300025915 Bacteria 17881
387 Ga0207693_10003680 3300025915 Bacteria 13087
388 Ga0207693_10005498 3300025915 Bacteria 10550
389 Ga0207693_10015601 3300025915 Bacteria 6092
390 Ga0207663_10004168 3300025916 Bacteria 7162
391 Ga0207663_10016337 3300025916 Bacteria 4113
392 Ga0207663_10081293 3300025916 Bacteria 2121
393 Ga0207660_10057200 3300025917 Bacteria 2793
394 Ga0207662_10031960 3300025918 Bacteria 3060
395 Ga0207657_10065141 3300025919 Bacteria 3107
396 Ga0207649_10281174 3300025920 Bacteria 1210
397 Ga0207681_10001678 3300025923 Bacteria 14267
398 Ga0207681_10038325 3300025923 Bacteria 3175
399 Ga0207681_10169826 3300025923 Bacteria 1652
400 Ga0207694_10049503 3300025924 Bacteria 3253
401 Ga0207694_10205594 3300025924 Bacteria 1603
402 Ga0207694_10491922 3300025924 Bacteria 1027
403 Ga0207659_10068415 3300025926 Bacteria 2582
404 Ga0207687_10005938 3300025927 Bacteria 8075
405 Ga0207687_10008539 3300025927 Bacteria 6699
406 Ga0207687_10038940 3300025927 Bacteria 3252
407 Ga0207687_10073145 3300025927 Bacteria 2454
408 Ga0207687_10203978 3300025927 Bacteria 1547
409 Ga0207687_10351506 3300025927 Bacteria 1201
410 Ga0207700_10163708 3300025928 Bacteria 1849
411 Ga0207644_10096721 3300025931 Bacteria 2211
412 Ga0207644_10098165 3300025931 Bacteria 2195
413 Ga0207690_10006937 3300025932 Bacteria 6715
414 Ga0207690_10034863 3300025932 Bacteria 3245
415 Ga0207690_10064081 3300025932 Bacteria 2508
416 Ga0207690_10156355 3300025932 Bacteria 1695
417 Ga0207690_10243462 3300025932 Bacteria 1386
418 Ga0207706_10025990 3300025933 Bacteria 5243
419 Ga0207706_10042550 3300025933 Bacteria 4026
420 Ga0207706_10061444 3300025933 Bacteria 3309
421 Ga0207686_10007174 3300025934 Bacteria 5999
422 Ga0207686_10056106 3300025934 Bacteria 2475
423 Ga0207709_10001915 3300025935 Bacteria 13707
424 Ga0207709_10069321 3300025935 Bacteria 2232
425 Ga0207709_10267877 3300025935 Bacteria 1256
426 Ga0207670_10033878 3300025936 Bacteria 3295
427 Ga0207670_10123513 3300025936 Bacteria 1886
428 Ga0207669_10001222 3300025937 Bacteria 10911
429 Ga0207669_10007348 3300025937 Bacteria 5089
430 Ga0207669_10016175 3300025937 Bacteria 3784
431 Ga0207669_10129936 3300025937 Bacteria 1729
432 Ga0207669_10264946 3300025937 Bacteria 1287
433 Ga0207704_10001661 3300025938 Bacteria 9991
434 Ga0207704_10057576 3300025938 Bacteria 2388
435 Ga0207704_10154761 3300025938 Bacteria 1623
436 Ga0207665_10001216 3300025939 Bacteria 17397
437 Ga0207665_10005614 3300025939 Bacteria 8361
438 Ga0207665_10024589 3300025939 Bacteria 3972
439 Ga0207691_10244670 3300025940 Bacteria 1550
440 Ga0207691_10286947 3300025940 Bacteria 1416
441 Ga0207711_10000168 3300025941 Bacteria 70279
442 Ga0207711_10000412 3300025941 Bacteria 45381
443 Ga0207711_10044387 3300025941 Bacteria 3794
444 Ga0207711_10149857 3300025941 Bacteria 2104
445 Ga0207711_10153261 3300025941 Bacteria 2081
446 Ga0207689_10016961 3300025942 Bacteria 6161
447 Ga0207689_10070988 3300025942 Bacteria 2860
448 Ga0207679_10251217 3300025945 Bacteria 1503
449 Ga0207712_10000025 3300025961 Bacteria 274015
450 Ga0207712_10000031 3300025961 Bacteria 213662
451 Ga0207712_10020672 3300025961 Bacteria 4314
452 Ga0207712_10045018 3300025961 Bacteria 3054
453 Ga0207668_10002021 3300025972 Bacteria 11840
454 Ga0207668_10003151 3300025972 Bacteria 9656
455 Ga0207668_10445829 3300025972 Bacteria 1103
456 Ga0207668_10459913 3300025972 Bacteria 1088
457 Ga0207668_10542169 3300025972 Bacteria 1006
458 Ga0207640_10003697 3300025981 Bacteria 8249
459 Ga0207658_10000125 3300025986 Bacteria 83488
460 Ga0207658_10000621 3300025986 Bacteria 31352
461 Ga0207658_10000792 3300025986 Bacteria 26813
462 Ga0207658_10021277 3300025986 Bacteria 4500
463 Ga0207658_10027530 3300025986 Bacteria 3994
464 Ga0207658_10492061 3300025986 Bacteria 1091
465 Ga0207677_10025479 3300026023 Bacteria 3692
466 Ga0207677_10027755 3300026023 Bacteria 3571
467 Ga0207677_10048665 3300026023 Bacteria 2856
468 Ga0207703_10003469 3300026035 Bacteria 13203
469 Ga0207703_10012068 3300026035 Bacteria 6731
470 Ga0207703_10015805 3300026035 Bacteria 5887
471 Ga0207703_10049916 3300026035 Bacteria 3384
472 Ga0207703_10338002 3300026035 Bacteria 1383
473 Ga0207703_10388337 3300026035 Bacteria 1293
474 Ga0207639_10006832 3300026041 Bacteria 7770
475 Ga0207639_10013554 3300026041 Bacteria 5711
476 Ga0207639_10043607 3300026041 Bacteria 3369
477 Ga0207639_10276005 3300026041 Bacteria 1476
478 Ga0207639_10315708 3300026041 Bacteria 1386
479 Ga0207678_10004736 3300026067 Bacteria 12221
480 Ga0207678_10011489 3300026067 Bacteria 7777
481 Ga0207678_10018657 3300026067 Bacteria 6090
482 Ga0207678_10103601 3300026067 Bacteria 2429
483 Ga0207678_10130964 3300026067 Bacteria 2139
484 Ga0207708_10009345 3300026075 Bacteria 7258
485 Ga0207708_10050894 3300026075 Bacteria 3153
486 Ga0207708_10111897 3300026075 Bacteria 2120
487 Ga0207708_10115406 3300026075 Bacteria 2088
488 Ga0207641_10008728 3300026088 Bacteria 8371
489 Ga0207641_10023523 3300026088 Bacteria 5074
490 Ga0207641_10054108 3300026088 Bacteria 3404
491 Ga0207641_10244993 3300026088 Bacteria 1672
492 Ga0207648_10002570 3300026089 Bacteria 19444
493 Ga0207648_10003286 3300026089 Bacteria 17005
494 Ga0207648_10027517 3300026089 Bacteria 5048
495 Ga0207676_10286784 3300026095 Bacteria 1497
496 Ga0207675_100000865 3300026118 Bacteria 30240
497 Ga0207675_100008787 3300026118 Bacteria 9484
498 Ga0207675_100113182 3300026118 Bacteria 2562
499 Ga0207675_100306160 3300026118 Bacteria 1549
500 Ga0207683_10000809 3300026121 Bacteria 28622
501 Ga0207683_10012042 3300026121 Bacteria 7383
502 Ga0207683_10125346 3300026121 Bacteria 2308
503 Ga0207683_10429818 3300026121 Bacteria 1217
504 Ga0207698_10115458 3300026142 Bacteria 2260
505 Ga0207698_10190416 3300026142 Bacteria 1826
506 Ga0207698_10564669 3300026142 Bacteria 1117
507 Ga0207428_10187595 3300027907 Bacteria 1560
508 Ga0268266_10001219 3300028379 Bacteria 31613
509 Ga0268266_10002719 3300028379 Bacteria 18542
510 Ga0268266_10014239 3300028379 Bacteria 6841
511 Ga0268266_10097931 3300028379 Bacteria 2580
512 Ga0268265_10000007 3300028380 Bacteria 431817
513 Ga0268265_10000029 3300028380 Bacteria 229499
514 Ga0268265_10005882 3300028380 Bacteria 8359
515 Ga0268265_10212831 3300028380 Bacteria 1685
516 Ga0268264_10000007 3300028381 Bacteria 815790
517 Ga0268264_10000222 3300028381 Bacteria 111162
518 Ga0268264_10003411 3300028381 Bacteria 13716
519 Ga0268264_10061459 3300028381 Bacteria 3151
520 Ga0268264_10154549 3300028381 Bacteria 2061
521 Ga0268264_10571864 3300028381 Bacteria 1111
522 Ga0307515_10270403 3300028794 Bacteria 1422
523 Ga0265327_10000067 3300031251 Bacteria 221289
524 Ga0265327_10000912 3300031251 Bacteria 43333
525 Ga0265327_10076101 3300031251 Bacteria 1668
526 Ga0307405_10218402 3300031731 Bacteria 1397
527 Ga0307410_10010477 3300031852 Bacteria 5253
528 Ga0307406_10190487 3300031901 Bacteria 1501
529 Ga0307409_100539295 3300031995 Bacteria 1143
530 Ga0307416_100085071 3300032002 Bacteria 2690
531 Ga0307416_100141975 3300032002 Bacteria 2185
532 Ga0307411_10024307 3300032005 Bacteria 3609
533 Ga0307415_100024393 3300032126 Bacteria 3775
534 Ga0373932_0034757 3300035112 Bacteria 1422
535 Ga0373960_0033547 3300035121 Bacteria 1448
536 Ga0373960_0040216 3300035121 Bacteria 1349
537 Ga0373962_0041142 3300035242 Bacteria 1302
538 Ga0373931_0067640 3300035691 Bacteria 1942
539 Ga0373931_0252172 3300035691 Bacteria 1073
540 Ga0316582_0157152 3300036647 Bacteria 1539
541 Ga0395900_0041409 3300037418 Bacteria 4749
542 Ga0395898_0012403 3300037466 Bacteria 8811
543 Ga0395905_0287259 3300037471 Bacteria 1532
544 Ga0436364_0584343 3300037853 Bacteria 14478
545 Ga0436364_0605056 3300037853 Bacteria 10303
546 Ga0436364_0724530 3300037853 Bacteria 21942
547 Ga0436364_0796992 3300037853 Bacteria 2833
548 Ga0436364_0990517 3300037853 Bacteria 28690
549 Ga0436364_1389559 3300037853 Bacteria 7247
550 Ga0395901_0000002 3300038443 Bacteria 761045
551 Ga0395901_0584857 3300038443 Bacteria 1127
552 Ga0400485_07994 3300038735 Bacteria 10410
553 Ga0400486_27752 3300038742 Bacteria 1584
554 Ga0400483_066491 3300039062 Bacteria 56152
555 Ga0400483_228778 3300039062 Bacteria 97865
556 Ga0436365_0138647 3300039437 Bacteria 7044
557 Ga0436365_1083994 3300039437 Bacteria 225582
558 Ga0436365_1305970 3300039437 Bacteria 5721
559 Ga0436365_1334824 3300039437 Bacteria 56389
560 Ga0436365_1936517 3300039437 Bacteria 18087
561 Ga0436363_1679774 3300039450 Bacteria 6499
562 Ga0439461_0000249 3300041410 Bacteria 7675
563 Ga0439461_0000637 3300041410 Bacteria 5059
564 Ga0439466_0001784 3300041411 Bacteria 8417
565 Ga0439466_0007193 3300041411 Bacteria 4211
566 Ga0439466_0029769 3300041411 Bacteria 1876
567 Ga0439465_0011150 3300041413 Bacteria 2820
568 Ga0451795_0520114 3300041456 Bacteria 3086
569 Ga0439431_0000548 3300041997 Bacteria 7998
570 Ga0439431_0008956 3300041997 Bacteria 2255
571 Ga0439431_0046609 3300041997 Bacteria 1116
572 Ga0439442_021566 3300042002 Bacteria 1336
573 Ga0439445_0001278 3300042004 Bacteria 5449
574 Ga0439445_0005881 3300042004 Bacteria 2806
575 Ga0439445_0026394 3300042004 Bacteria 1487
576 Ga0439434_0004220 3300042435 Bacteria 4198
577 Ga0439435_0004781 3300042436 Bacteria 2938
578 Ga0466969_0046993 3300044656 Bacteria 2138
579 Ga0466972_0003097 3300044658 Bacteria 8249
580 Ga0466972_0155687 3300044658 Bacteria 1073
581 Ga0466965_0001825 3300044683 Bacteria 8850
582 Ga0466965_0013675 3300044683 Bacteria 3831
583 Ga0466966_0000236 3300044684 Bacteria 36529
584 Ga0466966_0014538 3300044684 Bacteria 5209
585 Ga0466966_0076843 3300044684 Bacteria 2084
586 Ga0466961_0073873 3300044693 Bacteria 2162
587 Ga0466961_0079250 3300044693 Bacteria 2080
588 Ga0466963_0005748 3300044694 Bacteria 7291
589 Ga0466963_0104906 3300044694 Bacteria 1937
590 Ga0466963_0292522 3300044694 Bacteria 1145
591 Ga0466971_0018480 3300044719 Bacteria 3088
592 Ga0466971_0027279 3300044719 Bacteria 2557
593 Ga0466968_0002961 3300044735 Bacteria 6275
594 Ga0466968_0014481 3300044735 Bacteria 3118
595 Ga0466968_0030687 3300044735 Bacteria 2228
596 Ga0466968_0061450 3300044735 Bacteria 1621
597 Ga0466970_0003872 3300044765 Bacteria 7326
598 Ga0466970_0045943 3300044765 Bacteria 2325
599 Ga0466970_0170683 3300044765 Bacteria 1205
600 Ga0466957_0007155 3300044842 Bacteria 6310
601 Ga0466957_0020206 3300044842 Bacteria 3918
602 Ga0466957_0041886 3300044842 Bacteria 2769
603 Ga0466957_0060335 3300044842 Bacteria 2325
604 Ga0466960_0001119 3300044901 Bacteria 9626
605 Ga0466960_0002717 3300044901 Bacteria 6684
606 Ga0466960_0010770 3300044901 Bacteria 3806
607 Ga0466959_0017217 3300045049 Bacteria 5293
608 Ga0466959_0018993 3300045049 Bacteria 5051
609 Ga0466959_0025147 3300045049 Bacteria 4410
610 Ga0466958_0002652 3300045836 Bacteria 9043
611 Ga0466958_0004750 3300045836 Bacteria 7223
612 Ga0466958_0047797 3300045836 Bacteria 2584
613 Ga0466958_0124630 3300045836 Bacteria 1615
614 Ga0466967_0001551 3300045976 Bacteria 13460
615 Ga0466967_0026122 3300045976 Bacteria 4830
616 Ga0466967_0074046 3300045976 Bacteria 3057
617 Ga0466967_0076412 3300045976 Bacteria 3013
618 Ga0466967_0092019 3300045976 Bacteria 2757
619 Ga0466967_0231633 3300045976 Bacteria 1759
620 Ga0466967_0386777 3300045976 Bacteria 1359
621 Ga0495603_0056436 3300046455 Bacteria 2325
622 Ga0495603_0100826 3300046455 Bacteria 1685
623 Ga0495580_0041325 3300046472 Bacteria 3288
624 Ga0495605_0055137 3300046474 Bacteria 1922
625 Ga0495583_0041706 3300046506 Bacteria 2147
626 Ga0495583_0156708 3300046506 Bacteria 941
627 Ga0495606_0067474 3300046507 Bacteria 2265
628 Ga0495648_0002953 3300046524 Bacteria 15260
629 Ga0495648_0019325 3300046524 Bacteria 4794
630 Ga0495654_0033335 3300046530 Bacteria 2607
631 Ga0495665_0021848 3300046531 Bacteria 3442
632 Ga0495665_0055755 3300046531 Bacteria 2087
633 Ga0495640_0022096 3300046533 Bacteria 4659
634 Ga0495609_0127236 3300046538 Bacteria 1093
635 Ga0495645_0115341 3300046543 Bacteria 1897
636 Ga0495668_0000862 3300046616 Bacteria 34202
637 Ga0495668_0021200 3300046616 Bacteria 3730
638 Ga0495611_0065218 3300046648 Bacteria 1659
639 Ga0495635_0160574 3300046663 Bacteria 1529
640 Ga0495588_0211725 3300046674 Bacteria 1023
641 Ga0495658_0059303 3300046683 Bacteria 2191
642 Ga0495671_0127471 3300046692 Bacteria 1241
643 Ga0495649_0173854 3300046694 Bacteria 1126
644 Ga0495649_0202232 3300046694 Bacteria 1031
645 Ga0495581_0038465 3300047315 Bacteria 2769
646 Ga0495674_0039894 3300047319 Bacteria 4204
647 Ga0495674_0189999 3300047319 Bacteria 1707
648 Ga0495672_0005520 3300047320 Bacteria 10011
649 Ga0495676_0058695 3300047321 Bacteria 3026
650 Ga0495683_0116746 3300047323 Bacteria 1269
651 Ga0495687_053654 3300047443 Bacteria 1696
652 Ga0495673_0000588 3300047469 Bacteria 36483
653 Ga0495673_0004675 3300047469 Bacteria 8499
654 Ga0495686_0002574 3300047472 Bacteria 16882
655 Ga0495686_0006499 3300047472 Bacteria 8935
656 Ga0495686_0239910 3300047472 Bacteria 1023
657 Ga0495593_0062317 3300047673 Bacteria 1949
658 Ga0496100_0000026 3300048903 Bacteria 115873
659 Ga0496100_0000407 3300048903 Bacteria 20774
660 Ga0496100_0001469 3300048903 Bacteria 11539
661 Ga0496100_0004953 3300048903 Bacteria 7119
662 Ga0496100_0005354 3300048903 Bacteria 6901
663 Ga0496100_0010477 3300048903 Bacteria 5249
664 Ga0496100_0020227 3300048903 Bacteria 3987
665 Ga0496100_0026798 3300048903 Bacteria 3537
666 Ga0496100_0279764 3300048903 Bacteria 1243
667 Ga0496101_0000002 3300048904 Bacteria 410971
668 Ga0496101_0000015 3300048904 Bacteria 252368
669 Ga0496101_0000091 3300048904 Bacteria 97934
670 Ga0496101_0000176 3300048904 Bacteria 51135
671 Ga0496101_0001680 3300048904 Bacteria 13263
672 Ga0496101_0003585 3300048904 Bacteria 9693
673 Ga0496101_0023601 3300048904 Bacteria 4251
674 Ga0496101_0111983 3300048904 Bacteria 2055
675 Ga0496101_0122181 3300048904 Bacteria 1969
676 Ga0496101_0126438 3300048904 Bacteria 1937
677 Ga0496101_0234141 3300048904 Bacteria 1428
678 Ga0496101_0267084 3300048904 Bacteria 1335
679 Ga0496102_0000009 3300048905 Bacteria 344149
680 Ga0496102_0000016 3300048905 Bacteria 286787
681 Ga0496102_0000629 3300048905 Bacteria 36066
682 Ga0496102_0000789 3300048905 Bacteria 30791
683 Ga0496102_0001958 3300048905 Bacteria 17750
684 Ga0496102_0003406 3300048905 Bacteria 13480
685 Ga0496102_0003683 3300048905 Bacteria 12962
686 Ga0496102_0031692 3300048905 Bacteria 4744
687 Ga0496102_0078577 3300048905 Bacteria 3038
688 Ga0496102_0084417 3300048905 Bacteria 2931
689 Ga0496102_0138452 3300048905 Bacteria 2281
690 Ga0496102_0204020 3300048905 Bacteria 1864
691 Ga0496102_0286891 3300048905 Bacteria 1551
692 Ga0496103_0000005 3300048906 Bacteria 505416
693 Ga0496103_0000015 3300048906 Bacteria 287966
694 Ga0496103_0000409 3300048906 Bacteria 38113
695 Ga0496103_0000610 3300048906 Bacteria 27899
696 Ga0496103_0001002 3300048906 Bacteria 19780
697 Ga0496103_0018772 3300048906 Bacteria 4150
698 Ga0496103_0026722 3300048906 Bacteria 3493
699 Ga0496103_0049183 3300048906 Bacteria 2607
700 Ga0496103_0058278 3300048906 Bacteria 2399
701 Ga0496103_0105600 3300048906 Bacteria 1786
702 Ga0496103_0273533 3300048906 Bacteria 1087
703 Ga0496104_0000793 3300048907 Bacteria 27078
704 Ga0496104_0004506 3300048907 Bacteria 12141
705 Ga0496104_0128710 3300048907 Bacteria 2432
706 Ga0496104_0173589 3300048907 Bacteria 2066
707 Ga0496104_0286865 3300048907 Bacteria 1559
708 Ga0496104_0383891 3300048907 Bacteria 1317
709 Ga0496104_0481831 3300048907 Bacteria 1152
710 Ga0496105_0001664 3300048908 Bacteria 15828
711 Ga0496105_0006293 3300048908 Bacteria 9116
712 Ga0496105_0031837 3300048908 Bacteria 4325
713 Ga0496105_0192050 3300048908 Bacteria 1669
714 Ga0496106_0000640 3300048909 Bacteria 25096
715 Ga0496106_0004355 3300048909 Bacteria 10516
716 Ga0496106_0005431 3300048909 Bacteria 9429
717 Ga0496106_0008413 3300048909 Bacteria 7632
718 Ga0496106_0014165 3300048909 Bacteria 5890
719 Ga0496106_0024430 3300048909 Bacteria 4493
720 Ga0496106_0034334 3300048909 Bacteria 3788
721 Ga0496106_0111605 3300048909 Bacteria 2129
722 Ga0496106_0211498 3300048909 Bacteria 1545
723 Ga0496106_0221087 3300048909 Bacteria 1510
724 Ga0496106_0329581 3300048909 Bacteria 1225
725 Ga0496107_0000475 3300048910 Bacteria 22068
726 Ga0496107_0001091 3300048910 Bacteria 16314
727 Ga0496107_0002152 3300048910 Bacteria 12650
728 Ga0496107_0007237 3300048910 Bacteria 7646
729 Ga0496107_0008199 3300048910 Bacteria 7226
730 Ga0496107_0013934 3300048910 Bacteria 5623
731 Ga0496107_0014647 3300048910 Bacteria 5491
732 Ga0496107_0062523 3300048910 Bacteria 2697
733 Ga0496107_0109264 3300048910 Bacteria 2031
734 Ga0496107_0542488 3300048910 Bacteria 862
735 Ga0496108_0000189 3300048911 Bacteria 57428
736 Ga0496108_0007693 3300048911 Bacteria 8728
737 Ga0496108_0007870 3300048911 Bacteria 8640
738 Ga0496108_0045620 3300048911 Bacteria 3661
739 Ga0496108_0066092 3300048911 Bacteria 3049
740 Ga0496108_0071069 3300048911 Bacteria 2937
741 Ga0496108_0080026 3300048911 Bacteria 2767
742 Ga0496108_0105188 3300048911 Bacteria 2409
743 Ga0496108_0109721 3300048911 Bacteria 2358
744 Ga0496108_0121305 3300048911 Bacteria 2242
745 Ga0496109_0000022 3300048912 Bacteria 188901
746 Ga0496109_0000668 3300048912 Bacteria 28417
747 Ga0496109_0001533 3300048912 Bacteria 19230
748 Ga0496109_0016750 3300048912 Bacteria 6413
749 Ga0496109_0018882 3300048912 Bacteria 6068
750 Ga0496109_0064985 3300048912 Bacteria 3340
751 Ga0496109_0088630 3300048912 Bacteria 2860
752 Ga0496109_0198274 3300048912 Bacteria 1887
753 Ga0496109_0404077 3300048912 Bacteria 1290
754 Ga0496109_0583203 3300048912 Bacteria 1054
755 Ga0496110_0007546 3300048913 Bacteria 8688
756 Ga0496111_0296354 3300048914 Bacteria 1199
757 Ga0496111_0469091 3300048914 Bacteria 928
758 Ga0496112_0001161 3300048915 Bacteria 19679
759 Ga0496112_0012600 3300048915 Bacteria 7771
760 Ga0496112_0022286 3300048915 Bacteria 6035
761 Ga0496112_0046435 3300048915 Bacteria 4259
762 Ga0496112_0054624 3300048915 Bacteria 3925
763 Ga0496112_0067772 3300048915 Bacteria 3523
764 Ga0496112_0240060 3300048915 Bacteria 1765
765 Ga0496113_0009533 3300048916 Bacteria 6367
766 Ga0496113_0037510 3300048916 Bacteria 3557
767 Ga0496113_0064624 3300048916 Bacteria 2767
768 Ga0496113_0091562 3300048916 Bacteria 2344
769 Ga0496113_0148150 3300048916 Bacteria 1850
770 Ga0496113_0190292 3300048916 Bacteria 1629
771 Ga0496113_0430113 3300048916 Bacteria 1060
772 Ga0496114_0000829 3300048917 Bacteria 23199
773 Ga0496114_0000911 3300048917 Bacteria 22146
774 Ga0496114_0001530 3300048917 Bacteria 17530
775 Ga0496114_0005432 3300048917 Bacteria 9970
776 Ga0496114_0009086 3300048917 Bacteria 7881
777 Ga0496114_0014343 3300048917 Bacteria 6357
778 Ga0496114_0015198 3300048917 Bacteria 6190
779 Ga0496114_0440135 3300048917 Bacteria 1154
780 Ga0496115_0000929 3300048918 Bacteria 21222
781 Ga0496115_0002308 3300048918 Bacteria 13662
782 Ga0496115_0010831 3300048918 Bacteria 6821
783 Ga0496115_0039401 3300048918 Bacteria 3752
784 Ga0496115_0129129 3300048918 Bacteria 2083
785 Ga0496115_0259378 3300048918 Bacteria 1430
786 Ga0496116_0000055 3300048919 Bacteria 286923
787 Ga0496116_0000104 3300048919 Bacteria 193416
788 Ga0496116_0012030 3300048919 Bacteria 7100
789 Ga0496116_0014806 3300048919 Bacteria 6202
790 Ga0496117_0000006 3300048920 Bacteria 758420
791 Ga0496117_0000019 3300048920 Bacteria 469256
792 Ga0496117_0000415 3300048920 Bacteria 71870
793 Ga0496117_0000564 3300048920 Bacteria 60818
794 Ga0496117_0158938 3300048920 Bacteria 1327
795 Ga0496118_0000004 3300048921 Bacteria 758420
796 Ga0496118_0000020 3300048921 Bacteria 470521
797 Ga0496118_0000279 3300048921 Bacteria 89978
798 Ga0496118_0000609 3300048921 Bacteria 58938
799 Ga0496118_0002279 3300048921 Bacteria 26185
800 Ga0496118_0023329 3300048921 Bacteria 5377
801 Ga0496119_0001293 3300048922 Bacteria 30908
802 Ga0496119_0003048 3300048922 Bacteria 17729
803 Ga0496119_0024348 3300048922 Bacteria 4261
804 Ga0496120_0000272 3300048923 Bacteria 86274
805 Ga0496120_0009063 3300048923 Bacteria 7106
806 Ga0496120_0070350 3300048923 Bacteria 1925
807 Ga0496120_0091932 3300048923 Bacteria 1619
808 Ga0496121_0000004 3300048924 Bacteria 1139011
809 Ga0496121_0000331 3300048924 Bacteria 98656
810 Ga0496121_0001252 3300048924 Bacteria 44016
811 Ga0496121_0004561 3300048924 Bacteria 18494
812 Ga0496121_0013198 3300048924 Bacteria 8902
813 Ga0496121_0116924 3300048924 Bacteria 2021
814 Ga0496121_0247536 3300048924 Bacteria 1238
815 Ga0496122_0000257 3300048925 Bacteria 120176
816 Ga0496122_0009690 3300048925 Bacteria 10077
817 Ga0496122_0012801 3300048925 Bacteria 8300
818 Ga0496123_0003863 3300048926 Bacteria 16298
819 Ga0496123_0019811 3300048926 Bacteria 5284
820 Ga0496124_0000012 3300048927 Bacteria 512581
821 Ga0496124_0208243 3300048927 Bacteria 1482
822 Ga0496125_0000003 3300048928 Bacteria 1189767
823 Ga0496125_0007986 3300048928 Bacteria 11178
824 Ga0496125_0038627 3300048928 Bacteria 4127
825 Ga0496125_0057942 3300048928 Bacteria 3132
826 Ga0496125_0101715 3300048928 Bacteria 2114
827 Ga0496126_0000001 3300048929 Bacteria 1139011
828 Ga0496126_0000675 3300048929 Bacteria 62838
829 Ga0496126_0000931 3300048929 Bacteria 50490
830 Ga0496126_0001999 3300048929 Bacteria 28832
831 Ga0496126_0002966 3300048929 Bacteria 22050
832 Ga0496126_0004965 3300048929 Bacteria 15517
833 Ga0496126_0007614 3300048929 Bacteria 11826
834 Ga0496126_0034892 3300048929 Bacteria 4718
835 Ga0496126_0035612 3300048929 Bacteria 4663
836 Ga0495682_0040226 3300049460 Bacteria 1714
837 Ga0501032_0001262 3300049569 Bacteria 20302
838 Ga0501032_0002308 3300049569 Bacteria 14972
839 Ga0501032_0004982 3300049569 Bacteria 9932
840 Ga0501032_0013814 3300049569 Bacteria 5729
841 Ga0501032_0119055 3300049569 Bacteria 1746
842 Ga0501032_0241886 3300049569 Bacteria 1172
843 Ga0501033_0024034 3300049570 Bacteria 4598
844 Ga0501033_0041430 3300049570 Bacteria 3436
845 Ga0501033_0058998 3300049570 Bacteria 2834
846 Ga0501034_0005748 3300049571 Bacteria 13488
847 Ga0501034_0005877 3300049571 Bacteria 13331
848 Ga0501034_0006653 3300049571 Bacteria 12402
849 Ga0501034_0103519 3300049571 Bacteria 2840
850 Ga0501034_0117905 3300049571 Bacteria 2642
851 Ga0501034_0218066 3300049571 Bacteria 1861
852 Ga0501034_0543083 3300049571 Bacteria 1072
853 Ga0501036_0004384 3300049572 Bacteria 11391
854 Ga0501036_0098794 3300049572 Bacteria 2468
855 Ga0501036_0326851 3300049572 Bacteria 1281
856 Ga0501036_0404718 3300049572 Bacteria 1138
857 Ga0501037_0000265 3300049573 Bacteria 45219
858 Ga0501037_0001928 3300049573 Bacteria 15043
859 Ga0501037_0004967 3300049573 Bacteria 9671
860 Ga0501037_0006541 3300049573 Bacteria 8528
861 Ga0501037_0257192 3300049573 Bacteria 1221
862 Ga0501038_0003199 3300049574 Bacteria 15277
863 Ga0501038_0008311 3300049574 Bacteria 9552
864 Ga0501039_0002474 3300049575 Bacteria 13756
865 Ga0501039_0005085 3300049575 Bacteria 9965
866 Ga0501043_0004747 3300049579 Bacteria 11022
867 Ga0501043_0005944 3300049579 Bacteria 9815
868 Ga0501046_0004073 3300049580 Bacteria 13324
869 Ga0501047_0006308 3300049581 Bacteria 11155
870 Ga0501047_0025795 3300049581 Bacteria 5652
871 Ga0501047_0038821 3300049581 Bacteria 4606
872 Ga0501047_0049337 3300049581 Bacteria 4065
873 Ga0501047_0071854 3300049581 Bacteria 3331
874 Ga0501048_0020992 3300049582 Bacteria 4784
875 Ga0501067_0047620 3300049583 Bacteria 2378
876 Ga0501069_0266296 3300049585 Bacteria 1001
877 Ga0501070_0002057 3300049586 Bacteria 17672
878 Ga0501070_0002972 3300049586 Bacteria 14769
879 Ga0501070_0003070 3300049586 Bacteria 14540
880 Ga0501070_0003639 3300049586 Bacteria 13323
881 Ga0501070_0061119 3300049586 Bacteria 3122
882 Ga0501070_0113268 3300049586 Bacteria 2242
883 Ga0501073_0061257 3300049589 Bacteria 2626
884 Ga0501074_0039655 3300049590 Bacteria 3411
885 Ga0501080_0023143 3300049742 Bacteria 5762
886 Ga0501080_0298561 3300049742 Bacteria 1461
887 Ga0501083_0060642 3300049744 Bacteria 2527
888 Ga0501035_0000257 3300049822 Bacteria 63434
889 Ga0501035_0073719 3300049822 Bacteria 3020
890 Ga0501035_0168690 3300049822 Bacteria 1892
891 Ga0501044_0000977 3300049823 Bacteria 34360
892 Ga0501044_0001382 3300049823 Bacteria 28450
893 Ga0501044_0003233 3300049823 Bacteria 18345
894 Ga0501044_0003313 3300049823 Bacteria 18143
895 Ga0501044_0065446 3300049823 Bacteria 3707
896 Ga0501044_0221545 3300049823 Bacteria 1842
897 nmdc:mga03683_39082_c1 3300050489 Bacteria 1941
898 nmdc:mga03n38_216022_c1 3300050490 Bacteria 999
899 nmdc:mga03n38_21862_c1 3300050490 Bacteria 2580
900 nmdc:mga03n38_22112_c1 3300050490 Bacteria 2570
901 nmdc:mga03n38_29355_c1 3300050490 Bacteria 2301
902 nmdc:mga03n38_3035_c1 3300050490 Bacteria 5319
903 nmdc:mga03n38_3572_c1 3300050490 Bacteria 5018
904 nmdc:mga03n38_42458_c1 3300050490 Bacteria 1988
905 nmdc:mga03n38_6016_c1 3300050490 Bacteria 4183
906 nmdc:mga03n38_7837_c1 3300050490 Bacteria 3795
907 nmdc:mga00v17_11687_c1 3300050491 Bacteria 4829
908 nmdc:mga00v17_184386_c1 3300050491 Bacteria 1347
909 nmdc:mga00v17_202511_c1 3300050491 Bacteria 1283
910 nmdc:mga00v17_20770_c1 3300050491 Bacteria 3766
911 nmdc:mga00v17_31326_c1 3300050491 Bacteria 3136
912 nmdc:mga00v17_31428_c1 3300050491 Bacteria 3131
913 nmdc:mga00v17_3792_c1 3300050491 Bacteria 7801
914 nmdc:mga00v17_43540_c1 3300050491 Bacteria 2704
915 nmdc:mga00v17_4414_c1 3300050491 Bacteria 7315
916 nmdc:mga00v17_5963_c1 3300050491 Bacteria 6445
917 nmdc:mga00v17_61482_c1 3300050491 Bacteria 2309
918 nmdc:mga00v17_93203_c1 3300050491 Bacteria 1894
919 nmdc:mga0yw44_105230_c1 3300050492 Bacteria 1802
920 nmdc:mga0yw44_176404_c1 3300050492 Bacteria 1405
921 nmdc:mga0yw44_17649_c1 3300050492 Bacteria 3889
922 nmdc:mga0yw44_249740_c1 3300050492 Bacteria 1180
923 nmdc:mga0yw44_35276_c1 3300050492 Bacteria 2938
924 nmdc:mga0yw44_5500_c1 3300050492 Bacteria 5996
925 nmdc:mga0yw44_78080_c1 3300050492 Bacteria 1206
926 nmdc:mga0k408_63019_c1 3300050493 Bacteria 2156
927 nmdc:mga06z11_5107_c1 3300050494 Bacteria 5232
928 nmdc:mga07m45_10817_c2 3300050496 Bacteria 3811
929 nmdc:mga07m45_11196_c1 3300050496 Bacteria 4709
930 nmdc:mga07m45_130583_c1 3300050496 Bacteria 1453
931 nmdc:mga07m45_38628_c1 3300050496 Bacteria 2664
932 nmdc:mga07m45_47188_c1 3300050496 Bacteria 2421
933 nmdc:mga05p37_79717_c1 3300050507 Bacteria 4032
934 nmdc:mga0qj67_35429_c1 3300050509 Bacteria 3902
935 nmdc:mga06r32_10729_c1 3300050510 Bacteria 8250
936 nmdc:mga08y16_179786_c1 3300050511 Bacteria 2196
937 nmdc:mga0a205_69084_c1 3300050515 Bacteria 3412
938 nmdc:mga0sz30_1051_c2 3300050516 Bacteria 8013
939 nmdc:mga0sz30_14219_c1 3300050516 Bacteria 3128
940 nmdc:mga0sz30_17835_c1 3300050516 Bacteria 2039
941 nmdc:mga0sz30_23875_c1 3300050516 Bacteria 2492
942 nmdc:mga0sz30_30958_c1 3300050516 Bacteria 2212
943 nmdc:mga0sz30_3363_c1 3300050516 Bacteria 5752
944 nmdc:mga0sz30_50038_c1 3300050516 Bacteria 1771
945 nmdc:mga0sz30_77251_c1 3300050516 Bacteria 1438
946 nmdc:mga0sz30_935_c1 3300050516 Bacteria 10495
947 Ga0500635_0002098 3300053080 Bacteria 4889
948 Ga0500635_0011115 3300053080 Bacteria 2551
949 Ga0495619_0054648 3300053085 Bacteria 2643
950 Ga0500643_005840 3300053087 Bacteria 5233
951 Ga0500643_006895 3300053087 Bacteria 4673
952 Ga0500556_0001688 3300053104 Bacteria 8507
953 Ga0500593_002007 3300053117 Bacteria 7379
954 Ga0500642_0109249 3300053130 Bacteria 1291
955 Ga0500652_002449 3300053131 Bacteria 5593
956 Ga0500616_0002716 3300053153 Bacteria 14360
957 Ga0500616_0035165 3300053153 Bacteria 2726
958 Ga0500645_000023 3300053730 Bacteria 128995
959 Ga0501084_0081352 3300054114 Bacteria 2717
960 Ga0501082_0383102 3300060353 Bacteria 1227
961 Ga0466962_0016885 3300061719 Bacteria 3517

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038742 Ga0400486_27752 Ga0400486_27752_49_777 239
2 3300049572 Ga0501036_0404718 Ga0501036_0404718_305_1120 243
3 3300009094 Ga0111539_10637365 Ga0111539_106373653 248
4 3300053117 Ga0500593_002007 Ga0500593_002007_125_904 257
5 3300046506 Ga0495583_0156708 Ga0495583_0156708_143_925 258
6 3300048910 Ga0496107_0542488 Ga0496107_0542488_14_829 269
7 3300049569 Ga0501032_0013814 Ga0501032_0013814_1484_2404 277
8 3300049570 Ga0501033_0041430 Ga0501033_0041430_1278_2204 277
9 3300049571 Ga0501034_0103519 Ga0501034_0103519_67_993 277
10 3300049573 Ga0501037_0004967 Ga0501037_0004967_8352_9272 277
11 3300049579 Ga0501043_0005944 Ga0501043_0005944_267_1187 277
12 3300049581 Ga0501047_0038821 Ga0501047_0038821_476_1402 277
13 3300049581 Ga0501047_0049337 Ga0501047_0049337_1759_2679 277
14 3300049586 Ga0501070_0003070 Ga0501070_0003070_10484_11404 277
15 3300049742 Ga0501080_0023143 Ga0501080_0023143_4522_5442 277
16 3300049822 Ga0501035_0000257 Ga0501035_0000257_50363_51289 277
17 3300049823 Ga0501044_0000977 Ga0501044_0000977_6057_6983 277
18 3300049823 Ga0501044_0003233 Ga0501044_0003233_13615_14535 277
19 3300038443 Ga0395901_0584857 Ga0395901_0584857_194_1099 279
20 3300049586 Ga0501070_0061119 Ga0501070_0061119_2164_3084 279
21 3300014326 Ga0157380_10001851 Ga0157380_100018511 283
22 3300048914 Ga0496111_0469091 Ga0496111_0469091_11_868 283
23 3300046543 Ga0495645_0115341 Ga0495645_0115341_523_1650 284
24 3300005366 Ga0070659_100020849 Ga0070659_1000208496 286
25 3300025914 Ga0207671_10080894 Ga0207671_100808943 286
26 3300025919 Ga0207657_10065141 Ga0207657_100651413 286
27 3300025932 Ga0207690_10006937 Ga0207690_100069377 286
28 3300025924 Ga0207694_10049503 Ga0207694_100495031 288
29 3300037466 Ga0395898_0012403 Ga0395898_0012403_1619_2581 288
30 3300037471 Ga0395905_0287259 Ga0395905_0287259_599_1504 289
31 3300044684 Ga0466966_0000236 Ga0466966_0000236_26867_27772 289
32 3300044719 Ga0466971_0027279 Ga0466971_0027279_614_1519 289
33 3300045836 Ga0466958_0047797 Ga0466958_0047797_1214_2119 289
34 iso_pu_bacteria 2929226422 2929230839 289
35 3300049571 Ga0501034_0543083 Ga0501034_0543083_13_933 290
36 3300037418 Ga0395900_0041409 Ga0395900_0041409_3348_4259 292
37 3300003792 Ga0055540_1000207 Ga0055540_100020715 294
38 3300006038 Ga0075365_10130137 Ga0075365_101301372 294
39 3300009545 Ga0105237_10013063 Ga0105237_100130638 294
40 3300010375 Ga0105239_10072566 Ga0105239_100725662 294
41 3300021388 Ga0213875_10001995 Ga0213875_100019955 294
42 3300025303 Ga0209051_1000158 Ga0209051_100015883 294
43 3300025914 Ga0207671_10061121 Ga0207671_100611213 294
44 3300037853 Ga0436364_0990517 Ga0436364_0990517_7479_8390 294
45 3300005456 Ga0070678_100271034 Ga0070678_1002710342 295
46 3300005563 Ga0068855_100752964 Ga0068855_1007529641 295
47 3300009093 Ga0105240_10144161 Ga0105240_101441613 295
48 3300009545 Ga0105237_10000587 Ga0105237_1000058748 295
49 3300025909 Ga0207705_10000352 Ga0207705_1000035223 295
50 3300005842 Ga0068858_100351993 Ga0068858_1003519932 296
51 3300006852 Ga0075433_10056618 Ga0075433_100566183 296
52 3300006871 Ga0075434_100020986 Ga0075434_1000209865 296
53 3300009545 Ga0105237_10047482 Ga0105237_100474822 296
54 3300025986 Ga0207658_10000621 Ga0207658_1000062132 296
55 3300048903 Ga0496100_0000026 Ga0496100_0000026_44374_45306 296
56 3300048904 Ga0496101_0000015 Ga0496101_0000015_205226_206158 296
57 3300048905 Ga0496102_0031692 Ga0496102_0031692_953_1885 296
58 3300048906 Ga0496103_0018772 Ga0496103_0018772_1141_2073 296
59 3300048910 Ga0496107_0000475 Ga0496107_0000475_8289_9221 296
60 3300048911 Ga0496108_0071069 Ga0496108_0071069_1125_2057 296
61 3300048912 Ga0496109_0000022 Ga0496109_0000022_157371_158303 296
62 3300048913 Ga0496110_0007546 Ga0496110_0007546_5578_6510 296
63 3300048917 Ga0496114_0000829 Ga0496114_0000829_3799_4731 296
64 3300048918 Ga0496115_0010831 Ga0496115_0010831_1406_2338 296
65 3300048919 Ga0496116_0014806 Ga0496116_0014806_95_1027 296
66 3300048921 Ga0496118_0023329 Ga0496118_0023329_2988_3920 296
67 3300048924 Ga0496121_0000004 Ga0496121_0000004_740356_741288 296
68 3300048925 Ga0496122_0000257 Ga0496122_0000257_46213_47145 296
69 3300048926 Ga0496123_0003863 Ga0496123_0003863_4950_5882 296
70 3300048927 Ga0496124_0000012 Ga0496124_0000012_465149_466081 296
71 3300048928 Ga0496125_0000003 Ga0496125_0000003_448480_449412 296
72 3300048929 Ga0496126_0000001 Ga0496126_0000001_740356_741288 296
73 3300050515 nmdc:mga0a205_69084_c1 nmdc:mga0a205_69084_c1_935_1849 296
74 3300050516 nmdc:mga0sz30_23875_c1 nmdc:mga0sz30_23875_c1_493_1428 296
75 3300053087 Ga0500643_006895 Ga0500643_006895_1546_2475 296
76 iso_pu_bacteria 2565956761 2566997256 296
77 iso_pu_bacteria 2738541264 2738667931 296
78 iso_pu_bacteria 2738541356 2739147001 296
79 iso_pu_bacteria 2881927736 2881929048 296
80 iso_pu_bacteria 2904535858 2904536270 296
81 iso_pu_bacteria 2922554459 2922558200 296
82 iso_pu_bacteria 8048746797 8048748487 296
83 3300005341 Ga0070691_10182162 Ga0070691_101821621 297
84 3300005344 Ga0070661_100106368 Ga0070661_1001063682 297
85 3300005456 Ga0070678_100104239 Ga0070678_1001042391 297
86 3300006051 Ga0075364_10008064 Ga0075364_100080643 297
87 3300006353 Ga0075370_10100405 Ga0075370_101004052 297
88 3300009174 Ga0105241_10020745 Ga0105241_100207453 297
89 3300013104 Ga0157370_10016874 Ga0157370_100168743 297
90 3300021384 Ga0213876_10011942 Ga0213876_100119423 297
91 3300021388 Ga0213875_10026986 Ga0213875_100269862 297
92 3300025913 Ga0207695_10144529 Ga0207695_101445292 297
93 3300026121 Ga0207683_10429818 Ga0207683_104298181 297
94 3300037853 Ga0436364_1389559 Ga0436364_1389559_3679_4593 297
95 3300038735 Ga0400485_07994 Ga0400485_07994_4599_5504 297
96 3300039062 Ga0400483_066491 Ga0400483_066491_32772_33677 297
97 3300039062 Ga0400483_228778 Ga0400483_228778_64502_65407 297
98 3300039437 Ga0436365_1083994 Ga0436365_1083994_74490_75404 297
99 3300045049 Ga0466959_0018993 Ga0466959_0018993_903_1865 297
100 3300046616 Ga0495668_0000862 Ga0495668_0000862_3579_4493 297
101 3300048911 Ga0496108_0109721 Ga0496108_0109721_1129_2043 297
102 3300048928 Ga0496125_0057942 Ga0496125_0057942_1568_2482 297
103 3300049573 Ga0501037_0257192 Ga0501037_0257192_123_1031 297
104 3300049581 Ga0501047_0071854 Ga0501047_0071854_1557_2471 297
105 3300049586 Ga0501070_0113268 Ga0501070_0113268_432_1346 297
106 3300050491 nmdc:mga00v17_5963_c1 nmdc:mga00v17_5963_c1_3138_4055 297
107 3300050491 nmdc:mga00v17_61482_c1 nmdc:mga00v17_61482_c1_1385_2293 297
108 3300054114 Ga0501084_0081352 Ga0501084_0081352_1731_2648 297
109 iso_pu_bacteria 2738543034 2739366353 297
110 iso_pu_bacteria 2744054611 2744956369 297
111 iso_pu_bacteria 8002392321 8002395379 297
112 3300003203 JGI25406J46586_10006739 JGI25406J46586_100067393 298
113 3300005329 Ga0070683_100033202 Ga0070683_1000332022 298
114 3300005455 Ga0070663_100316966 Ga0070663_1003169662 298
115 3300009093 Ga0105240_10312736 Ga0105240_103127362 298
116 3300009551 Ga0105238_10343149 Ga0105238_103431492 298
117 3300013104 Ga0157370_10334804 Ga0157370_103348042 298
118 3300013307 Ga0157372_10043924 Ga0157372_100439242 298
119 3300020069 Ga0197907_10477761 Ga0197907_104777612 298
120 3300020070 Ga0206356_10088465 Ga0206356_100884655 298
121 3300020081 Ga0206354_10569538 Ga0206354_105695384 298
122 3300020082 Ga0206353_10019350 Ga0206353_100193504 298
123 3300022467 Ga0224712_10000628 Ga0224712_100006282 298
124 3300025924 Ga0207694_10205594 Ga0207694_102055942 298
125 3300026067 Ga0207678_10103601 Ga0207678_101036011 298
126 3300028794 Ga0307515_10270403 Ga0307515_102704032 298
127 3300031251 Ga0265327_10000912 Ga0265327_100009123 298
128 3300038443 Ga0395901_0000002 Ga0395901_0000002_499010_499972 298
129 3300044693 Ga0466961_0073873 Ga0466961_0073873_460_1413 298
130 3300044842 Ga0466957_0041886 Ga0466957_0041886_1299_2261 298
131 3300045836 Ga0466958_0124630 Ga0466958_0124630_569_1531 298
132 3300046455 Ga0495603_0100826 Ga0495603_0100826_453_1412 298
133 3300046472 Ga0495580_0041325 Ga0495580_0041325_90_1079 298
134 3300046474 Ga0495605_0055137 Ga0495605_0055137_462_1451 298
135 3300046506 Ga0495583_0041706 Ga0495583_0041706_126_1085 298
136 3300046694 Ga0495649_0202232 Ga0495649_0202232_37_942 298
137 3300047319 Ga0495674_0189999 Ga0495674_0189999_696_1685 298
138 3300047323 Ga0495683_0116746 Ga0495683_0116746_191_1180 298
139 3300047443 Ga0495687_053654 Ga0495687_053654_392_1381 298
140 3300048903 Ga0496100_0026798 Ga0496100_0026798_1158_2147 298
141 3300048908 Ga0496105_0031837 Ga0496105_0031837_2205_3194 298
142 3300048916 Ga0496113_0064624 Ga0496113_0064624_420_1409 298
143 3300048918 Ga0496115_0129129 Ga0496115_0129129_452_1411 298
144 3300048924 Ga0496121_0116924 Ga0496121_0116924_263_1222 298
145 3300049460 Ga0495682_0040226 Ga0495682_0040226_387_1346 298
146 3300049582 Ga0501048_0020992 Ga0501048_0020992_3832_4731 298
147 iso_pu_bacteria 2643221687 2644490516 298
148 iso_pu_bacteria 2643221715 2644639235 298
149 iso_pu_bacteria 2738541274 2738702389 298
150 iso_pu_bacteria 2738543028 2739331644 298
151 iso_pu_bacteria 2751185725 2753037291 298
152 iso_pu_bacteria 2751185792 2753325160 298
153 iso_pu_bacteria 2842134933 2842135364 298
154 iso_pu_bacteria 2902810491 2902816065 298
155 iso_pu_bacteria 2902837492 2902839652 298
156 iso_pu_bacteria 2929212328 2929212911 298
157 iso_pu_bacteria 2974315732 2974316915 298
158 iso_pu_bacteria 2974315732 2974319087 298
159 iso_pu_bacteria 2984523437 2984525098 298
160 3300005366 Ga0070659_100218123 Ga0070659_1002181232 299
161 3300005435 Ga0070714_100078214 Ga0070714_1000782143 299
162 3300025932 Ga0207690_10243462 Ga0207690_102434621 299
163 3300026142 Ga0207698_10115458 Ga0207698_101154582 299
164 3300027907 Ga0207428_10187595 Ga0207428_101875952 299
165 3300041410 Ga0439461_0000637 Ga0439461_0000637_3088_4002 299
166 3300041411 Ga0439466_0029769 Ga0439466_0029769_89_1003 299
167 3300042004 Ga0439445_0005881 Ga0439445_0005881_1747_2661 299
168 3300044719 Ga0466971_0018480 Ga0466971_0018480_171_1091 299
169 3300050511 nmdc:mga08y16_179786_c1 nmdc:mga08y16_179786_c1_64_984 299
170 3300003792 Ga0055540_1002158 Ga0055540_10021587 300
171 3300003792 Ga0055540_1003933 Ga0055540_10039336 300
172 3300003792 Ga0055540_1004158 Ga0055540_10041585 300
173 3300005353 Ga0070669_100000918 Ga0070669_1000009187 300
174 3300005367 Ga0070667_100000033 Ga0070667_100000033128 300
175 3300005436 Ga0070713_100091785 Ga0070713_1000917852 300
176 3300005440 Ga0070705_100328586 Ga0070705_1003285861 300
177 3300005539 Ga0068853_100426088 Ga0068853_1004260882 300
178 3300005548 Ga0070665_100034345 Ga0070665_1000343453 300
179 3300005617 Ga0068859_100000300 Ga0068859_10000030012 300
180 3300005841 Ga0068863_100003284 Ga0068863_1000032849 300
181 3300005842 Ga0068858_100015480 Ga0068858_1000154802 300
182 3300005843 Ga0068860_100000010 Ga0068860_100000010131 300
183 3300005844 Ga0068862_100000008 Ga0068862_100000008194 300
184 3300005937 Ga0081455_10049454 Ga0081455_100494542 300
185 3300006028 Ga0070717_10182747 Ga0070717_101827472 300
186 3300006038 Ga0075365_10008111 Ga0075365_100081113 300
187 3300006048 Ga0075363_100000999 Ga0075363_1000009997 300
188 3300006048 Ga0075363_100144439 Ga0075363_1001444392 300
189 3300006051 Ga0075364_10011101 Ga0075364_100111015 300
190 3300006051 Ga0075364_10070776 Ga0075364_100707762 300
191 3300006051 Ga0075364_10120684 Ga0075364_101206842 300
192 3300006051 Ga0075364_10241968 Ga0075364_102419682 300
193 3300006178 Ga0075367_10158497 Ga0075367_101584972 300
194 3300006186 Ga0075369_10002769 Ga0075369_100027692 300
195 3300006186 Ga0075369_10003013 Ga0075369_100030132 300
196 3300006186 Ga0075369_10007392 Ga0075369_100073923 300
197 3300006186 Ga0075369_10017850 Ga0075369_100178502 300
198 3300006186 Ga0075369_10033004 Ga0075369_100330042 300
199 3300006353 Ga0075370_10002984 Ga0075370_100029847 300
200 3300006353 Ga0075370_10014517 Ga0075370_100145173 300
201 3300006353 Ga0075370_10125557 Ga0075370_101255572 300
202 3300006353 Ga0075370_10127155 Ga0075370_101271551 300
203 3300006931 Ga0097620_100000300 Ga0097620_10000030042 300
204 3300009093 Ga0105240_10350170 Ga0105240_103501702 300
205 3300009094 Ga0111539_10314605 Ga0111539_103146052 300
206 3300009098 Ga0105245_10559017 Ga0105245_105590171 300
207 3300009101 Ga0105247_10000019 Ga0105247_1000001965 300
208 3300009177 Ga0105248_10000188 Ga0105248_1000018862 300
209 3300009545 Ga0105237_10038233 Ga0105237_100382332 300
210 3300009553 Ga0105249_10000019 Ga0105249_10000019190 300
211 3300010375 Ga0105239_10003372 Ga0105239_100033725 300
212 3300011119 Ga0105246_10334608 Ga0105246_103346082 300
213 3300014325 Ga0163163_10020081 Ga0163163_100200812 300
214 3300025303 Ga0209051_1000949 Ga0209051_10009499 300
215 3300025303 Ga0209051_1001572 Ga0209051_10015725 300
216 3300025303 Ga0209051_1002496 Ga0209051_10024964 300
217 3300025900 Ga0207710_10000036 Ga0207710_10000036173 300
218 3300025901 Ga0207688_10063138 Ga0207688_100631382 300
219 3300025914 Ga0207671_10007683 Ga0207671_100076835 300
220 3300025923 Ga0207681_10001678 Ga0207681_100016782 300
221 3300025928 Ga0207700_10163708 Ga0207700_101637082 300
222 3300025941 Ga0207711_10000168 Ga0207711_100001689 300
223 3300025961 Ga0207712_10000025 Ga0207712_1000002561 300
224 3300025986 Ga0207658_10000125 Ga0207658_1000012559 300
225 3300026035 Ga0207703_10338002 Ga0207703_103380022 300
226 3300026041 Ga0207639_10315708 Ga0207639_103157082 300
227 3300026088 Ga0207641_10008728 Ga0207641_100087282 300
228 3300028380 Ga0268265_10000007 Ga0268265_10000007190 300
229 3300028381 Ga0268264_10000007 Ga0268264_10000007325 300
230 3300031901 Ga0307406_10190487 Ga0307406_101904872 300
231 3300041456 Ga0451795_0520114 Ga0451795_0520114_1815_2738 300
232 3300044658 Ga0466972_0003097 Ga0466972_0003097_4710_5621 300
233 3300044683 Ga0466965_0013675 Ga0466965_0013675_1201_2112 300
234 3300044735 Ga0466968_0002961 Ga0466968_0002961_5278_6189 300
235 3300044735 Ga0466968_0014481 Ga0466968_0014481_2111_3034 300
236 3300044765 Ga0466970_0045943 Ga0466970_0045943_924_1835 300
237 3300044842 Ga0466957_0060335 Ga0466957_0060335_491_1402 300
238 3300044901 Ga0466960_0001119 Ga0466960_0001119_8097_9008 300
239 3300045049 Ga0466959_0025147 Ga0466959_0025147_1765_2676 300
240 3300045976 Ga0466967_0092019 Ga0466967_0092019_1525_2445 300
241 3300046507 Ga0495606_0067474 Ga0495606_0067474_119_1039 300
242 3300046524 Ga0495648_0002953 Ga0495648_0002953_12960_13880 300
243 3300046530 Ga0495654_0033335 Ga0495654_0033335_987_1907 300
244 3300047469 Ga0495673_0000588 Ga0495673_0000588_33046_33966 300
245 3300047472 Ga0495686_0002574 Ga0495686_0002574_14092_15012 300
246 3300047472 Ga0495686_0239910 Ga0495686_0239910_66_992 300
247 3300048903 Ga0496100_0000407 Ga0496100_0000407_18334_19254 300
248 3300048903 Ga0496100_0279764 Ga0496100_0279764_65_988 300
249 3300048904 Ga0496101_0000002 Ga0496101_0000002_110583_111503 300
250 3300048905 Ga0496102_0000009 Ga0496102_0000009_180363_181283 300
251 3300048905 Ga0496102_0000789 Ga0496102_0000789_13246_14169 300
252 3300048905 Ga0496102_0084417 Ga0496102_0084417_1528_2448 300
253 3300048905 Ga0496102_0286891 Ga0496102_0286891_125_1048 300
254 3300048906 Ga0496103_0000005 Ga0496103_0000005_341630_342550 300
255 3300048906 Ga0496103_0000409 Ga0496103_0000409_11887_12810 300
256 3300048907 Ga0496104_0481831 Ga0496104_0481831_82_1020 300
257 3300048909 Ga0496106_0014165 Ga0496106_0014165_2843_3763 300
258 3300048909 Ga0496106_0034334 Ga0496106_0034334_2835_3758 300
259 3300048909 Ga0496106_0211498 Ga0496106_0211498_416_1339 300
260 3300048910 Ga0496107_0013934 Ga0496107_0013934_3818_4738 300
261 3300048916 Ga0496113_0037510 Ga0496113_0037510_1005_1952 300
262 3300048918 Ga0496115_0259378 Ga0496115_0259378_204_1127 300
263 3300048919 Ga0496116_0000104 Ga0496116_0000104_163028_163948 300
264 3300048919 Ga0496116_0012030 Ga0496116_0012030_3801_4724 300
265 3300048920 Ga0496117_0000019 Ga0496117_0000019_287974_288894 300
266 3300048920 Ga0496117_0000564 Ga0496117_0000564_28450_29373 300
267 3300048921 Ga0496118_0000020 Ga0496118_0000020_180363_181283 300
268 3300048921 Ga0496118_0000279 Ga0496118_0000279_3454_4377 300
269 3300048922 Ga0496119_0003048 Ga0496119_0003048_6162_7085 300
270 3300048922 Ga0496119_0024348 Ga0496119_0024348_3254_4174 300
271 3300048923 Ga0496120_0009063 Ga0496120_0009063_3370_4293 300
272 3300048923 Ga0496120_0070350 Ga0496120_0070350_397_1314 300
273 3300048924 Ga0496121_0001252 Ga0496121_0001252_26087_27007 300
274 3300048924 Ga0496121_0004561 Ga0496121_0004561_3671_4594 300
275 3300048925 Ga0496122_0009690 Ga0496122_0009690_8713_9660 300
276 3300048927 Ga0496124_0208243 Ga0496124_0208243_318_1241 300
277 3300048928 Ga0496125_0038627 Ga0496125_0038627_260_1183 300
278 3300048928 Ga0496125_0101715 Ga0496125_0101715_559_1485 300
279 3300048929 Ga0496126_0000931 Ga0496126_0000931_20056_20976 300
280 3300048929 Ga0496126_0001999 Ga0496126_0001999_1794_2717 300
281 3300048929 Ga0496126_0002966 Ga0496126_0002966_5844_6767 300
282 3300048929 Ga0496126_0007614 Ga0496126_0007614_6757_7674 300
283 3300048929 Ga0496126_0034892 Ga0496126_0034892_492_1418 300
284 3300050490 nmdc:mga03n38_22112_c1 nmdc:mga03n38_22112_c1_512_1423 300
285 3300050490 nmdc:mga03n38_3035_c1 nmdc:mga03n38_3035_c1_1910_2821 300
286 3300050491 nmdc:mga00v17_11687_c1 nmdc:mga00v17_11687_c1_2562_3485 300
287 3300050491 nmdc:mga00v17_184386_c1 nmdc:mga00v17_184386_c1_346_1269 300
288 3300050491 nmdc:mga00v17_20770_c1 nmdc:mga00v17_20770_c1_508_1419 300
289 3300050492 nmdc:mga0yw44_17649_c1 nmdc:mga0yw44_17649_c1_358_1269 300
290 3300050492 nmdc:mga0yw44_35276_c1 nmdc:mga0yw44_35276_c1_1536_2459 300
291 3300050493 nmdc:mga0k408_63019_c1 nmdc:mga0k408_63019_c1_998_1909 300
292 3300050494 nmdc:mga06z11_5107_c1 nmdc:mga06z11_5107_c1_2454_3365 300
293 3300050496 nmdc:mga07m45_11196_c1 nmdc:mga07m45_11196_c1_228_1139 300
294 3300050496 nmdc:mga07m45_130583_c1 nmdc:mga07m45_130583_c1_385_1296 300
295 3300050496 nmdc:mga07m45_38628_c1 nmdc:mga07m45_38628_c1_333_1244 300
296 3300050496 nmdc:mga07m45_47188_c1 nmdc:mga07m45_47188_c1_202_1113 300
297 3300050516 nmdc:mga0sz30_14219_c1 nmdc:mga0sz30_14219_c1_879_1799 300
298 3300050516 nmdc:mga0sz30_30958_c1 nmdc:mga0sz30_30958_c1_509_1432 300
299 3300050516 nmdc:mga0sz30_3363_c1 nmdc:mga0sz30_3363_c1_3757_4683 300
300 3300050516 nmdc:mga0sz30_77251_c1 nmdc:mga0sz30_77251_c1_265_1176 300
301 3300053080 Ga0500635_0011115 Ga0500635_0011115_331_1248 300
302 3300053087 Ga0500643_005840 Ga0500643_005840_2492_3412 300
303 3300053130 Ga0500642_0109249 Ga0500642_0109249_261_1184 300
304 3300053131 Ga0500652_002449 Ga0500652_002449_1138_2055 300
305 3300053153 Ga0500616_0002716 Ga0500616_0002716_10966_11886 300
306 3300053730 Ga0500645_000023 Ga0500645_000023_2878_3804 300
307 3300001991 JGI24743J22301_10027850 JGI24743J22301_100278502 301
308 3300002073 JGI24745J21846_1001298 JGI24745J21846_10012982 301
309 3300002075 JGI24738J21930_10011412 JGI24738J21930_100114122 301
310 3300002077 JGI24744J21845_10006363 JGI24744J21845_100063632 301
311 3300002077 JGI24744J21845_10011916 JGI24744J21845_100119162 301
312 3300002239 JGI24034J26672_10003685 JGI24034J26672_100036852 301
313 3300005328 Ga0070676_10042659 Ga0070676_100426592 301
314 3300005330 Ga0070690_100106991 Ga0070690_1001069912 301
315 3300005334 Ga0068869_100033087 Ga0068869_1000330872 301
316 3300005335 Ga0070666_10011131 Ga0070666_100111313 301
317 3300005337 Ga0070682_100004029 Ga0070682_1000040294 301
318 3300005337 Ga0070682_100135875 Ga0070682_1001358752 301
319 3300005338 Ga0068868_100006676 Ga0068868_1000066762 301
320 3300005338 Ga0068868_100071887 Ga0068868_1000718872 301
321 3300005340 Ga0070689_100003095 Ga0070689_1000030957 301
322 3300005341 Ga0070691_10028379 Ga0070691_100283793 301
323 3300005347 Ga0070668_100003162 Ga0070668_1000031624 301
324 3300005347 Ga0070668_100029947 Ga0070668_1000299473 301
325 3300005347 Ga0070668_100066744 Ga0070668_1000667442 301
326 3300005353 Ga0070669_100002624 Ga0070669_1000026243 301
327 3300005355 Ga0070671_100119251 Ga0070671_1001192512 301
328 3300005356 Ga0070674_100004841 Ga0070674_1000048414 301
329 3300005365 Ga0070688_100021334 Ga0070688_1000213342 301
330 3300005365 Ga0070688_100055259 Ga0070688_1000552592 301
331 3300005366 Ga0070659_100022293 Ga0070659_1000222934 301
332 3300005366 Ga0070659_100237137 Ga0070659_1002371372 301
333 3300005434 Ga0070709_10001138 Ga0070709_100011383 301
334 3300005434 Ga0070709_10021799 Ga0070709_100217991 301
335 3300005437 Ga0070710_10003343 Ga0070710_100033433 301
336 3300005438 Ga0070701_10000574 Ga0070701_100005747 301
337 3300005439 Ga0070711_100001370 Ga0070711_1000013707 301
338 3300005439 Ga0070711_100018251 Ga0070711_1000182513 301
339 3300005440 Ga0070705_100007460 Ga0070705_1000074603 301
340 3300005440 Ga0070705_100108413 Ga0070705_1001084132 301
341 3300005441 Ga0070700_100040878 Ga0070700_1000408782 301
342 3300005455 Ga0070663_100058847 Ga0070663_1000588472 301
343 3300005456 Ga0070678_100003144 Ga0070678_1000031447 301
344 3300005457 Ga0070662_100002522 Ga0070662_1000025224 301
345 3300005459 Ga0068867_100002753 Ga0068867_1000027539 301
346 3300005459 Ga0068867_100073218 Ga0068867_1000732182 301
347 3300005466 Ga0070685_10077040 Ga0070685_100770402 301
348 3300005539 Ga0068853_100007969 Ga0068853_1000079698 301
349 3300005543 Ga0070672_100314505 Ga0070672_1003145052 301
350 3300005544 Ga0070686_100028584 Ga0070686_1000285843 301
351 3300005545 Ga0070695_100081041 Ga0070695_1000810412 301
352 3300005546 Ga0070696_100002819 Ga0070696_1000028199 301
353 3300005546 Ga0070696_100096529 Ga0070696_1000965292 301
354 3300005547 Ga0070693_100024104 Ga0070693_1000241041 301
355 3300005548 Ga0070665_100006270 Ga0070665_1000062705 301
356 3300005548 Ga0070665_100550018 Ga0070665_1005500182 301
357 3300005549 Ga0070704_100000324 Ga0070704_1000003247 301
358 3300005578 Ga0068854_100001503 Ga0068854_10000150314 301
359 3300005615 Ga0070702_100031367 Ga0070702_1000313672 301
360 3300005615 Ga0070702_100074665 Ga0070702_1000746652 301
361 3300005617 Ga0068859_100007033 Ga0068859_1000070336 301
362 3300005718 Ga0068866_10000937 Ga0068866_100009374 301
363 3300005719 Ga0068861_100006110 Ga0068861_1000061102 301
364 3300005719 Ga0068861_100074095 Ga0068861_1000740952 301
365 3300005719 Ga0068861_100586243 Ga0068861_1005862431 301
366 3300005841 Ga0068863_100170736 Ga0068863_1001707362 301
367 3300005842 Ga0068858_100007303 Ga0068858_1000073036 301
368 3300005842 Ga0068858_100046133 Ga0068858_1000461332 301
369 3300005843 Ga0068860_100006774 Ga0068860_1000067746 301
370 3300005843 Ga0068860_100600377 Ga0068860_1006003772 301
371 3300005844 Ga0068862_100000958 Ga0068862_10000095815 301
372 3300006051 Ga0075364_10005619 Ga0075364_100056192 301
373 3300006163 Ga0070715_10008709 Ga0070715_100087093 301
374 3300006173 Ga0070716_100006278 Ga0070716_1000062784 301
375 3300006175 Ga0070712_100002027 Ga0070712_1000020274 301
376 3300006844 Ga0075428_100000609 Ga0075428_10000060917 301
377 3300006846 Ga0075430_100003543 Ga0075430_1000035434 301
378 3300006881 Ga0068865_100002876 Ga0068865_1000028769 301
379 3300006931 Ga0097620_100007032 Ga0097620_1000070325 301
380 3300009098 Ga0105245_10035734 Ga0105245_100357342 301
381 3300009098 Ga0105245_10105760 Ga0105245_101057603 301
382 3300009098 Ga0105245_10355261 Ga0105245_103552612 301
383 3300009101 Ga0105247_10000265 Ga0105247_1000026537 301
384 3300009101 Ga0105247_10072375 Ga0105247_100723752 301
385 3300009101 Ga0105247_10194313 Ga0105247_101943131 301
386 3300009147 Ga0114129_10014863 Ga0114129_100148635 301
387 3300009148 Ga0105243_10001541 Ga0105243_1000154117 301
388 3300009148 Ga0105243_10176933 Ga0105243_101769332 301
389 3300009176 Ga0105242_10000329 Ga0105242_100003299 301
390 3300009177 Ga0105248_10006313 Ga0105248_100063134 301
391 3300009545 Ga0105237_10047948 Ga0105237_100479483 301
392 3300009545 Ga0105237_10347126 Ga0105237_103471262 301
393 3300009553 Ga0105249_10000892 Ga0105249_1000089212 301
394 3300010375 Ga0105239_10038691 Ga0105239_100386915 301
395 3300010375 Ga0105239_10247895 Ga0105239_102478952 301
396 3300011119 Ga0105246_10381369 Ga0105246_103813692 301
397 3300013296 Ga0157374_10082396 Ga0157374_100823962 301
398 3300013296 Ga0157374_10301541 Ga0157374_103015412 301
399 3300013297 Ga0157378_10000356 Ga0157378_100003562 301
400 3300013306 Ga0163162_10002067 Ga0163162_100020675 301
401 3300013306 Ga0163162_10025798 Ga0163162_100257983 301
402 3300013307 Ga0157372_10183567 Ga0157372_101835672 301
403 3300013308 Ga0157375_10000760 Ga0157375_1000076014 301
404 3300014326 Ga0157380_10142729 Ga0157380_101427291 301
405 3300014745 Ga0157377_10011682 Ga0157377_100116824 301
406 3300014968 Ga0157379_10019019 Ga0157379_100190192 301
407 3300014969 Ga0157376_10057926 Ga0157376_100579262 301
408 3300017792 Ga0163161_10018358 Ga0163161_100183584 301
409 3300021388 Ga0213875_10017345 Ga0213875_100173452 301
410 3300025898 Ga0207692_10024928 Ga0207692_100249282 301
411 3300025899 Ga0207642_10000917 Ga0207642_100009176 301
412 3300025900 Ga0207710_10009402 Ga0207710_100094023 301
413 3300025900 Ga0207710_10065713 Ga0207710_100657132 301
414 3300025901 Ga0207688_10000235 Ga0207688_1000023514 301
415 3300025901 Ga0207688_10007726 Ga0207688_100077263 301
416 3300025905 Ga0207685_10002069 Ga0207685_100020692 301
417 3300025906 Ga0207699_10095925 Ga0207699_100959252 301
418 3300025907 Ga0207645_10046109 Ga0207645_100461092 301
419 3300025914 Ga0207671_10066856 Ga0207671_100668562 301
420 3300025915 Ga0207693_10002003 Ga0207693_100020034 301
421 3300025915 Ga0207693_10005498 Ga0207693_100054989 301
422 3300025916 Ga0207663_10004168 Ga0207663_100041683 301
423 3300025916 Ga0207663_10016337 Ga0207663_100163374 301
424 3300025927 Ga0207687_10005938 Ga0207687_100059384 301
425 3300025927 Ga0207687_10038940 Ga0207687_100389403 301
426 3300025927 Ga0207687_10203978 Ga0207687_102039782 301
427 3300025931 Ga0207644_10096721 Ga0207644_100967212 301
428 3300025931 Ga0207644_10098165 Ga0207644_100981652 301
429 3300025932 Ga0207690_10034863 Ga0207690_100348632 301
430 3300025932 Ga0207690_10156355 Ga0207690_101563552 301
431 3300025933 Ga0207706_10025990 Ga0207706_100259904 301
432 3300025934 Ga0207686_10007174 Ga0207686_100071744 301
433 3300025935 Ga0207709_10001915 Ga0207709_100019159 301
434 3300025935 Ga0207709_10267877 Ga0207709_102678772 301
435 3300025936 Ga0207670_10033878 Ga0207670_100338783 301
436 3300025937 Ga0207669_10007348 Ga0207669_100073483 301
437 3300025937 Ga0207669_10129936 Ga0207669_101299362 301
438 3300025937 Ga0207669_10264946 Ga0207669_102649462 301
439 3300025938 Ga0207704_10001661 Ga0207704_100016614 301
440 3300025938 Ga0207704_10154761 Ga0207704_101547612 301
441 3300025939 Ga0207665_10001216 Ga0207665_1000121616 301
442 3300025939 Ga0207665_10005614 Ga0207665_100056144 301
443 3300025941 Ga0207711_10153261 Ga0207711_101532612 301
444 3300025942 Ga0207689_10016961 Ga0207689_100169612 301
445 3300025961 Ga0207712_10045018 Ga0207712_100450182 301
446 3300025972 Ga0207668_10003151 Ga0207668_100031514 301
447 3300025972 Ga0207668_10459913 Ga0207668_104599132 301
448 3300025986 Ga0207658_10021277 Ga0207658_100212774 301
449 3300025986 Ga0207658_10492061 Ga0207658_104920611 301
450 3300026023 Ga0207677_10025479 Ga0207677_100254793 301
451 3300026035 Ga0207703_10015805 Ga0207703_100158054 301
452 3300026035 Ga0207703_10049916 Ga0207703_100499162 301
453 3300026041 Ga0207639_10006832 Ga0207639_100068327 301
454 3300026067 Ga0207678_10130964 Ga0207678_101309642 301
455 3300026075 Ga0207708_10111897 Ga0207708_101118972 301
456 3300026075 Ga0207708_10115406 Ga0207708_101154062 301
457 3300026088 Ga0207641_10244993 Ga0207641_102449932 301
458 3300026089 Ga0207648_10003286 Ga0207648_100032864 301
459 3300026089 Ga0207648_10027517 Ga0207648_100275172 301
460 3300026118 Ga0207675_100000865 Ga0207675_10000086516 301
461 3300026118 Ga0207675_100113182 Ga0207675_1001131822 301
462 3300026121 Ga0207683_10000809 Ga0207683_1000080915 301
463 3300026121 Ga0207683_10012042 Ga0207683_100120422 301
464 3300026121 Ga0207683_10125346 Ga0207683_101253462 301
465 3300028379 Ga0268266_10014239 Ga0268266_100142392 301
466 3300028379 Ga0268266_10097931 Ga0268266_100979313 301
467 3300028380 Ga0268265_10005882 Ga0268265_100058822 301
468 3300028380 Ga0268265_10212831 Ga0268265_102128312 301
469 3300028381 Ga0268264_10061459 Ga0268264_100614592 301
470 3300028381 Ga0268264_10571864 Ga0268264_105718642 301
471 3300031251 Ga0265327_10000067 Ga0265327_1000006754 301
472 3300031251 Ga0265327_10076101 Ga0265327_100761012 301
473 3300035112 Ga0373932_0034757 Ga0373932_0034757_153_1079 301
474 3300035121 Ga0373960_0033547 Ga0373960_0033547_52_978 301
475 3300035121 Ga0373960_0040216 Ga0373960_0040216_291_1217 301
476 3300035691 Ga0373931_0067640 Ga0373931_0067640_524_1450 301
477 3300037853 Ga0436364_0584343 Ga0436364_0584343_11936_12874 301
478 3300039437 Ga0436365_0138647 Ga0436365_0138647_686_1624 301
479 3300045976 Ga0466967_0231633 Ga0466967_0231633_792_1718 301
480 3300046531 Ga0495665_0055755 Ga0495665_0055755_554_1474 301
481 3300046674 Ga0495588_0211725 Ga0495588_0211725_91_1011 301
482 3300048903 Ga0496100_0004953 Ga0496100_0004953_42_968 301
483 3300048904 Ga0496101_0000176 Ga0496101_0000176_2416_3339 301
484 3300048904 Ga0496101_0001680 Ga0496101_0001680_6317_7243 301
485 3300048904 Ga0496101_0023601 Ga0496101_0023601_126_1052 301
486 3300048905 Ga0496102_0003683 Ga0496102_0003683_7889_8815 301
487 3300048906 Ga0496103_0001002 Ga0496103_0001002_13745_14671 301
488 3300048906 Ga0496103_0049183 Ga0496103_0049183_1323_2249 301
489 3300048906 Ga0496103_0105600 Ga0496103_0105600_416_1339 301
490 3300048907 Ga0496104_0000793 Ga0496104_0000793_23716_24639 301
491 3300048907 Ga0496104_0286865 Ga0496104_0286865_437_1363 301
492 3300048908 Ga0496105_0006293 Ga0496105_0006293_2436_3359 301
493 3300048908 Ga0496105_0192050 Ga0496105_0192050_671_1597 301
494 3300048909 Ga0496106_0008413 Ga0496106_0008413_1774_2700 301
495 3300048909 Ga0496106_0024430 Ga0496106_0024430_2552_3475 301
496 3300048909 Ga0496106_0329581 Ga0496106_0329581_27_953 301
497 3300048910 Ga0496107_0007237 Ga0496107_0007237_4868_5794 301
498 3300048910 Ga0496107_0062523 Ga0496107_0062523_546_1472 301
499 3300048911 Ga0496108_0000189 Ga0496108_0000189_24626_25552 301
500 3300048911 Ga0496108_0045620 Ga0496108_0045620_952_1875 301
501 3300048911 Ga0496108_0066092 Ga0496108_0066092_1937_2854 301
502 3300048912 Ga0496109_0018882 Ga0496109_0018882_1458_2384 301
503 3300048912 Ga0496109_0404077 Ga0496109_0404077_32_958 301
504 3300048914 Ga0496111_0296354 Ga0496111_0296354_56_982 301
505 3300048915 Ga0496112_0046435 Ga0496112_0046435_3322_4239 301
506 3300048915 Ga0496112_0067772 Ga0496112_0067772_1380_2306 301
507 3300048916 Ga0496113_0430113 Ga0496113_0430113_46_972 301
508 3300048917 Ga0496114_0005432 Ga0496114_0005432_4622_5548 301
509 3300048917 Ga0496114_0009086 Ga0496114_0009086_1990_2913 301
510 3300048918 Ga0496115_0002308 Ga0496115_0002308_7456_8382 301
511 3300048918 Ga0496115_0039401 Ga0496115_0039401_225_1148 301
512 3300048920 Ga0496117_0158938 Ga0496117_0158938_42_971 301
513 3300050507 nmdc:mga05p37_79717_c1 nmdc:mga05p37_79717_c1_1223_2140 301
514 3300050509 nmdc:mga0qj67_35429_c1 nmdc:mga0qj67_35429_c1_1734_2651 301
515 iso_pu_bacteria 2929212328 2929216969 301
516 3300005337 Ga0070682_100053750 Ga0070682_1000537503 302
517 3300005338 Ga0068868_100089792 Ga0068868_1000897921 302
518 3300005441 Ga0070700_100302577 Ga0070700_1003025772 302
519 3300005535 Ga0070684_100176252 Ga0070684_1001762522 302
520 3300005564 Ga0070664_100306518 Ga0070664_1003065182 302
521 3300006048 Ga0075363_100007545 Ga0075363_1000075453 302
522 3300009174 Ga0105241_10425441 Ga0105241_104254411 302
523 3300010375 Ga0105239_10073218 Ga0105239_100732184 302
524 3300025945 Ga0207679_10251217 Ga0207679_102512172 302
525 3300026118 Ga0207675_100306160 Ga0207675_1003061602 302
526 3300044656 Ga0466969_0046993 Ga0466969_0046993_269_1216 302
527 3300044684 Ga0466966_0014538 Ga0466966_0014538_1141_2088 302
528 3300044765 Ga0466970_0170683 Ga0466970_0170683_74_1021 302
529 3300044842 Ga0466957_0007155 Ga0466957_0007155_2474_3421 302
530 3300045836 Ga0466958_0004750 Ga0466958_0004750_2028_2975 302
531 3300048904 Ga0496101_0267084 Ga0496101_0267084_96_1025 302
532 3300048907 Ga0496104_0128710 Ga0496104_0128710_82_1011 302
533 3300048911 Ga0496108_0007870 Ga0496108_0007870_4626_5555 302
534 3300048912 Ga0496109_0016750 Ga0496109_0016750_5385_6314 302
535 3300048915 Ga0496112_0022286 Ga0496112_0022286_1305_2234 302
536 3300049569 Ga0501032_0001262 Ga0501032_0001262_19203_20123 302
537 3300049569 Ga0501032_0119055 Ga0501032_0119055_374_1345 302
538 3300049571 Ga0501034_0005748 Ga0501034_0005748_6299_7219 302
539 3300049572 Ga0501036_0098794 Ga0501036_0098794_199_1119 302
540 3300049573 Ga0501037_0006541 Ga0501037_0006541_7429_8349 302
541 3300049574 Ga0501038_0008311 Ga0501038_0008311_1481_2401 302
542 3300049575 Ga0501039_0005085 Ga0501039_0005085_1894_2814 302
543 3300049579 Ga0501043_0004747 Ga0501043_0004747_4684_5604 302
544 3300049583 Ga0501067_0047620 Ga0501067_0047620_799_1719 302
545 3300049586 Ga0501070_0002972 Ga0501070_0002972_8127_9047 302
546 3300049823 Ga0501044_0221545 Ga0501044_0221545_194_1114 302
547 3300050490 nmdc:mga03n38_3572_c1 nmdc:mga03n38_3572_c1_2887_3816 302
548 3300005548 Ga0070665_100002721 Ga0070665_1000027217 303
549 3300028379 Ga0268266_10001219 Ga0268266_1000121913 303
550 3300036647 Ga0316582_0157152 Ga0316582_0157152_242_1159 303
551 3300048903 Ga0496100_0020227 Ga0496100_0020227_696_1616 303
552 3300048904 Ga0496101_0111983 Ga0496101_0111983_516_1436 303
553 3300048906 Ga0496103_0058278 Ga0496103_0058278_374_1294 303
554 3300048907 Ga0496104_0173589 Ga0496104_0173589_329_1249 303
555 3300048909 Ga0496106_0221087 Ga0496106_0221087_391_1311 303
556 3300048910 Ga0496107_0109264 Ga0496107_0109264_461_1381 303
557 3300048911 Ga0496108_0080026 Ga0496108_0080026_636_1556 303
558 3300048912 Ga0496109_0064985 Ga0496109_0064985_1017_1937 303
559 3300048917 Ga0496114_0014343 Ga0496114_0014343_4495_5415 303
560 3300048917 Ga0496114_0015198 Ga0496114_0015198_1336_2256 303
561 3300049590 Ga0501074_0039655 Ga0501074_0039655_2279_3295 303
562 3300053085 Ga0495619_0054648 Ga0495619_0054648_1144_2064 303
563 3300005336 Ga0070680_100263000 Ga0070680_1002630002 304
564 3300025901 Ga0207688_10121521 Ga0207688_101215212 304
565 3300025927 Ga0207687_10351506 Ga0207687_103515062 304
566 3300026041 Ga0207639_10276005 Ga0207639_102760051 304
567 3300026095 Ga0207676_10286784 Ga0207676_102867842 304
568 3300045976 Ga0466967_0026122 Ga0466967_0026122_3483_4445 304
569 3300046455 Ga0495603_0056436 Ga0495603_0056436_401_1324 304
570 3300046683 Ga0495658_0059303 Ga0495658_0059303_414_1337 304
571 iso_pu_bacteria 2939582691 2939584176 304
572 3300039450 Ga0436363_1679774 Ga0436363_1679774_4709_5632 305
573 3300048906 Ga0496103_0273533 Ga0496103_0273533_81_998 305
574 3300048910 Ga0496107_0008199 Ga0496107_0008199_1787_2713 305
575 iso_pu_bacteria 2643221687 2644491099 305
576 iso_pu_bacteria 2643221715 2644634531 305
577 iso_pu_bacteria 2902792274 2902792685 305
578 iso_pu_bacteria 2902810491 2902816749 305
579 iso_pu_bacteria 2902837492 2902843746 305
580 3300005435 Ga0070714_100715552 Ga0070714_1007155521 306
581 3300031852 Ga0307410_10010477 Ga0307410_100104772 306
582 3300039437 Ga0436365_1305970 Ga0436365_1305970_4708_5637 306
583 3300044694 Ga0466963_0005748 Ga0466963_0005748_1247_2176 306
584 3300044694 Ga0466963_0104906 Ga0466963_0104906_787_1716 306
585 3300044842 Ga0466957_0020206 Ga0466957_0020206_1021_1950 306
586 3300044901 Ga0466960_0010770 Ga0466960_0010770_2065_2994 306
587 3300045976 Ga0466967_0001551 Ga0466967_0001551_11271_12200 306
588 3300045976 Ga0466967_0076412 Ga0466967_0076412_846_1775 306
589 3300049569 Ga0501032_0004982 Ga0501032_0004982_4949_5878 306
590 3300049570 Ga0501033_0024034 Ga0501033_0024034_743_1672 306
591 3300049571 Ga0501034_0005877 Ga0501034_0005877_5991_6920 306
592 3300049573 Ga0501037_0001928 Ga0501037_0001928_3665_4594 306
593 3300049580 Ga0501046_0004073 Ga0501046_0004073_12011_12940 306
594 3300049581 Ga0501047_0006308 Ga0501047_0006308_6522_7451 306
595 3300049585 Ga0501069_0266296 Ga0501069_0266296_12_950 306
596 3300049586 Ga0501070_0002057 Ga0501070_0002057_11759_12688 306
597 3300049744 Ga0501083_0060642 Ga0501083_0060642_333_1262 306
598 3300049823 Ga0501044_0001382 Ga0501044_0001382_20253_21182 306
599 3300053080 Ga0500635_0002098 Ga0500635_0002098_722_1651 306
600 3300060353 Ga0501082_0383102 Ga0501082_0383102_15_944 306
601 3300005355 Ga0070671_100008676 Ga0070671_1000086761 307
602 3300005367 Ga0070667_100010764 Ga0070667_1000107645 307
603 3300005548 Ga0070665_100002910 Ga0070665_10000291014 307
604 3300005841 Ga0068863_100049338 Ga0068863_1000493382 307
605 3300005981 Ga0081538_10053133 Ga0081538_100531332 307
606 3300006038 Ga0075365_10021929 Ga0075365_100219292 307
607 3300006038 Ga0075365_10094207 Ga0075365_100942071 307
608 3300006038 Ga0075365_10119641 Ga0075365_101196412 307
609 3300006038 Ga0075365_10197090 Ga0075365_101970902 307
610 3300006048 Ga0075363_100002029 Ga0075363_1000020293 307
611 3300006048 Ga0075363_100021077 Ga0075363_1000210772 307
612 3300006048 Ga0075363_100033998 Ga0075363_1000339983 307
613 3300006051 Ga0075364_10006900 Ga0075364_100069007 307
614 3300006051 Ga0075364_10154487 Ga0075364_101544872 307
615 3300006051 Ga0075364_10311812 Ga0075364_103118121 307
616 3300006178 Ga0075367_10097939 Ga0075367_100979392 307
617 3300006186 Ga0075369_10038362 Ga0075369_100383622 307
618 3300006186 Ga0075369_10065419 Ga0075369_100654191 307
619 3300006353 Ga0075370_10031123 Ga0075370_100311233 307
620 3300006353 Ga0075370_10107482 Ga0075370_101074821 307
621 3300009147 Ga0114129_10804511 Ga0114129_108045111 307
622 3300011119 Ga0105246_10063567 Ga0105246_100635672 307
623 3300026088 Ga0207641_10054108 Ga0207641_100541082 307
624 3300028379 Ga0268266_10002719 Ga0268266_1000271914 307
625 3300028381 Ga0268264_10154549 Ga0268264_101545492 307
626 3300032002 Ga0307416_100085071 Ga0307416_1000850711 307
627 3300032005 Ga0307411_10024307 Ga0307411_100243073 307
628 3300032126 Ga0307415_100024393 Ga0307415_1000243933 307
629 3300037853 Ga0436364_0724530 Ga0436364_0724530_18064_19044 307
630 3300039437 Ga0436365_1936517 Ga0436365_1936517_16460_17389 307
631 3300041997 Ga0439431_0046609 Ga0439431_0046609_24_947 307
632 3300042004 Ga0439445_0026394 Ga0439445_0026394_471_1394 307
633 3300042435 Ga0439434_0004220 Ga0439434_0004220_935_1858 307
634 3300044684 Ga0466966_0076843 Ga0466966_0076843_262_1191 307
635 3300044693 Ga0466961_0079250 Ga0466961_0079250_318_1247 307
636 3300044694 Ga0466963_0292522 Ga0466963_0292522_53_976 307
637 3300044735 Ga0466968_0030687 Ga0466968_0030687_732_1661 307
638 3300044735 Ga0466968_0061450 Ga0466968_0061450_283_1206 307
639 3300045836 Ga0466958_0002652 Ga0466958_0002652_1491_2420 307
640 3300045976 Ga0466967_0074046 Ga0466967_0074046_1113_2036 307
641 3300045976 Ga0466967_0386777 Ga0466967_0386777_419_1342 307
642 3300048904 Ga0496101_0234141 Ga0496101_0234141_433_1356 307
643 3300048905 Ga0496102_0003406 Ga0496102_0003406_10719_11642 307
644 3300048905 Ga0496102_0078577 Ga0496102_0078577_1693_2622 307
645 3300048905 Ga0496102_0138452 Ga0496102_0138452_643_1566 307
646 3300048911 Ga0496108_0121305 Ga0496108_0121305_922_1845 307
647 3300048912 Ga0496109_0198274 Ga0496109_0198274_704_1627 307
648 3300048915 Ga0496112_0012600 Ga0496112_0012600_1825_2748 307
649 3300048916 Ga0496113_0148150 Ga0496113_0148150_183_1106 307
650 3300048917 Ga0496114_0440135 Ga0496114_0440135_61_984 307
651 3300048921 Ga0496118_0000609 Ga0496118_0000609_44821_45750 307
652 3300048924 Ga0496121_0247536 Ga0496121_0247536_149_1072 307
653 3300048929 Ga0496126_0004965 Ga0496126_0004965_7442_8422 307
654 3300049571 Ga0501034_0218066 Ga0501034_0218066_888_1811 307
655 3300049822 Ga0501035_0168690 Ga0501035_0168690_154_1083 307
656 3300050489 nmdc:mga03683_39082_c1 nmdc:mga03683_39082_c1_938_1864 307
657 3300050490 nmdc:mga03n38_21862_c1 nmdc:mga03n38_21862_c1_288_1217 307
658 3300050490 nmdc:mga03n38_29355_c1 nmdc:mga03n38_29355_c1_532_1455 307
659 3300050490 nmdc:mga03n38_42458_c1 nmdc:mga03n38_42458_c1_635_1564 307
660 3300050490 nmdc:mga03n38_6016_c1 nmdc:mga03n38_6016_c1_2865_3845 307
661 3300050490 nmdc:mga03n38_7837_c1 nmdc:mga03n38_7837_c1_2486_3409 307
662 3300050491 nmdc:mga00v17_31326_c1 nmdc:mga00v17_31326_c1_1929_2858 307
663 3300050491 nmdc:mga00v17_31428_c1 nmdc:mga00v17_31428_c1_67_993 307
664 3300050491 nmdc:mga00v17_43540_c1 nmdc:mga00v17_43540_c1_935_1858 307
665 3300050491 nmdc:mga00v17_93203_c1 nmdc:mga00v17_93203_c1_183_1163 307
666 3300050492 nmdc:mga0yw44_176404_c1 nmdc:mga0yw44_176404_c1_423_1352 307
667 3300050492 nmdc:mga0yw44_5500_c1 nmdc:mga0yw44_5500_c1_3283_4209 307
668 3300050492 nmdc:mga0yw44_78080_c1 nmdc:mga0yw44_78080_c1_224_1147 307
669 3300050496 nmdc:mga07m45_10817_c2 nmdc:mga07m45_10817_c2_2766_3689 307
670 3300050516 nmdc:mga0sz30_17835_c1 nmdc:mga0sz30_17835_c1_139_1062 307
671 3300001989 JGI24739J22299_10030285 JGI24739J22299_100302852 308
672 3300002075 JGI24738J21930_10028872 JGI24738J21930_100288721 308
673 3300002077 JGI24744J21845_10012948 JGI24744J21845_100129481 308
674 3300002244 JGI24742J22300_10003451 JGI24742J22300_100034512 308
675 3300005330 Ga0070690_100032667 Ga0070690_1000326671 308
676 3300005334 Ga0068869_100004264 Ga0068869_1000042644 308
677 3300005334 Ga0068869_100123533 Ga0068869_1001235332 308
678 3300005335 Ga0070666_10007434 Ga0070666_100074345 308
679 3300005336 Ga0070680_100078971 Ga0070680_1000789712 308
680 3300005337 Ga0070682_100008585 Ga0070682_1000085852 308
681 3300005338 Ga0068868_100001267 Ga0068868_10000126719 308
682 3300005338 Ga0068868_100017252 Ga0068868_1000172524 308
683 3300005340 Ga0070689_100068048 Ga0070689_1000680482 308
684 3300005341 Ga0070691_10001945 Ga0070691_100019455 308
685 3300005343 Ga0070687_100024588 Ga0070687_1000245882 308
686 3300005347 Ga0070668_100034759 Ga0070668_1000347593 308
687 3300005356 Ga0070674_100070662 Ga0070674_1000706622 308
688 3300005356 Ga0070674_100086627 Ga0070674_1000866272 308
689 3300005365 Ga0070688_100008911 Ga0070688_1000089115 308
690 3300005366 Ga0070659_100090496 Ga0070659_1000904963 308
691 3300005366 Ga0070659_100337250 Ga0070659_1003372501 308
692 3300005367 Ga0070667_100003398 Ga0070667_1000033983 308
693 3300005434 Ga0070709_10002108 Ga0070709_100021081 308
694 3300005437 Ga0070710_10023520 Ga0070710_100235202 308
695 3300005438 Ga0070701_10000460 Ga0070701_1000046016 308
696 3300005438 Ga0070701_10062632 Ga0070701_100626321 308
697 3300005439 Ga0070711_100002323 Ga0070711_1000023237 308
698 3300005439 Ga0070711_100055304 Ga0070711_1000553042 308
699 3300005440 Ga0070705_100005812 Ga0070705_1000058123 308
700 3300005440 Ga0070705_100166087 Ga0070705_1001660872 308
701 3300005441 Ga0070700_100007425 Ga0070700_1000074255 308
702 3300005441 Ga0070700_100092465 Ga0070700_1000924652 308
703 3300005444 Ga0070694_100004527 Ga0070694_1000045273 308
704 3300005455 Ga0070663_100013531 Ga0070663_1000135311 308
705 3300005456 Ga0070678_100046533 Ga0070678_1000465332 308
706 3300005457 Ga0070662_100026632 Ga0070662_1000266322 308
707 3300005457 Ga0070662_100276979 Ga0070662_1002769791 308
708 3300005459 Ga0068867_100004361 Ga0068867_1000043614 308
709 3300005536 Ga0070697_100349457 Ga0070697_1003494572 308
710 3300005539 Ga0068853_100016526 Ga0068853_1000165265 308
711 3300005539 Ga0068853_100241552 Ga0068853_1002415522 308
712 3300005543 Ga0070672_100171258 Ga0070672_1001712583 308
713 3300005544 Ga0070686_100144414 Ga0070686_1001444142 308
714 3300005545 Ga0070695_100016576 Ga0070695_1000165762 308
715 3300005545 Ga0070695_100215410 Ga0070695_1002154101 308
716 3300005546 Ga0070696_100041777 Ga0070696_1000417772 308
717 3300005547 Ga0070693_100058270 Ga0070693_1000582702 308
718 3300005547 Ga0070693_100084523 Ga0070693_1000845232 308
719 3300005548 Ga0070665_100067775 Ga0070665_1000677753 308
720 3300005549 Ga0070704_100009039 Ga0070704_1000090394 308
721 3300005578 Ga0068854_100001133 Ga0068854_1000011333 308
722 3300005578 Ga0068854_100076388 Ga0068854_1000763882 308
723 3300005615 Ga0070702_100001907 Ga0070702_1000019074 308
724 3300005615 Ga0070702_100167430 Ga0070702_1001674301 308
725 3300005616 Ga0068852_100155361 Ga0068852_1001553612 308
726 3300005617 Ga0068859_100001798 Ga0068859_10000179816 308
727 3300005718 Ga0068866_10009714 Ga0068866_100097143 308
728 3300005719 Ga0068861_100000649 Ga0068861_1000006499 308
729 3300005719 Ga0068861_100015616 Ga0068861_1000156165 308
730 3300005842 Ga0068858_100001026 Ga0068858_10000102631 308
731 3300005843 Ga0068860_100003057 Ga0068860_1000030575 308
732 3300006048 Ga0075363_100022089 Ga0075363_1000220892 308
733 3300006051 Ga0075364_10009026 Ga0075364_100090265 308
734 3300006163 Ga0070715_10005624 Ga0070715_100056241 308
735 3300006163 Ga0070715_10016832 Ga0070715_100168321 308
736 3300006173 Ga0070716_100002154 Ga0070716_1000021544 308
737 3300006173 Ga0070716_100007540 Ga0070716_1000075405 308
738 3300006175 Ga0070712_100000675 Ga0070712_10000067520 308
739 3300006175 Ga0070712_100023582 Ga0070712_1000235825 308
740 3300006177 Ga0075362_10066951 Ga0075362_100669512 308
741 3300006178 Ga0075367_10153107 Ga0075367_101531072 308
742 3300006186 Ga0075369_10000666 Ga0075369_100006667 308
743 3300006186 Ga0075369_10009178 Ga0075369_100091782 308
744 3300006844 Ga0075428_100003982 Ga0075428_1000039827 308
745 3300006846 Ga0075430_100043225 Ga0075430_1000432253 308
746 3300006847 Ga0075431_100013631 Ga0075431_1000136314 308
747 3300006881 Ga0068865_100000988 Ga0068865_1000009889 308
748 3300006931 Ga0097620_100001798 Ga0097620_10000179816 308
749 3300009098 Ga0105245_10072200 Ga0105245_100722002 308
750 3300009101 Ga0105247_10000517 Ga0105247_1000051735 308
751 3300009147 Ga0114129_10006162 Ga0114129_100061628 308
752 3300009148 Ga0105243_10004543 Ga0105243_100045434 308
753 3300009174 Ga0105241_10049089 Ga0105241_100490892 308
754 3300009176 Ga0105242_10002252 Ga0105242_100022522 308
755 3300009177 Ga0105248_10065705 Ga0105248_100657053 308
756 3300009551 Ga0105238_10391130 Ga0105238_103911302 308
757 3300009553 Ga0105249_10010119 Ga0105249_100101197 308
758 3300013105 Ga0157369_10520420 Ga0157369_105204201 308
759 3300013296 Ga0157374_10348673 Ga0157374_103486732 308
760 3300013297 Ga0157378_10003135 Ga0157378_1000313512 308
761 3300013306 Ga0163162_10305174 Ga0163162_103051742 308
762 3300013307 Ga0157372_10059963 Ga0157372_100599633 308
763 3300013307 Ga0157372_10110237 Ga0157372_101102371 308
764 3300013308 Ga0157375_10009045 Ga0157375_100090455 308
765 3300013308 Ga0157375_10068732 Ga0157375_100687323 308
766 3300014326 Ga0157380_10001266 Ga0157380_100012663 308
767 3300014968 Ga0157379_10004806 Ga0157379_100048065 308
768 3300014969 Ga0157376_10426916 Ga0157376_104269161 308
769 3300017792 Ga0163161_10000976 Ga0163161_1000097619 308
770 3300021388 Ga0213875_10084560 Ga0213875_100845601 308
771 3300025898 Ga0207692_10024473 Ga0207692_100244732 308
772 3300025899 Ga0207642_10000822 Ga0207642_1000082211 308
773 3300025900 Ga0207710_10002308 Ga0207710_100023088 308
774 3300025900 Ga0207710_10017219 Ga0207710_100172191 308
775 3300025901 Ga0207688_10004987 Ga0207688_100049877 308
776 3300025901 Ga0207688_10020294 Ga0207688_100202942 308
777 3300025903 Ga0207680_10049693 Ga0207680_100496932 308
778 3300025905 Ga0207685_10055002 Ga0207685_100550022 308
779 3300025905 Ga0207685_10116243 Ga0207685_101162431 308
780 3300025907 Ga0207645_10117281 Ga0207645_101172813 308
781 3300025911 Ga0207654_10008666 Ga0207654_100086664 308
782 3300025915 Ga0207693_10003680 Ga0207693_100036807 308
783 3300025915 Ga0207693_10015601 Ga0207693_100156017 308
784 3300025916 Ga0207663_10081293 Ga0207663_100812933 308
785 3300025917 Ga0207660_10057200 Ga0207660_100572002 308
786 3300025918 Ga0207662_10031960 Ga0207662_100319603 308
787 3300025923 Ga0207681_10038325 Ga0207681_100383253 308
788 3300025923 Ga0207681_10169826 Ga0207681_101698262 308
789 3300025924 Ga0207694_10491922 Ga0207694_104919221 308
790 3300025926 Ga0207659_10068415 Ga0207659_100684153 308
791 3300025927 Ga0207687_10008539 Ga0207687_100085393 308
792 3300025927 Ga0207687_10073145 Ga0207687_100731452 308
793 3300025932 Ga0207690_10064081 Ga0207690_100640813 308
794 3300025933 Ga0207706_10042550 Ga0207706_100425502 308
795 3300025933 Ga0207706_10061444 Ga0207706_100614441 308
796 3300025934 Ga0207686_10056106 Ga0207686_100561062 308
797 3300025935 Ga0207709_10069321 Ga0207709_100693212 308
798 3300025936 Ga0207670_10123513 Ga0207670_101235132 308
799 3300025937 Ga0207669_10001222 Ga0207669_1000122212 308
800 3300025938 Ga0207704_10057576 Ga0207704_100575762 308
801 3300025939 Ga0207665_10024589 Ga0207665_100245894 308
802 3300025940 Ga0207691_10244670 Ga0207691_102446702 308
803 3300025940 Ga0207691_10286947 Ga0207691_102869471 308
804 3300025941 Ga0207711_10044387 Ga0207711_100443873 308
805 3300025942 Ga0207689_10070988 Ga0207689_100709882 308
806 3300025961 Ga0207712_10020672 Ga0207712_100206723 308
807 3300025972 Ga0207668_10445829 Ga0207668_104458291 308
808 3300025972 Ga0207668_10542169 Ga0207668_105421691 308
809 3300025981 Ga0207640_10003697 Ga0207640_100036979 308
810 3300025986 Ga0207658_10027530 Ga0207658_100275303 308
811 3300026023 Ga0207677_10027755 Ga0207677_100277553 308
812 3300026023 Ga0207677_10048665 Ga0207677_100486652 308
813 3300026035 Ga0207703_10003469 Ga0207703_100034693 308
814 3300026035 Ga0207703_10012068 Ga0207703_100120685 308
815 3300026041 Ga0207639_10013554 Ga0207639_100135543 308
816 3300026067 Ga0207678_10011489 Ga0207678_100114898 308
817 3300026067 Ga0207678_10018657 Ga0207678_100186572 308
818 3300026075 Ga0207708_10009345 Ga0207708_100093456 308
819 3300026075 Ga0207708_10050894 Ga0207708_100508941 308
820 3300026089 Ga0207648_10002570 Ga0207648_100025704 308
821 3300026118 Ga0207675_100008787 Ga0207675_1000087876 308
822 3300026142 Ga0207698_10190416 Ga0207698_101904162 308
823 3300028381 Ga0268264_10003411 Ga0268264_100034112 308
824 3300031995 Ga0307409_100539295 Ga0307409_1005392951 308
825 3300032002 Ga0307416_100141975 Ga0307416_1001419752 308
826 3300035242 Ga0373962_0041142 Ga0373962_0041142_72_998 308
827 3300035691 Ga0373931_0252172 Ga0373931_0252172_60_986 308
828 3300037853 Ga0436364_0605056 Ga0436364_0605056_2157_3089 308
829 3300037853 Ga0436364_0796992 Ga0436364_0796992_175_1107 308
830 3300039437 Ga0436365_1334824 Ga0436365_1334824_12386_13318 308
831 3300041411 Ga0439466_0001784 Ga0439466_0001784_2417_3343 308
832 3300041413 Ga0439465_0011150 Ga0439465_0011150_1655_2581 308
833 3300041997 Ga0439431_0008956 Ga0439431_0008956_1064_1990 308
834 3300042002 Ga0439442_021566 Ga0439442_021566_348_1274 308
835 3300042436 Ga0439435_0004781 Ga0439435_0004781_525_1451 308
836 3300044658 Ga0466972_0155687 Ga0466972_0155687_98_1024 308
837 3300044765 Ga0466970_0003872 Ga0466970_0003872_493_1419 308
838 3300045049 Ga0466959_0017217 Ga0466959_0017217_125_1051 308
839 3300048903 Ga0496100_0010477 Ga0496100_0010477_617_1543 308
840 3300048904 Ga0496101_0122181 Ga0496101_0122181_916_1842 308
841 3300048905 Ga0496102_0001958 Ga0496102_0001958_9184_10110 308
842 3300048906 Ga0496103_0000610 Ga0496103_0000610_7211_8137 308
843 3300048906 Ga0496103_0026722 Ga0496103_0026722_2441_3367 308
844 3300048907 Ga0496104_0383891 Ga0496104_0383891_369_1295 308
845 3300048909 Ga0496106_0005431 Ga0496106_0005431_735_1661 308
846 3300048909 Ga0496106_0111605 Ga0496106_0111605_874_1902 308
847 3300048910 Ga0496107_0001091 Ga0496107_0001091_823_1749 308
848 3300048911 Ga0496108_0007693 Ga0496108_0007693_5244_6170 308
849 3300048912 Ga0496109_0001533 Ga0496109_0001533_1731_2657 308
850 3300048915 Ga0496112_0054624 Ga0496112_0054624_1787_2713 308
851 3300048916 Ga0496113_0091562 Ga0496113_0091562_734_1660 308
852 3300048917 Ga0496114_0001530 Ga0496114_0001530_15066_15992 308
853 3300050490 nmdc:mga03n38_216022_c1 nmdc:mga03n38_216022_c1_16_942 308
854 3300050491 nmdc:mga00v17_3792_c1 nmdc:mga00v17_3792_c1_4088_5014 308
855 3300050510 nmdc:mga06r32_10729_c1 nmdc:mga06r32_10729_c1_3236_4330 308
856 3300050516 nmdc:mga0sz30_1051_c2 nmdc:mga0sz30_1051_c2_492_1418 308
857 3300050516 nmdc:mga0sz30_935_c1 nmdc:mga0sz30_935_c1_4865_5791 308
858 3300061719 Ga0466962_0016885 Ga0466962_0016885_1191_2117 308
859 3300000546 LJNas_1005481 LJNas_10054811 309
860 3300003792 Ga0055540_1003118 Ga0055540_10031187 309
861 3300003792 Ga0055540_1011522 Ga0055540_10115224 309
862 3300005337 Ga0070682_100070849 Ga0070682_1000708492 309
863 3300005347 Ga0070668_100000264 Ga0070668_10000026423 309
864 3300005356 Ga0070674_100006933 Ga0070674_1000069332 309
865 3300005367 Ga0070667_100000962 Ga0070667_10000096225 309
866 3300005455 Ga0070663_100005728 Ga0070663_1000057287 309
867 3300005616 Ga0068852_100548741 Ga0068852_1005487412 309
868 3300005617 Ga0068859_100005012 Ga0068859_10000501211 309
869 3300005618 Ga0068864_100583880 Ga0068864_1005838801 309
870 3300005841 Ga0068863_100002210 Ga0068863_1000022102 309
871 3300005841 Ga0068863_100244078 Ga0068863_1002440782 309
872 3300005842 Ga0068858_100048229 Ga0068858_1000482294 309
873 3300005843 Ga0068860_100000156 Ga0068860_100000156104 309
874 3300005844 Ga0068862_100000019 Ga0068862_100000019124 309
875 3300006038 Ga0075365_10110383 Ga0075365_101103832 309
876 3300006048 Ga0075363_100001651 Ga0075363_1000016516 309
877 3300006048 Ga0075363_100169229 Ga0075363_1001692291 309
878 3300006051 Ga0075364_10019067 Ga0075364_100190673 309
879 3300006931 Ga0097620_100005012 Ga0097620_10000501211 309
880 3300009101 Ga0105247_10000023 Ga0105247_1000002394 309
881 3300009177 Ga0105248_10000409 Ga0105248_100004096 309
882 3300009177 Ga0105248_10007260 Ga0105248_100072608 309
883 3300009553 Ga0105249_10000033 Ga0105249_10000033102 309
884 3300013308 Ga0157375_10071536 Ga0157375_100715363 309
885 3300014325 Ga0163163_10172358 Ga0163163_101723582 309
886 3300014968 Ga0157379_10476367 Ga0157379_104763671 309
887 3300025303 Ga0209051_1000993 Ga0209051_100099326 309
888 3300025303 Ga0209051_1006734 Ga0209051_10067345 309
889 3300025303 Ga0209051_1024452 Ga0209051_10244524 309
890 3300025303 Ga0209051_1056120 Ga0209051_10561202 309
891 3300025900 Ga0207710_10000343 Ga0207710_1000034317 309
892 3300025920 Ga0207649_10281174 Ga0207649_102811741 309
893 3300025937 Ga0207669_10016175 Ga0207669_100161753 309
894 3300025941 Ga0207711_10000412 Ga0207711_1000041245 309
895 3300025941 Ga0207711_10149857 Ga0207711_101498572 309
896 3300025961 Ga0207712_10000031 Ga0207712_1000003195 309
897 3300025972 Ga0207668_10002021 Ga0207668_1000202111 309
898 3300025986 Ga0207658_10000792 Ga0207658_100007926 309
899 3300026035 Ga0207703_10388337 Ga0207703_103883371 309
900 3300026041 Ga0207639_10043607 Ga0207639_100436073 309
901 3300026067 Ga0207678_10004736 Ga0207678_1000473610 309
902 3300026088 Ga0207641_10023523 Ga0207641_100235232 309
903 3300026142 Ga0207698_10564669 Ga0207698_105646691 309
904 3300028380 Ga0268265_10000029 Ga0268265_10000029121 309
905 3300028381 Ga0268264_10000222 Ga0268264_10000222102 309
906 3300031731 Ga0307405_10218402 Ga0307405_102184022 309
907 3300041410 Ga0439461_0000249 Ga0439461_0000249_4276_5205 309
908 3300041411 Ga0439466_0007193 Ga0439466_0007193_1479_2408 309
909 3300041997 Ga0439431_0000548 Ga0439431_0000548_5002_5931 309
910 3300042004 Ga0439445_0001278 Ga0439445_0001278_3172_4101 309
911 3300044683 Ga0466965_0001825 Ga0466965_0001825_4165_5109 309
912 3300044901 Ga0466960_0002717 Ga0466960_0002717_5158_6102 309
913 3300046524 Ga0495648_0019325 Ga0495648_0019325_214_1143 309
914 3300046531 Ga0495665_0021848 Ga0495665_0021848_248_1177 309
915 3300046533 Ga0495640_0022096 Ga0495640_0022096_132_1061 309
916 3300046538 Ga0495609_0127236 Ga0495609_0127236_119_1048 309
917 3300046616 Ga0495668_0021200 Ga0495668_0021200_245_1174 309
918 3300046648 Ga0495611_0065218 Ga0495611_0065218_58_987 309
919 3300046663 Ga0495635_0160574 Ga0495635_0160574_387_1316 309
920 3300046692 Ga0495671_0127471 Ga0495671_0127471_38_967 309
921 3300046694 Ga0495649_0173854 Ga0495649_0173854_106_1035 309
922 3300047315 Ga0495581_0038465 Ga0495581_0038465_1781_2710 309
923 3300047319 Ga0495674_0039894 Ga0495674_0039894_2667_3596 309
924 3300047320 Ga0495672_0005520 Ga0495672_0005520_7928_8857 309
925 3300047321 Ga0495676_0058695 Ga0495676_0058695_63_992 309
926 3300047469 Ga0495673_0004675 Ga0495673_0004675_2342_3271 309
927 3300047472 Ga0495686_0006499 Ga0495686_0006499_1772_2704 309
928 3300047673 Ga0495593_0062317 Ga0495593_0062317_67_996 309
929 3300048903 Ga0496100_0001469 Ga0496100_0001469_10111_11040 309
930 3300048903 Ga0496100_0005354 Ga0496100_0005354_2103_3032 309
931 3300048904 Ga0496101_0000091 Ga0496101_0000091_24602_25531 309
932 3300048904 Ga0496101_0003585 Ga0496101_0003585_6911_7840 309
933 3300048904 Ga0496101_0126438 Ga0496101_0126438_426_1355 309
934 3300048905 Ga0496102_0000016 Ga0496102_0000016_220293_221222 309
935 3300048905 Ga0496102_0000629 Ga0496102_0000629_631_1560 309
936 3300048905 Ga0496102_0204020 Ga0496102_0204020_150_1079 309
937 3300048906 Ga0496103_0000015 Ga0496103_0000015_65553_66482 309
938 3300048907 Ga0496104_0004506 Ga0496104_0004506_10962_11891 309
939 3300048908 Ga0496105_0001664 Ga0496105_0001664_10179_11108 309
940 3300048909 Ga0496106_0000640 Ga0496106_0000640_19552_20481 309
941 3300048909 Ga0496106_0004355 Ga0496106_0004355_3810_4739 309
942 3300048910 Ga0496107_0002152 Ga0496107_0002152_9184_10113 309
943 3300048910 Ga0496107_0014647 Ga0496107_0014647_1044_1973 309
944 3300048911 Ga0496108_0105188 Ga0496108_0105188_758_1687 309
945 3300048912 Ga0496109_0000668 Ga0496109_0000668_25444_26373 309
946 3300048912 Ga0496109_0088630 Ga0496109_0088630_127_1056 309
947 3300048912 Ga0496109_0583203 Ga0496109_0583203_111_1040 309
948 3300048915 Ga0496112_0001161 Ga0496112_0001161_11_940 309
949 3300048915 Ga0496112_0240060 Ga0496112_0240060_792_1721 309
950 3300048916 Ga0496113_0009533 Ga0496113_0009533_3644_4573 309
951 3300048916 Ga0496113_0190292 Ga0496113_0190292_531_1460 309
952 3300048917 Ga0496114_0000911 Ga0496114_0000911_1681_2610 309
953 3300048918 Ga0496115_0000929 Ga0496115_0000929_5961_6890 309
954 3300048919 Ga0496116_0000055 Ga0496116_0000055_65740_66669 309
955 3300048920 Ga0496117_0000006 Ga0496117_0000006_691926_692855 309
956 3300048920 Ga0496117_0000415 Ga0496117_0000415_4590_5519 309
957 3300048921 Ga0496118_0000004 Ga0496118_0000004_691926_692855 309
958 3300048921 Ga0496118_0002279 Ga0496118_0002279_4614_5543 309
959 3300048922 Ga0496119_0001293 Ga0496119_0001293_26916_27845 309
960 3300048923 Ga0496120_0000272 Ga0496120_0000272_34688_35617 309
961 3300048923 Ga0496120_0091932 Ga0496120_0091932_415_1344 309
962 3300048924 Ga0496121_0000331 Ga0496121_0000331_77758_78687 309
963 3300048924 Ga0496121_0013198 Ga0496121_0013198_5552_6481 309
964 3300048925 Ga0496122_0012801 Ga0496122_0012801_5864_6793 309
965 3300048926 Ga0496123_0019811 Ga0496123_0019811_3351_4280 309
966 3300048928 Ga0496125_0007986 Ga0496125_0007986_630_1559 309
967 3300048929 Ga0496126_0000675 Ga0496126_0000675_23486_24415 309
968 3300048929 Ga0496126_0035612 Ga0496126_0035612_1528_2457 309
969 3300049569 Ga0501032_0002308 Ga0501032_0002308_11250_12179 309
970 3300049569 Ga0501032_0241886 Ga0501032_0241886_133_1086 309
971 3300049570 Ga0501033_0058998 Ga0501033_0058998_216_1169 309
972 3300049571 Ga0501034_0006653 Ga0501034_0006653_2397_3326 309
973 3300049571 Ga0501034_0117905 Ga0501034_0117905_817_1770 309
974 3300049572 Ga0501036_0004384 Ga0501036_0004384_7879_8808 309
975 3300049572 Ga0501036_0326851 Ga0501036_0326851_164_1117 309
976 3300049573 Ga0501037_0000265 Ga0501037_0000265_34554_35483 309
977 3300049574 Ga0501038_0003199 Ga0501038_0003199_1650_2579 309
978 3300049575 Ga0501039_0002474 Ga0501039_0002474_9621_10550 309
979 3300049581 Ga0501047_0025795 Ga0501047_0025795_3966_4919 309
980 3300049586 Ga0501070_0003639 Ga0501070_0003639_9106_10035 309
981 3300049589 Ga0501073_0061257 Ga0501073_0061257_31_960 309
982 3300049742 Ga0501080_0298561 Ga0501080_0298561_137_1069 309
983 3300049822 Ga0501035_0073719 Ga0501035_0073719_700_1653 309
984 3300049823 Ga0501044_0003313 Ga0501044_0003313_3450_4403 309
985 3300049823 Ga0501044_0065446 Ga0501044_0065446_2012_2941 309
986 3300050491 nmdc:mga00v17_202511_c1 nmdc:mga00v17_202511_c1_291_1220 309
987 3300050491 nmdc:mga00v17_4414_c1 nmdc:mga00v17_4414_c1_263_1192 309
988 3300050492 nmdc:mga0yw44_105230_c1 nmdc:mga0yw44_105230_c1_404_1333 309
989 3300050492 nmdc:mga0yw44_249740_c1 nmdc:mga0yw44_249740_c1_101_1030 309
990 3300050516 nmdc:mga0sz30_50038_c1 nmdc:mga0sz30_50038_c1_301_1230 309
991 3300053104 Ga0500556_0001688 Ga0500556_0001688_1065_1994 309
992 3300053153 Ga0500616_0035165 Ga0500616_0035165_97_1026 309

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01507

PAPS_reduct

Phosphoadenosine phosphosulfate reductase family

94

318

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zun-assembly1.cif.gz_A crystal structure of a gtp-regulated atp sulfurylase heterodimer from pseudomonas syringae 0.9032 18 219
1zun-assembly1.cif.gz_A crystal structure of a gtp-regulated atp sulfurylase heterodimer from pseudomonas syringae 0.8446 18 219
2oq2-assembly2.cif.gz_D crystal structure of yeast paps reductase with pap, a product complex 0.7625 26 215
3g59-assembly1.cif.gz_A crystal structure of candida glabrata fmn adenylyltransferase in complex with atp 0.745 15 205
3g5a-assembly5.cif.gz_E crystal structure of candida glabrata fmn adenylyltransferase in complex with fmn and atp analog ampcpp 0.7313 15 216
ID Description Score Start End Superfamily
1zunA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8985 18 219 3.40.50.620
1zunA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8893 18 219 3.40.50.620
af_Q9VJY1_8_244_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8438 17 216 3.40.50.620
af_Q9VYI5_67_322_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8319 14 216 3.40.50.620
af_Q4DC85_142_361_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8128 20 216 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A4Q5YQJ4-F1-model_v4 Sulfate adenylyltransferase small subunit 0.9941 18 98 GO:0016779
AF-A0A4Q3EEX2-F1-model_v4 Sulfate adenylyltransferase small subunit 0.993 18 101 GO:0016779
AF-A0A246R9P5-F1-model_v4 Sulfate adenylyltransferase small subunit 0.9851 21 131 GO:0016779
AF-A0A3D2JYL3-F1-model_v4 Sulfate adenylyltransferase small subunit 0.9841 18 111 GO:0016779
AF-A0A3S0F5T9-F1-model_v4 Sulfate adenylyltransferase small subunit (EC 2.7.7.4) 0.9841 18 99 GO:0004781

Feature Viewer

pLDDT pTM Quality
82.04 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map