F487660
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 992 | 348 | 961 | 307 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10006162|Ga0114129_100061628 |
| Length | 364 |
| Sequence | LLIAPSHDEAVHRRIGEIAYIGQGNELGALTAQAGAGFISGYADKSGHLYQLYEDAMTAAQELNQAGRYELSHLRSLEAEAIHIIREVAAEFERPVLLFSGGKDSIVMLHLALKAFRPGRLPFPVMHVDTGHNFDEVLQTRDELVEEAGVRLIVAKVQDDIDAGRVVETIPSRNPLQTVTLLRAIRENKFDAAFGGARRDEEKARAKERVFSFRDEFGQWDPKAQRPELWNLYNGRHHKGEHIRVFPLSNWTEFDIWSYIGAEKIKLPSIYYAHPRNVFQRDGMLLAVHRYLQPRKDEEVVEKTVRFRTVGDVTCTGCVESLAGTVSEVIAETAVSRLTERGATRADDRISEAGMEDRKREGYF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 2 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 3 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 4 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 5 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 6 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 7 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 8 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 9 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 10 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 11 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 12 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 13 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 14 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 15 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 16 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 17 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 18 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 19 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 20 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 21 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 22 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 23 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 24 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 25 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 26 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 27 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 28 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 29 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 30 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 31 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 32 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 33 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 34 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 92 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 94 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 95 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 96 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 100 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 101 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 102 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 103 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 104 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 105 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 106 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 109 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 142 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 143 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 201 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 204 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 205 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 208 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 209 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 212 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 214 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 215 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 216 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 217 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 218 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 219 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 220 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 221 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 222 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 223 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 224 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 225 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 226 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 227 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 229 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 230 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 231 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 232 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 233 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 234 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 235 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 236 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 237 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 238 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 239 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 240 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 241 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 242 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 243 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 244 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 245 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 246 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 247 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 277 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 278 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 279 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 280 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 281 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 282 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 285 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 286 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 287 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 288 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 289 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 290 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 291 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 292 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 293 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 294 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 295 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 296 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 297 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 298 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 299 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 300 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 301 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 323 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 324 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 325 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 326 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 327 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 328 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 329 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 335 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 336 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 338 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 339 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 340 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 341 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 342 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 343 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 344 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 347 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 348 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.37 |
| Metatranscriptomes | 0.5 |
| Isolates | 3.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.1 |
| Bulb | 0 |
| Endosphere | 11.79 |
| Nodule | 0.1 |
| Rhizoplane | 13 |
| Rhizosphere | 65.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1005481 | 3300000546 | Bacteria | 1384 |
| 2 | JGI24739J22299_10030285 | 3300001989 | Bacteria | 1877 |
| 3 | JGI24743J22301_10027850 | 3300001991 | Bacteria | 1104 |
| 4 | JGI24745J21846_1001298 | 3300002073 | Bacteria | 2413 |
| 5 | JGI24738J21930_10011412 | 3300002075 | Bacteria | 1954 |
| 6 | JGI24738J21930_10028872 | 3300002075 | Bacteria | 1134 |
| 7 | JGI24744J21845_10006363 | 3300002077 | Bacteria | 2451 |
| 8 | JGI24744J21845_10011916 | 3300002077 | Bacteria | 1770 |
| 9 | JGI24744J21845_10012948 | 3300002077 | Bacteria | 1685 |
| 10 | JGI24034J26672_10003685 | 3300002239 | Bacteria | 2141 |
| 11 | JGI24742J22300_10003451 | 3300002244 | Bacteria | 2564 |
| 12 | JGI25406J46586_10006739 | 3300003203 | Bacteria | 5279 |
| 13 | Ga0055540_1000207 | 3300003792 | Bacteria | 56613 |
| 14 | Ga0055540_1002158 | 3300003792 | Bacteria | 10719 |
| 15 | Ga0055540_1003118 | 3300003792 | Bacteria | 8221 |
| 16 | Ga0055540_1003933 | 3300003792 | Bacteria | 6946 |
| 17 | Ga0055540_1004158 | 3300003792 | Bacteria | 6684 |
| 18 | Ga0055540_1011522 | 3300003792 | Bacteria | 2843 |
| 19 | Ga0070676_10042659 | 3300005328 | Bacteria | 2635 |
| 20 | Ga0070683_100033202 | 3300005329 | Bacteria | 4704 |
| 21 | Ga0070690_100032667 | 3300005330 | Bacteria | 3252 |
| 22 | Ga0070690_100106991 | 3300005330 | Bacteria | 1861 |
| 23 | Ga0068869_100004264 | 3300005334 | Bacteria | 8873 |
| 24 | Ga0068869_100033087 | 3300005334 | Bacteria | 3648 |
| 25 | Ga0068869_100123533 | 3300005334 | Bacteria | 1983 |
| 26 | Ga0070666_10007434 | 3300005335 | Bacteria | 6754 |
| 27 | Ga0070666_10011131 | 3300005335 | Bacteria | 5639 |
| 28 | Ga0070680_100078971 | 3300005336 | Bacteria | 2712 |
| 29 | Ga0070680_100263000 | 3300005336 | Bacteria | 1460 |
| 30 | Ga0070682_100004029 | 3300005337 | Bacteria | 8164 |
| 31 | Ga0070682_100008585 | 3300005337 | Bacteria | 5768 |
| 32 | Ga0070682_100053750 | 3300005337 | Bacteria | 2525 |
| 33 | Ga0070682_100070849 | 3300005337 | Bacteria | 2230 |
| 34 | Ga0070682_100135875 | 3300005337 | Bacteria | 1670 |
| 35 | Ga0068868_100001267 | 3300005338 | Bacteria | 17394 |
| 36 | Ga0068868_100006676 | 3300005338 | Bacteria | 8189 |
| 37 | Ga0068868_100017252 | 3300005338 | Bacteria | 5374 |
| 38 | Ga0068868_100071887 | 3300005338 | Bacteria | 2759 |
| 39 | Ga0068868_100089792 | 3300005338 | Bacteria | 2474 |
| 40 | Ga0070689_100003095 | 3300005340 | Bacteria | 10976 |
| 41 | Ga0070689_100068048 | 3300005340 | Bacteria | 2777 |
| 42 | Ga0070691_10001945 | 3300005341 | Bacteria | 9083 |
| 43 | Ga0070691_10028379 | 3300005341 | Bacteria | 2614 |
| 44 | Ga0070691_10182162 | 3300005341 | Bacteria | 1094 |
| 45 | Ga0070687_100024588 | 3300005343 | Bacteria | 2878 |
| 46 | Ga0070661_100106368 | 3300005344 | Bacteria | 2092 |
| 47 | Ga0070668_100000264 | 3300005347 | Bacteria | 34698 |
| 48 | Ga0070668_100003162 | 3300005347 | Bacteria | 12133 |
| 49 | Ga0070668_100029947 | 3300005347 | Bacteria | 4136 |
| 50 | Ga0070668_100034759 | 3300005347 | Bacteria | 3841 |
| 51 | Ga0070668_100066744 | 3300005347 | Bacteria | 2792 |
| 52 | Ga0070669_100000918 | 3300005353 | Bacteria | 21431 |
| 53 | Ga0070669_100002624 | 3300005353 | Bacteria | 12996 |
| 54 | Ga0070671_100008676 | 3300005355 | Bacteria | 8154 |
| 55 | Ga0070671_100119251 | 3300005355 | Bacteria | 2220 |
| 56 | Ga0070674_100004841 | 3300005356 | Bacteria | 7718 |
| 57 | Ga0070674_100006933 | 3300005356 | Bacteria | 6644 |
| 58 | Ga0070674_100070662 | 3300005356 | Bacteria | 2467 |
| 59 | Ga0070674_100086627 | 3300005356 | Bacteria | 2250 |
| 60 | Ga0070688_100008911 | 3300005365 | Bacteria | 5464 |
| 61 | Ga0070688_100021334 | 3300005365 | Bacteria | 3783 |
| 62 | Ga0070688_100055259 | 3300005365 | Bacteria | 2490 |
| 63 | Ga0070659_100020849 | 3300005366 | Bacteria | 4984 |
| 64 | Ga0070659_100022293 | 3300005366 | Bacteria | 4834 |
| 65 | Ga0070659_100090496 | 3300005366 | Bacteria | 2452 |
| 66 | Ga0070659_100218123 | 3300005366 | Bacteria | 1574 |
| 67 | Ga0070659_100237137 | 3300005366 | Bacteria | 1508 |
| 68 | Ga0070659_100337250 | 3300005366 | Bacteria | 1262 |
| 69 | Ga0070667_100000033 | 3300005367 | Bacteria | 175463 |
| 70 | Ga0070667_100000962 | 3300005367 | Bacteria | 26520 |
| 71 | Ga0070667_100003398 | 3300005367 | Bacteria | 13558 |
| 72 | Ga0070667_100010764 | 3300005367 | Bacteria | 7559 |
| 73 | Ga0070709_10001138 | 3300005434 | Bacteria | 14658 |
| 74 | Ga0070709_10002108 | 3300005434 | Bacteria | 10762 |
| 75 | Ga0070709_10021799 | 3300005434 | Bacteria | 3738 |
| 76 | Ga0070714_100078214 | 3300005435 | Bacteria | 2874 |
| 77 | Ga0070714_100715552 | 3300005435 | Bacteria | 967 |
| 78 | Ga0070713_100091785 | 3300005436 | Bacteria | 2613 |
| 79 | Ga0070710_10003343 | 3300005437 | Bacteria | 7603 |
| 80 | Ga0070710_10023520 | 3300005437 | Bacteria | 3240 |
| 81 | Ga0070701_10000460 | 3300005438 | Bacteria | 13890 |
| 82 | Ga0070701_10000574 | 3300005438 | Bacteria | 12789 |
| 83 | Ga0070701_10062632 | 3300005438 | Bacteria | 1966 |
| 84 | Ga0070711_100001370 | 3300005439 | Bacteria | 13312 |
| 85 | Ga0070711_100002323 | 3300005439 | Bacteria | 10808 |
| 86 | Ga0070711_100018251 | 3300005439 | Bacteria | 4476 |
| 87 | Ga0070711_100055304 | 3300005439 | Bacteria | 2741 |
| 88 | Ga0070705_100005812 | 3300005440 | Bacteria | 6029 |
| 89 | Ga0070705_100007460 | 3300005440 | Bacteria | 5381 |
| 90 | Ga0070705_100108413 | 3300005440 | Bacteria | 1769 |
| 91 | Ga0070705_100166087 | 3300005440 | Bacteria | 1480 |
| 92 | Ga0070705_100328586 | 3300005440 | Bacteria | 1107 |
| 93 | Ga0070700_100007425 | 3300005441 | Bacteria | 5918 |
| 94 | Ga0070700_100040878 | 3300005441 | Bacteria | 2841 |
| 95 | Ga0070700_100092465 | 3300005441 | Bacteria | 1976 |
| 96 | Ga0070700_100302577 | 3300005441 | Bacteria | 1168 |
| 97 | Ga0070694_100004527 | 3300005444 | Bacteria | 8359 |
| 98 | Ga0070663_100005728 | 3300005455 | Bacteria | 7409 |
| 99 | Ga0070663_100013531 | 3300005455 | Bacteria | 5207 |
| 100 | Ga0070663_100058847 | 3300005455 | Bacteria | 2760 |
| 101 | Ga0070663_100316966 | 3300005455 | Bacteria | 1253 |
| 102 | Ga0070678_100003144 | 3300005456 | Bacteria | 9139 |
| 103 | Ga0070678_100046533 | 3300005456 | Bacteria | 3111 |
| 104 | Ga0070678_100104239 | 3300005456 | Bacteria | 2205 |
| 105 | Ga0070678_100271034 | 3300005456 | Bacteria | 1431 |
| 106 | Ga0070662_100002522 | 3300005457 | Bacteria | 11280 |
| 107 | Ga0070662_100026632 | 3300005457 | Bacteria | 4006 |
| 108 | Ga0070662_100276979 | 3300005457 | Bacteria | 1356 |
| 109 | Ga0068867_100002753 | 3300005459 | Bacteria | 12389 |
| 110 | Ga0068867_100004361 | 3300005459 | Bacteria | 9961 |
| 111 | Ga0068867_100073218 | 3300005459 | Bacteria | 2565 |
| 112 | Ga0070685_10077040 | 3300005466 | Bacteria | 1990 |
| 113 | Ga0070684_100176252 | 3300005535 | Bacteria | 1943 |
| 114 | Ga0070697_100349457 | 3300005536 | Bacteria | 1277 |
| 115 | Ga0068853_100007969 | 3300005539 | Bacteria | 8494 |
| 116 | Ga0068853_100016526 | 3300005539 | Bacteria | 6075 |
| 117 | Ga0068853_100241552 | 3300005539 | Bacteria | 1655 |
| 118 | Ga0068853_100426088 | 3300005539 | Bacteria | 1245 |
| 119 | Ga0070672_100171258 | 3300005543 | Bacteria | 1806 |
| 120 | Ga0070672_100314505 | 3300005543 | Bacteria | 1330 |
| 121 | Ga0070686_100028584 | 3300005544 | Bacteria | 3383 |
| 122 | Ga0070686_100144414 | 3300005544 | Bacteria | 1660 |
| 123 | Ga0070695_100016576 | 3300005545 | Bacteria | 4462 |
| 124 | Ga0070695_100081041 | 3300005545 | Bacteria | 2147 |
| 125 | Ga0070695_100215410 | 3300005545 | Bacteria | 1381 |
| 126 | Ga0070696_100002819 | 3300005546 | Bacteria | 11548 |
| 127 | Ga0070696_100041777 | 3300005546 | Bacteria | 3169 |
| 128 | Ga0070696_100096529 | 3300005546 | Bacteria | 2112 |
| 129 | Ga0070693_100024104 | 3300005547 | Bacteria | 3259 |
| 130 | Ga0070693_100058270 | 3300005547 | Bacteria | 2235 |
| 131 | Ga0070693_100084523 | 3300005547 | Bacteria | 1900 |
| 132 | Ga0070665_100002721 | 3300005548 | Bacteria | 19164 |
| 133 | Ga0070665_100002910 | 3300005548 | Bacteria | 18501 |
| 134 | Ga0070665_100006270 | 3300005548 | Bacteria | 12155 |
| 135 | Ga0070665_100034345 | 3300005548 | Bacteria | 5100 |
| 136 | Ga0070665_100067775 | 3300005548 | Bacteria | 3579 |
| 137 | Ga0070665_100550018 | 3300005548 | Bacteria | 1166 |
| 138 | Ga0070704_100000324 | 3300005549 | Bacteria | 21508 |
| 139 | Ga0070704_100009039 | 3300005549 | Bacteria | 6007 |
| 140 | Ga0068855_100752964 | 3300005563 | Bacteria | 1039 |
| 141 | Ga0070664_100306518 | 3300005564 | Bacteria | 1436 |
| 142 | Ga0068854_100001133 | 3300005578 | Bacteria | 16029 |
| 143 | Ga0068854_100001503 | 3300005578 | Bacteria | 14107 |
| 144 | Ga0068854_100076388 | 3300005578 | Bacteria | 2461 |
| 145 | Ga0070702_100001907 | 3300005615 | Bacteria | 8753 |
| 146 | Ga0070702_100031367 | 3300005615 | Bacteria | 2907 |
| 147 | Ga0070702_100074665 | 3300005615 | Bacteria | 2012 |
| 148 | Ga0070702_100167430 | 3300005615 | Bacteria | 1426 |
| 149 | Ga0068852_100155361 | 3300005616 | Bacteria | 2131 |
| 150 | Ga0068852_100548741 | 3300005616 | Bacteria | 1156 |
| 151 | Ga0068859_100000300 | 3300005617 | Bacteria | 49281 |
| 152 | Ga0068859_100001798 | 3300005617 | Bacteria | 21835 |
| 153 | Ga0068859_100005012 | 3300005617 | Bacteria | 13446 |
| 154 | Ga0068859_100007033 | 3300005617 | Bacteria | 11425 |
| 155 | Ga0068864_100583880 | 3300005618 | Bacteria | 1083 |
| 156 | Ga0068866_10000937 | 3300005718 | Bacteria | 12824 |
| 157 | Ga0068866_10009714 | 3300005718 | Bacteria | 4096 |
| 158 | Ga0068861_100000649 | 3300005719 | Bacteria | 20679 |
| 159 | Ga0068861_100006110 | 3300005719 | Bacteria | 8195 |
| 160 | Ga0068861_100015616 | 3300005719 | Bacteria | 5356 |
| 161 | Ga0068861_100074095 | 3300005719 | Bacteria | 2646 |
| 162 | Ga0068861_100586243 | 3300005719 | Bacteria | 1021 |
| 163 | Ga0068863_100002210 | 3300005841 | Bacteria | 19325 |
| 164 | Ga0068863_100003284 | 3300005841 | Bacteria | 15965 |
| 165 | Ga0068863_100049338 | 3300005841 | Bacteria | 3991 |
| 166 | Ga0068863_100170736 | 3300005841 | Bacteria | 2086 |
| 167 | Ga0068863_100244078 | 3300005841 | Bacteria | 1734 |
| 168 | Ga0068858_100001026 | 3300005842 | Bacteria | 28813 |
| 169 | Ga0068858_100007303 | 3300005842 | Bacteria | 10703 |
| 170 | Ga0068858_100015480 | 3300005842 | Bacteria | 7172 |
| 171 | Ga0068858_100046133 | 3300005842 | Bacteria | 4040 |
| 172 | Ga0068858_100048229 | 3300005842 | Bacteria | 3947 |
| 173 | Ga0068858_100351993 | 3300005842 | Bacteria | 1411 |
| 174 | Ga0068860_100000010 | 3300005843 | Bacteria | 359114 |
| 175 | Ga0068860_100000156 | 3300005843 | Bacteria | 111148 |
| 176 | Ga0068860_100003057 | 3300005843 | Bacteria | 17284 |
| 177 | Ga0068860_100006774 | 3300005843 | Bacteria | 11490 |
| 178 | Ga0068860_100600377 | 3300005843 | Bacteria | 1106 |
| 179 | Ga0068862_100000008 | 3300005844 | Bacteria | 305510 |
| 180 | Ga0068862_100000019 | 3300005844 | Bacteria | 229485 |
| 181 | Ga0068862_100000958 | 3300005844 | Bacteria | 27782 |
| 182 | Ga0081455_10049454 | 3300005937 | Bacteria | 3624 |
| 183 | Ga0081538_10053133 | 3300005981 | Bacteria | 2412 |
| 184 | Ga0070717_10182747 | 3300006028 | Bacteria | 1829 |
| 185 | Ga0075365_10008111 | 3300006038 | Bacteria | 5934 |
| 186 | Ga0075365_10021929 | 3300006038 | Bacteria | 3993 |
| 187 | Ga0075365_10094207 | 3300006038 | Bacteria | 2043 |
| 188 | Ga0075365_10110383 | 3300006038 | Bacteria | 1890 |
| 189 | Ga0075365_10119641 | 3300006038 | Bacteria | 1816 |
| 190 | Ga0075365_10130137 | 3300006038 | Bacteria | 1741 |
| 191 | Ga0075365_10197090 | 3300006038 | Bacteria | 1410 |
| 192 | Ga0075363_100000999 | 3300006048 | Bacteria | 10124 |
| 193 | Ga0075363_100001651 | 3300006048 | Bacteria | 8628 |
| 194 | Ga0075363_100002029 | 3300006048 | Bacteria | 8079 |
| 195 | Ga0075363_100007545 | 3300006048 | Bacteria | 5009 |
| 196 | Ga0075363_100021077 | 3300006048 | Bacteria | 3277 |
| 197 | Ga0075363_100022089 | 3300006048 | Bacteria | 3213 |
| 198 | Ga0075363_100033998 | 3300006048 | Bacteria | 2660 |
| 199 | Ga0075363_100144439 | 3300006048 | Bacteria | 1341 |
| 200 | Ga0075363_100169229 | 3300006048 | Bacteria | 1240 |
| 201 | Ga0075364_10005619 | 3300006051 | Bacteria | 7313 |
| 202 | Ga0075364_10006900 | 3300006051 | Bacteria | 6703 |
| 203 | Ga0075364_10008064 | 3300006051 | Bacteria | 6280 |
| 204 | Ga0075364_10009026 | 3300006051 | Bacteria | 5972 |
| 205 | Ga0075364_10011101 | 3300006051 | Bacteria | 5468 |
| 206 | Ga0075364_10019067 | 3300006051 | Bacteria | 4303 |
| 207 | Ga0075364_10070776 | 3300006051 | Bacteria | 2297 |
| 208 | Ga0075364_10120684 | 3300006051 | Bacteria | 1754 |
| 209 | Ga0075364_10154487 | 3300006051 | Bacteria | 1547 |
| 210 | Ga0075364_10241968 | 3300006051 | Bacteria | 1226 |
| 211 | Ga0075364_10311812 | 3300006051 | Bacteria | 1071 |
| 212 | Ga0070715_10005624 | 3300006163 | Bacteria | 4195 |
| 213 | Ga0070715_10008709 | 3300006163 | Bacteria | 3547 |
| 214 | Ga0070715_10016832 | 3300006163 | Bacteria | 2756 |
| 215 | Ga0070716_100002154 | 3300006173 | Bacteria | 9054 |
| 216 | Ga0070716_100006278 | 3300006173 | Bacteria | 5801 |
| 217 | Ga0070716_100007540 | 3300006173 | Bacteria | 5365 |
| 218 | Ga0070712_100000675 | 3300006175 | Bacteria | 20175 |
| 219 | Ga0070712_100002027 | 3300006175 | Bacteria | 12411 |
| 220 | Ga0070712_100023582 | 3300006175 | Bacteria | 4067 |
| 221 | Ga0075362_10066951 | 3300006177 | Bacteria | 1633 |
| 222 | Ga0075367_10097939 | 3300006178 | Bacteria | 1790 |
| 223 | Ga0075367_10153107 | 3300006178 | Bacteria | 1431 |
| 224 | Ga0075367_10158497 | 3300006178 | Bacteria | 1407 |
| 225 | Ga0075369_10000666 | 3300006186 | Bacteria | 10924 |
| 226 | Ga0075369_10002769 | 3300006186 | Bacteria | 6295 |
| 227 | Ga0075369_10003013 | 3300006186 | Bacteria | 6095 |
| 228 | Ga0075369_10007392 | 3300006186 | Bacteria | 4181 |
| 229 | Ga0075369_10009178 | 3300006186 | Bacteria | 3833 |
| 230 | Ga0075369_10017850 | 3300006186 | Bacteria | 2883 |
| 231 | Ga0075369_10033004 | 3300006186 | Bacteria | 2193 |
| 232 | Ga0075369_10038362 | 3300006186 | Bacteria | 2043 |
| 233 | Ga0075369_10065419 | 3300006186 | Bacteria | 1593 |
| 234 | Ga0075370_10002984 | 3300006353 | Bacteria | 7961 |
| 235 | Ga0075370_10014517 | 3300006353 | Bacteria | 4204 |
| 236 | Ga0075370_10031123 | 3300006353 | Bacteria | 2978 |
| 237 | Ga0075370_10100405 | 3300006353 | Bacteria | 1674 |
| 238 | Ga0075370_10107482 | 3300006353 | Bacteria | 1618 |
| 239 | Ga0075370_10125557 | 3300006353 | Bacteria | 1496 |
| 240 | Ga0075370_10127155 | 3300006353 | Bacteria | 1486 |
| 241 | Ga0075428_100000609 | 3300006844 | Bacteria | 36516 |
| 242 | Ga0075428_100003982 | 3300006844 | Bacteria | 16206 |
| 243 | Ga0075430_100003543 | 3300006846 | Bacteria | 13073 |
| 244 | Ga0075430_100043225 | 3300006846 | Bacteria | 3809 |
| 245 | Ga0075431_100013631 | 3300006847 | Bacteria | 8215 |
| 246 | Ga0075433_10056618 | 3300006852 | Bacteria | 3425 |
| 247 | Ga0075434_100020986 | 3300006871 | Bacteria | 6345 |
| 248 | Ga0068865_100000988 | 3300006881 | Bacteria | 16295 |
| 249 | Ga0068865_100002876 | 3300006881 | Bacteria | 10258 |
| 250 | Ga0097620_100000300 | 3300006931 | Bacteria | 49281 |
| 251 | Ga0097620_100001798 | 3300006931 | Bacteria | 21835 |
| 252 | Ga0097620_100005012 | 3300006931 | Bacteria | 13446 |
| 253 | Ga0097620_100007032 | 3300006931 | Bacteria | 11425 |
| 254 | Ga0105240_10144161 | 3300009093 | Bacteria | 2844 |
| 255 | Ga0105240_10312736 | 3300009093 | Bacteria | 1793 |
| 256 | Ga0105240_10350170 | 3300009093 | Bacteria | 1676 |
| 257 | Ga0111539_10314605 | 3300009094 | Bacteria | 1822 |
| 258 | Ga0111539_10637365 | 3300009094 | Bacteria | 1241 |
| 259 | Ga0105245_10035734 | 3300009098 | Bacteria | 4410 |
| 260 | Ga0105245_10072200 | 3300009098 | Bacteria | 3135 |
| 261 | Ga0105245_10105760 | 3300009098 | Bacteria | 2610 |
| 262 | Ga0105245_10355261 | 3300009098 | Bacteria | 1453 |
| 263 | Ga0105245_10559017 | 3300009098 | Bacteria | 1167 |
| 264 | Ga0105247_10000019 | 3300009101 | Bacteria | 245170 |
| 265 | Ga0105247_10000023 | 3300009101 | Bacteria | 215645 |
| 266 | Ga0105247_10000265 | 3300009101 | Bacteria | 48548 |
| 267 | Ga0105247_10000517 | 3300009101 | Bacteria | 31617 |
| 268 | Ga0105247_10072375 | 3300009101 | Bacteria | 2158 |
| 269 | Ga0105247_10194313 | 3300009101 | Bacteria | 1360 |
| 270 | Ga0114129_10006162 | 3300009147 | Bacteria | 17016 |
| 271 | Ga0114129_10014863 | 3300009147 | Bacteria | 11091 |
| 272 | Ga0114129_10804511 | 3300009147 | Bacteria | 1199 |
| 273 | Ga0105243_10001541 | 3300009148 | Bacteria | 20148 |
| 274 | Ga0105243_10004543 | 3300009148 | Bacteria | 10964 |
| 275 | Ga0105243_10176933 | 3300009148 | Bacteria | 1852 |
| 276 | Ga0105241_10020745 | 3300009174 | Bacteria | 4856 |
| 277 | Ga0105241_10049089 | 3300009174 | Bacteria | 3213 |
| 278 | Ga0105241_10425441 | 3300009174 | Bacteria | 1170 |
| 279 | Ga0105242_10000329 | 3300009176 | Bacteria | 38103 |
| 280 | Ga0105242_10002252 | 3300009176 | Bacteria | 15219 |
| 281 | Ga0105248_10000188 | 3300009177 | Bacteria | 71887 |
| 282 | Ga0105248_10000409 | 3300009177 | Bacteria | 49854 |
| 283 | Ga0105248_10006313 | 3300009177 | Bacteria | 13005 |
| 284 | Ga0105248_10007260 | 3300009177 | Bacteria | 12161 |
| 285 | Ga0105248_10065705 | 3300009177 | Bacteria | 4073 |
| 286 | Ga0105237_10000587 | 3300009545 | Bacteria | 50736 |
| 287 | Ga0105237_10013063 | 3300009545 | Bacteria | 8720 |
| 288 | Ga0105237_10038233 | 3300009545 | Bacteria | 4847 |
| 289 | Ga0105237_10047482 | 3300009545 | Bacteria | 4317 |
| 290 | Ga0105237_10047948 | 3300009545 | Bacteria | 4295 |
| 291 | Ga0105237_10347126 | 3300009545 | Bacteria | 1488 |
| 292 | Ga0105238_10343149 | 3300009551 | Bacteria | 1482 |
| 293 | Ga0105238_10391130 | 3300009551 | Bacteria | 1383 |
| 294 | Ga0105249_10000019 | 3300009553 | Bacteria | 273807 |
| 295 | Ga0105249_10000033 | 3300009553 | Bacteria | 213834 |
| 296 | Ga0105249_10000892 | 3300009553 | Bacteria | 26445 |
| 297 | Ga0105249_10010119 | 3300009553 | Bacteria | 8280 |
| 298 | Ga0105239_10003372 | 3300010375 | Bacteria | 19606 |
| 299 | Ga0105239_10038691 | 3300010375 | Bacteria | 5227 |
| 300 | Ga0105239_10072566 | 3300010375 | Bacteria | 3784 |
| 301 | Ga0105239_10073218 | 3300010375 | Bacteria | 3767 |
| 302 | Ga0105239_10247895 | 3300010375 | Bacteria | 2000 |
| 303 | Ga0105246_10063567 | 3300011119 | Bacteria | 2575 |
| 304 | Ga0105246_10334608 | 3300011119 | Bacteria | 1235 |
| 305 | Ga0105246_10381369 | 3300011119 | Bacteria | 1165 |
| 306 | Ga0157370_10016874 | 3300013104 | Bacteria | 7381 |
| 307 | Ga0157370_10334804 | 3300013104 | Bacteria | 1395 |
| 308 | Ga0157369_10520420 | 3300013105 | Bacteria | 1230 |
| 309 | Ga0157374_10082396 | 3300013296 | Bacteria | 3054 |
| 310 | Ga0157374_10301541 | 3300013296 | Bacteria | 1585 |
| 311 | Ga0157374_10348673 | 3300013296 | Bacteria | 1471 |
| 312 | Ga0157378_10000356 | 3300013297 | Bacteria | 45048 |
| 313 | Ga0157378_10003135 | 3300013297 | Bacteria | 14694 |
| 314 | Ga0163162_10002067 | 3300013306 | Bacteria | 18862 |
| 315 | Ga0163162_10025798 | 3300013306 | Bacteria | 5809 |
| 316 | Ga0163162_10305174 | 3300013306 | Bacteria | 1724 |
| 317 | Ga0157372_10043924 | 3300013307 | Bacteria | 4950 |
| 318 | Ga0157372_10059963 | 3300013307 | Bacteria | 4257 |
| 319 | Ga0157372_10110237 | 3300013307 | Bacteria | 3152 |
| 320 | Ga0157372_10183567 | 3300013307 | Bacteria | 2422 |
| 321 | Ga0157375_10000760 | 3300013308 | Bacteria | 28299 |
| 322 | Ga0157375_10009045 | 3300013308 | Bacteria | 8721 |
| 323 | Ga0157375_10068732 | 3300013308 | Bacteria | 3546 |
| 324 | Ga0157375_10071536 | 3300013308 | Bacteria | 3482 |
| 325 | Ga0163163_10020081 | 3300014325 | Bacteria | 6288 |
| 326 | Ga0163163_10172358 | 3300014325 | Bacteria | 2210 |
| 327 | Ga0157380_10001266 | 3300014326 | Bacteria | 16403 |
| 328 | Ga0157380_10001851 | 3300014326 | Bacteria | 13990 |
| 329 | Ga0157380_10142729 | 3300014326 | Bacteria | 2059 |
| 330 | Ga0157377_10011682 | 3300014745 | Bacteria | 4391 |
| 331 | Ga0157379_10004806 | 3300014968 | Bacteria | 11610 |
| 332 | Ga0157379_10019019 | 3300014968 | Bacteria | 6064 |
| 333 | Ga0157379_10476367 | 3300014968 | Bacteria | 1155 |
| 334 | Ga0157376_10057926 | 3300014969 | Bacteria | 3243 |
| 335 | Ga0157376_10426916 | 3300014969 | Bacteria | 1287 |
| 336 | Ga0163161_10000976 | 3300017792 | Bacteria | 21866 |
| 337 | Ga0163161_10018358 | 3300017792 | Bacteria | 4902 |
| 338 | Ga0197907_10477761 | 3300020069 | Bacteria | 4810 |
| 339 | Ga0206356_10088465 | 3300020070 | Bacteria | 7376 |
| 340 | Ga0206354_10569538 | 3300020081 | Bacteria | 5177 |
| 341 | Ga0206353_10019350 | 3300020082 | Bacteria | 3941 |
| 342 | Ga0213876_10011942 | 3300021384 | Bacteria | 4628 |
| 343 | Ga0213875_10001995 | 3300021388 | Bacteria | 12605 |
| 344 | Ga0213875_10017345 | 3300021388 | Bacteria | 3479 |
| 345 | Ga0213875_10026986 | 3300021388 | Bacteria | 2732 |
| 346 | Ga0213875_10084560 | 3300021388 | Bacteria | 1480 |
| 347 | Ga0224712_10000628 | 3300022467 | Bacteria | 7202 |
| 348 | Ga0209051_1000158 | 3300025303 | Bacteria | 127723 |
| 349 | Ga0209051_1000949 | 3300025303 | Bacteria | 28423 |
| 350 | Ga0209051_1000993 | 3300025303 | Bacteria | 27270 |
| 351 | Ga0209051_1001572 | 3300025303 | Bacteria | 18855 |
| 352 | Ga0209051_1002496 | 3300025303 | Bacteria | 13115 |
| 353 | Ga0209051_1006734 | 3300025303 | Bacteria | 6414 |
| 354 | Ga0209051_1024452 | 3300025303 | Bacteria | 2483 |
| 355 | Ga0209051_1056120 | 3300025303 | Bacteria | 1273 |
| 356 | Ga0207692_10024473 | 3300025898 | Bacteria | 2807 |
| 357 | Ga0207692_10024928 | 3300025898 | Bacteria | 2788 |
| 358 | Ga0207642_10000822 | 3300025899 | Bacteria | 9667 |
| 359 | Ga0207642_10000917 | 3300025899 | Bacteria | 9224 |
| 360 | Ga0207710_10000036 | 3300025900 | Bacteria | 245176 |
| 361 | Ga0207710_10000343 | 3300025900 | Bacteria | 34190 |
| 362 | Ga0207710_10002308 | 3300025900 | Bacteria | 8913 |
| 363 | Ga0207710_10009402 | 3300025900 | Bacteria | 4114 |
| 364 | Ga0207710_10017219 | 3300025900 | Bacteria | 3064 |
| 365 | Ga0207710_10065713 | 3300025900 | Bacteria | 1654 |
| 366 | Ga0207688_10000235 | 3300025901 | Bacteria | 25164 |
| 367 | Ga0207688_10004987 | 3300025901 | Bacteria | 7225 |
| 368 | Ga0207688_10007726 | 3300025901 | Bacteria | 5858 |
| 369 | Ga0207688_10020294 | 3300025901 | Bacteria | 3628 |
| 370 | Ga0207688_10063138 | 3300025901 | Bacteria | 2089 |
| 371 | Ga0207688_10121521 | 3300025901 | Bacteria | 1524 |
| 372 | Ga0207680_10049693 | 3300025903 | Bacteria | 2497 |
| 373 | Ga0207685_10002069 | 3300025905 | Bacteria | 4484 |
| 374 | Ga0207685_10055002 | 3300025905 | Bacteria | 1552 |
| 375 | Ga0207685_10116243 | 3300025905 | Bacteria | 1167 |
| 376 | Ga0207699_10095925 | 3300025906 | Bacteria | 1871 |
| 377 | Ga0207645_10046109 | 3300025907 | Bacteria | 2785 |
| 378 | Ga0207645_10117281 | 3300025907 | Bacteria | 1727 |
| 379 | Ga0207705_10000352 | 3300025909 | Bacteria | 41499 |
| 380 | Ga0207654_10008666 | 3300025911 | Bacteria | 5155 |
| 381 | Ga0207695_10144529 | 3300025913 | Bacteria | 2324 |
| 382 | Ga0207671_10007683 | 3300025914 | Bacteria | 9309 |
| 383 | Ga0207671_10061121 | 3300025914 | Bacteria | 2795 |
| 384 | Ga0207671_10066856 | 3300025914 | Bacteria | 2676 |
| 385 | Ga0207671_10080894 | 3300025914 | Bacteria | 2436 |
| 386 | Ga0207693_10002003 | 3300025915 | Bacteria | 17881 |
| 387 | Ga0207693_10003680 | 3300025915 | Bacteria | 13087 |
| 388 | Ga0207693_10005498 | 3300025915 | Bacteria | 10550 |
| 389 | Ga0207693_10015601 | 3300025915 | Bacteria | 6092 |
| 390 | Ga0207663_10004168 | 3300025916 | Bacteria | 7162 |
| 391 | Ga0207663_10016337 | 3300025916 | Bacteria | 4113 |
| 392 | Ga0207663_10081293 | 3300025916 | Bacteria | 2121 |
| 393 | Ga0207660_10057200 | 3300025917 | Bacteria | 2793 |
| 394 | Ga0207662_10031960 | 3300025918 | Bacteria | 3060 |
| 395 | Ga0207657_10065141 | 3300025919 | Bacteria | 3107 |
| 396 | Ga0207649_10281174 | 3300025920 | Bacteria | 1210 |
| 397 | Ga0207681_10001678 | 3300025923 | Bacteria | 14267 |
| 398 | Ga0207681_10038325 | 3300025923 | Bacteria | 3175 |
| 399 | Ga0207681_10169826 | 3300025923 | Bacteria | 1652 |
| 400 | Ga0207694_10049503 | 3300025924 | Bacteria | 3253 |
| 401 | Ga0207694_10205594 | 3300025924 | Bacteria | 1603 |
| 402 | Ga0207694_10491922 | 3300025924 | Bacteria | 1027 |
| 403 | Ga0207659_10068415 | 3300025926 | Bacteria | 2582 |
| 404 | Ga0207687_10005938 | 3300025927 | Bacteria | 8075 |
| 405 | Ga0207687_10008539 | 3300025927 | Bacteria | 6699 |
| 406 | Ga0207687_10038940 | 3300025927 | Bacteria | 3252 |
| 407 | Ga0207687_10073145 | 3300025927 | Bacteria | 2454 |
| 408 | Ga0207687_10203978 | 3300025927 | Bacteria | 1547 |
| 409 | Ga0207687_10351506 | 3300025927 | Bacteria | 1201 |
| 410 | Ga0207700_10163708 | 3300025928 | Bacteria | 1849 |
| 411 | Ga0207644_10096721 | 3300025931 | Bacteria | 2211 |
| 412 | Ga0207644_10098165 | 3300025931 | Bacteria | 2195 |
| 413 | Ga0207690_10006937 | 3300025932 | Bacteria | 6715 |
| 414 | Ga0207690_10034863 | 3300025932 | Bacteria | 3245 |
| 415 | Ga0207690_10064081 | 3300025932 | Bacteria | 2508 |
| 416 | Ga0207690_10156355 | 3300025932 | Bacteria | 1695 |
| 417 | Ga0207690_10243462 | 3300025932 | Bacteria | 1386 |
| 418 | Ga0207706_10025990 | 3300025933 | Bacteria | 5243 |
| 419 | Ga0207706_10042550 | 3300025933 | Bacteria | 4026 |
| 420 | Ga0207706_10061444 | 3300025933 | Bacteria | 3309 |
| 421 | Ga0207686_10007174 | 3300025934 | Bacteria | 5999 |
| 422 | Ga0207686_10056106 | 3300025934 | Bacteria | 2475 |
| 423 | Ga0207709_10001915 | 3300025935 | Bacteria | 13707 |
| 424 | Ga0207709_10069321 | 3300025935 | Bacteria | 2232 |
| 425 | Ga0207709_10267877 | 3300025935 | Bacteria | 1256 |
| 426 | Ga0207670_10033878 | 3300025936 | Bacteria | 3295 |
| 427 | Ga0207670_10123513 | 3300025936 | Bacteria | 1886 |
| 428 | Ga0207669_10001222 | 3300025937 | Bacteria | 10911 |
| 429 | Ga0207669_10007348 | 3300025937 | Bacteria | 5089 |
| 430 | Ga0207669_10016175 | 3300025937 | Bacteria | 3784 |
| 431 | Ga0207669_10129936 | 3300025937 | Bacteria | 1729 |
| 432 | Ga0207669_10264946 | 3300025937 | Bacteria | 1287 |
| 433 | Ga0207704_10001661 | 3300025938 | Bacteria | 9991 |
| 434 | Ga0207704_10057576 | 3300025938 | Bacteria | 2388 |
| 435 | Ga0207704_10154761 | 3300025938 | Bacteria | 1623 |
| 436 | Ga0207665_10001216 | 3300025939 | Bacteria | 17397 |
| 437 | Ga0207665_10005614 | 3300025939 | Bacteria | 8361 |
| 438 | Ga0207665_10024589 | 3300025939 | Bacteria | 3972 |
| 439 | Ga0207691_10244670 | 3300025940 | Bacteria | 1550 |
| 440 | Ga0207691_10286947 | 3300025940 | Bacteria | 1416 |
| 441 | Ga0207711_10000168 | 3300025941 | Bacteria | 70279 |
| 442 | Ga0207711_10000412 | 3300025941 | Bacteria | 45381 |
| 443 | Ga0207711_10044387 | 3300025941 | Bacteria | 3794 |
| 444 | Ga0207711_10149857 | 3300025941 | Bacteria | 2104 |
| 445 | Ga0207711_10153261 | 3300025941 | Bacteria | 2081 |
| 446 | Ga0207689_10016961 | 3300025942 | Bacteria | 6161 |
| 447 | Ga0207689_10070988 | 3300025942 | Bacteria | 2860 |
| 448 | Ga0207679_10251217 | 3300025945 | Bacteria | 1503 |
| 449 | Ga0207712_10000025 | 3300025961 | Bacteria | 274015 |
| 450 | Ga0207712_10000031 | 3300025961 | Bacteria | 213662 |
| 451 | Ga0207712_10020672 | 3300025961 | Bacteria | 4314 |
| 452 | Ga0207712_10045018 | 3300025961 | Bacteria | 3054 |
| 453 | Ga0207668_10002021 | 3300025972 | Bacteria | 11840 |
| 454 | Ga0207668_10003151 | 3300025972 | Bacteria | 9656 |
| 455 | Ga0207668_10445829 | 3300025972 | Bacteria | 1103 |
| 456 | Ga0207668_10459913 | 3300025972 | Bacteria | 1088 |
| 457 | Ga0207668_10542169 | 3300025972 | Bacteria | 1006 |
| 458 | Ga0207640_10003697 | 3300025981 | Bacteria | 8249 |
| 459 | Ga0207658_10000125 | 3300025986 | Bacteria | 83488 |
| 460 | Ga0207658_10000621 | 3300025986 | Bacteria | 31352 |
| 461 | Ga0207658_10000792 | 3300025986 | Bacteria | 26813 |
| 462 | Ga0207658_10021277 | 3300025986 | Bacteria | 4500 |
| 463 | Ga0207658_10027530 | 3300025986 | Bacteria | 3994 |
| 464 | Ga0207658_10492061 | 3300025986 | Bacteria | 1091 |
| 465 | Ga0207677_10025479 | 3300026023 | Bacteria | 3692 |
| 466 | Ga0207677_10027755 | 3300026023 | Bacteria | 3571 |
| 467 | Ga0207677_10048665 | 3300026023 | Bacteria | 2856 |
| 468 | Ga0207703_10003469 | 3300026035 | Bacteria | 13203 |
| 469 | Ga0207703_10012068 | 3300026035 | Bacteria | 6731 |
| 470 | Ga0207703_10015805 | 3300026035 | Bacteria | 5887 |
| 471 | Ga0207703_10049916 | 3300026035 | Bacteria | 3384 |
| 472 | Ga0207703_10338002 | 3300026035 | Bacteria | 1383 |
| 473 | Ga0207703_10388337 | 3300026035 | Bacteria | 1293 |
| 474 | Ga0207639_10006832 | 3300026041 | Bacteria | 7770 |
| 475 | Ga0207639_10013554 | 3300026041 | Bacteria | 5711 |
| 476 | Ga0207639_10043607 | 3300026041 | Bacteria | 3369 |
| 477 | Ga0207639_10276005 | 3300026041 | Bacteria | 1476 |
| 478 | Ga0207639_10315708 | 3300026041 | Bacteria | 1386 |
| 479 | Ga0207678_10004736 | 3300026067 | Bacteria | 12221 |
| 480 | Ga0207678_10011489 | 3300026067 | Bacteria | 7777 |
| 481 | Ga0207678_10018657 | 3300026067 | Bacteria | 6090 |
| 482 | Ga0207678_10103601 | 3300026067 | Bacteria | 2429 |
| 483 | Ga0207678_10130964 | 3300026067 | Bacteria | 2139 |
| 484 | Ga0207708_10009345 | 3300026075 | Bacteria | 7258 |
| 485 | Ga0207708_10050894 | 3300026075 | Bacteria | 3153 |
| 486 | Ga0207708_10111897 | 3300026075 | Bacteria | 2120 |
| 487 | Ga0207708_10115406 | 3300026075 | Bacteria | 2088 |
| 488 | Ga0207641_10008728 | 3300026088 | Bacteria | 8371 |
| 489 | Ga0207641_10023523 | 3300026088 | Bacteria | 5074 |
| 490 | Ga0207641_10054108 | 3300026088 | Bacteria | 3404 |
| 491 | Ga0207641_10244993 | 3300026088 | Bacteria | 1672 |
| 492 | Ga0207648_10002570 | 3300026089 | Bacteria | 19444 |
| 493 | Ga0207648_10003286 | 3300026089 | Bacteria | 17005 |
| 494 | Ga0207648_10027517 | 3300026089 | Bacteria | 5048 |
| 495 | Ga0207676_10286784 | 3300026095 | Bacteria | 1497 |
| 496 | Ga0207675_100000865 | 3300026118 | Bacteria | 30240 |
| 497 | Ga0207675_100008787 | 3300026118 | Bacteria | 9484 |
| 498 | Ga0207675_100113182 | 3300026118 | Bacteria | 2562 |
| 499 | Ga0207675_100306160 | 3300026118 | Bacteria | 1549 |
| 500 | Ga0207683_10000809 | 3300026121 | Bacteria | 28622 |
| 501 | Ga0207683_10012042 | 3300026121 | Bacteria | 7383 |
| 502 | Ga0207683_10125346 | 3300026121 | Bacteria | 2308 |
| 503 | Ga0207683_10429818 | 3300026121 | Bacteria | 1217 |
| 504 | Ga0207698_10115458 | 3300026142 | Bacteria | 2260 |
| 505 | Ga0207698_10190416 | 3300026142 | Bacteria | 1826 |
| 506 | Ga0207698_10564669 | 3300026142 | Bacteria | 1117 |
| 507 | Ga0207428_10187595 | 3300027907 | Bacteria | 1560 |
| 508 | Ga0268266_10001219 | 3300028379 | Bacteria | 31613 |
| 509 | Ga0268266_10002719 | 3300028379 | Bacteria | 18542 |
| 510 | Ga0268266_10014239 | 3300028379 | Bacteria | 6841 |
| 511 | Ga0268266_10097931 | 3300028379 | Bacteria | 2580 |
| 512 | Ga0268265_10000007 | 3300028380 | Bacteria | 431817 |
| 513 | Ga0268265_10000029 | 3300028380 | Bacteria | 229499 |
| 514 | Ga0268265_10005882 | 3300028380 | Bacteria | 8359 |
| 515 | Ga0268265_10212831 | 3300028380 | Bacteria | 1685 |
| 516 | Ga0268264_10000007 | 3300028381 | Bacteria | 815790 |
| 517 | Ga0268264_10000222 | 3300028381 | Bacteria | 111162 |
| 518 | Ga0268264_10003411 | 3300028381 | Bacteria | 13716 |
| 519 | Ga0268264_10061459 | 3300028381 | Bacteria | 3151 |
| 520 | Ga0268264_10154549 | 3300028381 | Bacteria | 2061 |
| 521 | Ga0268264_10571864 | 3300028381 | Bacteria | 1111 |
| 522 | Ga0307515_10270403 | 3300028794 | Bacteria | 1422 |
| 523 | Ga0265327_10000067 | 3300031251 | Bacteria | 221289 |
| 524 | Ga0265327_10000912 | 3300031251 | Bacteria | 43333 |
| 525 | Ga0265327_10076101 | 3300031251 | Bacteria | 1668 |
| 526 | Ga0307405_10218402 | 3300031731 | Bacteria | 1397 |
| 527 | Ga0307410_10010477 | 3300031852 | Bacteria | 5253 |
| 528 | Ga0307406_10190487 | 3300031901 | Bacteria | 1501 |
| 529 | Ga0307409_100539295 | 3300031995 | Bacteria | 1143 |
| 530 | Ga0307416_100085071 | 3300032002 | Bacteria | 2690 |
| 531 | Ga0307416_100141975 | 3300032002 | Bacteria | 2185 |
| 532 | Ga0307411_10024307 | 3300032005 | Bacteria | 3609 |
| 533 | Ga0307415_100024393 | 3300032126 | Bacteria | 3775 |
| 534 | Ga0373932_0034757 | 3300035112 | Bacteria | 1422 |
| 535 | Ga0373960_0033547 | 3300035121 | Bacteria | 1448 |
| 536 | Ga0373960_0040216 | 3300035121 | Bacteria | 1349 |
| 537 | Ga0373962_0041142 | 3300035242 | Bacteria | 1302 |
| 538 | Ga0373931_0067640 | 3300035691 | Bacteria | 1942 |
| 539 | Ga0373931_0252172 | 3300035691 | Bacteria | 1073 |
| 540 | Ga0316582_0157152 | 3300036647 | Bacteria | 1539 |
| 541 | Ga0395900_0041409 | 3300037418 | Bacteria | 4749 |
| 542 | Ga0395898_0012403 | 3300037466 | Bacteria | 8811 |
| 543 | Ga0395905_0287259 | 3300037471 | Bacteria | 1532 |
| 544 | Ga0436364_0584343 | 3300037853 | Bacteria | 14478 |
| 545 | Ga0436364_0605056 | 3300037853 | Bacteria | 10303 |
| 546 | Ga0436364_0724530 | 3300037853 | Bacteria | 21942 |
| 547 | Ga0436364_0796992 | 3300037853 | Bacteria | 2833 |
| 548 | Ga0436364_0990517 | 3300037853 | Bacteria | 28690 |
| 549 | Ga0436364_1389559 | 3300037853 | Bacteria | 7247 |
| 550 | Ga0395901_0000002 | 3300038443 | Bacteria | 761045 |
| 551 | Ga0395901_0584857 | 3300038443 | Bacteria | 1127 |
| 552 | Ga0400485_07994 | 3300038735 | Bacteria | 10410 |
| 553 | Ga0400486_27752 | 3300038742 | Bacteria | 1584 |
| 554 | Ga0400483_066491 | 3300039062 | Bacteria | 56152 |
| 555 | Ga0400483_228778 | 3300039062 | Bacteria | 97865 |
| 556 | Ga0436365_0138647 | 3300039437 | Bacteria | 7044 |
| 557 | Ga0436365_1083994 | 3300039437 | Bacteria | 225582 |
| 558 | Ga0436365_1305970 | 3300039437 | Bacteria | 5721 |
| 559 | Ga0436365_1334824 | 3300039437 | Bacteria | 56389 |
| 560 | Ga0436365_1936517 | 3300039437 | Bacteria | 18087 |
| 561 | Ga0436363_1679774 | 3300039450 | Bacteria | 6499 |
| 562 | Ga0439461_0000249 | 3300041410 | Bacteria | 7675 |
| 563 | Ga0439461_0000637 | 3300041410 | Bacteria | 5059 |
| 564 | Ga0439466_0001784 | 3300041411 | Bacteria | 8417 |
| 565 | Ga0439466_0007193 | 3300041411 | Bacteria | 4211 |
| 566 | Ga0439466_0029769 | 3300041411 | Bacteria | 1876 |
| 567 | Ga0439465_0011150 | 3300041413 | Bacteria | 2820 |
| 568 | Ga0451795_0520114 | 3300041456 | Bacteria | 3086 |
| 569 | Ga0439431_0000548 | 3300041997 | Bacteria | 7998 |
| 570 | Ga0439431_0008956 | 3300041997 | Bacteria | 2255 |
| 571 | Ga0439431_0046609 | 3300041997 | Bacteria | 1116 |
| 572 | Ga0439442_021566 | 3300042002 | Bacteria | 1336 |
| 573 | Ga0439445_0001278 | 3300042004 | Bacteria | 5449 |
| 574 | Ga0439445_0005881 | 3300042004 | Bacteria | 2806 |
| 575 | Ga0439445_0026394 | 3300042004 | Bacteria | 1487 |
| 576 | Ga0439434_0004220 | 3300042435 | Bacteria | 4198 |
| 577 | Ga0439435_0004781 | 3300042436 | Bacteria | 2938 |
| 578 | Ga0466969_0046993 | 3300044656 | Bacteria | 2138 |
| 579 | Ga0466972_0003097 | 3300044658 | Bacteria | 8249 |
| 580 | Ga0466972_0155687 | 3300044658 | Bacteria | 1073 |
| 581 | Ga0466965_0001825 | 3300044683 | Bacteria | 8850 |
| 582 | Ga0466965_0013675 | 3300044683 | Bacteria | 3831 |
| 583 | Ga0466966_0000236 | 3300044684 | Bacteria | 36529 |
| 584 | Ga0466966_0014538 | 3300044684 | Bacteria | 5209 |
| 585 | Ga0466966_0076843 | 3300044684 | Bacteria | 2084 |
| 586 | Ga0466961_0073873 | 3300044693 | Bacteria | 2162 |
| 587 | Ga0466961_0079250 | 3300044693 | Bacteria | 2080 |
| 588 | Ga0466963_0005748 | 3300044694 | Bacteria | 7291 |
| 589 | Ga0466963_0104906 | 3300044694 | Bacteria | 1937 |
| 590 | Ga0466963_0292522 | 3300044694 | Bacteria | 1145 |
| 591 | Ga0466971_0018480 | 3300044719 | Bacteria | 3088 |
| 592 | Ga0466971_0027279 | 3300044719 | Bacteria | 2557 |
| 593 | Ga0466968_0002961 | 3300044735 | Bacteria | 6275 |
| 594 | Ga0466968_0014481 | 3300044735 | Bacteria | 3118 |
| 595 | Ga0466968_0030687 | 3300044735 | Bacteria | 2228 |
| 596 | Ga0466968_0061450 | 3300044735 | Bacteria | 1621 |
| 597 | Ga0466970_0003872 | 3300044765 | Bacteria | 7326 |
| 598 | Ga0466970_0045943 | 3300044765 | Bacteria | 2325 |
| 599 | Ga0466970_0170683 | 3300044765 | Bacteria | 1205 |
| 600 | Ga0466957_0007155 | 3300044842 | Bacteria | 6310 |
| 601 | Ga0466957_0020206 | 3300044842 | Bacteria | 3918 |
| 602 | Ga0466957_0041886 | 3300044842 | Bacteria | 2769 |
| 603 | Ga0466957_0060335 | 3300044842 | Bacteria | 2325 |
| 604 | Ga0466960_0001119 | 3300044901 | Bacteria | 9626 |
| 605 | Ga0466960_0002717 | 3300044901 | Bacteria | 6684 |
| 606 | Ga0466960_0010770 | 3300044901 | Bacteria | 3806 |
| 607 | Ga0466959_0017217 | 3300045049 | Bacteria | 5293 |
| 608 | Ga0466959_0018993 | 3300045049 | Bacteria | 5051 |
| 609 | Ga0466959_0025147 | 3300045049 | Bacteria | 4410 |
| 610 | Ga0466958_0002652 | 3300045836 | Bacteria | 9043 |
| 611 | Ga0466958_0004750 | 3300045836 | Bacteria | 7223 |
| 612 | Ga0466958_0047797 | 3300045836 | Bacteria | 2584 |
| 613 | Ga0466958_0124630 | 3300045836 | Bacteria | 1615 |
| 614 | Ga0466967_0001551 | 3300045976 | Bacteria | 13460 |
| 615 | Ga0466967_0026122 | 3300045976 | Bacteria | 4830 |
| 616 | Ga0466967_0074046 | 3300045976 | Bacteria | 3057 |
| 617 | Ga0466967_0076412 | 3300045976 | Bacteria | 3013 |
| 618 | Ga0466967_0092019 | 3300045976 | Bacteria | 2757 |
| 619 | Ga0466967_0231633 | 3300045976 | Bacteria | 1759 |
| 620 | Ga0466967_0386777 | 3300045976 | Bacteria | 1359 |
| 621 | Ga0495603_0056436 | 3300046455 | Bacteria | 2325 |
| 622 | Ga0495603_0100826 | 3300046455 | Bacteria | 1685 |
| 623 | Ga0495580_0041325 | 3300046472 | Bacteria | 3288 |
| 624 | Ga0495605_0055137 | 3300046474 | Bacteria | 1922 |
| 625 | Ga0495583_0041706 | 3300046506 | Bacteria | 2147 |
| 626 | Ga0495583_0156708 | 3300046506 | Bacteria | 941 |
| 627 | Ga0495606_0067474 | 3300046507 | Bacteria | 2265 |
| 628 | Ga0495648_0002953 | 3300046524 | Bacteria | 15260 |
| 629 | Ga0495648_0019325 | 3300046524 | Bacteria | 4794 |
| 630 | Ga0495654_0033335 | 3300046530 | Bacteria | 2607 |
| 631 | Ga0495665_0021848 | 3300046531 | Bacteria | 3442 |
| 632 | Ga0495665_0055755 | 3300046531 | Bacteria | 2087 |
| 633 | Ga0495640_0022096 | 3300046533 | Bacteria | 4659 |
| 634 | Ga0495609_0127236 | 3300046538 | Bacteria | 1093 |
| 635 | Ga0495645_0115341 | 3300046543 | Bacteria | 1897 |
| 636 | Ga0495668_0000862 | 3300046616 | Bacteria | 34202 |
| 637 | Ga0495668_0021200 | 3300046616 | Bacteria | 3730 |
| 638 | Ga0495611_0065218 | 3300046648 | Bacteria | 1659 |
| 639 | Ga0495635_0160574 | 3300046663 | Bacteria | 1529 |
| 640 | Ga0495588_0211725 | 3300046674 | Bacteria | 1023 |
| 641 | Ga0495658_0059303 | 3300046683 | Bacteria | 2191 |
| 642 | Ga0495671_0127471 | 3300046692 | Bacteria | 1241 |
| 643 | Ga0495649_0173854 | 3300046694 | Bacteria | 1126 |
| 644 | Ga0495649_0202232 | 3300046694 | Bacteria | 1031 |
| 645 | Ga0495581_0038465 | 3300047315 | Bacteria | 2769 |
| 646 | Ga0495674_0039894 | 3300047319 | Bacteria | 4204 |
| 647 | Ga0495674_0189999 | 3300047319 | Bacteria | 1707 |
| 648 | Ga0495672_0005520 | 3300047320 | Bacteria | 10011 |
| 649 | Ga0495676_0058695 | 3300047321 | Bacteria | 3026 |
| 650 | Ga0495683_0116746 | 3300047323 | Bacteria | 1269 |
| 651 | Ga0495687_053654 | 3300047443 | Bacteria | 1696 |
| 652 | Ga0495673_0000588 | 3300047469 | Bacteria | 36483 |
| 653 | Ga0495673_0004675 | 3300047469 | Bacteria | 8499 |
| 654 | Ga0495686_0002574 | 3300047472 | Bacteria | 16882 |
| 655 | Ga0495686_0006499 | 3300047472 | Bacteria | 8935 |
| 656 | Ga0495686_0239910 | 3300047472 | Bacteria | 1023 |
| 657 | Ga0495593_0062317 | 3300047673 | Bacteria | 1949 |
| 658 | Ga0496100_0000026 | 3300048903 | Bacteria | 115873 |
| 659 | Ga0496100_0000407 | 3300048903 | Bacteria | 20774 |
| 660 | Ga0496100_0001469 | 3300048903 | Bacteria | 11539 |
| 661 | Ga0496100_0004953 | 3300048903 | Bacteria | 7119 |
| 662 | Ga0496100_0005354 | 3300048903 | Bacteria | 6901 |
| 663 | Ga0496100_0010477 | 3300048903 | Bacteria | 5249 |
| 664 | Ga0496100_0020227 | 3300048903 | Bacteria | 3987 |
| 665 | Ga0496100_0026798 | 3300048903 | Bacteria | 3537 |
| 666 | Ga0496100_0279764 | 3300048903 | Bacteria | 1243 |
| 667 | Ga0496101_0000002 | 3300048904 | Bacteria | 410971 |
| 668 | Ga0496101_0000015 | 3300048904 | Bacteria | 252368 |
| 669 | Ga0496101_0000091 | 3300048904 | Bacteria | 97934 |
| 670 | Ga0496101_0000176 | 3300048904 | Bacteria | 51135 |
| 671 | Ga0496101_0001680 | 3300048904 | Bacteria | 13263 |
| 672 | Ga0496101_0003585 | 3300048904 | Bacteria | 9693 |
| 673 | Ga0496101_0023601 | 3300048904 | Bacteria | 4251 |
| 674 | Ga0496101_0111983 | 3300048904 | Bacteria | 2055 |
| 675 | Ga0496101_0122181 | 3300048904 | Bacteria | 1969 |
| 676 | Ga0496101_0126438 | 3300048904 | Bacteria | 1937 |
| 677 | Ga0496101_0234141 | 3300048904 | Bacteria | 1428 |
| 678 | Ga0496101_0267084 | 3300048904 | Bacteria | 1335 |
| 679 | Ga0496102_0000009 | 3300048905 | Bacteria | 344149 |
| 680 | Ga0496102_0000016 | 3300048905 | Bacteria | 286787 |
| 681 | Ga0496102_0000629 | 3300048905 | Bacteria | 36066 |
| 682 | Ga0496102_0000789 | 3300048905 | Bacteria | 30791 |
| 683 | Ga0496102_0001958 | 3300048905 | Bacteria | 17750 |
| 684 | Ga0496102_0003406 | 3300048905 | Bacteria | 13480 |
| 685 | Ga0496102_0003683 | 3300048905 | Bacteria | 12962 |
| 686 | Ga0496102_0031692 | 3300048905 | Bacteria | 4744 |
| 687 | Ga0496102_0078577 | 3300048905 | Bacteria | 3038 |
| 688 | Ga0496102_0084417 | 3300048905 | Bacteria | 2931 |
| 689 | Ga0496102_0138452 | 3300048905 | Bacteria | 2281 |
| 690 | Ga0496102_0204020 | 3300048905 | Bacteria | 1864 |
| 691 | Ga0496102_0286891 | 3300048905 | Bacteria | 1551 |
| 692 | Ga0496103_0000005 | 3300048906 | Bacteria | 505416 |
| 693 | Ga0496103_0000015 | 3300048906 | Bacteria | 287966 |
| 694 | Ga0496103_0000409 | 3300048906 | Bacteria | 38113 |
| 695 | Ga0496103_0000610 | 3300048906 | Bacteria | 27899 |
| 696 | Ga0496103_0001002 | 3300048906 | Bacteria | 19780 |
| 697 | Ga0496103_0018772 | 3300048906 | Bacteria | 4150 |
| 698 | Ga0496103_0026722 | 3300048906 | Bacteria | 3493 |
| 699 | Ga0496103_0049183 | 3300048906 | Bacteria | 2607 |
| 700 | Ga0496103_0058278 | 3300048906 | Bacteria | 2399 |
| 701 | Ga0496103_0105600 | 3300048906 | Bacteria | 1786 |
| 702 | Ga0496103_0273533 | 3300048906 | Bacteria | 1087 |
| 703 | Ga0496104_0000793 | 3300048907 | Bacteria | 27078 |
| 704 | Ga0496104_0004506 | 3300048907 | Bacteria | 12141 |
| 705 | Ga0496104_0128710 | 3300048907 | Bacteria | 2432 |
| 706 | Ga0496104_0173589 | 3300048907 | Bacteria | 2066 |
| 707 | Ga0496104_0286865 | 3300048907 | Bacteria | 1559 |
| 708 | Ga0496104_0383891 | 3300048907 | Bacteria | 1317 |
| 709 | Ga0496104_0481831 | 3300048907 | Bacteria | 1152 |
| 710 | Ga0496105_0001664 | 3300048908 | Bacteria | 15828 |
| 711 | Ga0496105_0006293 | 3300048908 | Bacteria | 9116 |
| 712 | Ga0496105_0031837 | 3300048908 | Bacteria | 4325 |
| 713 | Ga0496105_0192050 | 3300048908 | Bacteria | 1669 |
| 714 | Ga0496106_0000640 | 3300048909 | Bacteria | 25096 |
| 715 | Ga0496106_0004355 | 3300048909 | Bacteria | 10516 |
| 716 | Ga0496106_0005431 | 3300048909 | Bacteria | 9429 |
| 717 | Ga0496106_0008413 | 3300048909 | Bacteria | 7632 |
| 718 | Ga0496106_0014165 | 3300048909 | Bacteria | 5890 |
| 719 | Ga0496106_0024430 | 3300048909 | Bacteria | 4493 |
| 720 | Ga0496106_0034334 | 3300048909 | Bacteria | 3788 |
| 721 | Ga0496106_0111605 | 3300048909 | Bacteria | 2129 |
| 722 | Ga0496106_0211498 | 3300048909 | Bacteria | 1545 |
| 723 | Ga0496106_0221087 | 3300048909 | Bacteria | 1510 |
| 724 | Ga0496106_0329581 | 3300048909 | Bacteria | 1225 |
| 725 | Ga0496107_0000475 | 3300048910 | Bacteria | 22068 |
| 726 | Ga0496107_0001091 | 3300048910 | Bacteria | 16314 |
| 727 | Ga0496107_0002152 | 3300048910 | Bacteria | 12650 |
| 728 | Ga0496107_0007237 | 3300048910 | Bacteria | 7646 |
| 729 | Ga0496107_0008199 | 3300048910 | Bacteria | 7226 |
| 730 | Ga0496107_0013934 | 3300048910 | Bacteria | 5623 |
| 731 | Ga0496107_0014647 | 3300048910 | Bacteria | 5491 |
| 732 | Ga0496107_0062523 | 3300048910 | Bacteria | 2697 |
| 733 | Ga0496107_0109264 | 3300048910 | Bacteria | 2031 |
| 734 | Ga0496107_0542488 | 3300048910 | Bacteria | 862 |
| 735 | Ga0496108_0000189 | 3300048911 | Bacteria | 57428 |
| 736 | Ga0496108_0007693 | 3300048911 | Bacteria | 8728 |
| 737 | Ga0496108_0007870 | 3300048911 | Bacteria | 8640 |
| 738 | Ga0496108_0045620 | 3300048911 | Bacteria | 3661 |
| 739 | Ga0496108_0066092 | 3300048911 | Bacteria | 3049 |
| 740 | Ga0496108_0071069 | 3300048911 | Bacteria | 2937 |
| 741 | Ga0496108_0080026 | 3300048911 | Bacteria | 2767 |
| 742 | Ga0496108_0105188 | 3300048911 | Bacteria | 2409 |
| 743 | Ga0496108_0109721 | 3300048911 | Bacteria | 2358 |
| 744 | Ga0496108_0121305 | 3300048911 | Bacteria | 2242 |
| 745 | Ga0496109_0000022 | 3300048912 | Bacteria | 188901 |
| 746 | Ga0496109_0000668 | 3300048912 | Bacteria | 28417 |
| 747 | Ga0496109_0001533 | 3300048912 | Bacteria | 19230 |
| 748 | Ga0496109_0016750 | 3300048912 | Bacteria | 6413 |
| 749 | Ga0496109_0018882 | 3300048912 | Bacteria | 6068 |
| 750 | Ga0496109_0064985 | 3300048912 | Bacteria | 3340 |
| 751 | Ga0496109_0088630 | 3300048912 | Bacteria | 2860 |
| 752 | Ga0496109_0198274 | 3300048912 | Bacteria | 1887 |
| 753 | Ga0496109_0404077 | 3300048912 | Bacteria | 1290 |
| 754 | Ga0496109_0583203 | 3300048912 | Bacteria | 1054 |
| 755 | Ga0496110_0007546 | 3300048913 | Bacteria | 8688 |
| 756 | Ga0496111_0296354 | 3300048914 | Bacteria | 1199 |
| 757 | Ga0496111_0469091 | 3300048914 | Bacteria | 928 |
| 758 | Ga0496112_0001161 | 3300048915 | Bacteria | 19679 |
| 759 | Ga0496112_0012600 | 3300048915 | Bacteria | 7771 |
| 760 | Ga0496112_0022286 | 3300048915 | Bacteria | 6035 |
| 761 | Ga0496112_0046435 | 3300048915 | Bacteria | 4259 |
| 762 | Ga0496112_0054624 | 3300048915 | Bacteria | 3925 |
| 763 | Ga0496112_0067772 | 3300048915 | Bacteria | 3523 |
| 764 | Ga0496112_0240060 | 3300048915 | Bacteria | 1765 |
| 765 | Ga0496113_0009533 | 3300048916 | Bacteria | 6367 |
| 766 | Ga0496113_0037510 | 3300048916 | Bacteria | 3557 |
| 767 | Ga0496113_0064624 | 3300048916 | Bacteria | 2767 |
| 768 | Ga0496113_0091562 | 3300048916 | Bacteria | 2344 |
| 769 | Ga0496113_0148150 | 3300048916 | Bacteria | 1850 |
| 770 | Ga0496113_0190292 | 3300048916 | Bacteria | 1629 |
| 771 | Ga0496113_0430113 | 3300048916 | Bacteria | 1060 |
| 772 | Ga0496114_0000829 | 3300048917 | Bacteria | 23199 |
| 773 | Ga0496114_0000911 | 3300048917 | Bacteria | 22146 |
| 774 | Ga0496114_0001530 | 3300048917 | Bacteria | 17530 |
| 775 | Ga0496114_0005432 | 3300048917 | Bacteria | 9970 |
| 776 | Ga0496114_0009086 | 3300048917 | Bacteria | 7881 |
| 777 | Ga0496114_0014343 | 3300048917 | Bacteria | 6357 |
| 778 | Ga0496114_0015198 | 3300048917 | Bacteria | 6190 |
| 779 | Ga0496114_0440135 | 3300048917 | Bacteria | 1154 |
| 780 | Ga0496115_0000929 | 3300048918 | Bacteria | 21222 |
| 781 | Ga0496115_0002308 | 3300048918 | Bacteria | 13662 |
| 782 | Ga0496115_0010831 | 3300048918 | Bacteria | 6821 |
| 783 | Ga0496115_0039401 | 3300048918 | Bacteria | 3752 |
| 784 | Ga0496115_0129129 | 3300048918 | Bacteria | 2083 |
| 785 | Ga0496115_0259378 | 3300048918 | Bacteria | 1430 |
| 786 | Ga0496116_0000055 | 3300048919 | Bacteria | 286923 |
| 787 | Ga0496116_0000104 | 3300048919 | Bacteria | 193416 |
| 788 | Ga0496116_0012030 | 3300048919 | Bacteria | 7100 |
| 789 | Ga0496116_0014806 | 3300048919 | Bacteria | 6202 |
| 790 | Ga0496117_0000006 | 3300048920 | Bacteria | 758420 |
| 791 | Ga0496117_0000019 | 3300048920 | Bacteria | 469256 |
| 792 | Ga0496117_0000415 | 3300048920 | Bacteria | 71870 |
| 793 | Ga0496117_0000564 | 3300048920 | Bacteria | 60818 |
| 794 | Ga0496117_0158938 | 3300048920 | Bacteria | 1327 |
| 795 | Ga0496118_0000004 | 3300048921 | Bacteria | 758420 |
| 796 | Ga0496118_0000020 | 3300048921 | Bacteria | 470521 |
| 797 | Ga0496118_0000279 | 3300048921 | Bacteria | 89978 |
| 798 | Ga0496118_0000609 | 3300048921 | Bacteria | 58938 |
| 799 | Ga0496118_0002279 | 3300048921 | Bacteria | 26185 |
| 800 | Ga0496118_0023329 | 3300048921 | Bacteria | 5377 |
| 801 | Ga0496119_0001293 | 3300048922 | Bacteria | 30908 |
| 802 | Ga0496119_0003048 | 3300048922 | Bacteria | 17729 |
| 803 | Ga0496119_0024348 | 3300048922 | Bacteria | 4261 |
| 804 | Ga0496120_0000272 | 3300048923 | Bacteria | 86274 |
| 805 | Ga0496120_0009063 | 3300048923 | Bacteria | 7106 |
| 806 | Ga0496120_0070350 | 3300048923 | Bacteria | 1925 |
| 807 | Ga0496120_0091932 | 3300048923 | Bacteria | 1619 |
| 808 | Ga0496121_0000004 | 3300048924 | Bacteria | 1139011 |
| 809 | Ga0496121_0000331 | 3300048924 | Bacteria | 98656 |
| 810 | Ga0496121_0001252 | 3300048924 | Bacteria | 44016 |
| 811 | Ga0496121_0004561 | 3300048924 | Bacteria | 18494 |
| 812 | Ga0496121_0013198 | 3300048924 | Bacteria | 8902 |
| 813 | Ga0496121_0116924 | 3300048924 | Bacteria | 2021 |
| 814 | Ga0496121_0247536 | 3300048924 | Bacteria | 1238 |
| 815 | Ga0496122_0000257 | 3300048925 | Bacteria | 120176 |
| 816 | Ga0496122_0009690 | 3300048925 | Bacteria | 10077 |
| 817 | Ga0496122_0012801 | 3300048925 | Bacteria | 8300 |
| 818 | Ga0496123_0003863 | 3300048926 | Bacteria | 16298 |
| 819 | Ga0496123_0019811 | 3300048926 | Bacteria | 5284 |
| 820 | Ga0496124_0000012 | 3300048927 | Bacteria | 512581 |
| 821 | Ga0496124_0208243 | 3300048927 | Bacteria | 1482 |
| 822 | Ga0496125_0000003 | 3300048928 | Bacteria | 1189767 |
| 823 | Ga0496125_0007986 | 3300048928 | Bacteria | 11178 |
| 824 | Ga0496125_0038627 | 3300048928 | Bacteria | 4127 |
| 825 | Ga0496125_0057942 | 3300048928 | Bacteria | 3132 |
| 826 | Ga0496125_0101715 | 3300048928 | Bacteria | 2114 |
| 827 | Ga0496126_0000001 | 3300048929 | Bacteria | 1139011 |
| 828 | Ga0496126_0000675 | 3300048929 | Bacteria | 62838 |
| 829 | Ga0496126_0000931 | 3300048929 | Bacteria | 50490 |
| 830 | Ga0496126_0001999 | 3300048929 | Bacteria | 28832 |
| 831 | Ga0496126_0002966 | 3300048929 | Bacteria | 22050 |
| 832 | Ga0496126_0004965 | 3300048929 | Bacteria | 15517 |
| 833 | Ga0496126_0007614 | 3300048929 | Bacteria | 11826 |
| 834 | Ga0496126_0034892 | 3300048929 | Bacteria | 4718 |
| 835 | Ga0496126_0035612 | 3300048929 | Bacteria | 4663 |
| 836 | Ga0495682_0040226 | 3300049460 | Bacteria | 1714 |
| 837 | Ga0501032_0001262 | 3300049569 | Bacteria | 20302 |
| 838 | Ga0501032_0002308 | 3300049569 | Bacteria | 14972 |
| 839 | Ga0501032_0004982 | 3300049569 | Bacteria | 9932 |
| 840 | Ga0501032_0013814 | 3300049569 | Bacteria | 5729 |
| 841 | Ga0501032_0119055 | 3300049569 | Bacteria | 1746 |
| 842 | Ga0501032_0241886 | 3300049569 | Bacteria | 1172 |
| 843 | Ga0501033_0024034 | 3300049570 | Bacteria | 4598 |
| 844 | Ga0501033_0041430 | 3300049570 | Bacteria | 3436 |
| 845 | Ga0501033_0058998 | 3300049570 | Bacteria | 2834 |
| 846 | Ga0501034_0005748 | 3300049571 | Bacteria | 13488 |
| 847 | Ga0501034_0005877 | 3300049571 | Bacteria | 13331 |
| 848 | Ga0501034_0006653 | 3300049571 | Bacteria | 12402 |
| 849 | Ga0501034_0103519 | 3300049571 | Bacteria | 2840 |
| 850 | Ga0501034_0117905 | 3300049571 | Bacteria | 2642 |
| 851 | Ga0501034_0218066 | 3300049571 | Bacteria | 1861 |
| 852 | Ga0501034_0543083 | 3300049571 | Bacteria | 1072 |
| 853 | Ga0501036_0004384 | 3300049572 | Bacteria | 11391 |
| 854 | Ga0501036_0098794 | 3300049572 | Bacteria | 2468 |
| 855 | Ga0501036_0326851 | 3300049572 | Bacteria | 1281 |
| 856 | Ga0501036_0404718 | 3300049572 | Bacteria | 1138 |
| 857 | Ga0501037_0000265 | 3300049573 | Bacteria | 45219 |
| 858 | Ga0501037_0001928 | 3300049573 | Bacteria | 15043 |
| 859 | Ga0501037_0004967 | 3300049573 | Bacteria | 9671 |
| 860 | Ga0501037_0006541 | 3300049573 | Bacteria | 8528 |
| 861 | Ga0501037_0257192 | 3300049573 | Bacteria | 1221 |
| 862 | Ga0501038_0003199 | 3300049574 | Bacteria | 15277 |
| 863 | Ga0501038_0008311 | 3300049574 | Bacteria | 9552 |
| 864 | Ga0501039_0002474 | 3300049575 | Bacteria | 13756 |
| 865 | Ga0501039_0005085 | 3300049575 | Bacteria | 9965 |
| 866 | Ga0501043_0004747 | 3300049579 | Bacteria | 11022 |
| 867 | Ga0501043_0005944 | 3300049579 | Bacteria | 9815 |
| 868 | Ga0501046_0004073 | 3300049580 | Bacteria | 13324 |
| 869 | Ga0501047_0006308 | 3300049581 | Bacteria | 11155 |
| 870 | Ga0501047_0025795 | 3300049581 | Bacteria | 5652 |
| 871 | Ga0501047_0038821 | 3300049581 | Bacteria | 4606 |
| 872 | Ga0501047_0049337 | 3300049581 | Bacteria | 4065 |
| 873 | Ga0501047_0071854 | 3300049581 | Bacteria | 3331 |
| 874 | Ga0501048_0020992 | 3300049582 | Bacteria | 4784 |
| 875 | Ga0501067_0047620 | 3300049583 | Bacteria | 2378 |
| 876 | Ga0501069_0266296 | 3300049585 | Bacteria | 1001 |
| 877 | Ga0501070_0002057 | 3300049586 | Bacteria | 17672 |
| 878 | Ga0501070_0002972 | 3300049586 | Bacteria | 14769 |
| 879 | Ga0501070_0003070 | 3300049586 | Bacteria | 14540 |
| 880 | Ga0501070_0003639 | 3300049586 | Bacteria | 13323 |
| 881 | Ga0501070_0061119 | 3300049586 | Bacteria | 3122 |
| 882 | Ga0501070_0113268 | 3300049586 | Bacteria | 2242 |
| 883 | Ga0501073_0061257 | 3300049589 | Bacteria | 2626 |
| 884 | Ga0501074_0039655 | 3300049590 | Bacteria | 3411 |
| 885 | Ga0501080_0023143 | 3300049742 | Bacteria | 5762 |
| 886 | Ga0501080_0298561 | 3300049742 | Bacteria | 1461 |
| 887 | Ga0501083_0060642 | 3300049744 | Bacteria | 2527 |
| 888 | Ga0501035_0000257 | 3300049822 | Bacteria | 63434 |
| 889 | Ga0501035_0073719 | 3300049822 | Bacteria | 3020 |
| 890 | Ga0501035_0168690 | 3300049822 | Bacteria | 1892 |
| 891 | Ga0501044_0000977 | 3300049823 | Bacteria | 34360 |
| 892 | Ga0501044_0001382 | 3300049823 | Bacteria | 28450 |
| 893 | Ga0501044_0003233 | 3300049823 | Bacteria | 18345 |
| 894 | Ga0501044_0003313 | 3300049823 | Bacteria | 18143 |
| 895 | Ga0501044_0065446 | 3300049823 | Bacteria | 3707 |
| 896 | Ga0501044_0221545 | 3300049823 | Bacteria | 1842 |
| 897 | nmdc:mga03683_39082_c1 | 3300050489 | Bacteria | 1941 |
| 898 | nmdc:mga03n38_216022_c1 | 3300050490 | Bacteria | 999 |
| 899 | nmdc:mga03n38_21862_c1 | 3300050490 | Bacteria | 2580 |
| 900 | nmdc:mga03n38_22112_c1 | 3300050490 | Bacteria | 2570 |
| 901 | nmdc:mga03n38_29355_c1 | 3300050490 | Bacteria | 2301 |
| 902 | nmdc:mga03n38_3035_c1 | 3300050490 | Bacteria | 5319 |
| 903 | nmdc:mga03n38_3572_c1 | 3300050490 | Bacteria | 5018 |
| 904 | nmdc:mga03n38_42458_c1 | 3300050490 | Bacteria | 1988 |
| 905 | nmdc:mga03n38_6016_c1 | 3300050490 | Bacteria | 4183 |
| 906 | nmdc:mga03n38_7837_c1 | 3300050490 | Bacteria | 3795 |
| 907 | nmdc:mga00v17_11687_c1 | 3300050491 | Bacteria | 4829 |
| 908 | nmdc:mga00v17_184386_c1 | 3300050491 | Bacteria | 1347 |
| 909 | nmdc:mga00v17_202511_c1 | 3300050491 | Bacteria | 1283 |
| 910 | nmdc:mga00v17_20770_c1 | 3300050491 | Bacteria | 3766 |
| 911 | nmdc:mga00v17_31326_c1 | 3300050491 | Bacteria | 3136 |
| 912 | nmdc:mga00v17_31428_c1 | 3300050491 | Bacteria | 3131 |
| 913 | nmdc:mga00v17_3792_c1 | 3300050491 | Bacteria | 7801 |
| 914 | nmdc:mga00v17_43540_c1 | 3300050491 | Bacteria | 2704 |
| 915 | nmdc:mga00v17_4414_c1 | 3300050491 | Bacteria | 7315 |
| 916 | nmdc:mga00v17_5963_c1 | 3300050491 | Bacteria | 6445 |
| 917 | nmdc:mga00v17_61482_c1 | 3300050491 | Bacteria | 2309 |
| 918 | nmdc:mga00v17_93203_c1 | 3300050491 | Bacteria | 1894 |
| 919 | nmdc:mga0yw44_105230_c1 | 3300050492 | Bacteria | 1802 |
| 920 | nmdc:mga0yw44_176404_c1 | 3300050492 | Bacteria | 1405 |
| 921 | nmdc:mga0yw44_17649_c1 | 3300050492 | Bacteria | 3889 |
| 922 | nmdc:mga0yw44_249740_c1 | 3300050492 | Bacteria | 1180 |
| 923 | nmdc:mga0yw44_35276_c1 | 3300050492 | Bacteria | 2938 |
| 924 | nmdc:mga0yw44_5500_c1 | 3300050492 | Bacteria | 5996 |
| 925 | nmdc:mga0yw44_78080_c1 | 3300050492 | Bacteria | 1206 |
| 926 | nmdc:mga0k408_63019_c1 | 3300050493 | Bacteria | 2156 |
| 927 | nmdc:mga06z11_5107_c1 | 3300050494 | Bacteria | 5232 |
| 928 | nmdc:mga07m45_10817_c2 | 3300050496 | Bacteria | 3811 |
| 929 | nmdc:mga07m45_11196_c1 | 3300050496 | Bacteria | 4709 |
| 930 | nmdc:mga07m45_130583_c1 | 3300050496 | Bacteria | 1453 |
| 931 | nmdc:mga07m45_38628_c1 | 3300050496 | Bacteria | 2664 |
| 932 | nmdc:mga07m45_47188_c1 | 3300050496 | Bacteria | 2421 |
| 933 | nmdc:mga05p37_79717_c1 | 3300050507 | Bacteria | 4032 |
| 934 | nmdc:mga0qj67_35429_c1 | 3300050509 | Bacteria | 3902 |
| 935 | nmdc:mga06r32_10729_c1 | 3300050510 | Bacteria | 8250 |
| 936 | nmdc:mga08y16_179786_c1 | 3300050511 | Bacteria | 2196 |
| 937 | nmdc:mga0a205_69084_c1 | 3300050515 | Bacteria | 3412 |
| 938 | nmdc:mga0sz30_1051_c2 | 3300050516 | Bacteria | 8013 |
| 939 | nmdc:mga0sz30_14219_c1 | 3300050516 | Bacteria | 3128 |
| 940 | nmdc:mga0sz30_17835_c1 | 3300050516 | Bacteria | 2039 |
| 941 | nmdc:mga0sz30_23875_c1 | 3300050516 | Bacteria | 2492 |
| 942 | nmdc:mga0sz30_30958_c1 | 3300050516 | Bacteria | 2212 |
| 943 | nmdc:mga0sz30_3363_c1 | 3300050516 | Bacteria | 5752 |
| 944 | nmdc:mga0sz30_50038_c1 | 3300050516 | Bacteria | 1771 |
| 945 | nmdc:mga0sz30_77251_c1 | 3300050516 | Bacteria | 1438 |
| 946 | nmdc:mga0sz30_935_c1 | 3300050516 | Bacteria | 10495 |
| 947 | Ga0500635_0002098 | 3300053080 | Bacteria | 4889 |
| 948 | Ga0500635_0011115 | 3300053080 | Bacteria | 2551 |
| 949 | Ga0495619_0054648 | 3300053085 | Bacteria | 2643 |
| 950 | Ga0500643_005840 | 3300053087 | Bacteria | 5233 |
| 951 | Ga0500643_006895 | 3300053087 | Bacteria | 4673 |
| 952 | Ga0500556_0001688 | 3300053104 | Bacteria | 8507 |
| 953 | Ga0500593_002007 | 3300053117 | Bacteria | 7379 |
| 954 | Ga0500642_0109249 | 3300053130 | Bacteria | 1291 |
| 955 | Ga0500652_002449 | 3300053131 | Bacteria | 5593 |
| 956 | Ga0500616_0002716 | 3300053153 | Bacteria | 14360 |
| 957 | Ga0500616_0035165 | 3300053153 | Bacteria | 2726 |
| 958 | Ga0500645_000023 | 3300053730 | Bacteria | 128995 |
| 959 | Ga0501084_0081352 | 3300054114 | Bacteria | 2717 |
| 960 | Ga0501082_0383102 | 3300060353 | Bacteria | 1227 |
| 961 | Ga0466962_0016885 | 3300061719 | Bacteria | 3517 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038742 | Ga0400486_27752 | Ga0400486_27752_49_777 | 239 |
| 2 | 3300049572 | Ga0501036_0404718 | Ga0501036_0404718_305_1120 | 243 |
| 3 | 3300009094 | Ga0111539_10637365 | Ga0111539_106373653 | 248 |
| 4 | 3300053117 | Ga0500593_002007 | Ga0500593_002007_125_904 | 257 |
| 5 | 3300046506 | Ga0495583_0156708 | Ga0495583_0156708_143_925 | 258 |
| 6 | 3300048910 | Ga0496107_0542488 | Ga0496107_0542488_14_829 | 269 |
| 7 | 3300049569 | Ga0501032_0013814 | Ga0501032_0013814_1484_2404 | 277 |
| 8 | 3300049570 | Ga0501033_0041430 | Ga0501033_0041430_1278_2204 | 277 |
| 9 | 3300049571 | Ga0501034_0103519 | Ga0501034_0103519_67_993 | 277 |
| 10 | 3300049573 | Ga0501037_0004967 | Ga0501037_0004967_8352_9272 | 277 |
| 11 | 3300049579 | Ga0501043_0005944 | Ga0501043_0005944_267_1187 | 277 |
| 12 | 3300049581 | Ga0501047_0038821 | Ga0501047_0038821_476_1402 | 277 |
| 13 | 3300049581 | Ga0501047_0049337 | Ga0501047_0049337_1759_2679 | 277 |
| 14 | 3300049586 | Ga0501070_0003070 | Ga0501070_0003070_10484_11404 | 277 |
| 15 | 3300049742 | Ga0501080_0023143 | Ga0501080_0023143_4522_5442 | 277 |
| 16 | 3300049822 | Ga0501035_0000257 | Ga0501035_0000257_50363_51289 | 277 |
| 17 | 3300049823 | Ga0501044_0000977 | Ga0501044_0000977_6057_6983 | 277 |
| 18 | 3300049823 | Ga0501044_0003233 | Ga0501044_0003233_13615_14535 | 277 |
| 19 | 3300038443 | Ga0395901_0584857 | Ga0395901_0584857_194_1099 | 279 |
| 20 | 3300049586 | Ga0501070_0061119 | Ga0501070_0061119_2164_3084 | 279 |
| 21 | 3300014326 | Ga0157380_10001851 | Ga0157380_100018511 | 283 |
| 22 | 3300048914 | Ga0496111_0469091 | Ga0496111_0469091_11_868 | 283 |
| 23 | 3300046543 | Ga0495645_0115341 | Ga0495645_0115341_523_1650 | 284 |
| 24 | 3300005366 | Ga0070659_100020849 | Ga0070659_1000208496 | 286 |
| 25 | 3300025914 | Ga0207671_10080894 | Ga0207671_100808943 | 286 |
| 26 | 3300025919 | Ga0207657_10065141 | Ga0207657_100651413 | 286 |
| 27 | 3300025932 | Ga0207690_10006937 | Ga0207690_100069377 | 286 |
| 28 | 3300025924 | Ga0207694_10049503 | Ga0207694_100495031 | 288 |
| 29 | 3300037466 | Ga0395898_0012403 | Ga0395898_0012403_1619_2581 | 288 |
| 30 | 3300037471 | Ga0395905_0287259 | Ga0395905_0287259_599_1504 | 289 |
| 31 | 3300044684 | Ga0466966_0000236 | Ga0466966_0000236_26867_27772 | 289 |
| 32 | 3300044719 | Ga0466971_0027279 | Ga0466971_0027279_614_1519 | 289 |
| 33 | 3300045836 | Ga0466958_0047797 | Ga0466958_0047797_1214_2119 | 289 |
| 34 | iso_pu_bacteria | 2929226422 | 2929230839 | 289 |
| 35 | 3300049571 | Ga0501034_0543083 | Ga0501034_0543083_13_933 | 290 |
| 36 | 3300037418 | Ga0395900_0041409 | Ga0395900_0041409_3348_4259 | 292 |
| 37 | 3300003792 | Ga0055540_1000207 | Ga0055540_100020715 | 294 |
| 38 | 3300006038 | Ga0075365_10130137 | Ga0075365_101301372 | 294 |
| 39 | 3300009545 | Ga0105237_10013063 | Ga0105237_100130638 | 294 |
| 40 | 3300010375 | Ga0105239_10072566 | Ga0105239_100725662 | 294 |
| 41 | 3300021388 | Ga0213875_10001995 | Ga0213875_100019955 | 294 |
| 42 | 3300025303 | Ga0209051_1000158 | Ga0209051_100015883 | 294 |
| 43 | 3300025914 | Ga0207671_10061121 | Ga0207671_100611213 | 294 |
| 44 | 3300037853 | Ga0436364_0990517 | Ga0436364_0990517_7479_8390 | 294 |
| 45 | 3300005456 | Ga0070678_100271034 | Ga0070678_1002710342 | 295 |
| 46 | 3300005563 | Ga0068855_100752964 | Ga0068855_1007529641 | 295 |
| 47 | 3300009093 | Ga0105240_10144161 | Ga0105240_101441613 | 295 |
| 48 | 3300009545 | Ga0105237_10000587 | Ga0105237_1000058748 | 295 |
| 49 | 3300025909 | Ga0207705_10000352 | Ga0207705_1000035223 | 295 |
| 50 | 3300005842 | Ga0068858_100351993 | Ga0068858_1003519932 | 296 |
| 51 | 3300006852 | Ga0075433_10056618 | Ga0075433_100566183 | 296 |
| 52 | 3300006871 | Ga0075434_100020986 | Ga0075434_1000209865 | 296 |
| 53 | 3300009545 | Ga0105237_10047482 | Ga0105237_100474822 | 296 |
| 54 | 3300025986 | Ga0207658_10000621 | Ga0207658_1000062132 | 296 |
| 55 | 3300048903 | Ga0496100_0000026 | Ga0496100_0000026_44374_45306 | 296 |
| 56 | 3300048904 | Ga0496101_0000015 | Ga0496101_0000015_205226_206158 | 296 |
| 57 | 3300048905 | Ga0496102_0031692 | Ga0496102_0031692_953_1885 | 296 |
| 58 | 3300048906 | Ga0496103_0018772 | Ga0496103_0018772_1141_2073 | 296 |
| 59 | 3300048910 | Ga0496107_0000475 | Ga0496107_0000475_8289_9221 | 296 |
| 60 | 3300048911 | Ga0496108_0071069 | Ga0496108_0071069_1125_2057 | 296 |
| 61 | 3300048912 | Ga0496109_0000022 | Ga0496109_0000022_157371_158303 | 296 |
| 62 | 3300048913 | Ga0496110_0007546 | Ga0496110_0007546_5578_6510 | 296 |
| 63 | 3300048917 | Ga0496114_0000829 | Ga0496114_0000829_3799_4731 | 296 |
| 64 | 3300048918 | Ga0496115_0010831 | Ga0496115_0010831_1406_2338 | 296 |
| 65 | 3300048919 | Ga0496116_0014806 | Ga0496116_0014806_95_1027 | 296 |
| 66 | 3300048921 | Ga0496118_0023329 | Ga0496118_0023329_2988_3920 | 296 |
| 67 | 3300048924 | Ga0496121_0000004 | Ga0496121_0000004_740356_741288 | 296 |
| 68 | 3300048925 | Ga0496122_0000257 | Ga0496122_0000257_46213_47145 | 296 |
| 69 | 3300048926 | Ga0496123_0003863 | Ga0496123_0003863_4950_5882 | 296 |
| 70 | 3300048927 | Ga0496124_0000012 | Ga0496124_0000012_465149_466081 | 296 |
| 71 | 3300048928 | Ga0496125_0000003 | Ga0496125_0000003_448480_449412 | 296 |
| 72 | 3300048929 | Ga0496126_0000001 | Ga0496126_0000001_740356_741288 | 296 |
| 73 | 3300050515 | nmdc:mga0a205_69084_c1 | nmdc:mga0a205_69084_c1_935_1849 | 296 |
| 74 | 3300050516 | nmdc:mga0sz30_23875_c1 | nmdc:mga0sz30_23875_c1_493_1428 | 296 |
| 75 | 3300053087 | Ga0500643_006895 | Ga0500643_006895_1546_2475 | 296 |
| 76 | iso_pu_bacteria | 2565956761 | 2566997256 | 296 |
| 77 | iso_pu_bacteria | 2738541264 | 2738667931 | 296 |
| 78 | iso_pu_bacteria | 2738541356 | 2739147001 | 296 |
| 79 | iso_pu_bacteria | 2881927736 | 2881929048 | 296 |
| 80 | iso_pu_bacteria | 2904535858 | 2904536270 | 296 |
| 81 | iso_pu_bacteria | 2922554459 | 2922558200 | 296 |
| 82 | iso_pu_bacteria | 8048746797 | 8048748487 | 296 |
| 83 | 3300005341 | Ga0070691_10182162 | Ga0070691_101821621 | 297 |
| 84 | 3300005344 | Ga0070661_100106368 | Ga0070661_1001063682 | 297 |
| 85 | 3300005456 | Ga0070678_100104239 | Ga0070678_1001042391 | 297 |
| 86 | 3300006051 | Ga0075364_10008064 | Ga0075364_100080643 | 297 |
| 87 | 3300006353 | Ga0075370_10100405 | Ga0075370_101004052 | 297 |
| 88 | 3300009174 | Ga0105241_10020745 | Ga0105241_100207453 | 297 |
| 89 | 3300013104 | Ga0157370_10016874 | Ga0157370_100168743 | 297 |
| 90 | 3300021384 | Ga0213876_10011942 | Ga0213876_100119423 | 297 |
| 91 | 3300021388 | Ga0213875_10026986 | Ga0213875_100269862 | 297 |
| 92 | 3300025913 | Ga0207695_10144529 | Ga0207695_101445292 | 297 |
| 93 | 3300026121 | Ga0207683_10429818 | Ga0207683_104298181 | 297 |
| 94 | 3300037853 | Ga0436364_1389559 | Ga0436364_1389559_3679_4593 | 297 |
| 95 | 3300038735 | Ga0400485_07994 | Ga0400485_07994_4599_5504 | 297 |
| 96 | 3300039062 | Ga0400483_066491 | Ga0400483_066491_32772_33677 | 297 |
| 97 | 3300039062 | Ga0400483_228778 | Ga0400483_228778_64502_65407 | 297 |
| 98 | 3300039437 | Ga0436365_1083994 | Ga0436365_1083994_74490_75404 | 297 |
| 99 | 3300045049 | Ga0466959_0018993 | Ga0466959_0018993_903_1865 | 297 |
| 100 | 3300046616 | Ga0495668_0000862 | Ga0495668_0000862_3579_4493 | 297 |
| 101 | 3300048911 | Ga0496108_0109721 | Ga0496108_0109721_1129_2043 | 297 |
| 102 | 3300048928 | Ga0496125_0057942 | Ga0496125_0057942_1568_2482 | 297 |
| 103 | 3300049573 | Ga0501037_0257192 | Ga0501037_0257192_123_1031 | 297 |
| 104 | 3300049581 | Ga0501047_0071854 | Ga0501047_0071854_1557_2471 | 297 |
| 105 | 3300049586 | Ga0501070_0113268 | Ga0501070_0113268_432_1346 | 297 |
| 106 | 3300050491 | nmdc:mga00v17_5963_c1 | nmdc:mga00v17_5963_c1_3138_4055 | 297 |
| 107 | 3300050491 | nmdc:mga00v17_61482_c1 | nmdc:mga00v17_61482_c1_1385_2293 | 297 |
| 108 | 3300054114 | Ga0501084_0081352 | Ga0501084_0081352_1731_2648 | 297 |
| 109 | iso_pu_bacteria | 2738543034 | 2739366353 | 297 |
| 110 | iso_pu_bacteria | 2744054611 | 2744956369 | 297 |
| 111 | iso_pu_bacteria | 8002392321 | 8002395379 | 297 |
| 112 | 3300003203 | JGI25406J46586_10006739 | JGI25406J46586_100067393 | 298 |
| 113 | 3300005329 | Ga0070683_100033202 | Ga0070683_1000332022 | 298 |
| 114 | 3300005455 | Ga0070663_100316966 | Ga0070663_1003169662 | 298 |
| 115 | 3300009093 | Ga0105240_10312736 | Ga0105240_103127362 | 298 |
| 116 | 3300009551 | Ga0105238_10343149 | Ga0105238_103431492 | 298 |
| 117 | 3300013104 | Ga0157370_10334804 | Ga0157370_103348042 | 298 |
| 118 | 3300013307 | Ga0157372_10043924 | Ga0157372_100439242 | 298 |
| 119 | 3300020069 | Ga0197907_10477761 | Ga0197907_104777612 | 298 |
| 120 | 3300020070 | Ga0206356_10088465 | Ga0206356_100884655 | 298 |
| 121 | 3300020081 | Ga0206354_10569538 | Ga0206354_105695384 | 298 |
| 122 | 3300020082 | Ga0206353_10019350 | Ga0206353_100193504 | 298 |
| 123 | 3300022467 | Ga0224712_10000628 | Ga0224712_100006282 | 298 |
| 124 | 3300025924 | Ga0207694_10205594 | Ga0207694_102055942 | 298 |
| 125 | 3300026067 | Ga0207678_10103601 | Ga0207678_101036011 | 298 |
| 126 | 3300028794 | Ga0307515_10270403 | Ga0307515_102704032 | 298 |
| 127 | 3300031251 | Ga0265327_10000912 | Ga0265327_100009123 | 298 |
| 128 | 3300038443 | Ga0395901_0000002 | Ga0395901_0000002_499010_499972 | 298 |
| 129 | 3300044693 | Ga0466961_0073873 | Ga0466961_0073873_460_1413 | 298 |
| 130 | 3300044842 | Ga0466957_0041886 | Ga0466957_0041886_1299_2261 | 298 |
| 131 | 3300045836 | Ga0466958_0124630 | Ga0466958_0124630_569_1531 | 298 |
| 132 | 3300046455 | Ga0495603_0100826 | Ga0495603_0100826_453_1412 | 298 |
| 133 | 3300046472 | Ga0495580_0041325 | Ga0495580_0041325_90_1079 | 298 |
| 134 | 3300046474 | Ga0495605_0055137 | Ga0495605_0055137_462_1451 | 298 |
| 135 | 3300046506 | Ga0495583_0041706 | Ga0495583_0041706_126_1085 | 298 |
| 136 | 3300046694 | Ga0495649_0202232 | Ga0495649_0202232_37_942 | 298 |
| 137 | 3300047319 | Ga0495674_0189999 | Ga0495674_0189999_696_1685 | 298 |
| 138 | 3300047323 | Ga0495683_0116746 | Ga0495683_0116746_191_1180 | 298 |
| 139 | 3300047443 | Ga0495687_053654 | Ga0495687_053654_392_1381 | 298 |
| 140 | 3300048903 | Ga0496100_0026798 | Ga0496100_0026798_1158_2147 | 298 |
| 141 | 3300048908 | Ga0496105_0031837 | Ga0496105_0031837_2205_3194 | 298 |
| 142 | 3300048916 | Ga0496113_0064624 | Ga0496113_0064624_420_1409 | 298 |
| 143 | 3300048918 | Ga0496115_0129129 | Ga0496115_0129129_452_1411 | 298 |
| 144 | 3300048924 | Ga0496121_0116924 | Ga0496121_0116924_263_1222 | 298 |
| 145 | 3300049460 | Ga0495682_0040226 | Ga0495682_0040226_387_1346 | 298 |
| 146 | 3300049582 | Ga0501048_0020992 | Ga0501048_0020992_3832_4731 | 298 |
| 147 | iso_pu_bacteria | 2643221687 | 2644490516 | 298 |
| 148 | iso_pu_bacteria | 2643221715 | 2644639235 | 298 |
| 149 | iso_pu_bacteria | 2738541274 | 2738702389 | 298 |
| 150 | iso_pu_bacteria | 2738543028 | 2739331644 | 298 |
| 151 | iso_pu_bacteria | 2751185725 | 2753037291 | 298 |
| 152 | iso_pu_bacteria | 2751185792 | 2753325160 | 298 |
| 153 | iso_pu_bacteria | 2842134933 | 2842135364 | 298 |
| 154 | iso_pu_bacteria | 2902810491 | 2902816065 | 298 |
| 155 | iso_pu_bacteria | 2902837492 | 2902839652 | 298 |
| 156 | iso_pu_bacteria | 2929212328 | 2929212911 | 298 |
| 157 | iso_pu_bacteria | 2974315732 | 2974316915 | 298 |
| 158 | iso_pu_bacteria | 2974315732 | 2974319087 | 298 |
| 159 | iso_pu_bacteria | 2984523437 | 2984525098 | 298 |
| 160 | 3300005366 | Ga0070659_100218123 | Ga0070659_1002181232 | 299 |
| 161 | 3300005435 | Ga0070714_100078214 | Ga0070714_1000782143 | 299 |
| 162 | 3300025932 | Ga0207690_10243462 | Ga0207690_102434621 | 299 |
| 163 | 3300026142 | Ga0207698_10115458 | Ga0207698_101154582 | 299 |
| 164 | 3300027907 | Ga0207428_10187595 | Ga0207428_101875952 | 299 |
| 165 | 3300041410 | Ga0439461_0000637 | Ga0439461_0000637_3088_4002 | 299 |
| 166 | 3300041411 | Ga0439466_0029769 | Ga0439466_0029769_89_1003 | 299 |
| 167 | 3300042004 | Ga0439445_0005881 | Ga0439445_0005881_1747_2661 | 299 |
| 168 | 3300044719 | Ga0466971_0018480 | Ga0466971_0018480_171_1091 | 299 |
| 169 | 3300050511 | nmdc:mga08y16_179786_c1 | nmdc:mga08y16_179786_c1_64_984 | 299 |
| 170 | 3300003792 | Ga0055540_1002158 | Ga0055540_10021587 | 300 |
| 171 | 3300003792 | Ga0055540_1003933 | Ga0055540_10039336 | 300 |
| 172 | 3300003792 | Ga0055540_1004158 | Ga0055540_10041585 | 300 |
| 173 | 3300005353 | Ga0070669_100000918 | Ga0070669_1000009187 | 300 |
| 174 | 3300005367 | Ga0070667_100000033 | Ga0070667_100000033128 | 300 |
| 175 | 3300005436 | Ga0070713_100091785 | Ga0070713_1000917852 | 300 |
| 176 | 3300005440 | Ga0070705_100328586 | Ga0070705_1003285861 | 300 |
| 177 | 3300005539 | Ga0068853_100426088 | Ga0068853_1004260882 | 300 |
| 178 | 3300005548 | Ga0070665_100034345 | Ga0070665_1000343453 | 300 |
| 179 | 3300005617 | Ga0068859_100000300 | Ga0068859_10000030012 | 300 |
| 180 | 3300005841 | Ga0068863_100003284 | Ga0068863_1000032849 | 300 |
| 181 | 3300005842 | Ga0068858_100015480 | Ga0068858_1000154802 | 300 |
| 182 | 3300005843 | Ga0068860_100000010 | Ga0068860_100000010131 | 300 |
| 183 | 3300005844 | Ga0068862_100000008 | Ga0068862_100000008194 | 300 |
| 184 | 3300005937 | Ga0081455_10049454 | Ga0081455_100494542 | 300 |
| 185 | 3300006028 | Ga0070717_10182747 | Ga0070717_101827472 | 300 |
| 186 | 3300006038 | Ga0075365_10008111 | Ga0075365_100081113 | 300 |
| 187 | 3300006048 | Ga0075363_100000999 | Ga0075363_1000009997 | 300 |
| 188 | 3300006048 | Ga0075363_100144439 | Ga0075363_1001444392 | 300 |
| 189 | 3300006051 | Ga0075364_10011101 | Ga0075364_100111015 | 300 |
| 190 | 3300006051 | Ga0075364_10070776 | Ga0075364_100707762 | 300 |
| 191 | 3300006051 | Ga0075364_10120684 | Ga0075364_101206842 | 300 |
| 192 | 3300006051 | Ga0075364_10241968 | Ga0075364_102419682 | 300 |
| 193 | 3300006178 | Ga0075367_10158497 | Ga0075367_101584972 | 300 |
| 194 | 3300006186 | Ga0075369_10002769 | Ga0075369_100027692 | 300 |
| 195 | 3300006186 | Ga0075369_10003013 | Ga0075369_100030132 | 300 |
| 196 | 3300006186 | Ga0075369_10007392 | Ga0075369_100073923 | 300 |
| 197 | 3300006186 | Ga0075369_10017850 | Ga0075369_100178502 | 300 |
| 198 | 3300006186 | Ga0075369_10033004 | Ga0075369_100330042 | 300 |
| 199 | 3300006353 | Ga0075370_10002984 | Ga0075370_100029847 | 300 |
| 200 | 3300006353 | Ga0075370_10014517 | Ga0075370_100145173 | 300 |
| 201 | 3300006353 | Ga0075370_10125557 | Ga0075370_101255572 | 300 |
| 202 | 3300006353 | Ga0075370_10127155 | Ga0075370_101271551 | 300 |
| 203 | 3300006931 | Ga0097620_100000300 | Ga0097620_10000030042 | 300 |
| 204 | 3300009093 | Ga0105240_10350170 | Ga0105240_103501702 | 300 |
| 205 | 3300009094 | Ga0111539_10314605 | Ga0111539_103146052 | 300 |
| 206 | 3300009098 | Ga0105245_10559017 | Ga0105245_105590171 | 300 |
| 207 | 3300009101 | Ga0105247_10000019 | Ga0105247_1000001965 | 300 |
| 208 | 3300009177 | Ga0105248_10000188 | Ga0105248_1000018862 | 300 |
| 209 | 3300009545 | Ga0105237_10038233 | Ga0105237_100382332 | 300 |
| 210 | 3300009553 | Ga0105249_10000019 | Ga0105249_10000019190 | 300 |
| 211 | 3300010375 | Ga0105239_10003372 | Ga0105239_100033725 | 300 |
| 212 | 3300011119 | Ga0105246_10334608 | Ga0105246_103346082 | 300 |
| 213 | 3300014325 | Ga0163163_10020081 | Ga0163163_100200812 | 300 |
| 214 | 3300025303 | Ga0209051_1000949 | Ga0209051_10009499 | 300 |
| 215 | 3300025303 | Ga0209051_1001572 | Ga0209051_10015725 | 300 |
| 216 | 3300025303 | Ga0209051_1002496 | Ga0209051_10024964 | 300 |
| 217 | 3300025900 | Ga0207710_10000036 | Ga0207710_10000036173 | 300 |
| 218 | 3300025901 | Ga0207688_10063138 | Ga0207688_100631382 | 300 |
| 219 | 3300025914 | Ga0207671_10007683 | Ga0207671_100076835 | 300 |
| 220 | 3300025923 | Ga0207681_10001678 | Ga0207681_100016782 | 300 |
| 221 | 3300025928 | Ga0207700_10163708 | Ga0207700_101637082 | 300 |
| 222 | 3300025941 | Ga0207711_10000168 | Ga0207711_100001689 | 300 |
| 223 | 3300025961 | Ga0207712_10000025 | Ga0207712_1000002561 | 300 |
| 224 | 3300025986 | Ga0207658_10000125 | Ga0207658_1000012559 | 300 |
| 225 | 3300026035 | Ga0207703_10338002 | Ga0207703_103380022 | 300 |
| 226 | 3300026041 | Ga0207639_10315708 | Ga0207639_103157082 | 300 |
| 227 | 3300026088 | Ga0207641_10008728 | Ga0207641_100087282 | 300 |
| 228 | 3300028380 | Ga0268265_10000007 | Ga0268265_10000007190 | 300 |
| 229 | 3300028381 | Ga0268264_10000007 | Ga0268264_10000007325 | 300 |
| 230 | 3300031901 | Ga0307406_10190487 | Ga0307406_101904872 | 300 |
| 231 | 3300041456 | Ga0451795_0520114 | Ga0451795_0520114_1815_2738 | 300 |
| 232 | 3300044658 | Ga0466972_0003097 | Ga0466972_0003097_4710_5621 | 300 |
| 233 | 3300044683 | Ga0466965_0013675 | Ga0466965_0013675_1201_2112 | 300 |
| 234 | 3300044735 | Ga0466968_0002961 | Ga0466968_0002961_5278_6189 | 300 |
| 235 | 3300044735 | Ga0466968_0014481 | Ga0466968_0014481_2111_3034 | 300 |
| 236 | 3300044765 | Ga0466970_0045943 | Ga0466970_0045943_924_1835 | 300 |
| 237 | 3300044842 | Ga0466957_0060335 | Ga0466957_0060335_491_1402 | 300 |
| 238 | 3300044901 | Ga0466960_0001119 | Ga0466960_0001119_8097_9008 | 300 |
| 239 | 3300045049 | Ga0466959_0025147 | Ga0466959_0025147_1765_2676 | 300 |
| 240 | 3300045976 | Ga0466967_0092019 | Ga0466967_0092019_1525_2445 | 300 |
| 241 | 3300046507 | Ga0495606_0067474 | Ga0495606_0067474_119_1039 | 300 |
| 242 | 3300046524 | Ga0495648_0002953 | Ga0495648_0002953_12960_13880 | 300 |
| 243 | 3300046530 | Ga0495654_0033335 | Ga0495654_0033335_987_1907 | 300 |
| 244 | 3300047469 | Ga0495673_0000588 | Ga0495673_0000588_33046_33966 | 300 |
| 245 | 3300047472 | Ga0495686_0002574 | Ga0495686_0002574_14092_15012 | 300 |
| 246 | 3300047472 | Ga0495686_0239910 | Ga0495686_0239910_66_992 | 300 |
| 247 | 3300048903 | Ga0496100_0000407 | Ga0496100_0000407_18334_19254 | 300 |
| 248 | 3300048903 | Ga0496100_0279764 | Ga0496100_0279764_65_988 | 300 |
| 249 | 3300048904 | Ga0496101_0000002 | Ga0496101_0000002_110583_111503 | 300 |
| 250 | 3300048905 | Ga0496102_0000009 | Ga0496102_0000009_180363_181283 | 300 |
| 251 | 3300048905 | Ga0496102_0000789 | Ga0496102_0000789_13246_14169 | 300 |
| 252 | 3300048905 | Ga0496102_0084417 | Ga0496102_0084417_1528_2448 | 300 |
| 253 | 3300048905 | Ga0496102_0286891 | Ga0496102_0286891_125_1048 | 300 |
| 254 | 3300048906 | Ga0496103_0000005 | Ga0496103_0000005_341630_342550 | 300 |
| 255 | 3300048906 | Ga0496103_0000409 | Ga0496103_0000409_11887_12810 | 300 |
| 256 | 3300048907 | Ga0496104_0481831 | Ga0496104_0481831_82_1020 | 300 |
| 257 | 3300048909 | Ga0496106_0014165 | Ga0496106_0014165_2843_3763 | 300 |
| 258 | 3300048909 | Ga0496106_0034334 | Ga0496106_0034334_2835_3758 | 300 |
| 259 | 3300048909 | Ga0496106_0211498 | Ga0496106_0211498_416_1339 | 300 |
| 260 | 3300048910 | Ga0496107_0013934 | Ga0496107_0013934_3818_4738 | 300 |
| 261 | 3300048916 | Ga0496113_0037510 | Ga0496113_0037510_1005_1952 | 300 |
| 262 | 3300048918 | Ga0496115_0259378 | Ga0496115_0259378_204_1127 | 300 |
| 263 | 3300048919 | Ga0496116_0000104 | Ga0496116_0000104_163028_163948 | 300 |
| 264 | 3300048919 | Ga0496116_0012030 | Ga0496116_0012030_3801_4724 | 300 |
| 265 | 3300048920 | Ga0496117_0000019 | Ga0496117_0000019_287974_288894 | 300 |
| 266 | 3300048920 | Ga0496117_0000564 | Ga0496117_0000564_28450_29373 | 300 |
| 267 | 3300048921 | Ga0496118_0000020 | Ga0496118_0000020_180363_181283 | 300 |
| 268 | 3300048921 | Ga0496118_0000279 | Ga0496118_0000279_3454_4377 | 300 |
| 269 | 3300048922 | Ga0496119_0003048 | Ga0496119_0003048_6162_7085 | 300 |
| 270 | 3300048922 | Ga0496119_0024348 | Ga0496119_0024348_3254_4174 | 300 |
| 271 | 3300048923 | Ga0496120_0009063 | Ga0496120_0009063_3370_4293 | 300 |
| 272 | 3300048923 | Ga0496120_0070350 | Ga0496120_0070350_397_1314 | 300 |
| 273 | 3300048924 | Ga0496121_0001252 | Ga0496121_0001252_26087_27007 | 300 |
| 274 | 3300048924 | Ga0496121_0004561 | Ga0496121_0004561_3671_4594 | 300 |
| 275 | 3300048925 | Ga0496122_0009690 | Ga0496122_0009690_8713_9660 | 300 |
| 276 | 3300048927 | Ga0496124_0208243 | Ga0496124_0208243_318_1241 | 300 |
| 277 | 3300048928 | Ga0496125_0038627 | Ga0496125_0038627_260_1183 | 300 |
| 278 | 3300048928 | Ga0496125_0101715 | Ga0496125_0101715_559_1485 | 300 |
| 279 | 3300048929 | Ga0496126_0000931 | Ga0496126_0000931_20056_20976 | 300 |
| 280 | 3300048929 | Ga0496126_0001999 | Ga0496126_0001999_1794_2717 | 300 |
| 281 | 3300048929 | Ga0496126_0002966 | Ga0496126_0002966_5844_6767 | 300 |
| 282 | 3300048929 | Ga0496126_0007614 | Ga0496126_0007614_6757_7674 | 300 |
| 283 | 3300048929 | Ga0496126_0034892 | Ga0496126_0034892_492_1418 | 300 |
| 284 | 3300050490 | nmdc:mga03n38_22112_c1 | nmdc:mga03n38_22112_c1_512_1423 | 300 |
| 285 | 3300050490 | nmdc:mga03n38_3035_c1 | nmdc:mga03n38_3035_c1_1910_2821 | 300 |
| 286 | 3300050491 | nmdc:mga00v17_11687_c1 | nmdc:mga00v17_11687_c1_2562_3485 | 300 |
| 287 | 3300050491 | nmdc:mga00v17_184386_c1 | nmdc:mga00v17_184386_c1_346_1269 | 300 |
| 288 | 3300050491 | nmdc:mga00v17_20770_c1 | nmdc:mga00v17_20770_c1_508_1419 | 300 |
| 289 | 3300050492 | nmdc:mga0yw44_17649_c1 | nmdc:mga0yw44_17649_c1_358_1269 | 300 |
| 290 | 3300050492 | nmdc:mga0yw44_35276_c1 | nmdc:mga0yw44_35276_c1_1536_2459 | 300 |
| 291 | 3300050493 | nmdc:mga0k408_63019_c1 | nmdc:mga0k408_63019_c1_998_1909 | 300 |
| 292 | 3300050494 | nmdc:mga06z11_5107_c1 | nmdc:mga06z11_5107_c1_2454_3365 | 300 |
| 293 | 3300050496 | nmdc:mga07m45_11196_c1 | nmdc:mga07m45_11196_c1_228_1139 | 300 |
| 294 | 3300050496 | nmdc:mga07m45_130583_c1 | nmdc:mga07m45_130583_c1_385_1296 | 300 |
| 295 | 3300050496 | nmdc:mga07m45_38628_c1 | nmdc:mga07m45_38628_c1_333_1244 | 300 |
| 296 | 3300050496 | nmdc:mga07m45_47188_c1 | nmdc:mga07m45_47188_c1_202_1113 | 300 |
| 297 | 3300050516 | nmdc:mga0sz30_14219_c1 | nmdc:mga0sz30_14219_c1_879_1799 | 300 |
| 298 | 3300050516 | nmdc:mga0sz30_30958_c1 | nmdc:mga0sz30_30958_c1_509_1432 | 300 |
| 299 | 3300050516 | nmdc:mga0sz30_3363_c1 | nmdc:mga0sz30_3363_c1_3757_4683 | 300 |
| 300 | 3300050516 | nmdc:mga0sz30_77251_c1 | nmdc:mga0sz30_77251_c1_265_1176 | 300 |
| 301 | 3300053080 | Ga0500635_0011115 | Ga0500635_0011115_331_1248 | 300 |
| 302 | 3300053087 | Ga0500643_005840 | Ga0500643_005840_2492_3412 | 300 |
| 303 | 3300053130 | Ga0500642_0109249 | Ga0500642_0109249_261_1184 | 300 |
| 304 | 3300053131 | Ga0500652_002449 | Ga0500652_002449_1138_2055 | 300 |
| 305 | 3300053153 | Ga0500616_0002716 | Ga0500616_0002716_10966_11886 | 300 |
| 306 | 3300053730 | Ga0500645_000023 | Ga0500645_000023_2878_3804 | 300 |
| 307 | 3300001991 | JGI24743J22301_10027850 | JGI24743J22301_100278502 | 301 |
| 308 | 3300002073 | JGI24745J21846_1001298 | JGI24745J21846_10012982 | 301 |
| 309 | 3300002075 | JGI24738J21930_10011412 | JGI24738J21930_100114122 | 301 |
| 310 | 3300002077 | JGI24744J21845_10006363 | JGI24744J21845_100063632 | 301 |
| 311 | 3300002077 | JGI24744J21845_10011916 | JGI24744J21845_100119162 | 301 |
| 312 | 3300002239 | JGI24034J26672_10003685 | JGI24034J26672_100036852 | 301 |
| 313 | 3300005328 | Ga0070676_10042659 | Ga0070676_100426592 | 301 |
| 314 | 3300005330 | Ga0070690_100106991 | Ga0070690_1001069912 | 301 |
| 315 | 3300005334 | Ga0068869_100033087 | Ga0068869_1000330872 | 301 |
| 316 | 3300005335 | Ga0070666_10011131 | Ga0070666_100111313 | 301 |
| 317 | 3300005337 | Ga0070682_100004029 | Ga0070682_1000040294 | 301 |
| 318 | 3300005337 | Ga0070682_100135875 | Ga0070682_1001358752 | 301 |
| 319 | 3300005338 | Ga0068868_100006676 | Ga0068868_1000066762 | 301 |
| 320 | 3300005338 | Ga0068868_100071887 | Ga0068868_1000718872 | 301 |
| 321 | 3300005340 | Ga0070689_100003095 | Ga0070689_1000030957 | 301 |
| 322 | 3300005341 | Ga0070691_10028379 | Ga0070691_100283793 | 301 |
| 323 | 3300005347 | Ga0070668_100003162 | Ga0070668_1000031624 | 301 |
| 324 | 3300005347 | Ga0070668_100029947 | Ga0070668_1000299473 | 301 |
| 325 | 3300005347 | Ga0070668_100066744 | Ga0070668_1000667442 | 301 |
| 326 | 3300005353 | Ga0070669_100002624 | Ga0070669_1000026243 | 301 |
| 327 | 3300005355 | Ga0070671_100119251 | Ga0070671_1001192512 | 301 |
| 328 | 3300005356 | Ga0070674_100004841 | Ga0070674_1000048414 | 301 |
| 329 | 3300005365 | Ga0070688_100021334 | Ga0070688_1000213342 | 301 |
| 330 | 3300005365 | Ga0070688_100055259 | Ga0070688_1000552592 | 301 |
| 331 | 3300005366 | Ga0070659_100022293 | Ga0070659_1000222934 | 301 |
| 332 | 3300005366 | Ga0070659_100237137 | Ga0070659_1002371372 | 301 |
| 333 | 3300005434 | Ga0070709_10001138 | Ga0070709_100011383 | 301 |
| 334 | 3300005434 | Ga0070709_10021799 | Ga0070709_100217991 | 301 |
| 335 | 3300005437 | Ga0070710_10003343 | Ga0070710_100033433 | 301 |
| 336 | 3300005438 | Ga0070701_10000574 | Ga0070701_100005747 | 301 |
| 337 | 3300005439 | Ga0070711_100001370 | Ga0070711_1000013707 | 301 |
| 338 | 3300005439 | Ga0070711_100018251 | Ga0070711_1000182513 | 301 |
| 339 | 3300005440 | Ga0070705_100007460 | Ga0070705_1000074603 | 301 |
| 340 | 3300005440 | Ga0070705_100108413 | Ga0070705_1001084132 | 301 |
| 341 | 3300005441 | Ga0070700_100040878 | Ga0070700_1000408782 | 301 |
| 342 | 3300005455 | Ga0070663_100058847 | Ga0070663_1000588472 | 301 |
| 343 | 3300005456 | Ga0070678_100003144 | Ga0070678_1000031447 | 301 |
| 344 | 3300005457 | Ga0070662_100002522 | Ga0070662_1000025224 | 301 |
| 345 | 3300005459 | Ga0068867_100002753 | Ga0068867_1000027539 | 301 |
| 346 | 3300005459 | Ga0068867_100073218 | Ga0068867_1000732182 | 301 |
| 347 | 3300005466 | Ga0070685_10077040 | Ga0070685_100770402 | 301 |
| 348 | 3300005539 | Ga0068853_100007969 | Ga0068853_1000079698 | 301 |
| 349 | 3300005543 | Ga0070672_100314505 | Ga0070672_1003145052 | 301 |
| 350 | 3300005544 | Ga0070686_100028584 | Ga0070686_1000285843 | 301 |
| 351 | 3300005545 | Ga0070695_100081041 | Ga0070695_1000810412 | 301 |
| 352 | 3300005546 | Ga0070696_100002819 | Ga0070696_1000028199 | 301 |
| 353 | 3300005546 | Ga0070696_100096529 | Ga0070696_1000965292 | 301 |
| 354 | 3300005547 | Ga0070693_100024104 | Ga0070693_1000241041 | 301 |
| 355 | 3300005548 | Ga0070665_100006270 | Ga0070665_1000062705 | 301 |
| 356 | 3300005548 | Ga0070665_100550018 | Ga0070665_1005500182 | 301 |
| 357 | 3300005549 | Ga0070704_100000324 | Ga0070704_1000003247 | 301 |
| 358 | 3300005578 | Ga0068854_100001503 | Ga0068854_10000150314 | 301 |
| 359 | 3300005615 | Ga0070702_100031367 | Ga0070702_1000313672 | 301 |
| 360 | 3300005615 | Ga0070702_100074665 | Ga0070702_1000746652 | 301 |
| 361 | 3300005617 | Ga0068859_100007033 | Ga0068859_1000070336 | 301 |
| 362 | 3300005718 | Ga0068866_10000937 | Ga0068866_100009374 | 301 |
| 363 | 3300005719 | Ga0068861_100006110 | Ga0068861_1000061102 | 301 |
| 364 | 3300005719 | Ga0068861_100074095 | Ga0068861_1000740952 | 301 |
| 365 | 3300005719 | Ga0068861_100586243 | Ga0068861_1005862431 | 301 |
| 366 | 3300005841 | Ga0068863_100170736 | Ga0068863_1001707362 | 301 |
| 367 | 3300005842 | Ga0068858_100007303 | Ga0068858_1000073036 | 301 |
| 368 | 3300005842 | Ga0068858_100046133 | Ga0068858_1000461332 | 301 |
| 369 | 3300005843 | Ga0068860_100006774 | Ga0068860_1000067746 | 301 |
| 370 | 3300005843 | Ga0068860_100600377 | Ga0068860_1006003772 | 301 |
| 371 | 3300005844 | Ga0068862_100000958 | Ga0068862_10000095815 | 301 |
| 372 | 3300006051 | Ga0075364_10005619 | Ga0075364_100056192 | 301 |
| 373 | 3300006163 | Ga0070715_10008709 | Ga0070715_100087093 | 301 |
| 374 | 3300006173 | Ga0070716_100006278 | Ga0070716_1000062784 | 301 |
| 375 | 3300006175 | Ga0070712_100002027 | Ga0070712_1000020274 | 301 |
| 376 | 3300006844 | Ga0075428_100000609 | Ga0075428_10000060917 | 301 |
| 377 | 3300006846 | Ga0075430_100003543 | Ga0075430_1000035434 | 301 |
| 378 | 3300006881 | Ga0068865_100002876 | Ga0068865_1000028769 | 301 |
| 379 | 3300006931 | Ga0097620_100007032 | Ga0097620_1000070325 | 301 |
| 380 | 3300009098 | Ga0105245_10035734 | Ga0105245_100357342 | 301 |
| 381 | 3300009098 | Ga0105245_10105760 | Ga0105245_101057603 | 301 |
| 382 | 3300009098 | Ga0105245_10355261 | Ga0105245_103552612 | 301 |
| 383 | 3300009101 | Ga0105247_10000265 | Ga0105247_1000026537 | 301 |
| 384 | 3300009101 | Ga0105247_10072375 | Ga0105247_100723752 | 301 |
| 385 | 3300009101 | Ga0105247_10194313 | Ga0105247_101943131 | 301 |
| 386 | 3300009147 | Ga0114129_10014863 | Ga0114129_100148635 | 301 |
| 387 | 3300009148 | Ga0105243_10001541 | Ga0105243_1000154117 | 301 |
| 388 | 3300009148 | Ga0105243_10176933 | Ga0105243_101769332 | 301 |
| 389 | 3300009176 | Ga0105242_10000329 | Ga0105242_100003299 | 301 |
| 390 | 3300009177 | Ga0105248_10006313 | Ga0105248_100063134 | 301 |
| 391 | 3300009545 | Ga0105237_10047948 | Ga0105237_100479483 | 301 |
| 392 | 3300009545 | Ga0105237_10347126 | Ga0105237_103471262 | 301 |
| 393 | 3300009553 | Ga0105249_10000892 | Ga0105249_1000089212 | 301 |
| 394 | 3300010375 | Ga0105239_10038691 | Ga0105239_100386915 | 301 |
| 395 | 3300010375 | Ga0105239_10247895 | Ga0105239_102478952 | 301 |
| 396 | 3300011119 | Ga0105246_10381369 | Ga0105246_103813692 | 301 |
| 397 | 3300013296 | Ga0157374_10082396 | Ga0157374_100823962 | 301 |
| 398 | 3300013296 | Ga0157374_10301541 | Ga0157374_103015412 | 301 |
| 399 | 3300013297 | Ga0157378_10000356 | Ga0157378_100003562 | 301 |
| 400 | 3300013306 | Ga0163162_10002067 | Ga0163162_100020675 | 301 |
| 401 | 3300013306 | Ga0163162_10025798 | Ga0163162_100257983 | 301 |
| 402 | 3300013307 | Ga0157372_10183567 | Ga0157372_101835672 | 301 |
| 403 | 3300013308 | Ga0157375_10000760 | Ga0157375_1000076014 | 301 |
| 404 | 3300014326 | Ga0157380_10142729 | Ga0157380_101427291 | 301 |
| 405 | 3300014745 | Ga0157377_10011682 | Ga0157377_100116824 | 301 |
| 406 | 3300014968 | Ga0157379_10019019 | Ga0157379_100190192 | 301 |
| 407 | 3300014969 | Ga0157376_10057926 | Ga0157376_100579262 | 301 |
| 408 | 3300017792 | Ga0163161_10018358 | Ga0163161_100183584 | 301 |
| 409 | 3300021388 | Ga0213875_10017345 | Ga0213875_100173452 | 301 |
| 410 | 3300025898 | Ga0207692_10024928 | Ga0207692_100249282 | 301 |
| 411 | 3300025899 | Ga0207642_10000917 | Ga0207642_100009176 | 301 |
| 412 | 3300025900 | Ga0207710_10009402 | Ga0207710_100094023 | 301 |
| 413 | 3300025900 | Ga0207710_10065713 | Ga0207710_100657132 | 301 |
| 414 | 3300025901 | Ga0207688_10000235 | Ga0207688_1000023514 | 301 |
| 415 | 3300025901 | Ga0207688_10007726 | Ga0207688_100077263 | 301 |
| 416 | 3300025905 | Ga0207685_10002069 | Ga0207685_100020692 | 301 |
| 417 | 3300025906 | Ga0207699_10095925 | Ga0207699_100959252 | 301 |
| 418 | 3300025907 | Ga0207645_10046109 | Ga0207645_100461092 | 301 |
| 419 | 3300025914 | Ga0207671_10066856 | Ga0207671_100668562 | 301 |
| 420 | 3300025915 | Ga0207693_10002003 | Ga0207693_100020034 | 301 |
| 421 | 3300025915 | Ga0207693_10005498 | Ga0207693_100054989 | 301 |
| 422 | 3300025916 | Ga0207663_10004168 | Ga0207663_100041683 | 301 |
| 423 | 3300025916 | Ga0207663_10016337 | Ga0207663_100163374 | 301 |
| 424 | 3300025927 | Ga0207687_10005938 | Ga0207687_100059384 | 301 |
| 425 | 3300025927 | Ga0207687_10038940 | Ga0207687_100389403 | 301 |
| 426 | 3300025927 | Ga0207687_10203978 | Ga0207687_102039782 | 301 |
| 427 | 3300025931 | Ga0207644_10096721 | Ga0207644_100967212 | 301 |
| 428 | 3300025931 | Ga0207644_10098165 | Ga0207644_100981652 | 301 |
| 429 | 3300025932 | Ga0207690_10034863 | Ga0207690_100348632 | 301 |
| 430 | 3300025932 | Ga0207690_10156355 | Ga0207690_101563552 | 301 |
| 431 | 3300025933 | Ga0207706_10025990 | Ga0207706_100259904 | 301 |
| 432 | 3300025934 | Ga0207686_10007174 | Ga0207686_100071744 | 301 |
| 433 | 3300025935 | Ga0207709_10001915 | Ga0207709_100019159 | 301 |
| 434 | 3300025935 | Ga0207709_10267877 | Ga0207709_102678772 | 301 |
| 435 | 3300025936 | Ga0207670_10033878 | Ga0207670_100338783 | 301 |
| 436 | 3300025937 | Ga0207669_10007348 | Ga0207669_100073483 | 301 |
| 437 | 3300025937 | Ga0207669_10129936 | Ga0207669_101299362 | 301 |
| 438 | 3300025937 | Ga0207669_10264946 | Ga0207669_102649462 | 301 |
| 439 | 3300025938 | Ga0207704_10001661 | Ga0207704_100016614 | 301 |
| 440 | 3300025938 | Ga0207704_10154761 | Ga0207704_101547612 | 301 |
| 441 | 3300025939 | Ga0207665_10001216 | Ga0207665_1000121616 | 301 |
| 442 | 3300025939 | Ga0207665_10005614 | Ga0207665_100056144 | 301 |
| 443 | 3300025941 | Ga0207711_10153261 | Ga0207711_101532612 | 301 |
| 444 | 3300025942 | Ga0207689_10016961 | Ga0207689_100169612 | 301 |
| 445 | 3300025961 | Ga0207712_10045018 | Ga0207712_100450182 | 301 |
| 446 | 3300025972 | Ga0207668_10003151 | Ga0207668_100031514 | 301 |
| 447 | 3300025972 | Ga0207668_10459913 | Ga0207668_104599132 | 301 |
| 448 | 3300025986 | Ga0207658_10021277 | Ga0207658_100212774 | 301 |
| 449 | 3300025986 | Ga0207658_10492061 | Ga0207658_104920611 | 301 |
| 450 | 3300026023 | Ga0207677_10025479 | Ga0207677_100254793 | 301 |
| 451 | 3300026035 | Ga0207703_10015805 | Ga0207703_100158054 | 301 |
| 452 | 3300026035 | Ga0207703_10049916 | Ga0207703_100499162 | 301 |
| 453 | 3300026041 | Ga0207639_10006832 | Ga0207639_100068327 | 301 |
| 454 | 3300026067 | Ga0207678_10130964 | Ga0207678_101309642 | 301 |
| 455 | 3300026075 | Ga0207708_10111897 | Ga0207708_101118972 | 301 |
| 456 | 3300026075 | Ga0207708_10115406 | Ga0207708_101154062 | 301 |
| 457 | 3300026088 | Ga0207641_10244993 | Ga0207641_102449932 | 301 |
| 458 | 3300026089 | Ga0207648_10003286 | Ga0207648_100032864 | 301 |
| 459 | 3300026089 | Ga0207648_10027517 | Ga0207648_100275172 | 301 |
| 460 | 3300026118 | Ga0207675_100000865 | Ga0207675_10000086516 | 301 |
| 461 | 3300026118 | Ga0207675_100113182 | Ga0207675_1001131822 | 301 |
| 462 | 3300026121 | Ga0207683_10000809 | Ga0207683_1000080915 | 301 |
| 463 | 3300026121 | Ga0207683_10012042 | Ga0207683_100120422 | 301 |
| 464 | 3300026121 | Ga0207683_10125346 | Ga0207683_101253462 | 301 |
| 465 | 3300028379 | Ga0268266_10014239 | Ga0268266_100142392 | 301 |
| 466 | 3300028379 | Ga0268266_10097931 | Ga0268266_100979313 | 301 |
| 467 | 3300028380 | Ga0268265_10005882 | Ga0268265_100058822 | 301 |
| 468 | 3300028380 | Ga0268265_10212831 | Ga0268265_102128312 | 301 |
| 469 | 3300028381 | Ga0268264_10061459 | Ga0268264_100614592 | 301 |
| 470 | 3300028381 | Ga0268264_10571864 | Ga0268264_105718642 | 301 |
| 471 | 3300031251 | Ga0265327_10000067 | Ga0265327_1000006754 | 301 |
| 472 | 3300031251 | Ga0265327_10076101 | Ga0265327_100761012 | 301 |
| 473 | 3300035112 | Ga0373932_0034757 | Ga0373932_0034757_153_1079 | 301 |
| 474 | 3300035121 | Ga0373960_0033547 | Ga0373960_0033547_52_978 | 301 |
| 475 | 3300035121 | Ga0373960_0040216 | Ga0373960_0040216_291_1217 | 301 |
| 476 | 3300035691 | Ga0373931_0067640 | Ga0373931_0067640_524_1450 | 301 |
| 477 | 3300037853 | Ga0436364_0584343 | Ga0436364_0584343_11936_12874 | 301 |
| 478 | 3300039437 | Ga0436365_0138647 | Ga0436365_0138647_686_1624 | 301 |
| 479 | 3300045976 | Ga0466967_0231633 | Ga0466967_0231633_792_1718 | 301 |
| 480 | 3300046531 | Ga0495665_0055755 | Ga0495665_0055755_554_1474 | 301 |
| 481 | 3300046674 | Ga0495588_0211725 | Ga0495588_0211725_91_1011 | 301 |
| 482 | 3300048903 | Ga0496100_0004953 | Ga0496100_0004953_42_968 | 301 |
| 483 | 3300048904 | Ga0496101_0000176 | Ga0496101_0000176_2416_3339 | 301 |
| 484 | 3300048904 | Ga0496101_0001680 | Ga0496101_0001680_6317_7243 | 301 |
| 485 | 3300048904 | Ga0496101_0023601 | Ga0496101_0023601_126_1052 | 301 |
| 486 | 3300048905 | Ga0496102_0003683 | Ga0496102_0003683_7889_8815 | 301 |
| 487 | 3300048906 | Ga0496103_0001002 | Ga0496103_0001002_13745_14671 | 301 |
| 488 | 3300048906 | Ga0496103_0049183 | Ga0496103_0049183_1323_2249 | 301 |
| 489 | 3300048906 | Ga0496103_0105600 | Ga0496103_0105600_416_1339 | 301 |
| 490 | 3300048907 | Ga0496104_0000793 | Ga0496104_0000793_23716_24639 | 301 |
| 491 | 3300048907 | Ga0496104_0286865 | Ga0496104_0286865_437_1363 | 301 |
| 492 | 3300048908 | Ga0496105_0006293 | Ga0496105_0006293_2436_3359 | 301 |
| 493 | 3300048908 | Ga0496105_0192050 | Ga0496105_0192050_671_1597 | 301 |
| 494 | 3300048909 | Ga0496106_0008413 | Ga0496106_0008413_1774_2700 | 301 |
| 495 | 3300048909 | Ga0496106_0024430 | Ga0496106_0024430_2552_3475 | 301 |
| 496 | 3300048909 | Ga0496106_0329581 | Ga0496106_0329581_27_953 | 301 |
| 497 | 3300048910 | Ga0496107_0007237 | Ga0496107_0007237_4868_5794 | 301 |
| 498 | 3300048910 | Ga0496107_0062523 | Ga0496107_0062523_546_1472 | 301 |
| 499 | 3300048911 | Ga0496108_0000189 | Ga0496108_0000189_24626_25552 | 301 |
| 500 | 3300048911 | Ga0496108_0045620 | Ga0496108_0045620_952_1875 | 301 |
| 501 | 3300048911 | Ga0496108_0066092 | Ga0496108_0066092_1937_2854 | 301 |
| 502 | 3300048912 | Ga0496109_0018882 | Ga0496109_0018882_1458_2384 | 301 |
| 503 | 3300048912 | Ga0496109_0404077 | Ga0496109_0404077_32_958 | 301 |
| 504 | 3300048914 | Ga0496111_0296354 | Ga0496111_0296354_56_982 | 301 |
| 505 | 3300048915 | Ga0496112_0046435 | Ga0496112_0046435_3322_4239 | 301 |
| 506 | 3300048915 | Ga0496112_0067772 | Ga0496112_0067772_1380_2306 | 301 |
| 507 | 3300048916 | Ga0496113_0430113 | Ga0496113_0430113_46_972 | 301 |
| 508 | 3300048917 | Ga0496114_0005432 | Ga0496114_0005432_4622_5548 | 301 |
| 509 | 3300048917 | Ga0496114_0009086 | Ga0496114_0009086_1990_2913 | 301 |
| 510 | 3300048918 | Ga0496115_0002308 | Ga0496115_0002308_7456_8382 | 301 |
| 511 | 3300048918 | Ga0496115_0039401 | Ga0496115_0039401_225_1148 | 301 |
| 512 | 3300048920 | Ga0496117_0158938 | Ga0496117_0158938_42_971 | 301 |
| 513 | 3300050507 | nmdc:mga05p37_79717_c1 | nmdc:mga05p37_79717_c1_1223_2140 | 301 |
| 514 | 3300050509 | nmdc:mga0qj67_35429_c1 | nmdc:mga0qj67_35429_c1_1734_2651 | 301 |
| 515 | iso_pu_bacteria | 2929212328 | 2929216969 | 301 |
| 516 | 3300005337 | Ga0070682_100053750 | Ga0070682_1000537503 | 302 |
| 517 | 3300005338 | Ga0068868_100089792 | Ga0068868_1000897921 | 302 |
| 518 | 3300005441 | Ga0070700_100302577 | Ga0070700_1003025772 | 302 |
| 519 | 3300005535 | Ga0070684_100176252 | Ga0070684_1001762522 | 302 |
| 520 | 3300005564 | Ga0070664_100306518 | Ga0070664_1003065182 | 302 |
| 521 | 3300006048 | Ga0075363_100007545 | Ga0075363_1000075453 | 302 |
| 522 | 3300009174 | Ga0105241_10425441 | Ga0105241_104254411 | 302 |
| 523 | 3300010375 | Ga0105239_10073218 | Ga0105239_100732184 | 302 |
| 524 | 3300025945 | Ga0207679_10251217 | Ga0207679_102512172 | 302 |
| 525 | 3300026118 | Ga0207675_100306160 | Ga0207675_1003061602 | 302 |
| 526 | 3300044656 | Ga0466969_0046993 | Ga0466969_0046993_269_1216 | 302 |
| 527 | 3300044684 | Ga0466966_0014538 | Ga0466966_0014538_1141_2088 | 302 |
| 528 | 3300044765 | Ga0466970_0170683 | Ga0466970_0170683_74_1021 | 302 |
| 529 | 3300044842 | Ga0466957_0007155 | Ga0466957_0007155_2474_3421 | 302 |
| 530 | 3300045836 | Ga0466958_0004750 | Ga0466958_0004750_2028_2975 | 302 |
| 531 | 3300048904 | Ga0496101_0267084 | Ga0496101_0267084_96_1025 | 302 |
| 532 | 3300048907 | Ga0496104_0128710 | Ga0496104_0128710_82_1011 | 302 |
| 533 | 3300048911 | Ga0496108_0007870 | Ga0496108_0007870_4626_5555 | 302 |
| 534 | 3300048912 | Ga0496109_0016750 | Ga0496109_0016750_5385_6314 | 302 |
| 535 | 3300048915 | Ga0496112_0022286 | Ga0496112_0022286_1305_2234 | 302 |
| 536 | 3300049569 | Ga0501032_0001262 | Ga0501032_0001262_19203_20123 | 302 |
| 537 | 3300049569 | Ga0501032_0119055 | Ga0501032_0119055_374_1345 | 302 |
| 538 | 3300049571 | Ga0501034_0005748 | Ga0501034_0005748_6299_7219 | 302 |
| 539 | 3300049572 | Ga0501036_0098794 | Ga0501036_0098794_199_1119 | 302 |
| 540 | 3300049573 | Ga0501037_0006541 | Ga0501037_0006541_7429_8349 | 302 |
| 541 | 3300049574 | Ga0501038_0008311 | Ga0501038_0008311_1481_2401 | 302 |
| 542 | 3300049575 | Ga0501039_0005085 | Ga0501039_0005085_1894_2814 | 302 |
| 543 | 3300049579 | Ga0501043_0004747 | Ga0501043_0004747_4684_5604 | 302 |
| 544 | 3300049583 | Ga0501067_0047620 | Ga0501067_0047620_799_1719 | 302 |
| 545 | 3300049586 | Ga0501070_0002972 | Ga0501070_0002972_8127_9047 | 302 |
| 546 | 3300049823 | Ga0501044_0221545 | Ga0501044_0221545_194_1114 | 302 |
| 547 | 3300050490 | nmdc:mga03n38_3572_c1 | nmdc:mga03n38_3572_c1_2887_3816 | 302 |
| 548 | 3300005548 | Ga0070665_100002721 | Ga0070665_1000027217 | 303 |
| 549 | 3300028379 | Ga0268266_10001219 | Ga0268266_1000121913 | 303 |
| 550 | 3300036647 | Ga0316582_0157152 | Ga0316582_0157152_242_1159 | 303 |
| 551 | 3300048903 | Ga0496100_0020227 | Ga0496100_0020227_696_1616 | 303 |
| 552 | 3300048904 | Ga0496101_0111983 | Ga0496101_0111983_516_1436 | 303 |
| 553 | 3300048906 | Ga0496103_0058278 | Ga0496103_0058278_374_1294 | 303 |
| 554 | 3300048907 | Ga0496104_0173589 | Ga0496104_0173589_329_1249 | 303 |
| 555 | 3300048909 | Ga0496106_0221087 | Ga0496106_0221087_391_1311 | 303 |
| 556 | 3300048910 | Ga0496107_0109264 | Ga0496107_0109264_461_1381 | 303 |
| 557 | 3300048911 | Ga0496108_0080026 | Ga0496108_0080026_636_1556 | 303 |
| 558 | 3300048912 | Ga0496109_0064985 | Ga0496109_0064985_1017_1937 | 303 |
| 559 | 3300048917 | Ga0496114_0014343 | Ga0496114_0014343_4495_5415 | 303 |
| 560 | 3300048917 | Ga0496114_0015198 | Ga0496114_0015198_1336_2256 | 303 |
| 561 | 3300049590 | Ga0501074_0039655 | Ga0501074_0039655_2279_3295 | 303 |
| 562 | 3300053085 | Ga0495619_0054648 | Ga0495619_0054648_1144_2064 | 303 |
| 563 | 3300005336 | Ga0070680_100263000 | Ga0070680_1002630002 | 304 |
| 564 | 3300025901 | Ga0207688_10121521 | Ga0207688_101215212 | 304 |
| 565 | 3300025927 | Ga0207687_10351506 | Ga0207687_103515062 | 304 |
| 566 | 3300026041 | Ga0207639_10276005 | Ga0207639_102760051 | 304 |
| 567 | 3300026095 | Ga0207676_10286784 | Ga0207676_102867842 | 304 |
| 568 | 3300045976 | Ga0466967_0026122 | Ga0466967_0026122_3483_4445 | 304 |
| 569 | 3300046455 | Ga0495603_0056436 | Ga0495603_0056436_401_1324 | 304 |
| 570 | 3300046683 | Ga0495658_0059303 | Ga0495658_0059303_414_1337 | 304 |
| 571 | iso_pu_bacteria | 2939582691 | 2939584176 | 304 |
| 572 | 3300039450 | Ga0436363_1679774 | Ga0436363_1679774_4709_5632 | 305 |
| 573 | 3300048906 | Ga0496103_0273533 | Ga0496103_0273533_81_998 | 305 |
| 574 | 3300048910 | Ga0496107_0008199 | Ga0496107_0008199_1787_2713 | 305 |
| 575 | iso_pu_bacteria | 2643221687 | 2644491099 | 305 |
| 576 | iso_pu_bacteria | 2643221715 | 2644634531 | 305 |
| 577 | iso_pu_bacteria | 2902792274 | 2902792685 | 305 |
| 578 | iso_pu_bacteria | 2902810491 | 2902816749 | 305 |
| 579 | iso_pu_bacteria | 2902837492 | 2902843746 | 305 |
| 580 | 3300005435 | Ga0070714_100715552 | Ga0070714_1007155521 | 306 |
| 581 | 3300031852 | Ga0307410_10010477 | Ga0307410_100104772 | 306 |
| 582 | 3300039437 | Ga0436365_1305970 | Ga0436365_1305970_4708_5637 | 306 |
| 583 | 3300044694 | Ga0466963_0005748 | Ga0466963_0005748_1247_2176 | 306 |
| 584 | 3300044694 | Ga0466963_0104906 | Ga0466963_0104906_787_1716 | 306 |
| 585 | 3300044842 | Ga0466957_0020206 | Ga0466957_0020206_1021_1950 | 306 |
| 586 | 3300044901 | Ga0466960_0010770 | Ga0466960_0010770_2065_2994 | 306 |
| 587 | 3300045976 | Ga0466967_0001551 | Ga0466967_0001551_11271_12200 | 306 |
| 588 | 3300045976 | Ga0466967_0076412 | Ga0466967_0076412_846_1775 | 306 |
| 589 | 3300049569 | Ga0501032_0004982 | Ga0501032_0004982_4949_5878 | 306 |
| 590 | 3300049570 | Ga0501033_0024034 | Ga0501033_0024034_743_1672 | 306 |
| 591 | 3300049571 | Ga0501034_0005877 | Ga0501034_0005877_5991_6920 | 306 |
| 592 | 3300049573 | Ga0501037_0001928 | Ga0501037_0001928_3665_4594 | 306 |
| 593 | 3300049580 | Ga0501046_0004073 | Ga0501046_0004073_12011_12940 | 306 |
| 594 | 3300049581 | Ga0501047_0006308 | Ga0501047_0006308_6522_7451 | 306 |
| 595 | 3300049585 | Ga0501069_0266296 | Ga0501069_0266296_12_950 | 306 |
| 596 | 3300049586 | Ga0501070_0002057 | Ga0501070_0002057_11759_12688 | 306 |
| 597 | 3300049744 | Ga0501083_0060642 | Ga0501083_0060642_333_1262 | 306 |
| 598 | 3300049823 | Ga0501044_0001382 | Ga0501044_0001382_20253_21182 | 306 |
| 599 | 3300053080 | Ga0500635_0002098 | Ga0500635_0002098_722_1651 | 306 |
| 600 | 3300060353 | Ga0501082_0383102 | Ga0501082_0383102_15_944 | 306 |
| 601 | 3300005355 | Ga0070671_100008676 | Ga0070671_1000086761 | 307 |
| 602 | 3300005367 | Ga0070667_100010764 | Ga0070667_1000107645 | 307 |
| 603 | 3300005548 | Ga0070665_100002910 | Ga0070665_10000291014 | 307 |
| 604 | 3300005841 | Ga0068863_100049338 | Ga0068863_1000493382 | 307 |
| 605 | 3300005981 | Ga0081538_10053133 | Ga0081538_100531332 | 307 |
| 606 | 3300006038 | Ga0075365_10021929 | Ga0075365_100219292 | 307 |
| 607 | 3300006038 | Ga0075365_10094207 | Ga0075365_100942071 | 307 |
| 608 | 3300006038 | Ga0075365_10119641 | Ga0075365_101196412 | 307 |
| 609 | 3300006038 | Ga0075365_10197090 | Ga0075365_101970902 | 307 |
| 610 | 3300006048 | Ga0075363_100002029 | Ga0075363_1000020293 | 307 |
| 611 | 3300006048 | Ga0075363_100021077 | Ga0075363_1000210772 | 307 |
| 612 | 3300006048 | Ga0075363_100033998 | Ga0075363_1000339983 | 307 |
| 613 | 3300006051 | Ga0075364_10006900 | Ga0075364_100069007 | 307 |
| 614 | 3300006051 | Ga0075364_10154487 | Ga0075364_101544872 | 307 |
| 615 | 3300006051 | Ga0075364_10311812 | Ga0075364_103118121 | 307 |
| 616 | 3300006178 | Ga0075367_10097939 | Ga0075367_100979392 | 307 |
| 617 | 3300006186 | Ga0075369_10038362 | Ga0075369_100383622 | 307 |
| 618 | 3300006186 | Ga0075369_10065419 | Ga0075369_100654191 | 307 |
| 619 | 3300006353 | Ga0075370_10031123 | Ga0075370_100311233 | 307 |
| 620 | 3300006353 | Ga0075370_10107482 | Ga0075370_101074821 | 307 |
| 621 | 3300009147 | Ga0114129_10804511 | Ga0114129_108045111 | 307 |
| 622 | 3300011119 | Ga0105246_10063567 | Ga0105246_100635672 | 307 |
| 623 | 3300026088 | Ga0207641_10054108 | Ga0207641_100541082 | 307 |
| 624 | 3300028379 | Ga0268266_10002719 | Ga0268266_1000271914 | 307 |
| 625 | 3300028381 | Ga0268264_10154549 | Ga0268264_101545492 | 307 |
| 626 | 3300032002 | Ga0307416_100085071 | Ga0307416_1000850711 | 307 |
| 627 | 3300032005 | Ga0307411_10024307 | Ga0307411_100243073 | 307 |
| 628 | 3300032126 | Ga0307415_100024393 | Ga0307415_1000243933 | 307 |
| 629 | 3300037853 | Ga0436364_0724530 | Ga0436364_0724530_18064_19044 | 307 |
| 630 | 3300039437 | Ga0436365_1936517 | Ga0436365_1936517_16460_17389 | 307 |
| 631 | 3300041997 | Ga0439431_0046609 | Ga0439431_0046609_24_947 | 307 |
| 632 | 3300042004 | Ga0439445_0026394 | Ga0439445_0026394_471_1394 | 307 |
| 633 | 3300042435 | Ga0439434_0004220 | Ga0439434_0004220_935_1858 | 307 |
| 634 | 3300044684 | Ga0466966_0076843 | Ga0466966_0076843_262_1191 | 307 |
| 635 | 3300044693 | Ga0466961_0079250 | Ga0466961_0079250_318_1247 | 307 |
| 636 | 3300044694 | Ga0466963_0292522 | Ga0466963_0292522_53_976 | 307 |
| 637 | 3300044735 | Ga0466968_0030687 | Ga0466968_0030687_732_1661 | 307 |
| 638 | 3300044735 | Ga0466968_0061450 | Ga0466968_0061450_283_1206 | 307 |
| 639 | 3300045836 | Ga0466958_0002652 | Ga0466958_0002652_1491_2420 | 307 |
| 640 | 3300045976 | Ga0466967_0074046 | Ga0466967_0074046_1113_2036 | 307 |
| 641 | 3300045976 | Ga0466967_0386777 | Ga0466967_0386777_419_1342 | 307 |
| 642 | 3300048904 | Ga0496101_0234141 | Ga0496101_0234141_433_1356 | 307 |
| 643 | 3300048905 | Ga0496102_0003406 | Ga0496102_0003406_10719_11642 | 307 |
| 644 | 3300048905 | Ga0496102_0078577 | Ga0496102_0078577_1693_2622 | 307 |
| 645 | 3300048905 | Ga0496102_0138452 | Ga0496102_0138452_643_1566 | 307 |
| 646 | 3300048911 | Ga0496108_0121305 | Ga0496108_0121305_922_1845 | 307 |
| 647 | 3300048912 | Ga0496109_0198274 | Ga0496109_0198274_704_1627 | 307 |
| 648 | 3300048915 | Ga0496112_0012600 | Ga0496112_0012600_1825_2748 | 307 |
| 649 | 3300048916 | Ga0496113_0148150 | Ga0496113_0148150_183_1106 | 307 |
| 650 | 3300048917 | Ga0496114_0440135 | Ga0496114_0440135_61_984 | 307 |
| 651 | 3300048921 | Ga0496118_0000609 | Ga0496118_0000609_44821_45750 | 307 |
| 652 | 3300048924 | Ga0496121_0247536 | Ga0496121_0247536_149_1072 | 307 |
| 653 | 3300048929 | Ga0496126_0004965 | Ga0496126_0004965_7442_8422 | 307 |
| 654 | 3300049571 | Ga0501034_0218066 | Ga0501034_0218066_888_1811 | 307 |
| 655 | 3300049822 | Ga0501035_0168690 | Ga0501035_0168690_154_1083 | 307 |
| 656 | 3300050489 | nmdc:mga03683_39082_c1 | nmdc:mga03683_39082_c1_938_1864 | 307 |
| 657 | 3300050490 | nmdc:mga03n38_21862_c1 | nmdc:mga03n38_21862_c1_288_1217 | 307 |
| 658 | 3300050490 | nmdc:mga03n38_29355_c1 | nmdc:mga03n38_29355_c1_532_1455 | 307 |
| 659 | 3300050490 | nmdc:mga03n38_42458_c1 | nmdc:mga03n38_42458_c1_635_1564 | 307 |
| 660 | 3300050490 | nmdc:mga03n38_6016_c1 | nmdc:mga03n38_6016_c1_2865_3845 | 307 |
| 661 | 3300050490 | nmdc:mga03n38_7837_c1 | nmdc:mga03n38_7837_c1_2486_3409 | 307 |
| 662 | 3300050491 | nmdc:mga00v17_31326_c1 | nmdc:mga00v17_31326_c1_1929_2858 | 307 |
| 663 | 3300050491 | nmdc:mga00v17_31428_c1 | nmdc:mga00v17_31428_c1_67_993 | 307 |
| 664 | 3300050491 | nmdc:mga00v17_43540_c1 | nmdc:mga00v17_43540_c1_935_1858 | 307 |
| 665 | 3300050491 | nmdc:mga00v17_93203_c1 | nmdc:mga00v17_93203_c1_183_1163 | 307 |
| 666 | 3300050492 | nmdc:mga0yw44_176404_c1 | nmdc:mga0yw44_176404_c1_423_1352 | 307 |
| 667 | 3300050492 | nmdc:mga0yw44_5500_c1 | nmdc:mga0yw44_5500_c1_3283_4209 | 307 |
| 668 | 3300050492 | nmdc:mga0yw44_78080_c1 | nmdc:mga0yw44_78080_c1_224_1147 | 307 |
| 669 | 3300050496 | nmdc:mga07m45_10817_c2 | nmdc:mga07m45_10817_c2_2766_3689 | 307 |
| 670 | 3300050516 | nmdc:mga0sz30_17835_c1 | nmdc:mga0sz30_17835_c1_139_1062 | 307 |
| 671 | 3300001989 | JGI24739J22299_10030285 | JGI24739J22299_100302852 | 308 |
| 672 | 3300002075 | JGI24738J21930_10028872 | JGI24738J21930_100288721 | 308 |
| 673 | 3300002077 | JGI24744J21845_10012948 | JGI24744J21845_100129481 | 308 |
| 674 | 3300002244 | JGI24742J22300_10003451 | JGI24742J22300_100034512 | 308 |
| 675 | 3300005330 | Ga0070690_100032667 | Ga0070690_1000326671 | 308 |
| 676 | 3300005334 | Ga0068869_100004264 | Ga0068869_1000042644 | 308 |
| 677 | 3300005334 | Ga0068869_100123533 | Ga0068869_1001235332 | 308 |
| 678 | 3300005335 | Ga0070666_10007434 | Ga0070666_100074345 | 308 |
| 679 | 3300005336 | Ga0070680_100078971 | Ga0070680_1000789712 | 308 |
| 680 | 3300005337 | Ga0070682_100008585 | Ga0070682_1000085852 | 308 |
| 681 | 3300005338 | Ga0068868_100001267 | Ga0068868_10000126719 | 308 |
| 682 | 3300005338 | Ga0068868_100017252 | Ga0068868_1000172524 | 308 |
| 683 | 3300005340 | Ga0070689_100068048 | Ga0070689_1000680482 | 308 |
| 684 | 3300005341 | Ga0070691_10001945 | Ga0070691_100019455 | 308 |
| 685 | 3300005343 | Ga0070687_100024588 | Ga0070687_1000245882 | 308 |
| 686 | 3300005347 | Ga0070668_100034759 | Ga0070668_1000347593 | 308 |
| 687 | 3300005356 | Ga0070674_100070662 | Ga0070674_1000706622 | 308 |
| 688 | 3300005356 | Ga0070674_100086627 | Ga0070674_1000866272 | 308 |
| 689 | 3300005365 | Ga0070688_100008911 | Ga0070688_1000089115 | 308 |
| 690 | 3300005366 | Ga0070659_100090496 | Ga0070659_1000904963 | 308 |
| 691 | 3300005366 | Ga0070659_100337250 | Ga0070659_1003372501 | 308 |
| 692 | 3300005367 | Ga0070667_100003398 | Ga0070667_1000033983 | 308 |
| 693 | 3300005434 | Ga0070709_10002108 | Ga0070709_100021081 | 308 |
| 694 | 3300005437 | Ga0070710_10023520 | Ga0070710_100235202 | 308 |
| 695 | 3300005438 | Ga0070701_10000460 | Ga0070701_1000046016 | 308 |
| 696 | 3300005438 | Ga0070701_10062632 | Ga0070701_100626321 | 308 |
| 697 | 3300005439 | Ga0070711_100002323 | Ga0070711_1000023237 | 308 |
| 698 | 3300005439 | Ga0070711_100055304 | Ga0070711_1000553042 | 308 |
| 699 | 3300005440 | Ga0070705_100005812 | Ga0070705_1000058123 | 308 |
| 700 | 3300005440 | Ga0070705_100166087 | Ga0070705_1001660872 | 308 |
| 701 | 3300005441 | Ga0070700_100007425 | Ga0070700_1000074255 | 308 |
| 702 | 3300005441 | Ga0070700_100092465 | Ga0070700_1000924652 | 308 |
| 703 | 3300005444 | Ga0070694_100004527 | Ga0070694_1000045273 | 308 |
| 704 | 3300005455 | Ga0070663_100013531 | Ga0070663_1000135311 | 308 |
| 705 | 3300005456 | Ga0070678_100046533 | Ga0070678_1000465332 | 308 |
| 706 | 3300005457 | Ga0070662_100026632 | Ga0070662_1000266322 | 308 |
| 707 | 3300005457 | Ga0070662_100276979 | Ga0070662_1002769791 | 308 |
| 708 | 3300005459 | Ga0068867_100004361 | Ga0068867_1000043614 | 308 |
| 709 | 3300005536 | Ga0070697_100349457 | Ga0070697_1003494572 | 308 |
| 710 | 3300005539 | Ga0068853_100016526 | Ga0068853_1000165265 | 308 |
| 711 | 3300005539 | Ga0068853_100241552 | Ga0068853_1002415522 | 308 |
| 712 | 3300005543 | Ga0070672_100171258 | Ga0070672_1001712583 | 308 |
| 713 | 3300005544 | Ga0070686_100144414 | Ga0070686_1001444142 | 308 |
| 714 | 3300005545 | Ga0070695_100016576 | Ga0070695_1000165762 | 308 |
| 715 | 3300005545 | Ga0070695_100215410 | Ga0070695_1002154101 | 308 |
| 716 | 3300005546 | Ga0070696_100041777 | Ga0070696_1000417772 | 308 |
| 717 | 3300005547 | Ga0070693_100058270 | Ga0070693_1000582702 | 308 |
| 718 | 3300005547 | Ga0070693_100084523 | Ga0070693_1000845232 | 308 |
| 719 | 3300005548 | Ga0070665_100067775 | Ga0070665_1000677753 | 308 |
| 720 | 3300005549 | Ga0070704_100009039 | Ga0070704_1000090394 | 308 |
| 721 | 3300005578 | Ga0068854_100001133 | Ga0068854_1000011333 | 308 |
| 722 | 3300005578 | Ga0068854_100076388 | Ga0068854_1000763882 | 308 |
| 723 | 3300005615 | Ga0070702_100001907 | Ga0070702_1000019074 | 308 |
| 724 | 3300005615 | Ga0070702_100167430 | Ga0070702_1001674301 | 308 |
| 725 | 3300005616 | Ga0068852_100155361 | Ga0068852_1001553612 | 308 |
| 726 | 3300005617 | Ga0068859_100001798 | Ga0068859_10000179816 | 308 |
| 727 | 3300005718 | Ga0068866_10009714 | Ga0068866_100097143 | 308 |
| 728 | 3300005719 | Ga0068861_100000649 | Ga0068861_1000006499 | 308 |
| 729 | 3300005719 | Ga0068861_100015616 | Ga0068861_1000156165 | 308 |
| 730 | 3300005842 | Ga0068858_100001026 | Ga0068858_10000102631 | 308 |
| 731 | 3300005843 | Ga0068860_100003057 | Ga0068860_1000030575 | 308 |
| 732 | 3300006048 | Ga0075363_100022089 | Ga0075363_1000220892 | 308 |
| 733 | 3300006051 | Ga0075364_10009026 | Ga0075364_100090265 | 308 |
| 734 | 3300006163 | Ga0070715_10005624 | Ga0070715_100056241 | 308 |
| 735 | 3300006163 | Ga0070715_10016832 | Ga0070715_100168321 | 308 |
| 736 | 3300006173 | Ga0070716_100002154 | Ga0070716_1000021544 | 308 |
| 737 | 3300006173 | Ga0070716_100007540 | Ga0070716_1000075405 | 308 |
| 738 | 3300006175 | Ga0070712_100000675 | Ga0070712_10000067520 | 308 |
| 739 | 3300006175 | Ga0070712_100023582 | Ga0070712_1000235825 | 308 |
| 740 | 3300006177 | Ga0075362_10066951 | Ga0075362_100669512 | 308 |
| 741 | 3300006178 | Ga0075367_10153107 | Ga0075367_101531072 | 308 |
| 742 | 3300006186 | Ga0075369_10000666 | Ga0075369_100006667 | 308 |
| 743 | 3300006186 | Ga0075369_10009178 | Ga0075369_100091782 | 308 |
| 744 | 3300006844 | Ga0075428_100003982 | Ga0075428_1000039827 | 308 |
| 745 | 3300006846 | Ga0075430_100043225 | Ga0075430_1000432253 | 308 |
| 746 | 3300006847 | Ga0075431_100013631 | Ga0075431_1000136314 | 308 |
| 747 | 3300006881 | Ga0068865_100000988 | Ga0068865_1000009889 | 308 |
| 748 | 3300006931 | Ga0097620_100001798 | Ga0097620_10000179816 | 308 |
| 749 | 3300009098 | Ga0105245_10072200 | Ga0105245_100722002 | 308 |
| 750 | 3300009101 | Ga0105247_10000517 | Ga0105247_1000051735 | 308 |
| 751 | 3300009147 | Ga0114129_10006162 | Ga0114129_100061628 | 308 |
| 752 | 3300009148 | Ga0105243_10004543 | Ga0105243_100045434 | 308 |
| 753 | 3300009174 | Ga0105241_10049089 | Ga0105241_100490892 | 308 |
| 754 | 3300009176 | Ga0105242_10002252 | Ga0105242_100022522 | 308 |
| 755 | 3300009177 | Ga0105248_10065705 | Ga0105248_100657053 | 308 |
| 756 | 3300009551 | Ga0105238_10391130 | Ga0105238_103911302 | 308 |
| 757 | 3300009553 | Ga0105249_10010119 | Ga0105249_100101197 | 308 |
| 758 | 3300013105 | Ga0157369_10520420 | Ga0157369_105204201 | 308 |
| 759 | 3300013296 | Ga0157374_10348673 | Ga0157374_103486732 | 308 |
| 760 | 3300013297 | Ga0157378_10003135 | Ga0157378_1000313512 | 308 |
| 761 | 3300013306 | Ga0163162_10305174 | Ga0163162_103051742 | 308 |
| 762 | 3300013307 | Ga0157372_10059963 | Ga0157372_100599633 | 308 |
| 763 | 3300013307 | Ga0157372_10110237 | Ga0157372_101102371 | 308 |
| 764 | 3300013308 | Ga0157375_10009045 | Ga0157375_100090455 | 308 |
| 765 | 3300013308 | Ga0157375_10068732 | Ga0157375_100687323 | 308 |
| 766 | 3300014326 | Ga0157380_10001266 | Ga0157380_100012663 | 308 |
| 767 | 3300014968 | Ga0157379_10004806 | Ga0157379_100048065 | 308 |
| 768 | 3300014969 | Ga0157376_10426916 | Ga0157376_104269161 | 308 |
| 769 | 3300017792 | Ga0163161_10000976 | Ga0163161_1000097619 | 308 |
| 770 | 3300021388 | Ga0213875_10084560 | Ga0213875_100845601 | 308 |
| 771 | 3300025898 | Ga0207692_10024473 | Ga0207692_100244732 | 308 |
| 772 | 3300025899 | Ga0207642_10000822 | Ga0207642_1000082211 | 308 |
| 773 | 3300025900 | Ga0207710_10002308 | Ga0207710_100023088 | 308 |
| 774 | 3300025900 | Ga0207710_10017219 | Ga0207710_100172191 | 308 |
| 775 | 3300025901 | Ga0207688_10004987 | Ga0207688_100049877 | 308 |
| 776 | 3300025901 | Ga0207688_10020294 | Ga0207688_100202942 | 308 |
| 777 | 3300025903 | Ga0207680_10049693 | Ga0207680_100496932 | 308 |
| 778 | 3300025905 | Ga0207685_10055002 | Ga0207685_100550022 | 308 |
| 779 | 3300025905 | Ga0207685_10116243 | Ga0207685_101162431 | 308 |
| 780 | 3300025907 | Ga0207645_10117281 | Ga0207645_101172813 | 308 |
| 781 | 3300025911 | Ga0207654_10008666 | Ga0207654_100086664 | 308 |
| 782 | 3300025915 | Ga0207693_10003680 | Ga0207693_100036807 | 308 |
| 783 | 3300025915 | Ga0207693_10015601 | Ga0207693_100156017 | 308 |
| 784 | 3300025916 | Ga0207663_10081293 | Ga0207663_100812933 | 308 |
| 785 | 3300025917 | Ga0207660_10057200 | Ga0207660_100572002 | 308 |
| 786 | 3300025918 | Ga0207662_10031960 | Ga0207662_100319603 | 308 |
| 787 | 3300025923 | Ga0207681_10038325 | Ga0207681_100383253 | 308 |
| 788 | 3300025923 | Ga0207681_10169826 | Ga0207681_101698262 | 308 |
| 789 | 3300025924 | Ga0207694_10491922 | Ga0207694_104919221 | 308 |
| 790 | 3300025926 | Ga0207659_10068415 | Ga0207659_100684153 | 308 |
| 791 | 3300025927 | Ga0207687_10008539 | Ga0207687_100085393 | 308 |
| 792 | 3300025927 | Ga0207687_10073145 | Ga0207687_100731452 | 308 |
| 793 | 3300025932 | Ga0207690_10064081 | Ga0207690_100640813 | 308 |
| 794 | 3300025933 | Ga0207706_10042550 | Ga0207706_100425502 | 308 |
| 795 | 3300025933 | Ga0207706_10061444 | Ga0207706_100614441 | 308 |
| 796 | 3300025934 | Ga0207686_10056106 | Ga0207686_100561062 | 308 |
| 797 | 3300025935 | Ga0207709_10069321 | Ga0207709_100693212 | 308 |
| 798 | 3300025936 | Ga0207670_10123513 | Ga0207670_101235132 | 308 |
| 799 | 3300025937 | Ga0207669_10001222 | Ga0207669_1000122212 | 308 |
| 800 | 3300025938 | Ga0207704_10057576 | Ga0207704_100575762 | 308 |
| 801 | 3300025939 | Ga0207665_10024589 | Ga0207665_100245894 | 308 |
| 802 | 3300025940 | Ga0207691_10244670 | Ga0207691_102446702 | 308 |
| 803 | 3300025940 | Ga0207691_10286947 | Ga0207691_102869471 | 308 |
| 804 | 3300025941 | Ga0207711_10044387 | Ga0207711_100443873 | 308 |
| 805 | 3300025942 | Ga0207689_10070988 | Ga0207689_100709882 | 308 |
| 806 | 3300025961 | Ga0207712_10020672 | Ga0207712_100206723 | 308 |
| 807 | 3300025972 | Ga0207668_10445829 | Ga0207668_104458291 | 308 |
| 808 | 3300025972 | Ga0207668_10542169 | Ga0207668_105421691 | 308 |
| 809 | 3300025981 | Ga0207640_10003697 | Ga0207640_100036979 | 308 |
| 810 | 3300025986 | Ga0207658_10027530 | Ga0207658_100275303 | 308 |
| 811 | 3300026023 | Ga0207677_10027755 | Ga0207677_100277553 | 308 |
| 812 | 3300026023 | Ga0207677_10048665 | Ga0207677_100486652 | 308 |
| 813 | 3300026035 | Ga0207703_10003469 | Ga0207703_100034693 | 308 |
| 814 | 3300026035 | Ga0207703_10012068 | Ga0207703_100120685 | 308 |
| 815 | 3300026041 | Ga0207639_10013554 | Ga0207639_100135543 | 308 |
| 816 | 3300026067 | Ga0207678_10011489 | Ga0207678_100114898 | 308 |
| 817 | 3300026067 | Ga0207678_10018657 | Ga0207678_100186572 | 308 |
| 818 | 3300026075 | Ga0207708_10009345 | Ga0207708_100093456 | 308 |
| 819 | 3300026075 | Ga0207708_10050894 | Ga0207708_100508941 | 308 |
| 820 | 3300026089 | Ga0207648_10002570 | Ga0207648_100025704 | 308 |
| 821 | 3300026118 | Ga0207675_100008787 | Ga0207675_1000087876 | 308 |
| 822 | 3300026142 | Ga0207698_10190416 | Ga0207698_101904162 | 308 |
| 823 | 3300028381 | Ga0268264_10003411 | Ga0268264_100034112 | 308 |
| 824 | 3300031995 | Ga0307409_100539295 | Ga0307409_1005392951 | 308 |
| 825 | 3300032002 | Ga0307416_100141975 | Ga0307416_1001419752 | 308 |
| 826 | 3300035242 | Ga0373962_0041142 | Ga0373962_0041142_72_998 | 308 |
| 827 | 3300035691 | Ga0373931_0252172 | Ga0373931_0252172_60_986 | 308 |
| 828 | 3300037853 | Ga0436364_0605056 | Ga0436364_0605056_2157_3089 | 308 |
| 829 | 3300037853 | Ga0436364_0796992 | Ga0436364_0796992_175_1107 | 308 |
| 830 | 3300039437 | Ga0436365_1334824 | Ga0436365_1334824_12386_13318 | 308 |
| 831 | 3300041411 | Ga0439466_0001784 | Ga0439466_0001784_2417_3343 | 308 |
| 832 | 3300041413 | Ga0439465_0011150 | Ga0439465_0011150_1655_2581 | 308 |
| 833 | 3300041997 | Ga0439431_0008956 | Ga0439431_0008956_1064_1990 | 308 |
| 834 | 3300042002 | Ga0439442_021566 | Ga0439442_021566_348_1274 | 308 |
| 835 | 3300042436 | Ga0439435_0004781 | Ga0439435_0004781_525_1451 | 308 |
| 836 | 3300044658 | Ga0466972_0155687 | Ga0466972_0155687_98_1024 | 308 |
| 837 | 3300044765 | Ga0466970_0003872 | Ga0466970_0003872_493_1419 | 308 |
| 838 | 3300045049 | Ga0466959_0017217 | Ga0466959_0017217_125_1051 | 308 |
| 839 | 3300048903 | Ga0496100_0010477 | Ga0496100_0010477_617_1543 | 308 |
| 840 | 3300048904 | Ga0496101_0122181 | Ga0496101_0122181_916_1842 | 308 |
| 841 | 3300048905 | Ga0496102_0001958 | Ga0496102_0001958_9184_10110 | 308 |
| 842 | 3300048906 | Ga0496103_0000610 | Ga0496103_0000610_7211_8137 | 308 |
| 843 | 3300048906 | Ga0496103_0026722 | Ga0496103_0026722_2441_3367 | 308 |
| 844 | 3300048907 | Ga0496104_0383891 | Ga0496104_0383891_369_1295 | 308 |
| 845 | 3300048909 | Ga0496106_0005431 | Ga0496106_0005431_735_1661 | 308 |
| 846 | 3300048909 | Ga0496106_0111605 | Ga0496106_0111605_874_1902 | 308 |
| 847 | 3300048910 | Ga0496107_0001091 | Ga0496107_0001091_823_1749 | 308 |
| 848 | 3300048911 | Ga0496108_0007693 | Ga0496108_0007693_5244_6170 | 308 |
| 849 | 3300048912 | Ga0496109_0001533 | Ga0496109_0001533_1731_2657 | 308 |
| 850 | 3300048915 | Ga0496112_0054624 | Ga0496112_0054624_1787_2713 | 308 |
| 851 | 3300048916 | Ga0496113_0091562 | Ga0496113_0091562_734_1660 | 308 |
| 852 | 3300048917 | Ga0496114_0001530 | Ga0496114_0001530_15066_15992 | 308 |
| 853 | 3300050490 | nmdc:mga03n38_216022_c1 | nmdc:mga03n38_216022_c1_16_942 | 308 |
| 854 | 3300050491 | nmdc:mga00v17_3792_c1 | nmdc:mga00v17_3792_c1_4088_5014 | 308 |
| 855 | 3300050510 | nmdc:mga06r32_10729_c1 | nmdc:mga06r32_10729_c1_3236_4330 | 308 |
| 856 | 3300050516 | nmdc:mga0sz30_1051_c2 | nmdc:mga0sz30_1051_c2_492_1418 | 308 |
| 857 | 3300050516 | nmdc:mga0sz30_935_c1 | nmdc:mga0sz30_935_c1_4865_5791 | 308 |
| 858 | 3300061719 | Ga0466962_0016885 | Ga0466962_0016885_1191_2117 | 308 |
| 859 | 3300000546 | LJNas_1005481 | LJNas_10054811 | 309 |
| 860 | 3300003792 | Ga0055540_1003118 | Ga0055540_10031187 | 309 |
| 861 | 3300003792 | Ga0055540_1011522 | Ga0055540_10115224 | 309 |
| 862 | 3300005337 | Ga0070682_100070849 | Ga0070682_1000708492 | 309 |
| 863 | 3300005347 | Ga0070668_100000264 | Ga0070668_10000026423 | 309 |
| 864 | 3300005356 | Ga0070674_100006933 | Ga0070674_1000069332 | 309 |
| 865 | 3300005367 | Ga0070667_100000962 | Ga0070667_10000096225 | 309 |
| 866 | 3300005455 | Ga0070663_100005728 | Ga0070663_1000057287 | 309 |
| 867 | 3300005616 | Ga0068852_100548741 | Ga0068852_1005487412 | 309 |
| 868 | 3300005617 | Ga0068859_100005012 | Ga0068859_10000501211 | 309 |
| 869 | 3300005618 | Ga0068864_100583880 | Ga0068864_1005838801 | 309 |
| 870 | 3300005841 | Ga0068863_100002210 | Ga0068863_1000022102 | 309 |
| 871 | 3300005841 | Ga0068863_100244078 | Ga0068863_1002440782 | 309 |
| 872 | 3300005842 | Ga0068858_100048229 | Ga0068858_1000482294 | 309 |
| 873 | 3300005843 | Ga0068860_100000156 | Ga0068860_100000156104 | 309 |
| 874 | 3300005844 | Ga0068862_100000019 | Ga0068862_100000019124 | 309 |
| 875 | 3300006038 | Ga0075365_10110383 | Ga0075365_101103832 | 309 |
| 876 | 3300006048 | Ga0075363_100001651 | Ga0075363_1000016516 | 309 |
| 877 | 3300006048 | Ga0075363_100169229 | Ga0075363_1001692291 | 309 |
| 878 | 3300006051 | Ga0075364_10019067 | Ga0075364_100190673 | 309 |
| 879 | 3300006931 | Ga0097620_100005012 | Ga0097620_10000501211 | 309 |
| 880 | 3300009101 | Ga0105247_10000023 | Ga0105247_1000002394 | 309 |
| 881 | 3300009177 | Ga0105248_10000409 | Ga0105248_100004096 | 309 |
| 882 | 3300009177 | Ga0105248_10007260 | Ga0105248_100072608 | 309 |
| 883 | 3300009553 | Ga0105249_10000033 | Ga0105249_10000033102 | 309 |
| 884 | 3300013308 | Ga0157375_10071536 | Ga0157375_100715363 | 309 |
| 885 | 3300014325 | Ga0163163_10172358 | Ga0163163_101723582 | 309 |
| 886 | 3300014968 | Ga0157379_10476367 | Ga0157379_104763671 | 309 |
| 887 | 3300025303 | Ga0209051_1000993 | Ga0209051_100099326 | 309 |
| 888 | 3300025303 | Ga0209051_1006734 | Ga0209051_10067345 | 309 |
| 889 | 3300025303 | Ga0209051_1024452 | Ga0209051_10244524 | 309 |
| 890 | 3300025303 | Ga0209051_1056120 | Ga0209051_10561202 | 309 |
| 891 | 3300025900 | Ga0207710_10000343 | Ga0207710_1000034317 | 309 |
| 892 | 3300025920 | Ga0207649_10281174 | Ga0207649_102811741 | 309 |
| 893 | 3300025937 | Ga0207669_10016175 | Ga0207669_100161753 | 309 |
| 894 | 3300025941 | Ga0207711_10000412 | Ga0207711_1000041245 | 309 |
| 895 | 3300025941 | Ga0207711_10149857 | Ga0207711_101498572 | 309 |
| 896 | 3300025961 | Ga0207712_10000031 | Ga0207712_1000003195 | 309 |
| 897 | 3300025972 | Ga0207668_10002021 | Ga0207668_1000202111 | 309 |
| 898 | 3300025986 | Ga0207658_10000792 | Ga0207658_100007926 | 309 |
| 899 | 3300026035 | Ga0207703_10388337 | Ga0207703_103883371 | 309 |
| 900 | 3300026041 | Ga0207639_10043607 | Ga0207639_100436073 | 309 |
| 901 | 3300026067 | Ga0207678_10004736 | Ga0207678_1000473610 | 309 |
| 902 | 3300026088 | Ga0207641_10023523 | Ga0207641_100235232 | 309 |
| 903 | 3300026142 | Ga0207698_10564669 | Ga0207698_105646691 | 309 |
| 904 | 3300028380 | Ga0268265_10000029 | Ga0268265_10000029121 | 309 |
| 905 | 3300028381 | Ga0268264_10000222 | Ga0268264_10000222102 | 309 |
| 906 | 3300031731 | Ga0307405_10218402 | Ga0307405_102184022 | 309 |
| 907 | 3300041410 | Ga0439461_0000249 | Ga0439461_0000249_4276_5205 | 309 |
| 908 | 3300041411 | Ga0439466_0007193 | Ga0439466_0007193_1479_2408 | 309 |
| 909 | 3300041997 | Ga0439431_0000548 | Ga0439431_0000548_5002_5931 | 309 |
| 910 | 3300042004 | Ga0439445_0001278 | Ga0439445_0001278_3172_4101 | 309 |
| 911 | 3300044683 | Ga0466965_0001825 | Ga0466965_0001825_4165_5109 | 309 |
| 912 | 3300044901 | Ga0466960_0002717 | Ga0466960_0002717_5158_6102 | 309 |
| 913 | 3300046524 | Ga0495648_0019325 | Ga0495648_0019325_214_1143 | 309 |
| 914 | 3300046531 | Ga0495665_0021848 | Ga0495665_0021848_248_1177 | 309 |
| 915 | 3300046533 | Ga0495640_0022096 | Ga0495640_0022096_132_1061 | 309 |
| 916 | 3300046538 | Ga0495609_0127236 | Ga0495609_0127236_119_1048 | 309 |
| 917 | 3300046616 | Ga0495668_0021200 | Ga0495668_0021200_245_1174 | 309 |
| 918 | 3300046648 | Ga0495611_0065218 | Ga0495611_0065218_58_987 | 309 |
| 919 | 3300046663 | Ga0495635_0160574 | Ga0495635_0160574_387_1316 | 309 |
| 920 | 3300046692 | Ga0495671_0127471 | Ga0495671_0127471_38_967 | 309 |
| 921 | 3300046694 | Ga0495649_0173854 | Ga0495649_0173854_106_1035 | 309 |
| 922 | 3300047315 | Ga0495581_0038465 | Ga0495581_0038465_1781_2710 | 309 |
| 923 | 3300047319 | Ga0495674_0039894 | Ga0495674_0039894_2667_3596 | 309 |
| 924 | 3300047320 | Ga0495672_0005520 | Ga0495672_0005520_7928_8857 | 309 |
| 925 | 3300047321 | Ga0495676_0058695 | Ga0495676_0058695_63_992 | 309 |
| 926 | 3300047469 | Ga0495673_0004675 | Ga0495673_0004675_2342_3271 | 309 |
| 927 | 3300047472 | Ga0495686_0006499 | Ga0495686_0006499_1772_2704 | 309 |
| 928 | 3300047673 | Ga0495593_0062317 | Ga0495593_0062317_67_996 | 309 |
| 929 | 3300048903 | Ga0496100_0001469 | Ga0496100_0001469_10111_11040 | 309 |
| 930 | 3300048903 | Ga0496100_0005354 | Ga0496100_0005354_2103_3032 | 309 |
| 931 | 3300048904 | Ga0496101_0000091 | Ga0496101_0000091_24602_25531 | 309 |
| 932 | 3300048904 | Ga0496101_0003585 | Ga0496101_0003585_6911_7840 | 309 |
| 933 | 3300048904 | Ga0496101_0126438 | Ga0496101_0126438_426_1355 | 309 |
| 934 | 3300048905 | Ga0496102_0000016 | Ga0496102_0000016_220293_221222 | 309 |
| 935 | 3300048905 | Ga0496102_0000629 | Ga0496102_0000629_631_1560 | 309 |
| 936 | 3300048905 | Ga0496102_0204020 | Ga0496102_0204020_150_1079 | 309 |
| 937 | 3300048906 | Ga0496103_0000015 | Ga0496103_0000015_65553_66482 | 309 |
| 938 | 3300048907 | Ga0496104_0004506 | Ga0496104_0004506_10962_11891 | 309 |
| 939 | 3300048908 | Ga0496105_0001664 | Ga0496105_0001664_10179_11108 | 309 |
| 940 | 3300048909 | Ga0496106_0000640 | Ga0496106_0000640_19552_20481 | 309 |
| 941 | 3300048909 | Ga0496106_0004355 | Ga0496106_0004355_3810_4739 | 309 |
| 942 | 3300048910 | Ga0496107_0002152 | Ga0496107_0002152_9184_10113 | 309 |
| 943 | 3300048910 | Ga0496107_0014647 | Ga0496107_0014647_1044_1973 | 309 |
| 944 | 3300048911 | Ga0496108_0105188 | Ga0496108_0105188_758_1687 | 309 |
| 945 | 3300048912 | Ga0496109_0000668 | Ga0496109_0000668_25444_26373 | 309 |
| 946 | 3300048912 | Ga0496109_0088630 | Ga0496109_0088630_127_1056 | 309 |
| 947 | 3300048912 | Ga0496109_0583203 | Ga0496109_0583203_111_1040 | 309 |
| 948 | 3300048915 | Ga0496112_0001161 | Ga0496112_0001161_11_940 | 309 |
| 949 | 3300048915 | Ga0496112_0240060 | Ga0496112_0240060_792_1721 | 309 |
| 950 | 3300048916 | Ga0496113_0009533 | Ga0496113_0009533_3644_4573 | 309 |
| 951 | 3300048916 | Ga0496113_0190292 | Ga0496113_0190292_531_1460 | 309 |
| 952 | 3300048917 | Ga0496114_0000911 | Ga0496114_0000911_1681_2610 | 309 |
| 953 | 3300048918 | Ga0496115_0000929 | Ga0496115_0000929_5961_6890 | 309 |
| 954 | 3300048919 | Ga0496116_0000055 | Ga0496116_0000055_65740_66669 | 309 |
| 955 | 3300048920 | Ga0496117_0000006 | Ga0496117_0000006_691926_692855 | 309 |
| 956 | 3300048920 | Ga0496117_0000415 | Ga0496117_0000415_4590_5519 | 309 |
| 957 | 3300048921 | Ga0496118_0000004 | Ga0496118_0000004_691926_692855 | 309 |
| 958 | 3300048921 | Ga0496118_0002279 | Ga0496118_0002279_4614_5543 | 309 |
| 959 | 3300048922 | Ga0496119_0001293 | Ga0496119_0001293_26916_27845 | 309 |
| 960 | 3300048923 | Ga0496120_0000272 | Ga0496120_0000272_34688_35617 | 309 |
| 961 | 3300048923 | Ga0496120_0091932 | Ga0496120_0091932_415_1344 | 309 |
| 962 | 3300048924 | Ga0496121_0000331 | Ga0496121_0000331_77758_78687 | 309 |
| 963 | 3300048924 | Ga0496121_0013198 | Ga0496121_0013198_5552_6481 | 309 |
| 964 | 3300048925 | Ga0496122_0012801 | Ga0496122_0012801_5864_6793 | 309 |
| 965 | 3300048926 | Ga0496123_0019811 | Ga0496123_0019811_3351_4280 | 309 |
| 966 | 3300048928 | Ga0496125_0007986 | Ga0496125_0007986_630_1559 | 309 |
| 967 | 3300048929 | Ga0496126_0000675 | Ga0496126_0000675_23486_24415 | 309 |
| 968 | 3300048929 | Ga0496126_0035612 | Ga0496126_0035612_1528_2457 | 309 |
| 969 | 3300049569 | Ga0501032_0002308 | Ga0501032_0002308_11250_12179 | 309 |
| 970 | 3300049569 | Ga0501032_0241886 | Ga0501032_0241886_133_1086 | 309 |
| 971 | 3300049570 | Ga0501033_0058998 | Ga0501033_0058998_216_1169 | 309 |
| 972 | 3300049571 | Ga0501034_0006653 | Ga0501034_0006653_2397_3326 | 309 |
| 973 | 3300049571 | Ga0501034_0117905 | Ga0501034_0117905_817_1770 | 309 |
| 974 | 3300049572 | Ga0501036_0004384 | Ga0501036_0004384_7879_8808 | 309 |
| 975 | 3300049572 | Ga0501036_0326851 | Ga0501036_0326851_164_1117 | 309 |
| 976 | 3300049573 | Ga0501037_0000265 | Ga0501037_0000265_34554_35483 | 309 |
| 977 | 3300049574 | Ga0501038_0003199 | Ga0501038_0003199_1650_2579 | 309 |
| 978 | 3300049575 | Ga0501039_0002474 | Ga0501039_0002474_9621_10550 | 309 |
| 979 | 3300049581 | Ga0501047_0025795 | Ga0501047_0025795_3966_4919 | 309 |
| 980 | 3300049586 | Ga0501070_0003639 | Ga0501070_0003639_9106_10035 | 309 |
| 981 | 3300049589 | Ga0501073_0061257 | Ga0501073_0061257_31_960 | 309 |
| 982 | 3300049742 | Ga0501080_0298561 | Ga0501080_0298561_137_1069 | 309 |
| 983 | 3300049822 | Ga0501035_0073719 | Ga0501035_0073719_700_1653 | 309 |
| 984 | 3300049823 | Ga0501044_0003313 | Ga0501044_0003313_3450_4403 | 309 |
| 985 | 3300049823 | Ga0501044_0065446 | Ga0501044_0065446_2012_2941 | 309 |
| 986 | 3300050491 | nmdc:mga00v17_202511_c1 | nmdc:mga00v17_202511_c1_291_1220 | 309 |
| 987 | 3300050491 | nmdc:mga00v17_4414_c1 | nmdc:mga00v17_4414_c1_263_1192 | 309 |
| 988 | 3300050492 | nmdc:mga0yw44_105230_c1 | nmdc:mga0yw44_105230_c1_404_1333 | 309 |
| 989 | 3300050492 | nmdc:mga0yw44_249740_c1 | nmdc:mga0yw44_249740_c1_101_1030 | 309 |
| 990 | 3300050516 | nmdc:mga0sz30_50038_c1 | nmdc:mga0sz30_50038_c1_301_1230 | 309 |
| 991 | 3300053104 | Ga0500556_0001688 | Ga0500556_0001688_1065_1994 | 309 |
| 992 | 3300053153 | Ga0500616_0035165 | Ga0500616_0035165_97_1026 | 309 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zun-assembly1.cif.gz_A | crystal structure of a gtp-regulated atp sulfurylase heterodimer from pseudomonas syringae | 0.9032 | 18 | 219 |
| 1zun-assembly1.cif.gz_A | crystal structure of a gtp-regulated atp sulfurylase heterodimer from pseudomonas syringae | 0.8446 | 18 | 219 |
| 2oq2-assembly2.cif.gz_D | crystal structure of yeast paps reductase with pap, a product complex | 0.7625 | 26 | 215 |
| 3g59-assembly1.cif.gz_A | crystal structure of candida glabrata fmn adenylyltransferase in complex with atp | 0.745 | 15 | 205 |
| 3g5a-assembly5.cif.gz_E | crystal structure of candida glabrata fmn adenylyltransferase in complex with fmn and atp analog ampcpp | 0.7313 | 15 | 216 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1zunA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8985 | 18 | 219 | 3.40.50.620 |
| 1zunA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8893 | 18 | 219 | 3.40.50.620 |
| af_Q9VJY1_8_244_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8438 | 17 | 216 | 3.40.50.620 |
| af_Q9VYI5_67_322_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8319 | 14 | 216 | 3.40.50.620 |
| af_Q4DC85_142_361_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8128 | 20 | 216 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q5YQJ4-F1-model_v4 | Sulfate adenylyltransferase small subunit | 0.9941 | 18 | 98 |
GO:0016779
|
| AF-A0A4Q3EEX2-F1-model_v4 | Sulfate adenylyltransferase small subunit | 0.993 | 18 | 101 |
GO:0016779
|
| AF-A0A246R9P5-F1-model_v4 | Sulfate adenylyltransferase small subunit | 0.9851 | 21 | 131 |
GO:0016779
|
| AF-A0A3D2JYL3-F1-model_v4 | Sulfate adenylyltransferase small subunit | 0.9841 | 18 | 111 |
GO:0016779
|
| AF-A0A3S0F5T9-F1-model_v4 | Sulfate adenylyltransferase small subunit (EC 2.7.7.4) | 0.9841 | 18 | 99 |
GO:0004781
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar