F487573

General Info

Members Datasets Scaffolds Average Seq Length
988 532 806 272

Family's Representative Sequence

Representative Sequence 3300047319|Ga0495674_0009261|Ga0495674_0009261_4255_5202
Length 308
Sequence VLARCCPALTDAPATSSDTINFEAGMSETTFLYGGNVHANGIRQHYLRYGAHTGERARRDAIIIVPGITSPAVTWGFVGEHFGTTFDTYVLDIRGRGLSAASDTLDYSLDAQAADLVAFAQALALERYSVVGHSMGARIGIRAARTQPDGLARLVLVDPPVSGPGRRSYPAQLPWYIDSIRLARSGTDHHGMRGFCPNWTDKQLRLRAEWLHTCDERAVRTSFDGFHTDDVHADLAHIGIPVMLMTAGRGDVVREADSAEIRTLLPHLVHSHVSDAGHMIPWDDAAGFYRAFGDFLGEPLPMLDTPRA

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
4 2506520008 Serratia plymuthica AS12 Isolate Unclassified
5 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
6 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
9 2511231017 Pseudomonas sp. GM55 Isolate Nodule
10 2511231024 Pseudomonas sp. GM84 Isolate Nodule
11 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
12 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
13 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
14 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
15 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
16 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
19 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
20 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
21 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
22 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
23 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
24 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
25 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
26 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
27 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
28 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
29 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
30 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
31 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
32 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
33 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
34 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
35 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
36 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
37 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
38 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
39 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
40 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
41 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
42 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
43 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
44 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
45 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
46 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
47 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
48 2643221558 Rhizobium sp. Root149 Isolate Unclassified
49 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
50 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
51 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
52 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
53 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
54 2721755523 Delftia sp. HK171 Isolate Unclassified
55 2738541307 Variovorax sp. GV008 Isolate Unclassified
56 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
57 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
58 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
59 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
60 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
61 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
62 2818991446 Variovorax sp. 1180 Isolate Unclassified
63 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
64 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
65 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
66 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
67 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
68 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
69 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
70 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
71 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
72 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
73 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
74 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
75 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
76 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
77 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
78 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
79 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
80 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
81 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
82 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
83 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
84 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
85 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
86 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
87 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
88 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
89 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
90 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
91 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
92 2855730933 Achromobacter sp. HZ28 Isolate Nodule
93 2855767633 Achromobacter sp. HZ34 Isolate Nodule
94 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
95 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
96 2858950400 Achromobacter sp. K91 Isolate Unclassified
97 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
98 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
99 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
100 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
101 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
102 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
103 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
104 2899924645 Variovorax sp. 369 Isolate Unclassified
105 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
106 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
107 2904456579 Variovorax sp. 2002 Isolate Unclassified
108 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
109 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
110 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
111 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
112 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
113 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
114 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
115 2928037797 Variovorax sp. 1126 Isolate Unclassified
116 2928044640 Variovorax sp. 1128 Isolate Unclassified
117 2928051484 Variovorax sp. 1133 Isolate Unclassified
118 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
119 2928070936 Variovorax gossypii 1167 Isolate Unclassified
120 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
121 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
122 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
123 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
124 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
125 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
126 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
127 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
128 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
129 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
130 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
131 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
132 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
133 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
134 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
135 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
136 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
137 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
138 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
139 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
140 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
141 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
142 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
143 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
144 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
145 2941479691
146 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
147 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
148 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
149 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
150 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
151 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
152 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
153 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
154 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
155 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
156 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
157 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
158 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
159 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
160 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
161 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
162 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
163 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
164 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
165 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
166 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
167 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
168 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
169 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
170 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
171 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
172 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
173 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
174 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
175 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
176 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
177 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
178 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
179 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
180 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
181 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
182 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
183 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
184 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
185 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
186 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
187 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
188 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
189 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
190 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
191 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
192 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
193 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
194 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
195 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
196 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
197 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
198 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
199 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
200 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
201 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
202 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
203 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
204 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
205 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
206 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
207 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
208 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
209 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
210 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
211 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
212 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
213 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
214 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
215 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
216 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
217 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
218 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
219 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
220 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
221 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
222 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
223 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
224 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
225 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
226 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
227 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
228 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
229 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
230 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
231 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
232 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
233 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
234 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
235 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
236 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
237 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
238 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
239 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
240 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
241 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
242 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
243 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
244 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
245 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
246 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
247 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
248 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
249 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
250 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
251 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
252 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
253 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
254 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
255 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
256 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
257 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
258 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
259 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
260 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
261 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
262 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
264 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
266 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
267 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
268 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
270 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
271 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
272 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
273 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
275 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
276 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
277 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
278 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
279 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
280 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
281 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
283 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
284 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
319 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
320 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
321 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
322 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
323 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
324 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
325 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
327 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
328 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
329 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
330 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
331 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
332 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
333 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
334 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
335 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
336 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
337 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
338 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
339 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
340 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
341 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
342 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
343 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
344 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
345 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
346 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
347 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
348 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
349 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
350 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
351 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
352 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
353 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
354 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
355 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
356 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
357 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
358 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
359 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
360 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
361 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
362 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
363 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
364 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
365 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
366 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
367 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
368 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
369 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
370 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
371 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
372 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
373 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
374 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
375 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
376 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
377 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
378 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
379 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
380 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
381 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
382 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
383 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
384 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
385 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
386 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
387 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
388 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
389 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
390 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
391 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
392 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
393 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
394 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
395 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
396 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
397 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
398 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
399 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
400 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
401 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
402 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
403 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
404 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
405 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
406 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
407 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
408 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
409 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
410 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
411 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
412 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
413 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
414 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
415 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
416 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
417 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
418 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
419 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
420 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
421 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
422 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
423 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
424 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
425 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
426 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
427 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
428 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
429 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
430 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
431 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
432 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
433 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
434 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
435 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
436 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
437 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
438 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
439 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
440 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
441 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
442 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
443 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
444 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
445 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
446 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
447 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
448 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
449 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
450 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
451 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
452 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
453 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
454 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
455 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
456 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
457 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
458 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
459 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
460 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
465 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
466 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
467 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
468 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
469 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
470 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
471 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
472 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
473 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
474 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
475 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
476 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
477 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
478 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
479 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
480 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
481 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
482 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
483 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
484 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
485 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
486 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
487 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
488 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
489 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
490 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
491 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
492 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
493 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
494 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
495 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
496 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
497 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
498 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
499 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
500 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
501 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
502 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
503 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
504 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
505 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
506 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
507 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
508 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
509 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
510 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
511 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
512 640753048 Serratia proteamaculans 568 Isolate Endosphere
513 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
514 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
515 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
516 8004592986 Serratia sp. S119 Isolate Unclassified
517 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
518 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
519 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
520 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
521 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
522 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
523 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
524 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
525 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
526 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
527 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
528 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
529 8052494512 Pseudomonas putida LD6 Isolate Unclassified
530 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
531 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
532 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.48
Metatranscriptomes 0.1
Isolates 18.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.5
Nodule 10.63
Rhizoplane 5.16
Rhizosphere 49.7
Stem 0
Stem Tuber 0
Unclassified 18.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_7280 2124908027 Bacteria 5201
2 SwRhRL2b_contig_2571238 2162886007 Bacteria 2013
3 JGI24740J21852_10000003 3300001979 Bacteria 127453
4 JGI24735J21928_10000668 3300002067 Bacteria 12140
5 JGI25155J39150_1000133 3300002704 Bacteria 35480
6 JGI25156J39149_1000263 3300002705 Bacteria 35480
7 JGI25162J39368_1000069 3300002737 Bacteria 125244
8 JGI25154J39366_1000338 3300002738 Bacteria 26999
9 JGI25157J39369_1000306 3300002741 Bacteria 35480
10 JGI25152J39213_1000122 3300002773 Bacteria 54029
11 JGI25152J39213_1010718 3300002773 Bacteria 2074
12 JGI25150J39212_1001287 3300002774 Bacteria 7166
13 JGI25159J45721_1000987 3300002987 Bacteria 12285
14 JGI25159J45721_1010275 3300002987 Bacteria 2399
15 JGI25159J45721_1011002 3300002987 Bacteria 2253
16 JGI25151J46595_10000401 3300003187 Bacteria 45001
17 JGI25151J46595_10000448 3300003187 Bacteria 39942
18 JGI25151J46595_10000608 3300003187 Bacteria 31358
19 JGI25151J46595_10018070 3300003187 Bacteria 3040
20 JGI25151J46595_10031433 3300003187 Bacteria 2074
21 JGI25165J46597_1000018 3300003214 Bacteria 374701
22 JGI25153J46596_10000159 3300003215 Bacteria 68077
23 JGI25153J46596_10002484 3300003215 Bacteria 10584
24 JGI25153J46596_10026123 3300003215 Bacteria 2074
25 rootL2_10210444 3300003322 Bacteria 2367
26 rootH1_10167920 3300003323 Bacteria 5206
27 rootH1_10274232 3300003323 Bacteria 4469
28 JGI25160J50197_1000058 3300003354 Bacteria 117529
29 JGI25160J50197_1016303 3300003354 Bacteria 2399
30 JGI25161J50226_1000044 3300003374 Bacteria 117529
31 JGI25161J50226_1005119 3300003374 Bacteria 2608
32 Ga0055532_1011066 3300003758 Bacteria 1069
33 Ga0055535_1002066 3300003761 Bacteria 8032
34 Ga0055542_1000381 3300003762 Bacteria 45199
35 Ga0055526_1021376 3300003771 Bacteria 2253
36 Ga0055526_1023143 3300003771 Bacteria 2084
37 Ga0055537_1001819 3300003773 Bacteria 7723
38 Ga0055537_1009806 3300003773 Bacteria 2074
39 Ga0055524_1018681 3300003775 Bacteria 2399
40 Ga0055524_1020192 3300003775 Bacteria 2253
41 Ga0055536_1018491 3300003781 Bacteria 2232
42 Ga0055534_1000260 3300003784 Bacteria 36676
43 Ga0055534_1009685 3300003784 Bacteria 2074
44 Ga0055528_1010747 3300003790 Bacteria 3695
45 Ga0055528_1021187 3300003790 Bacteria 2074
46 Ga0055540_1000890 3300003792 Bacteria 19699
47 Ga0055540_1010767 3300003792 Bacteria 3017
48 Ga0055531_10007399 3300003794 Bacteria 6007
49 Ga0055543_1006413 3300004625 Bacteria 2845
50 Ga0055543_1010321 3300004625 Bacteria 1962
51 Ga0065165_1000158 3300005262 Bacteria 117567
52 Ga0065165_1000618 3300005262 Bacteria 51600
53 Ga0065165_1015909 3300005262 Bacteria 2845
54 Ga0065714_10003745 3300005288 Bacteria 11353
55 Ga0065714_10022924 3300005288 Bacteria 1259
56 Ga0065704_10096997 3300005289 Bacteria 2414
57 Ga0065704_10110782 3300005289 Bacteria 1973
58 Ga0070658_10011628 3300005327 Bacteria 7060
59 Ga0070658_10113096 3300005327 Bacteria 2251
60 Ga0070683_100044621 3300005329 Bacteria 4089
61 Ga0070670_100000722 3300005331 Bacteria 25662
62 Ga0070680_100020564 3300005336 Bacteria 5240
63 Ga0070680_100576270 3300005336 Bacteria 965
64 Ga0070660_100010431 3300005339 Bacteria 6564
65 Ga0070661_100000040 3300005344 Bacteria 99921
66 Ga0070661_100011546 3300005344 Bacteria 6154
67 Ga0070673_100171680 3300005364 Bacteria 1851
68 Ga0070659_100040888 3300005366 Bacteria 3624
69 Ga0070659_100114731 3300005366 Bacteria 2177
70 Ga0070667_100019539 3300005367 Bacteria 5622
71 Ga0070714_100003508 3300005435 Bacteria 11706
72 Ga0070681_10006959 3300005458 Bacteria 11004
73 Ga0070679_100030891 3300005530 Bacteria 5292
74 Ga0070679_100054041 3300005530 Bacteria 3998
75 Ga0070684_100002664 3300005535 Bacteria 13191
76 Ga0068853_100002331 3300005539 Bacteria 14200
77 Ga0068853_100114040 3300005539 Bacteria 2403
78 Ga0070693_100007035 3300005547 Bacteria 5479
79 Ga0068855_100000037 3300005563 Bacteria 158161
80 Ga0068855_100008499 3300005563 Bacteria 12411
81 Ga0070664_100043080 3300005564 Bacteria 3808
82 Ga0068857_100003638 3300005577 Bacteria 12922
83 Ga0068857_100209354 3300005577 Bacteria 1779
84 Ga0068854_100008606 3300005578 Bacteria 6570
85 Ga0068852_100000513 3300005616 Bacteria 25506
86 Ga0068852_100035844 3300005616 Bacteria 4143
87 Ga0068851_10028683 3300005834 Bacteria 2750
88 Ga0068863_100186825 3300005841 Bacteria 1991
89 Ga0068860_100002725 3300005843 Bacteria 18383
90 Ga0081540_1020081 3300005983 Bacteria 4032
91 Ga0075365_10151781 3300006038 Bacteria 1612
92 Ga0075368_10022562 3300006042 Bacteria 2397
93 Ga0075364_10016197 3300006051 Bacteria 4636
94 Ga0075432_10012455 3300006058 Bacteria 2889
95 Ga0075432_10026499 3300006058 Bacteria 1992
96 Ga0075362_10012710 3300006177 Bacteria 3351
97 Ga0075362_10140473 3300006177 Bacteria 1154
98 Ga0075367_10101029 3300006178 Bacteria 1763
99 Ga0075369_10011291 3300006186 Bacteria 3512
100 Ga0075369_10068311 3300006186 Bacteria 1562
101 Ga0075369_10126160 3300006186 Bacteria 1161
102 Ga0075370_10000965 3300006353 Bacteria 11870
103 Ga0075370_10211189 3300006353 Bacteria 1146
104 Ga0068871_100377361 3300006358 Bacteria 1259
105 Ga0075428_100185933 3300006844 Bacteria 2248
106 Ga0099823_1000006 3300006944 Bacteria 135028
107 Ga0079104_1000072 3300006946 Bacteria 152567
108 Ga0079104_1001229 3300006946 Bacteria 18067
109 Ga0079104_1044692 3300006946 Bacteria 1014
110 Ga0099826_10000044 3300006948 Bacteria 88060
111 Ga0105251_10000002 3300009011 Bacteria 350843
112 Ga0105251_10000066 3300009011 Bacteria 99856
113 Ga0105251_10002189 3300009011 Bacteria 15637
114 Ga0105251_10016021 3300009011 Bacteria 4069
115 Ga0105244_10004003 3300009036 Bacteria 10307
116 Ga0105244_10020922 3300009036 Bacteria 3625
117 Ga0105244_10072214 3300009036 Bacteria 1719
118 Ga0105244_10135184 3300009036 Bacteria 1188
119 Ga0105250_10000992 3300009092 Bacteria 16492
120 Ga0105250_10005221 3300009092 Bacteria 5849
121 Ga0105250_10026569 3300009092 Bacteria 2333
122 Ga0105240_10008252 3300009093 Bacteria 14909
123 Ga0105240_10056923 3300009093 Bacteria 4889
124 Ga0105240_10098178 3300009093 Bacteria 3567
125 Ga0105240_10656503 3300009093 Bacteria 1149
126 Ga0105245_10049230 3300009098 Bacteria 3773
127 Ga0105247_10000128 3300009101 Bacteria 73288
128 Ga0114129_10463539 3300009147 Bacteria 1660
129 Ga0105243_10003192 3300009148 Bacteria 13428
130 Ga0105241_10000002 3300009174 Bacteria 869480
131 Ga0105241_10043125 3300009174 Bacteria 3415
132 Ga0105241_10058427 3300009174 Bacteria 2962
133 Ga0105242_10003142 3300009176 Bacteria 12894
134 Ga0105248_11025050 3300009177 Archaea 932
135 Ga0105237_10000933 3300009545 Bacteria 39346
136 Ga0105237_10015089 3300009545 Bacteria 8051
137 Ga0105237_10226444 3300009545 Bacteria 1870
138 Ga0105238_10001084 3300009551 Bacteria 27454
139 Ga0105238_10038832 3300009551 Bacteria 4834
140 Ga0105238_10061454 3300009551 Bacteria 3759
141 Ga0105239_10010763 3300010375 Bacteria 10219
142 Ga0105239_10013297 3300010375 Bacteria 9146
143 Ga0105246_10381816 3300011119 Bacteria 1164
144 Ga0157373_10005574 3300013100 Bacteria 9436
145 Ga0157373_10014879 3300013100 Bacteria 5697
146 Ga0157373_10016159 3300013100 Bacteria 5448
147 Ga0157373_10306061 3300013100 Bacteria 1129
148 Ga0157371_10012334 3300013102 Bacteria 6539
149 Ga0157371_10025042 3300013102 Bacteria 4354
150 Ga0157370_10014861 3300013104 Bacteria 7944
151 Ga0157370_10139328 3300013104 Bacteria 2260
152 Ga0157369_10000456 3300013105 Bacteria 54115
153 Ga0157369_10314399 3300013105 Bacteria 1628
154 Ga0157369_10771175 3300013105 Bacteria 989
155 Ga0157374_10041472 3300013296 Bacteria 4242
156 Ga0163162_10038626 3300013306 Bacteria 4764
157 Ga0157372_10108470 3300013307 Bacteria 3177
158 Ga0157375_10138188 3300013308 Bacteria 2562
159 Ga0157375_10604402 3300013308 Bacteria 1256
160 Ga0182008_10000107 3300014497 Bacteria 64378
161 Ga0182008_10000644 3300014497 Bacteria 25500
162 Ga0182008_10006362 3300014497 Bacteria 6612
163 Ga0182008_10017638 3300014497 Bacteria 3702
164 Ga0157379_10745795 3300014968 Archaea 921
165 Ga0157376_10906501 3300014969 Bacteria 900
166 Ga0182006_1012688 3300015261 Bacteria 3681
167 Ga0182006_1022628 3300015261 Bacteria 2611
168 Ga0182007_10001168 3300015262 Bacteria 14232
169 Ga0182007_10036575 3300015262 Bacteria 1651
170 Ga0182005_1000979 3300015265 Bacteria 12386
171 Ga0183362_10006 3300015683 Bacteria 287231
172 Ga0163161_10000001 3300017792 Bacteria 2041488
173 Ga0163161_10000308 3300017792 Bacteria 42596
174 Ga0163161_10014069 3300017792 Bacteria 5570
175 Ga0163161_10116368 3300017792 Bacteria 2004
176 Ga0209435_100083 3300025206 Bacteria 45292
177 Ga0209435_101941 3300025206 Bacteria 2490
178 Ga0209436_110831 3300025208 Bacteria 1641
179 Ga0209147_102644 3300025229 Bacteria 4189
180 Ga0209437_100022 3300025233 Bacteria 625694
181 Ga0209258_100454 3300025242 Bacteria 45089
182 Ga0207425_1000483 3300025245 Bacteria 25107
183 Ga0209646_1000278 3300025246 Bacteria 45214
184 Ga0209026_1000339 3300025250 Bacteria 45292
185 Ga0209148_1000449 3300025254 Bacteria 45110
186 Ga0209759_1000469 3300025256 Bacteria 45292
187 Ga0209129_1000030 3300025258 Bacteria 391958
188 Ga0209129_1006426 3300025258 Bacteria 3796
189 Ga0209233_1000031 3300025261 Bacteria 624646
190 Ga0209233_1005675 3300025261 Bacteria 4117
191 Ga0209565_1000019 3300025263 Bacteria 438920
192 Ga0209565_1000047 3300025263 Bacteria 225745
193 Ga0209565_1007509 3300025263 Bacteria 2933
194 Ga0209455_1013693 3300025272 Bacteria 1871
195 Ga0209673_1000079 3300025273 Bacteria 225746
196 Ga0209673_1000095 3300025273 Bacteria 197466
197 Ga0209673_1012683 3300025273 Bacteria 3379
198 Ga0209130_1000011 3300025284 Bacteria 431723
199 Ga0209130_1000085 3300025284 Bacteria 158670
200 Ga0209130_1000272 3300025284 Bacteria 64696
201 Ga0209130_1002673 3300025284 Bacteria 8502
202 Ga0209675_1000046 3300025291 Bacteria 225746
203 Ga0209675_1000073 3300025291 Bacteria 163009
204 Ga0209675_1004206 3300025291 Bacteria 6501
205 Ga0209675_1008546 3300025291 Bacteria 3744
206 Ga0209675_1012745 3300025291 Bacteria 2684
207 Ga0209676_1003773 3300025292 Bacteria 8977
208 Ga0209676_1005770 3300025292 Bacteria 6341
209 Ga0209676_1027740 3300025292 Bacteria 1777
210 Ga0209025_1000028 3300025294 Bacteria 490678
211 Ga0209025_1000055 3300025294 Bacteria 316748
212 Ga0209025_1000471 3300025294 Bacteria 78395
213 Ga0209025_1000494 3300025294 Bacteria 75744
214 Ga0209025_1000973 3300025294 Bacteria 42929
215 Ga0209025_1017045 3300025294 Bacteria 4228
216 Ga0209025_1029664 3300025294 Bacteria 2640
217 Ga0209564_1000725 3300025295 Bacteria 47333
218 Ga0209564_1014616 3300025295 Bacteria 3249
219 Ga0209758_1000037 3300025297 Bacteria 439101
220 Ga0209758_1018973 3300025297 Bacteria 3341
221 Ga0209050_1041390 3300025298 Bacteria 1271
222 Ga0209256_1000023 3300025299 Bacteria 461150
223 Ga0209256_1001930 3300025299 Bacteria 18911
224 Ga0207426_1000029 3300025302 Bacteria 473835
225 Ga0207426_1000076 3300025302 Bacteria 320851
226 Ga0207426_1000835 3300025302 Bacteria 32700
227 Ga0207426_1007595 3300025302 Bacteria 4513
228 Ga0207426_1019688 3300025302 Bacteria 2356
229 Ga0209051_1000128 3300025303 Bacteria 142159
230 Ga0209051_1004231 3300025303 Bacteria 8948
231 Ga0209051_1007641 3300025303 Bacteria 5877
232 Ga0209051_1035753 3300025303 Bacteria 1843
233 Ga0209051_1040679 3300025303 Bacteria 1663
234 Ga0209257_1010457 3300025304 Bacteria 4692
235 Ga0207656_10012577 3300025321 Bacteria 3221
236 Ga0207696_1000001 3300025711 Bacteria 2579611
237 Ga0207696_1003281 3300025711 Bacteria 7467
238 Ga0207696_1007082 3300025711 Bacteria 4433
239 Ga0207655_1000081 3300025728 Bacteria 214272
240 Ga0207655_1000180 3300025728 Bacteria 112767
241 Ga0207655_1104552 3300025728 Bacteria 968
242 Ga0207713_1000008 3300025735 Bacteria 553952
243 Ga0207713_1000016 3300025735 Bacteria 421689
244 Ga0207713_1000193 3300025735 Bacteria 85067
245 Ga0207713_1002232 3300025735 Bacteria 14352
246 Ga0207713_1021468 3300025735 Bacteria 3094
247 Ga0207710_10000224 3300025900 Bacteria 49005
248 Ga0207705_10035521 3300025909 Bacteria 3566
249 Ga0207705_10130272 3300025909 Bacteria 1872
250 Ga0207654_10000005 3300025911 Bacteria 869492
251 Ga0207654_10046835 3300025911 Bacteria 2468
252 Ga0207654_10110251 3300025911 Bacteria 1711
253 Ga0207695_10128426 3300025913 Bacteria 2494
254 Ga0207695_10372910 3300025913 Bacteria 1313
255 Ga0207671_10174376 3300025914 Bacteria 1671
256 Ga0207660_10062792 3300025917 Bacteria 2677
257 Ga0207657_10002914 3300025919 Bacteria 18368
258 Ga0207649_10070214 3300025920 Bacteria 2233
259 Ga0207652_10025294 3300025921 Bacteria 4933
260 Ga0207652_10080692 3300025921 Bacteria 2844
261 Ga0207694_10000833 3300025924 Bacteria 27460
262 Ga0207694_10103017 3300025924 Bacteria 2263
263 Ga0207694_10126979 3300025924 Bacteria 2041
264 Ga0207687_10029533 3300025927 Bacteria 3688
265 Ga0207664_10143199 3300025929 Bacteria 2024
266 Ga0207690_10035802 3300025932 Bacteria 3210
267 Ga0207690_10143778 3300025932 Bacteria 1761
268 Ga0207686_10012369 3300025934 Bacteria 4693
269 Ga0207709_10000104 3300025935 Bacteria 130964
270 Ga0207661_10325648 3300025944 Bacteria 1382
271 Ga0207661_10575746 3300025944 Bacteria 1033
272 Ga0207679_10014861 3300025945 Bacteria 5129
273 Ga0207667_10000053 3300025949 Bacteria 226712
274 Ga0207667_10011698 3300025949 Bacteria 10180
275 Ga0207668_10104234 3300025972 Bacteria 2114
276 Ga0207640_10008079 3300025981 Bacteria 5820
277 Ga0207658_10165261 3300025986 Bacteria 1817
278 Ga0207639_10002786 3300026041 Bacteria 11739
279 Ga0207702_10007049 3300026078 Bacteria 9617
280 Ga0207641_10035601 3300026088 Bacteria 4149
281 Ga0207648_10077499 3300026089 Bacteria 2898
282 Ga0207674_10000994 3300026116 Bacteria 37007
283 Ga0207674_10291049 3300026116 Bacteria 1582
284 Ga0207683_10141845 3300026121 Bacteria 2165
285 Ga0207698_10152222 3300026142 Bacteria 2009
286 Ga0209281_1000002 3300027111 Bacteria 1924012
287 Ga0209281_1000003 3300027111 Bacteria 1260089
288 Ga0209281_1023761 3300027111 Bacteria 1158
289 Ga0209389_1000003 3300027296 Bacteria 268927
290 Ga0209389_1000030 3300027296 Bacteria 139329
291 Ga0209371_1000409 3300027312 Bacteria 44442
292 Ga0209489_100022 3300027361 Bacteria 202016
293 Ga0209700_100023 3300027363 Bacteria 229662
294 Ga0209282_1001203 3300027666 Bacteria 13962
295 Ga0207428_10024062 3300027907 Bacteria 5114
296 Ga0268264_10004086 3300028381 Bacteria 12491
297 Ga0307515_10000115 3300028794 Bacteria 193697
298 Ga0307515_10004008 3300028794 Bacteria 30737
299 Ga0307515_10038642 3300028794 Bacteria 7626
300 Ga0307515_10121696 3300028794 Bacteria 2950
301 Ga0268256_1000350 3300030500 Bacteria 44442
302 Ga0265327_10005883 3300031251 Bacteria 10021
303 Ga0307513_10000931 3300031456 Bacteria 42258
304 Ga0307513_10057631 3300031456 Bacteria 4136
305 Ga0307513_10106562 3300031456 Bacteria 2809
306 Ga0307408_100005155 3300031548 Bacteria 8761
307 Ga0307508_10102253 3300031616 Bacteria 2462
308 Ga0265314_10002400 3300031711 Bacteria 19257
309 Ga0265314_10040524 3300031711 Bacteria 3342
310 Ga0307516_10006311 3300031730 Bacteria 13930
311 Ga0307405_10000548 3300031731 Bacteria 14272
312 Ga0307405_10002875 3300031731 Bacteria 7742
313 Ga0307405_10274248 3300031731 Bacteria 1266
314 Ga0307405_10494364 3300031731 Bacteria 979
315 Ga0307406_10327556 3300031901 Bacteria 1187
316 Ga0307412_10000123 3300031911 Bacteria 59156
317 Ga0307412_10000487 3300031911 Bacteria 23696
318 Ga0307412_10107044 3300031911 Bacteria 1989
319 Ga0307416_100013723 3300032002 Bacteria 5518
320 Ga0307416_100038208 3300032002 Bacteria 3702
321 Ga0307416_100655794 3300032002 Bacteria 1135
322 Ga0307414_10021385 3300032004 Bacteria 4058
323 Ga0307414_10206106 3300032004 Bacteria 1604
324 Ga0307414_10213411 3300032004 Bacteria 1579
325 Ga0307414_10347015 3300032004 Bacteria 1273
326 Ga0307411_10106748 3300032005 Bacteria 1994
327 Ga0373925_0008436 3300037068 Bacteria 7505
328 Ga0395900_0002965 3300037418 Bacteria 18476
329 Ga0395900_0039763 3300037418 Bacteria 4846
330 Ga0395898_0106298 3300037466 Bacteria 2692
331 Ga0395905_0000330 3300037471 Bacteria 67978
332 Ga0395905_0050737 3300037471 Bacteria 3886
333 Ga0395905_0115577 3300037471 Bacteria 2522
334 Ga0436361_0282271 3300039447 Bacteria 8908
335 Ga0439436_0055836 3300041404 Bacteria 1109
336 Ga0439438_001817 3300041405 Bacteria 9356
337 Ga0451835_0099071 3300041492 Bacteria 4534
338 Ga0451841_1152441 3300041498 Bacteria 1881
339 Ga0451845_0146513 3300041501 Bacteria 1336
340 Ga0451855_0112004 3300041511 Bacteria 1894
341 Ga0451853_0494432 3300041512 Bacteria 924
342 Ga0439432_001581 3300042006 Bacteria 8522
343 Ga0439432_016922 3300042006 Bacteria 2451
344 Ga0439452_009979 3300042010 Bacteria 2778
345 Ga0450911_000058 3300042115 Bacteria 45420
346 Ga0450902_000607 3300042137 Bacteria 4544
347 Ga0450905_011319 3300042142 Bacteria 1246
348 Ga0450901_000408 3300042533 Bacteria 5174
349 Ga0495617_000082 3300046452 Bacteria 71035
350 Ga0495617_025514 3300046452 Bacteria 1992
351 Ga0495617_038087 3300046452 Bacteria 1609
352 Ga0495617_070725 3300046452 Bacteria 1148
353 Ga0495627_000070 3300046453 Bacteria 125171
354 Ga0495627_016113 3300046453 Bacteria 2566
355 Ga0495603_0005865 3300046455 Bacteria 7346
356 Ga0495590_0002468 3300046457 Bacteria 7656
357 Ga0495591_003453 3300046458 Bacteria 8148
358 Ga0495591_007354 3300046458 Bacteria 4696
359 Ga0495591_008555 3300046458 Bacteria 4180
360 Ga0495591_012751 3300046458 Bacteria 3111
361 Ga0495629_0009217 3300046459 Bacteria 7223
362 Ga0495638_0000216 3300046460 Bacteria 80528
363 Ga0495638_0000518 3300046460 Bacteria 45116
364 Ga0495638_0005479 3300046460 Bacteria 9435
365 Ga0495638_0020423 3300046460 Bacteria 4377
366 Ga0495638_0083882 3300046460 Bacteria 1929
367 Ga0495638_0175068 3300046460 Bacteria 1228
368 Ga0495653_0000460 3300046463 Bacteria 31749
369 Ga0495653_0002626 3300046463 Bacteria 14299
370 Ga0495650_0000143 3300046471 Bacteria 168096
371 Ga0495650_0010402 3300046471 Bacteria 5192
372 Ga0495650_0039603 3300046471 Bacteria 2032
373 Ga0495580_0012949 3300046472 Bacteria 6385
374 Ga0495605_0000401 3300046474 Bacteria 39759
375 Ga0495605_0006510 3300046474 Bacteria 6706
376 Ga0495605_0008765 3300046474 Bacteria 5706
377 Ga0495605_0013692 3300046474 Bacteria 4457
378 Ga0495664_0015752 3300046477 Bacteria 4302
379 Ga0495664_0034121 3300046477 Bacteria 2992
380 Ga0495664_0161927 3300046477 Bacteria 1357
381 Ga0495664_0217329 3300046477 Bacteria 1157
382 Ga0495585_0000300 3300046492 Bacteria 49530
383 Ga0495585_0001961 3300046492 Bacteria 15338
384 Ga0495585_0009470 3300046492 Bacteria 5841
385 Ga0495585_0015901 3300046492 Bacteria 4366
386 Ga0495585_0044825 3300046492 Bacteria 2470
387 Ga0495585_0084926 3300046492 Bacteria 1711
388 Ga0495596_0040257 3300046500 Bacteria 1845
389 Ga0495607_0001528 3300046501 Bacteria 20344
390 Ga0495607_0004890 3300046501 Bacteria 9748
391 Ga0495607_0008626 3300046501 Bacteria 6951
392 Ga0495607_0018423 3300046501 Bacteria 4451
393 Ga0495607_0031773 3300046501 Bacteria 3230
394 Ga0495607_0040498 3300046501 Bacteria 2774
395 Ga0495583_0000124 3300046506 Bacteria 130757
396 Ga0495583_0000181 3300046506 Bacteria 107973
397 Ga0495583_0000283 3300046506 Bacteria 81166
398 Ga0495583_0011914 3300046506 Bacteria 4962
399 Ga0495606_0000013 3300046507 Bacteria 292850
400 Ga0495606_0004709 3300046507 Bacteria 13458
401 Ga0495606_0005549 3300046507 Bacteria 12034
402 Ga0495606_0008182 3300046507 Bacteria 9149
403 Ga0495606_0013479 3300046507 Bacteria 6451
404 Ga0495606_0013628 3300046507 Bacteria 6410
405 Ga0495606_0030652 3300046507 Bacteria 3753
406 Ga0495606_0033875 3300046507 Bacteria 3515
407 Ga0495606_0040943 3300046507 Bacteria 3109
408 Ga0495606_0120660 3300046507 Bacteria 1570
409 Ga0495608_0190927 3300046511 Bacteria 1293
410 Ga0495610_0000379 3300046512 Bacteria 45939
411 Ga0495610_0023910 3300046512 Bacteria 3309
412 Ga0495610_0039870 3300046512 Bacteria 2371
413 Ga0495610_0041757 3300046512 Bacteria 2300
414 Ga0495610_0049767 3300046512 Bacteria 2050
415 Ga0495610_0128269 3300046512 Bacteria 1104
416 Ga0495616_0001220 3300046513 Bacteria 18108
417 Ga0495616_0022532 3300046513 Bacteria 3402
418 Ga0495616_0037115 3300046513 Bacteria 2509
419 Ga0495620_0000058 3300046515 Bacteria 96873
420 Ga0495628_0003162 3300046516 Bacteria 14753
421 Ga0495628_0022973 3300046516 Bacteria 5119
422 Ga0495630_0000726 3300046517 Bacteria 23297
423 Ga0495631_0003886 3300046518 Bacteria 8079
424 Ga0495631_0010898 3300046518 Bacteria 4488
425 Ga0495631_0040319 3300046518 Bacteria 2069
426 Ga0495632_0000838 3300046519 Bacteria 27076
427 Ga0495632_0007273 3300046519 Bacteria 6981
428 Ga0495632_0034611 3300046519 Bacteria 2583
429 Ga0495632_0035654 3300046519 Bacteria 2537
430 Ga0495632_0125168 3300046519 Bacteria 1198
431 Ga0495637_0000021 3300046520 Bacteria 179141
432 Ga0495637_0000282 3300046520 Bacteria 39834
433 Ga0495637_0006029 3300046520 Bacteria 6122
434 Ga0495637_0024633 3300046520 Bacteria 2722
435 Ga0495637_0070543 3300046520 Bacteria 1411
436 Ga0495637_0117789 3300046520 Bacteria 1024
437 Ga0495643_0000508 3300046522 Bacteria 48532
438 Ga0495643_0054569 3300046522 Bacteria 2138
439 Ga0495643_0141856 3300046522 Bacteria 1197
440 Ga0495644_0008858 3300046523 Bacteria 3868
441 Ga0495648_0001313 3300046524 Bacteria 24626
442 Ga0495648_0004836 3300046524 Bacteria 11367
443 Ga0495648_0010321 3300046524 Bacteria 7124
444 Ga0495648_0018664 3300046524 Bacteria 4899
445 Ga0495648_0033997 3300046524 Bacteria 3324
446 Ga0495648_0049671 3300046524 Bacteria 2569
447 Ga0495648_0119297 3300046524 Bacteria 1420
448 Ga0495652_0004289 3300046529 Bacteria 13675
449 Ga0495654_0000379 3300046530 Bacteria 38260
450 Ga0495654_0001416 3300046530 Bacteria 16598
451 Ga0495654_0007575 3300046530 Bacteria 6048
452 Ga0495654_0045589 3300046530 Bacteria 2162
453 Ga0495654_0046362 3300046530 Bacteria 2141
454 Ga0495654_0064016 3300046530 Bacteria 1759
455 Ga0495654_0074601 3300046530 Bacteria 1601
456 Ga0495654_0104263 3300046530 Bacteria 1301
457 Ga0495665_0000144 3300046531 Bacteria 34978
458 Ga0495665_0097272 3300046531 Bacteria 1545
459 Ga0495665_0169460 3300046531 Bacteria 1137
460 Ga0495586_0043755 3300046535 Bacteria 2412
461 Ga0495586_0064320 3300046535 Bacteria 1999
462 Ga0495609_0000062 3300046538 Bacteria 138094
463 Ga0495609_0000706 3300046538 Bacteria 25687
464 Ga0495609_0082525 3300046538 Bacteria 1404
465 Ga0495597_0000109 3300046542 Bacteria 73193
466 Ga0495597_0005857 3300046542 Bacteria 6425
467 Ga0495597_0006216 3300046542 Bacteria 6194
468 Ga0495597_0013772 3300046542 Bacteria 3867
469 Ga0495622_0008380 3300046557 Bacteria 4786
470 Ga0495622_0008444 3300046557 Bacteria 4768
471 Ga0495633_0000168 3300046558 Bacteria 86321
472 Ga0495633_0042286 3300046558 Bacteria 2165
473 Ga0495668_0015505 3300046616 Bacteria 4448
474 Ga0495668_0021620 3300046616 Bacteria 3686
475 Ga0495668_0038102 3300046616 Bacteria 2688
476 Ga0495611_0001757 3300046648 Bacteria 10477
477 Ga0495611_0002586 3300046648 Bacteria 8195
478 Ga0495611_0010031 3300046648 Bacteria 4007
479 Ga0495625_0000028 3300046660 Bacteria 256946
480 Ga0495625_0010130 3300046660 Bacteria 7832
481 Ga0495625_0014308 3300046660 Bacteria 6339
482 Ga0495625_0077770 3300046660 Bacteria 2317
483 Ga0495635_0001829 3300046663 Bacteria 14383
484 Ga0495635_0053270 3300046663 Bacteria 2788
485 Ga0495659_0091739 3300046664 Bacteria 1167
486 Ga0495661_0000001 3300046665 Bacteria 898372
487 Ga0495661_0000013 3300046665 Bacteria 259387
488 Ga0495661_0001016 3300046665 Bacteria 25033
489 Ga0495661_0003810 3300046665 Bacteria 11038
490 Ga0495661_0008465 3300046665 Bacteria 7111
491 Ga0495661_0032611 3300046665 Bacteria 3291
492 Ga0495588_0006483 3300046674 Bacteria 5275
493 Ga0495588_0036530 3300046674 Bacteria 2493
494 Ga0495588_0088308 3300046674 Bacteria 1622
495 Ga0495657_0076360 3300046675 Bacteria 2176
496 Ga0495599_0020738 3300046678 Bacteria 4095
497 Ga0495623_0002095 3300046679 Bacteria 13335
498 Ga0495646_0234091 3300046680 Bacteria 989
499 Ga0495669_0007329 3300046684 Bacteria 4622
500 Ga0495669_0012505 3300046684 Bacteria 3614
501 Ga0495624_0143254 3300046690 Bacteria 1463
502 Ga0495670_0000809 3300046691 Bacteria 15073
503 Ga0495670_0007933 3300046691 Bacteria 5218
504 Ga0495670_0031795 3300046691 Bacteria 2623
505 Ga0495670_0068448 3300046691 Bacteria 1794
506 Ga0495670_0101312 3300046691 Bacteria 1483
507 Ga0495670_0117308 3300046691 Bacteria 1381
508 Ga0495671_0001413 3300046692 Bacteria 16136
509 Ga0495671_0007853 3300046692 Bacteria 6036
510 Ga0495671_0017251 3300046692 Bacteria 3844
511 Ga0495671_0094418 3300046692 Bacteria 1463
512 Ga0495649_0003338 3300046694 Bacteria 10888
513 Ga0495649_0065376 3300046694 Bacteria 1952
514 Ga0495589_0000001 3300046794 Bacteria 888100
515 Ga0495589_0000767 3300046794 Bacteria 20524
516 Ga0495589_0029858 3300046794 Bacteria 2748
517 Ga0495600_0026821 3300046809 Bacteria 3721
518 Ga0495660_0001061 3300046810 Bacteria 19874
519 Ga0495660_0001202 3300046810 Bacteria 18131
520 Ga0495660_0030230 3300046810 Bacteria 3052
521 Ga0495660_0220253 3300046810 Bacteria 895
522 Ga0495604_0002608 3300047317 Bacteria 14455
523 Ga0495604_0025994 3300047317 Bacteria 4662
524 Ga0495636_0016843 3300047318 Bacteria 2923
525 Ga0495674_0003450 3300047319 Bacteria 15359
526 Ga0495674_0004344 3300047319 Bacteria 13626
527 Ga0495674_0009261 3300047319 Bacteria 9358
528 Ga0495674_0316535 3300047319 Bacteria 1272
529 Ga0495672_0000912 3300047320 Bacteria 30930
530 Ga0495672_0005501 3300047320 Bacteria 10036
531 Ga0495672_0026007 3300047320 Bacteria 3739
532 Ga0495672_0127544 3300047320 Bacteria 1343
533 Ga0495676_0000006 3300047321 Bacteria 280508
534 Ga0495676_0056728 3300047321 Bacteria 3095
535 Ga0495676_0091183 3300047321 Bacteria 2279
536 Ga0495680_0001386 3300047322 Bacteria 26182
537 Ga0495683_0000185 3300047323 Bacteria 61212
538 Ga0495683_0000673 3300047323 Bacteria 25234
539 Ga0495683_0001189 3300047323 Bacteria 17742
540 Ga0495683_0014792 3300047323 Bacteria 4063
541 Ga0495683_0016469 3300047323 Bacteria 3838
542 Ga0495683_0090691 3300047323 Bacteria 1481
543 Ga0495687_000784 3300047443 Bacteria 34187
544 Ga0495687_009122 3300047443 Bacteria 5587
545 Ga0495687_089050 3300047443 Bacteria 1187
546 Ga0495675_0043309 3300047444 Bacteria 2868
547 Ga0495679_000148 3300047446 Bacteria 63053
548 Ga0495679_000203 3300047446 Bacteria 51947
549 Ga0495685_077901 3300047447 Bacteria 1106
550 Ga0495673_0004182 3300047469 Bacteria 9118
551 Ga0495673_0005131 3300047469 Bacteria 7985
552 Ga0495673_0007202 3300047469 Bacteria 6430
553 Ga0495673_0014894 3300047469 Bacteria 4026
554 Ga0495673_0025263 3300047469 Bacteria 2856
555 Ga0495673_0125942 3300047469 Bacteria 1010
556 Ga0495681_0000653 3300047470 Bacteria 26356
557 Ga0495681_0000803 3300047470 Bacteria 24200
558 Ga0495681_0005526 3300047470 Bacteria 8447
559 Ga0495686_0000045 3300047472 Bacteria 284761
560 Ga0495686_0005840 3300047472 Bacteria 9600
561 Ga0495686_0016711 3300047472 Bacteria 4967
562 Ga0495686_0031403 3300047472 Bacteria 3444
563 Ga0495686_0078738 3300047472 Bacteria 2017
564 Ga0495686_0171279 3300047472 Bacteria 1262
565 Ga0495686_0193019 3300047472 Bacteria 1173
566 Ga0495593_0002697 3300047673 Bacteria 10685
567 Ga0495593_0008883 3300047673 Bacteria 5831
568 Ga0495593_0013971 3300047673 Bacteria 4574
569 Ga0495602_0004972 3300048088 Bacteria 13931
570 Ga0495602_0045254 3300048088 Bacteria 3984
571 Ga0495602_0061771 3300048088 Bacteria 3255
572 Ga0495615_0061209 3300048090 Bacteria 994
573 Ga0495626_0000019 3300048091 Bacteria 225494
574 Ga0495626_0001519 3300048091 Bacteria 18245
575 Ga0495626_0091028 3300048091 Bacteria 1341
576 Ga0496100_0008194 3300048903 Bacteria 5819
577 Ga0496101_0002200 3300048904 Bacteria 11916
578 Ga0496101_0023922 3300048904 Bacteria 4223
579 Ga0496101_0203978 3300048904 Bacteria 1529
580 Ga0496102_0002501 3300048905 Bacteria 15698
581 Ga0496102_0009781 3300048905 Bacteria 8247
582 Ga0496102_0049467 3300048905 Bacteria 3824
583 Ga0496102_0519249 3300048905 Bacteria 1113
584 Ga0496103_0006426 3300048906 Bacteria 7020
585 Ga0496103_0009825 3300048906 Bacteria 5666
586 Ga0496103_0171022 3300048906 Bacteria 1395
587 Ga0496104_0024714 3300048907 Bacteria 5530
588 Ga0496104_0051878 3300048907 Bacteria 3872
589 Ga0496104_0193752 3300048907 Bacteria 1944
590 Ga0496105_0002786 3300048908 Bacteria 12782
591 Ga0496105_0016402 3300048908 Bacteria 5914
592 Ga0496105_0023953 3300048908 Bacteria 4958
593 Ga0496106_0013396 3300048909 Bacteria 6055
594 Ga0496106_0017119 3300048909 Bacteria 5365
595 Ga0496106_0241956 3300048909 Bacteria 1442
596 Ga0496107_0005965 3300048910 Bacteria 8347
597 Ga0496107_0041431 3300048910 Bacteria 3306
598 Ga0496107_0261726 3300048910 Bacteria 1287
599 Ga0496109_0325806 3300048912 Bacteria 1450
600 Ga0496110_0003473 3300048913 Bacteria 12086
601 Ga0496110_0012286 3300048913 Bacteria 7038
602 Ga0496110_0425536 3300048913 Bacteria 1210
603 Ga0496110_0625009 3300048913 Bacteria 976
604 Ga0496111_0017806 3300048914 Bacteria 4913
605 Ga0496111_0171455 3300048914 Bacteria 1612
606 Ga0496111_0315808 3300048914 Bacteria 1157
607 Ga0496112_0005936 3300048915 Bacteria 10652
608 Ga0496113_0077820 3300048916 Bacteria 2537
609 Ga0496113_0766816 3300048916 Bacteria 767
610 Ga0496114_0001598 3300048917 Bacteria 17186
611 Ga0496114_0015328 3300048917 Bacteria 6162
612 Ga0496114_0138462 3300048917 Bacteria 2106
613 Ga0496114_0544534 3300048917 Bacteria 1026
614 Ga0496115_0110618 3300048918 Bacteria 2257
615 Ga0496116_0000001 3300048919 Bacteria 1501681
616 Ga0496116_0004925 3300048919 Bacteria 12582
617 Ga0496116_0006000 3300048919 Bacteria 11134
618 Ga0496116_0010671 3300048919 Bacteria 7677
619 Ga0496116_0011008 3300048919 Bacteria 7528
620 Ga0496116_0037904 3300048919 Bacteria 3355
621 Ga0496117_0000958 3300048920 Bacteria 44157
622 Ga0496117_0000965 3300048920 Bacteria 44061
623 Ga0496117_0001888 3300048920 Bacteria 28090
624 Ga0496117_0002440 3300048920 Bacteria 23448
625 Ga0496117_0003572 3300048920 Bacteria 17940
626 Ga0496117_0004240 3300048920 Bacteria 16002
627 Ga0496117_0041762 3300048920 Bacteria 3355
628 Ga0496117_0089604 3300048920 Bacteria 1986
629 Ga0496117_0142075 3300048920 Bacteria 1436
630 Ga0496118_0000568 3300048921 Bacteria 61136
631 Ga0496118_0001301 3300048921 Bacteria 38037
632 Ga0496118_0004937 3300048921 Bacteria 15461
633 Ga0496118_0005145 3300048921 Bacteria 14996
634 Ga0496118_0036182 3300048921 Bacteria 3996
635 Ga0496118_0086465 3300048921 Bacteria 2178
636 Ga0496118_0128695 3300048921 Bacteria 1631
637 Ga0496118_0131904 3300048921 Bacteria 1603
638 Ga0496118_0165062 3300048921 Bacteria 1362
639 Ga0496119_0000011 3300048922 Bacteria 438315
640 Ga0496119_0002074 3300048922 Bacteria 22650
641 Ga0496119_0003186 3300048922 Bacteria 17202
642 Ga0496119_0005028 3300048922 Bacteria 12861
643 Ga0496119_0025377 3300048922 Bacteria 4141
644 Ga0496119_0026843 3300048922 Bacteria 3980
645 Ga0496119_0152593 3300048922 Bacteria 1236
646 Ga0496119_0212843 3300048922 Bacteria 993
647 Ga0496120_0000051 3300048923 Bacteria 186239
648 Ga0496120_0000092 3300048923 Bacteria 148990
649 Ga0496120_0000627 3300048923 Bacteria 52784
650 Ga0496120_0010894 3300048923 Bacteria 6290
651 Ga0496120_0018559 3300048923 Bacteria 4477
652 Ga0496120_0127969 3300048923 Bacteria 1304
653 Ga0496121_0000275 3300048924 Bacteria 107073
654 Ga0496121_0000590 3300048924 Bacteria 68048
655 Ga0496121_0001459 3300048924 Bacteria 39949
656 Ga0496121_0002682 3300048924 Bacteria 26627
657 Ga0496121_0004343 3300048924 Bacteria 19165
658 Ga0496121_0005254 3300048924 Bacteria 16736
659 Ga0496121_0006478 3300048924 Bacteria 14510
660 Ga0496121_0019538 3300048924 Bacteria 6766
661 Ga0496121_0069887 3300048924 Bacteria 2831
662 Ga0496121_0075624 3300048924 Bacteria 2689
663 Ga0496121_0103649 3300048924 Bacteria 2188
664 Ga0496121_0121197 3300048924 Bacteria 1975
665 Ga0496121_0152801 3300048924 Bacteria 1696
666 Ga0496121_0178652 3300048924 Bacteria 1534
667 Ga0496121_0343949 3300048924 Bacteria 996
668 Ga0496122_0000363 3300048925 Bacteria 97542
669 Ga0496122_0000451 3300048925 Bacteria 85677
670 Ga0496122_0004519 3300048925 Bacteria 17177
671 Ga0496122_0005094 3300048925 Bacteria 15856
672 Ga0496122_0005170 3300048925 Bacteria 15699
673 Ga0496122_0007206 3300048925 Bacteria 12448
674 Ga0496122_0035300 3300048925 Bacteria 4070
675 Ga0496122_0124986 3300048925 Bacteria 1649
676 Ga0496122_0150230 3300048925 Bacteria 1439
677 Ga0496123_0000136 3300048926 Bacteria 152399
678 Ga0496123_0000271 3300048926 Bacteria 102859
679 Ga0496123_0000639 3300048926 Bacteria 58527
680 Ga0496123_0004166 3300048926 Bacteria 15465
681 Ga0496123_0005138 3300048926 Bacteria 13346
682 Ga0496123_0010618 3300048926 Bacteria 8104
683 Ga0496123_0017281 3300048926 Bacteria 5813
684 Ga0496123_0050892 3300048926 Bacteria 2764
685 Ga0496123_0107397 3300048926 Bacteria 1606
686 Ga0496124_0000103 3300048927 Bacteria 179162
687 Ga0496124_0000195 3300048927 Bacteria 119909
688 Ga0496124_0000248 3300048927 Bacteria 104502
689 Ga0496124_0002867 3300048927 Bacteria 21798
690 Ga0496124_0005108 3300048927 Bacteria 14942
691 Ga0496124_0006092 3300048927 Bacteria 13266
692 Ga0496124_0009336 3300048927 Bacteria 10105
693 Ga0496124_0028018 3300048927 Bacteria 5043
694 Ga0496124_0080861 3300048927 Bacteria 2673
695 Ga0496124_0087337 3300048927 Bacteria 2550
696 Ga0496124_0235075 3300048927 Bacteria 1367
697 Ga0496125_0000023 3300048928 Bacteria 449042
698 Ga0496125_0000269 3300048928 Bacteria 106605
699 Ga0496125_0000361 3300048928 Bacteria 85699
700 Ga0496125_0000502 3300048928 Bacteria 68171
701 Ga0496125_0003272 3300048928 Bacteria 19921
702 Ga0496125_0010599 3300048928 Bacteria 9311
703 Ga0496125_0015010 3300048928 Bacteria 7522
704 Ga0496125_0032286 3300048928 Bacteria 4652
705 Ga0496125_0051940 3300048928 Bacteria 3375
706 Ga0496125_0066629 3300048928 Bacteria 2844
707 Ga0496125_0082116 3300048928 Bacteria 2458
708 Ga0496125_0083661 3300048928 Bacteria 2426
709 Ga0496125_0126515 3300048928 Bacteria 1810
710 Ga0496125_0208089 3300048928 Bacteria 1273
711 Ga0496126_0002450 3300048929 Bacteria 25049
712 Ga0496126_0003075 3300048929 Bacteria 21581
713 Ga0496126_0014791 3300048929 Bacteria 7872
714 Ga0496126_0022492 3300048929 Bacteria 6134
715 Ga0496126_0024999 3300048929 Bacteria 5757
716 Ga0496126_0031321 3300048929 Bacteria 5028
717 Ga0496126_0056934 3300048929 Bacteria 3532
718 Ga0496126_0063270 3300048929 Bacteria 3317
719 Ga0496126_0088155 3300048929 Bacteria 2734
720 Ga0496126_0133837 3300048929 Bacteria 2140
721 Ga0496126_0244575 3300048929 Bacteria 1497
722 Ga0495678_000138 3300049459 Bacteria 87271
723 Ga0495678_005713 3300049459 Bacteria 6767
724 Ga0495678_008918 3300049459 Bacteria 5014
725 Ga0495678_009445 3300049459 Bacteria 4824
726 Ga0495678_018353 3300049459 Bacteria 3147
727 Ga0495682_0002747 3300049460 Bacteria 8155
728 Ga0495682_0003903 3300049460 Bacteria 6513
729 Ga0501032_0064833 3300049569 Bacteria 2445
730 Ga0501034_0000067 3300049571 Bacteria 184398
731 Ga0501034_0000411 3300049571 Bacteria 72008
732 Ga0501034_0000969 3300049571 Bacteria 41330
733 Ga0501034_0117187 3300049571 Bacteria 2651
734 Ga0501038_0124549 3300049574 Bacteria 2122
735 Ga0501047_0005850 3300049581 Bacteria 11575
736 Ga0501047_0474055 3300049581 Bacteria 1080
737 Ga0501069_0026589 3300049585 Bacteria 3169
738 Ga0501070_0003372 3300049586 Bacteria 13862
739 Ga0501073_0003130 3300049589 Bacteria 12402
740 Ga0501074_0003900 3300049590 Bacteria 10629
741 Ga0501079_0013758 3300049741 Bacteria 6170
742 Ga0501080_0008917 3300049742 Bacteria 9120
743 Ga0501083_0001432 3300049744 Bacteria 16284
744 Ga0501083_0075678 3300049744 Bacteria 2236
745 Ga0501262_000023 3300049759 Bacteria 21585
746 Ga0501035_0030816 3300049822 Bacteria 4888
747 Ga0501044_0019060 3300049823 Bacteria 7345
748 nmdc:mga03683_3815_c1 3300050489 Bacteria 4922
749 nmdc:mga03n38_180050_c1 3300050490 Bacteria 1082
750 nmdc:mga00v17_42544_c2 3300050491 Bacteria 1131
751 nmdc:mga0yw44_290053_c1 3300050492 Bacteria 1095
752 nmdc:mga0yw44_43558_c1 3300050492 Bacteria 2680
753 nmdc:mga06z11_106634_c1 3300050494 Bacteria 1545
754 nmdc:mga07m45_131526_c1 3300050496 Bacteria 1159
755 nmdc:mga07m45_23805_c1 3300050496 Bacteria 3350
756 nmdc:mga07m45_77748_c1 3300050496 Bacteria 1893
757 nmdc:mga05p37_423978_c1 3300050507 Bacteria 1547
758 nmdc:mga0sz30_144709_c1 3300050516 Bacteria 1050
759 nmdc:mga0sz30_2557_c1 3300050516 Bacteria 6477
760 nmdc:mga0sz30_51021_c2 3300050516 Bacteria 1187
761 Ga0500610_0002836 3300053079 Bacteria 6502
762 Ga0500643_027219 3300053087 Bacteria 1780
763 Ga0500641_0049477 3300053096 Bacteria 1724
764 Ga0500650_0000063 3300053098 Bacteria 34213
765 Ga0500556_0009668 3300053104 Bacteria 2809
766 Ga0500557_025410 3300053105 Bacteria 1741
767 Ga0500562_000113 3300053108 Bacteria 27908
768 Ga0500562_013490 3300053108 Bacteria 2088
769 Ga0500569_000924 3300053109 Bacteria 5278
770 Ga0500572_001665 3300053111 Bacteria 5820
771 Ga0500608_058236 3300053122 Bacteria 1850
772 Ga0500608_104707 3300053122 Bacteria 1306
773 Ga0500618_026479 3300053125 Bacteria 1385
774 Ga0500626_082159 3300053128 Bacteria 1423
775 Ga0500642_0110031 3300053130 Bacteria 1286
776 Ga0500658_0000070 3300053134 Bacteria 48197
777 Ga0500658_0000102 3300053134 Bacteria 39059
778 Ga0500658_0001588 3300053134 Bacteria 9082
779 Ga0500658_0047632 3300053134 Bacteria 1740
780 Ga0500659_0001037 3300053135 Bacteria 17855
781 Ga0500659_0211279 3300053135 Bacteria 925
782 Ga0500559_0027737 3300053136 Bacteria 2417
783 Ga0500559_0128397 3300053136 Bacteria 1183
784 Ga0500568_0000375 3300053139 Bacteria 34271
785 Ga0500568_0000604 3300053139 Bacteria 26015
786 Ga0500568_0000686 3300053139 Bacteria 24412
787 Ga0500568_0003547 3300053139 Bacteria 8635
788 Ga0500577_0000018 3300053142 Bacteria 48454
789 Ga0500577_0007804 3300053142 Bacteria 3018
790 Ga0500588_0003446 3300053146 Bacteria 3339
791 Ga0500590_005262 3300053148 Bacteria 6213
792 Ga0500603_010192 3300053150 Bacteria 2116
793 Ga0500604_0000104 3300053151 Bacteria 26172
794 Ga0500604_0017316 3300053151 Bacteria 1993
795 Ga0500616_0000057 3300053153 Bacteria 278571
796 Ga0500616_0001104 3300053153 Bacteria 27910
797 Ga0500616_0041529 3300053153 Bacteria 2467
798 Ga0500622_0000060 3300053156 Bacteria 133737
799 Ga0500634_0055094 3300053161 Bacteria 2128
800 Ga0500636_0000914 3300053177 Bacteria 15902
801 Ga0500636_0094542 3300053177 Bacteria 1707
802 Ga0500599_000112 3300053736 Bacteria 7459
803 Ga0501084_0037477 3300054114 Bacteria 4051
804 Ga0501084_0203163 3300054114 Bacteria 1672
805 Ga0587128_005133 3300059630 Bacteria 1552
806 Ga0501082_0051239 3300060353 Bacteria 3558

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300017792 Ga0163161_10000308 Ga0163161_1000030840 216
2 3300046524 Ga0495648_0018664 Ga0495648_0018664_15_692 221
3 3300046511 Ga0495608_0190927 Ga0495608_0190927_23_709 225
4 3300041512 Ga0451853_0494432 Ga0451853_0494432_55_777 236
5 3300046452 Ga0495617_038087 Ga0495617_038087_22_744 237
6 3300048916 Ga0496113_0766816 Ga0496113_0766816_14_754 239
7 3300053142 Ga0500577_0000018 Ga0500577_0000018_46683_47486 244
8 3300006177 Ga0075362_10140473 Ga0075362_101404732 245
9 3300025258 Ga0209129_1006426 Ga0209129_10064264 245
10 3300025263 Ga0209565_1000019 Ga0209565_100001983 245
11 3300025263 Ga0209565_1007509 Ga0209565_10075093 245
12 3300006946 Ga0079104_1000072 Ga0079104_100007222 246
13 3300009092 Ga0105250_10000992 Ga0105250_1000099214 246
14 3300025711 Ga0207696_1003281 Ga0207696_10032814 246
15 3300027111 Ga0209281_1000002 Ga0209281_10000021103 246
16 3300047320 Ga0495672_0005501 Ga0495672_0005501_3026_3829 247
17 iso_pu_bacteria 2903748898 2903749977 247
18 iso_pu_bacteria 2913036834 2913041221 247
19 3300046472 Ga0495580_0012949 Ga0495580_0012949_1944_2771 249
20 3300046531 Ga0495665_0097272 Ga0495665_0097272_283_1110 249
21 3300046690 Ga0495624_0143254 Ga0495624_0143254_398_1225 249
22 3300047317 Ga0495604_0025994 Ga0495604_0025994_2990_3817 249
23 3300053161 Ga0500634_0055094 Ga0500634_0055094_1062_1874 249
24 3300027907 Ga0207428_10024062 Ga0207428_100240625 251
25 3300031616 Ga0307508_10102253 Ga0307508_101022532 251
26 iso_pu_bacteria 2885383462 2885384113 251
27 3300006058 Ga0075432_10012455 Ga0075432_100124552 252
28 3300046474 Ga0495605_0006510 Ga0495605_0006510_2349_3200 252
29 3300046507 Ga0495606_0033875 Ga0495606_0033875_521_1372 252
30 iso_pu_bacteria 2842509118 2842515791 252
31 iso_pu_bacteria 8045864390 8045868269 252
32 3300048924 Ga0496121_0006478 Ga0496121_0006478_10441_11241 254
33 3300048929 Ga0496126_0063270 Ga0496126_0063270_1863_2711 255
34 3300048929 Ga0496126_0133837 Ga0496126_0133837_191_1039 255
35 3300046474 Ga0495605_0013692 Ga0495605_0013692_17_829 256
36 iso_pu_bacteria 2643221558 2643810975 256
37 iso_pu_bacteria 2939631187 2939632206 256
38 3300009147 Ga0114129_10463539 Ga0114129_104635392 257
39 3300037068 Ga0373925_0008436 Ga0373925_0008436_2047_2862 257
40 3300046665 Ga0495661_0003810 Ga0495661_0003810_5222_6046 257
41 3300047447 Ga0495685_077901 Ga0495685_077901_193_978 257
42 3300050507 nmdc:mga05p37_423978_c1 nmdc:mga05p37_423978_c1_479_1267 257
43 iso_pu_bacteria 2506520007 2506578337 257
44 iso_pu_bacteria 2506520008 2506583475 257
45 iso_pu_bacteria 2508501071 2508852338 257
46 iso_pu_bacteria 2654587920 2656279148 257
47 iso_pu_bacteria 2687453601 2689444885 257
48 iso_pu_bacteria 2806310673 2807177537 257
49 iso_pu_bacteria 2869551831 2869554293 257
50 iso_pu_bacteria 2888366609 2888368949 257
51 iso_pu_bacteria 640753048 640937849 257
52 iso_pu_bacteria 8004592986 8004595831 257
53 iso_pu_bacteria 8015394850 8015398173 257
54 3300003187 JGI25151J46595_10000608 JGI25151J46595_1000060818 258
55 3300025294 Ga0209025_1000055 Ga0209025_1000055206 258
56 3300049571 Ga0501034_0000067 Ga0501034_0000067_167704_168555 258
57 3300053136 Ga0500559_0128397 Ga0500559_0128397_274_1077 258
58 3300053139 Ga0500568_0003547 Ga0500568_0003547_5831_6634 258
59 iso_pu_bacteria 2510461076 2510893229 258
60 iso_pu_bacteria 2513237093 2513634707 258
61 iso_pu_bacteria 2513237137 2513861813 258
62 iso_pu_bacteria 2513237162 2514024288 258
63 iso_pu_bacteria 2515154113 2515637284 258
64 iso_pu_bacteria 2515154114 2515645210 258
65 iso_pu_bacteria 2515154116 2515661593 258
66 iso_pu_bacteria 2517093000 2517099336 258
67 iso_pu_bacteria 2582581306 2585268594 258
68 iso_pu_bacteria 2582581865 2585389258 258
69 iso_pu_bacteria 2936367885 2936371301 258
70 iso_pu_bacteria 2936375103 2936375496 258
71 iso_pu_bacteria 8005376324 8005380285 258
72 3300009545 Ga0105237_10226444 Ga0105237_102264442 259
73 3300025206 Ga0209435_101941 Ga0209435_1019413 259
74 3300037471 Ga0395905_0050737 Ga0395905_0050737_467_1282 259
75 3300046459 Ga0495629_0009217 Ga0495629_0009217_2139_2954 259
76 3300046463 Ga0495653_0002626 Ga0495653_0002626_4041_4856 259
77 3300046477 Ga0495664_0015752 Ga0495664_0015752_2698_3513 259
78 3300046477 Ga0495664_0161927 Ga0495664_0161927_527_1342 259
79 3300046516 Ga0495628_0022973 Ga0495628_0022973_1699_2514 259
80 3300046529 Ga0495652_0004289 Ga0495652_0004289_3467_4282 259
81 3300046531 Ga0495665_0000144 Ga0495665_0000144_24574_25389 259
82 3300046535 Ga0495586_0043755 Ga0495586_0043755_1039_1854 259
83 3300046663 Ga0495635_0001829 Ga0495635_0001829_9594_10409 259
84 3300046679 Ga0495623_0002095 Ga0495623_0002095_3443_4258 259
85 3300046684 Ga0495669_0007329 Ga0495669_0007329_2737_3552 259
86 3300046809 Ga0495600_0026821 Ga0495600_0026821_274_1089 259
87 3300047317 Ga0495604_0002608 Ga0495604_0002608_4162_4977 259
88 3300047319 Ga0495674_0004344 Ga0495674_0004344_3771_4586 259
89 3300047444 Ga0495675_0043309 Ga0495675_0043309_453_1268 259
90 3300047673 Ga0495593_0002697 Ga0495593_0002697_2809_3624 259
91 3300047673 Ga0495593_0013971 Ga0495593_0013971_3729_4544 259
92 3300048088 Ga0495602_0004972 Ga0495602_0004972_9477_10292 259
93 3300048088 Ga0495602_0061771 Ga0495602_0061771_676_1491 259
94 3300048904 Ga0496101_0203978 Ga0496101_0203978_35_850 259
95 3300048907 Ga0496104_0193752 Ga0496104_0193752_745_1560 259
96 3300048908 Ga0496105_0023953 Ga0496105_0023953_11_826 259
97 3300048928 Ga0496125_0126515 Ga0496125_0126515_419_1234 259
98 3300049581 Ga0501047_0005850 Ga0501047_0005850_1842_2657 259
99 3300049585 Ga0501069_0026589 Ga0501069_0026589_591_1406 259
100 3300049586 Ga0501070_0003372 Ga0501070_0003372_10672_11487 259
101 3300049589 Ga0501073_0003130 Ga0501073_0003130_9719_10534 259
102 3300049590 Ga0501074_0003900 Ga0501074_0003900_9216_10031 259
103 3300049741 Ga0501079_0013758 Ga0501079_0013758_4368_5183 259
104 3300049742 Ga0501080_0008917 Ga0501080_0008917_5586_6401 259
105 3300049744 Ga0501083_0001432 Ga0501083_0001432_823_1638 259
106 3300053135 Ga0500659_0211279 Ga0500659_0211279_103_894 259
107 3300054114 Ga0501084_0037477 Ga0501084_0037477_692_1507 259
108 3300060353 Ga0501082_0051239 Ga0501082_0051239_1273_2088 259
109 iso_pu_bacteria 2510917030 2511194172 259
110 iso_pu_bacteria 2513237085 2513574292 259
111 iso_pu_bacteria 2513237159 2514000792 259
112 iso_pu_bacteria 2515154134 2515737800 259
113 iso_pu_bacteria 2516653085 2517079753 259
114 iso_pu_bacteria 2524023210 2524465520 259
115 iso_pu_bacteria 2582581316 2585333109 259
116 iso_pu_bacteria 2582581866 2585393657 259
117 iso_pu_bacteria 2585427526 2585525896 259
118 iso_pu_bacteria 2585427594 2585847597 259
119 iso_pu_bacteria 2599185236 2599723581 259
120 iso_pu_bacteria 2643221689 2644498332 259
121 iso_pu_bacteria 2667528174 2671113210 259
122 iso_pu_bacteria 2765235942 2766066515 259
123 iso_pu_bacteria 2791355197 2793072252 259
124 iso_pu_bacteria 2838029111 2838031730 259
125 iso_pu_bacteria 2838686498 2838687981 259
126 iso_pu_bacteria 2838729681 2838733704 259
127 iso_pu_bacteria 2838742623 2838746374 259
128 iso_pu_bacteria 2841851746 2841857620 259
129 iso_pu_bacteria 2842110456 2842111913 259
130 iso_pu_bacteria 2842156927 2842159203 259
131 iso_pu_bacteria 2842163707 2842163739 259
132 iso_pu_bacteria 2842180545 2842183228 259
133 iso_pu_bacteria 2842229732 2842234492 259
134 iso_pu_bacteria 2842243621 2842248014 259
135 iso_pu_bacteria 2842257432 2842259609 259
136 iso_pu_bacteria 2842271015 2842271988 259
137 iso_pu_bacteria 2842304105 2842309710 259
138 iso_pu_bacteria 2842475841 2842478462 259
139 iso_pu_bacteria 2842502639 2842505592 259
140 iso_pu_bacteria 2842521101 2842525419 259
141 iso_pu_bacteria 2844454524 2844459938 259
142 iso_pu_bacteria 2852387548 2852393898 259
143 iso_pu_bacteria 2855730933 2855733412 259
144 iso_pu_bacteria 2855767633 2855772371 259
145 iso_pu_bacteria 2857516855 2857523570 259
146 iso_pu_bacteria 2881412998 2881413878 259
147 iso_pu_bacteria 2891373044 2891378098 259
148 iso_pu_bacteria 2919408235 2919412978 259
149 iso_pu_bacteria 2933570622 2933576152 259
150 iso_pu_bacteria 2933586486 2933588188 259
151 iso_pu_bacteria 2935901341 2935902840 259
152 iso_pu_bacteria 2937049772 2937053825 259
153 iso_pu_bacteria 2957415311 2957415532 259
154 iso_pu_bacteria 2957443900 2957447389 259
155 iso_pu_bacteria 2960617483 2960623168 259
156 iso_pu_bacteria 2960660292 2960663177 259
157 iso_pu_bacteria 2970040964 2970044156 259
158 iso_pu_bacteria 2970116247 2970119377 259
159 iso_pu_bacteria 2970149975 2970153564 259
160 iso_pu_bacteria 2977523885 2977526488 259
161 iso_pu_bacteria 2977579622 2977583208 259
162 iso_pu_bacteria 3005416602 3005419360 259
163 iso_pu_bacteria 3005474847 3005477345 259
164 iso_pu_bacteria 8005307578 8005307610 259
165 iso_pu_bacteria 8019555841 8019559072 259
166 iso_pu_bacteria 8019565922 8019566231 259
167 iso_pu_bacteria 8023680758 8023687798 259
168 iso_pu_bacteria 8046767195 8046767856 259
169 iso_pu_bacteria 8056148874 8056154613 259
170 3300011119 Ga0105246_10381816 Ga0105246_103818161 260
171 3300028794 Ga0307515_10004008 Ga0307515_100040089 260
172 3300031456 Ga0307513_10057631 Ga0307513_100576315 260
173 3300031731 Ga0307405_10002875 Ga0307405_100028755 260
174 3300032002 Ga0307416_100013723 Ga0307416_1000137232 260
175 3300032004 Ga0307414_10021385 Ga0307414_100213852 260
176 3300047472 Ga0495686_0031403 Ga0495686_0031403_2122_2937 260
177 3300053148 Ga0500590_005262 Ga0500590_005262_5103_5921 260
178 iso_pu_bacteria 2597490356 2599101781 260
179 iso_pu_bacteria 2599185214 2599627751 260
180 iso_pu_bacteria 2599185226 2599677328 260
181 iso_pu_bacteria 2599185227 2599685392 260
182 iso_pu_bacteria 2599185229 2599697194 260
183 iso_pu_bacteria 2738541307 2738885337 260
184 iso_pu_bacteria 2818991446 2819598493 260
185 iso_pu_bacteria 2838054893 2838061385 260
186 iso_pu_bacteria 2846952575 2846957925 260
187 iso_pu_bacteria 2899924645 2899926279 260
188 iso_pu_bacteria 2904449895 2904453798 260
189 iso_pu_bacteria 2904456579 2904462273 260
190 iso_pu_bacteria 2904541872 2904550019 260
191 iso_pu_bacteria 2928037797 2928044212 260
192 iso_pu_bacteria 2928044640 2928051051 260
193 iso_pu_bacteria 2928051484 2928057114 260
194 iso_pu_bacteria 2928064002 2928069370 260
195 iso_pu_bacteria 2928070936 2928077120 260
196 iso_pu_bacteria 2928084124 2928089891 260
197 iso_pu_bacteria 2928115317 2928118698 260
198 iso_pu_bacteria 2929160207 2929166513 260
199 iso_pu_bacteria 2954767861 2954767901 260
200 iso_pu_bacteria 8002392321 8002396191 260
201 3300005327 Ga0070658_10011628 Ga0070658_100116283 261
202 3300005364 Ga0070673_100171680 Ga0070673_1001716802 261
203 3300005367 Ga0070667_100019539 Ga0070667_1000195396 261
204 3300005841 Ga0068863_100186825 Ga0068863_1001868252 261
205 3300005843 Ga0068860_100002725 Ga0068860_10000272516 261
206 3300006358 Ga0068871_100377361 Ga0068871_1003773612 261
207 3300006946 Ga0079104_1001229 Ga0079104_10012292 261
208 3300009011 Ga0105251_10000002 Ga0105251_10000002223 261
209 3300009092 Ga0105250_10005221 Ga0105250_100052213 261
210 3300009101 Ga0105247_10000128 Ga0105247_1000012860 261
211 3300009174 Ga0105241_10000002 Ga0105241_10000002407 261
212 3300009177 Ga0105248_11025050 Ga0105248_110250501 261
213 3300013100 Ga0157373_10016159 Ga0157373_100161592 261
214 3300013105 Ga0157369_10771175 Ga0157369_107711751 261
215 3300013308 Ga0157375_10604402 Ga0157375_106044022 261
216 3300014497 Ga0182008_10000644 Ga0182008_1000064418 261
217 3300014497 Ga0182008_10006362 Ga0182008_100063621 261
218 3300014968 Ga0157379_10745795 Ga0157379_107457951 261
219 3300014969 Ga0157376_10906501 Ga0157376_109065011 261
220 3300015262 Ga0182007_10001168 Ga0182007_100011683 261
221 3300017792 Ga0163161_10000001 Ga0163161_100000011096 261
222 3300017792 Ga0163161_10116368 Ga0163161_101163682 261
223 3300025711 Ga0207696_1000001 Ga0207696_10000011167 261
224 3300025735 Ga0207713_1000008 Ga0207713_1000008123 261
225 3300025735 Ga0207713_1000016 Ga0207713_1000016132 261
226 3300025900 Ga0207710_10000224 Ga0207710_1000022411 261
227 3300025909 Ga0207705_10035521 Ga0207705_100355213 261
228 3300025911 Ga0207654_10000005 Ga0207654_10000005406 261
229 3300025972 Ga0207668_10104234 Ga0207668_101042342 261
230 3300025986 Ga0207658_10165261 Ga0207658_101652613 261
231 3300026088 Ga0207641_10035601 Ga0207641_100356014 261
232 3300026089 Ga0207648_10077499 Ga0207648_100774992 261
233 3300026121 Ga0207683_10141845 Ga0207683_101418452 261
234 3300027111 Ga0209281_1000003 Ga0209281_1000003301 261
235 3300028381 Ga0268264_10004086 Ga0268264_100040863 261
236 3300031251 Ga0265327_10005883 Ga0265327_100058835 261
237 3300031456 Ga0307513_10106562 Ga0307513_101065623 261
238 3300037471 Ga0395905_0000330 Ga0395905_0000330_55535_56362 261
239 3300041492 Ga0451835_0099071 Ga0451835_0099071_1539_2336 261
240 3300041498 Ga0451841_1152441 Ga0451841_1152441_137_934 261
241 3300041501 Ga0451845_0146513 Ga0451845_0146513_390_1187 261
242 3300041511 Ga0451855_0112004 Ga0451855_0112004_335_1132 261
243 3300042006 Ga0439432_016922 Ga0439432_016922_901_1695 261
244 3300046453 Ga0495627_000070 Ga0495627_000070_105398_106192 261
245 3300046492 Ga0495585_0009470 Ga0495585_0009470_1421_2218 261
246 3300046492 Ga0495585_0044825 Ga0495585_0044825_105_902 261
247 3300046500 Ga0495596_0040257 Ga0495596_0040257_79_876 261
248 3300046512 Ga0495610_0049767 Ga0495610_0049767_1166_1963 261
249 3300046518 Ga0495631_0040319 Ga0495631_0040319_1129_1926 261
250 3300046524 Ga0495648_0049671 Ga0495648_0049671_1338_2135 261
251 3300046530 Ga0495654_0000379 Ga0495654_0000379_12245_13039 261
252 3300046558 Ga0495633_0042286 Ga0495633_0042286_1356_2153 261
253 3300046616 Ga0495668_0038102 Ga0495668_0038102_1414_2211 261
254 3300046660 Ga0495625_0014308 Ga0495625_0014308_3841_4638 261
255 3300046664 Ga0495659_0091739 Ga0495659_0091739_324_1148 261
256 3300046674 Ga0495588_0036530 Ga0495588_0036530_283_1080 261
257 3300046691 Ga0495670_0068448 Ga0495670_0068448_916_1737 261
258 3300046691 Ga0495670_0101312 Ga0495670_0101312_535_1332 261
259 3300046794 Ga0495589_0000001 Ga0495589_0000001_796108_796902 261
260 3300047320 Ga0495672_0026007 Ga0495672_0026007_773_1639 261
261 3300047472 Ga0495686_0078738 Ga0495686_0078738_22_819 261
262 3300048090 Ga0495615_0061209 Ga0495615_0061209_157_978 261
263 3300048903 Ga0496100_0008194 Ga0496100_0008194_4428_5249 261
264 3300048904 Ga0496101_0002200 Ga0496101_0002200_2240_3061 261
265 3300048905 Ga0496102_0049467 Ga0496102_0049467_386_1207 261
266 3300048905 Ga0496102_0519249 Ga0496102_0519249_249_1070 261
267 3300048906 Ga0496103_0171022 Ga0496103_0171022_274_1095 261
268 3300048907 Ga0496104_0051878 Ga0496104_0051878_2666_3487 261
269 3300048908 Ga0496105_0002786 Ga0496105_0002786_2364_3185 261
270 3300048909 Ga0496106_0013396 Ga0496106_0013396_416_1237 261
271 3300048909 Ga0496106_0241956 Ga0496106_0241956_148_969 261
272 3300048910 Ga0496107_0041431 Ga0496107_0041431_77_898 261
273 3300048910 Ga0496107_0261726 Ga0496107_0261726_49_870 261
274 3300048912 Ga0496109_0325806 Ga0496109_0325806_435_1256 261
275 3300048913 Ga0496110_0012286 Ga0496110_0012286_3983_4804 261
276 3300048913 Ga0496110_0425536 Ga0496110_0425536_212_1033 261
277 3300048914 Ga0496111_0171455 Ga0496111_0171455_188_1009 261
278 3300048914 Ga0496111_0315808 Ga0496111_0315808_222_1043 261
279 3300048917 Ga0496114_0544534 Ga0496114_0544534_180_1001 261
280 3300048919 Ga0496116_0000001 Ga0496116_0000001_575628_576422 261
281 3300048920 Ga0496117_0002440 Ga0496117_0002440_6679_7473 261
282 3300048921 Ga0496118_0004937 Ga0496118_0004937_1728_2522 261
283 3300048922 Ga0496119_0002074 Ga0496119_0002074_19963_20757 261
284 3300048922 Ga0496119_0025377 Ga0496119_0025377_2567_3361 261
285 3300048923 Ga0496120_0000051 Ga0496120_0000051_123872_124666 261
286 3300048923 Ga0496120_0000092 Ga0496120_0000092_47866_48660 261
287 3300048927 Ga0496124_0000195 Ga0496124_0000195_57814_58608 261
288 iso_pu_bacteria 2511231017 2511330144 261
289 iso_pu_bacteria 2511231017 2511330400 261
290 iso_pu_bacteria 2511231024 2511376646 261
291 iso_pu_bacteria 2513237150 2513952704 261
292 iso_pu_bacteria 2599185316 2600024933 261
293 iso_pu_bacteria 2599185317 2600029440 261
294 iso_pu_bacteria 2599185319 2600041055 261
295 iso_pu_bacteria 2599185323 2600065422 261
296 iso_pu_bacteria 2599185325 2600079060 261
297 iso_pu_bacteria 2600254930 2600358876 261
298 iso_pu_bacteria 2667528176 2671130169 261
299 iso_pu_bacteria 2738543004 2739199704 261
300 iso_pu_bacteria 2818991449 2819617776 261
301 iso_pu_bacteria 2857542790 2857543514 261
302 iso_pu_bacteria 2858950400 2858952486 261
303 iso_pu_bacteria 2904479285 2904482799 261
304 iso_pu_bacteria 2909399089 2909401414 261
305 iso_pu_bacteria 2919155634 2919157135 261
306 iso_pu_bacteria 2928130867 2928133337 261
307 iso_pu_bacteria 2941479691 2941480830 261
308 iso_pu_bacteria 2945961074 2945963914 261
309 iso_pu_bacteria 3007315729 3007319683 261
310 iso_pu_bacteria 8052494512 8052498070 261
311 3300001979 JGI24740J21852_10000003 JGI24740J21852_1000000331 262
312 3300002704 JGI25155J39150_1000133 JGI25155J39150_100013318 262
313 3300002705 JGI25156J39149_1000263 JGI25156J39149_100026318 262
314 3300002737 JGI25162J39368_1000069 JGI25162J39368_1000069127 262
315 3300002738 JGI25154J39366_1000338 JGI25154J39366_100033820 262
316 3300002741 JGI25157J39369_1000306 JGI25157J39369_100030621 262
317 3300002773 JGI25152J39213_1000122 JGI25152J39213_100012234 262
318 3300002987 JGI25159J45721_1000987 JGI25159J45721_10009872 262
319 3300003187 JGI25151J46595_10000401 JGI25151J46595_1000040140 262
320 3300003187 JGI25151J46595_10000448 JGI25151J46595_1000044810 262
321 3300003214 JGI25165J46597_1000018 JGI25165J46597_100001822 262
322 3300003215 JGI25153J46596_10000159 JGI25153J46596_1000015939 262
323 3300003215 JGI25153J46596_10002484 JGI25153J46596_100024848 262
324 3300003323 rootH1_10274232 rootH1_102742323 262
325 3300003354 JGI25160J50197_1000058 JGI25160J50197_100005899 262
326 3300003374 JGI25161J50226_1000044 JGI25161J50226_100004499 262
327 3300005262 Ga0065165_1000158 Ga0065165_100015899 262
328 3300005331 Ga0070670_100000722 Ga0070670_10000072225 262
329 3300005336 Ga0070680_100020564 Ga0070680_1000205643 262
330 3300005530 Ga0070679_100030891 Ga0070679_1000308912 262
331 3300005983 Ga0081540_1020081 Ga0081540_10200813 262
332 3300006042 Ga0075368_10022562 Ga0075368_100225622 262
333 3300006178 Ga0075367_10101029 Ga0075367_101010292 262
334 3300009093 Ga0105240_10098178 Ga0105240_100981782 262
335 3300013100 Ga0157373_10306061 Ga0157373_103060612 262
336 3300013105 Ga0157369_10314399 Ga0157369_103143992 262
337 3300025206 Ga0209435_100083 Ga0209435_10008331 262
338 3300025208 Ga0209436_110831 Ga0209436_1108312 262
339 3300025233 Ga0209437_100022 Ga0209437_10002287 262
340 3300025246 Ga0209646_1000278 Ga0209646_100027831 262
341 3300025250 Ga0209026_1000339 Ga0209026_100033931 262
342 3300025256 Ga0209759_1000469 Ga0209759_100046931 262
343 3300025261 Ga0209233_1000031 Ga0209233_100003187 262
344 3300025272 Ga0209455_1013693 Ga0209455_10136932 262
345 3300025284 Ga0209130_1000085 Ga0209130_100008512 262
346 3300025284 Ga0209130_1002673 Ga0209130_10026732 262
347 3300025291 Ga0209675_1004206 Ga0209675_10042067 262
348 3300025292 Ga0209676_1003773 Ga0209676_10037735 262
349 3300025294 Ga0209025_1000028 Ga0209025_1000028311 262
350 3300025294 Ga0209025_1017045 Ga0209025_10170454 262
351 3300025297 Ga0209758_1018973 Ga0209758_10189734 262
352 3300025298 Ga0209050_1041390 Ga0209050_10413902 262
353 3300025302 Ga0207426_1000076 Ga0207426_1000076141 262
354 3300025303 Ga0209051_1004231 Ga0209051_10042312 262
355 3300025304 Ga0209257_1010457 Ga0209257_10104572 262
356 3300025913 Ga0207695_10372910 Ga0207695_103729102 262
357 3300025917 Ga0207660_10062792 Ga0207660_100627922 262
358 3300025921 Ga0207652_10025294 Ga0207652_100252945 262
359 3300025944 Ga0207661_10575746 Ga0207661_105757461 262
360 3300026078 Ga0207702_10007049 Ga0207702_100070494 262
361 3300028794 Ga0307515_10000115 Ga0307515_1000011540 262
362 3300028794 Ga0307515_10038642 Ga0307515_100386427 262
363 3300031456 Ga0307513_10000931 Ga0307513_1000093116 262
364 3300031731 Ga0307405_10000548 Ga0307405_100005489 262
365 3300032004 Ga0307414_10347015 Ga0307414_103470152 262
366 3300037418 Ga0395900_0039763 Ga0395900_0039763_1494_2330 262
367 3300037466 Ga0395898_0106298 Ga0395898_0106298_1495_2331 262
368 3300041404 Ga0439436_0055836 Ga0439436_0055836_176_982 262
369 3300046460 Ga0495638_0000216 Ga0495638_0000216_54223_55023 262
370 3300046460 Ga0495638_0020423 Ga0495638_0020423_1412_2236 262
371 3300046474 Ga0495605_0008765 Ga0495605_0008765_2713_3513 262
372 3300046492 Ga0495585_0015901 Ga0495585_0015901_761_1561 262
373 3300046501 Ga0495607_0008626 Ga0495607_0008626_1312_2136 262
374 3300046501 Ga0495607_0040498 Ga0495607_0040498_807_1646 262
375 3300046506 Ga0495583_0011914 Ga0495583_0011914_3942_4742 262
376 3300046507 Ga0495606_0004709 Ga0495606_0004709_6688_7536 262
377 3300046507 Ga0495606_0008182 Ga0495606_0008182_905_1705 262
378 3300046507 Ga0495606_0013479 Ga0495606_0013479_4246_5046 262
379 3300046507 Ga0495606_0013628 Ga0495606_0013628_5237_6079 262
380 3300046507 Ga0495606_0120660 Ga0495606_0120660_396_1196 262
381 3300046512 Ga0495610_0041757 Ga0495610_0041757_1456_2256 262
382 3300046513 Ga0495616_0037115 Ga0495616_0037115_126_926 262
383 3300046518 Ga0495631_0010898 Ga0495631_0010898_2630_3430 262
384 3300046519 Ga0495632_0007273 Ga0495632_0007273_3534_4334 262
385 3300046519 Ga0495632_0034611 Ga0495632_0034611_1598_2398 262
386 3300046524 Ga0495648_0001313 Ga0495648_0001313_19901_20725 262
387 3300046542 Ga0495597_0006216 Ga0495597_0006216_3144_3944 262
388 3300046616 Ga0495668_0015505 Ga0495668_0015505_748_1548 262
389 3300046648 Ga0495611_0010031 Ga0495611_0010031_1835_2635 262
390 3300046660 Ga0495625_0010130 Ga0495625_0010130_4033_4833 262
391 3300046665 Ga0495661_0008465 Ga0495661_0008465_3738_4562 262
392 3300046684 Ga0495669_0012505 Ga0495669_0012505_2122_2970 262
393 3300046691 Ga0495670_0007933 Ga0495670_0007933_1052_1852 262
394 3300046692 Ga0495671_0001413 Ga0495671_0001413_1046_1885 262
395 3300047319 Ga0495674_0316535 Ga0495674_0316535_414_1262 262
396 3300047320 Ga0495672_0127544 Ga0495672_0127544_463_1287 262
397 3300047323 Ga0495683_0000673 Ga0495683_0000673_4609_5433 262
398 3300047323 Ga0495683_0090691 Ga0495683_0090691_261_1061 262
399 3300047443 Ga0495687_009122 Ga0495687_009122_2841_3641 262
400 3300047443 Ga0495687_089050 Ga0495687_089050_168_968 262
401 3300047472 Ga0495686_0005840 Ga0495686_0005840_8672_9511 262
402 3300048088 Ga0495602_0045254 Ga0495602_0045254_1303_2151 262
403 3300048091 Ga0495626_0091028 Ga0495626_0091028_229_1029 262
404 3300048905 Ga0496102_0009781 Ga0496102_0009781_2235_3059 262
405 3300048906 Ga0496103_0006426 Ga0496103_0006426_5382_6206 262
406 3300048917 Ga0496114_0138462 Ga0496114_0138462_761_1561 262
407 3300048920 Ga0496117_0000958 Ga0496117_0000958_2258_3058 262
408 3300048920 Ga0496117_0001888 Ga0496117_0001888_23292_24116 262
409 3300048920 Ga0496117_0142075 Ga0496117_0142075_506_1306 262
410 3300048921 Ga0496118_0000568 Ga0496118_0000568_19181_20005 262
411 3300048921 Ga0496118_0086465 Ga0496118_0086465_303_1130 262
412 3300048921 Ga0496118_0131904 Ga0496118_0131904_557_1357 262
413 3300048922 Ga0496119_0003186 Ga0496119_0003186_10607_11407 262
414 3300048924 Ga0496121_0005254 Ga0496121_0005254_5941_6741 262
415 3300048924 Ga0496121_0121197 Ga0496121_0121197_39_839 262
416 3300048924 Ga0496121_0152801 Ga0496121_0152801_112_936 262
417 3300048925 Ga0496122_0000363 Ga0496122_0000363_35853_36653 262
418 3300048925 Ga0496122_0005170 Ga0496122_0005170_10288_11088 262
419 3300048926 Ga0496123_0000271 Ga0496123_0000271_41171_41971 262
420 3300048926 Ga0496123_0004166 Ga0496123_0004166_10303_11103 262
421 3300048927 Ga0496124_0000103 Ga0496124_0000103_122681_123505 262
422 3300048927 Ga0496124_0000248 Ga0496124_0000248_94430_95230 262
423 3300048927 Ga0496124_0009336 Ga0496124_0009336_9115_9915 262
424 3300048928 Ga0496125_0000269 Ga0496125_0000269_22937_23737 262
425 3300048928 Ga0496125_0208089 Ga0496125_0208089_421_1248 262
426 3300048929 Ga0496126_0014791 Ga0496126_0014791_653_1480 262
427 3300049459 Ga0495678_005713 Ga0495678_005713_2722_3522 262
428 3300049569 Ga0501032_0064833 Ga0501032_0064833_536_1384 262
429 3300049574 Ga0501038_0124549 Ga0501038_0124549_561_1409 262
430 3300049581 Ga0501047_0474055 Ga0501047_0474055_78_926 262
431 3300049822 Ga0501035_0030816 Ga0501035_0030816_3487_4335 262
432 3300049823 Ga0501044_0019060 Ga0501044_0019060_2642_3490 262
433 3300050516 nmdc:mga0sz30_144709_c1 nmdc:mga0sz30_144709_c1_179_979 262
434 3300053079 Ga0500610_0002836 Ga0500610_0002836_3937_4737 262
435 3300053087 Ga0500643_027219 Ga0500643_027219_928_1728 262
436 3300053104 Ga0500556_0009668 Ga0500556_0009668_1933_2772 262
437 3300053105 Ga0500557_025410 Ga0500557_025410_237_1037 262
438 3300053108 Ga0500562_000113 Ga0500562_000113_9864_10703 262
439 3300053109 Ga0500569_000924 Ga0500569_000924_2713_3513 262
440 3300053111 Ga0500572_001665 Ga0500572_001665_721_1521 262
441 3300053122 Ga0500608_104707 Ga0500608_104707_208_1008 262
442 3300053130 Ga0500642_0110031 Ga0500642_0110031_283_1083 262
443 3300053134 Ga0500658_0000070 Ga0500658_0000070_46421_47221 262
444 3300053134 Ga0500658_0001588 Ga0500658_0001588_8047_8886 262
445 3300053139 Ga0500568_0000604 Ga0500568_0000604_19109_19909 262
446 3300053142 Ga0500577_0007804 Ga0500577_0007804_748_1548 262
447 3300053146 Ga0500588_0003446 Ga0500588_0003446_2329_3129 262
448 3300053151 Ga0500604_0017316 Ga0500604_0017316_59_898 262
449 3300053153 Ga0500616_0001104 Ga0500616_0001104_16358_17158 262
450 3300053153 Ga0500616_0041529 Ga0500616_0041529_799_1599 262
451 3300053156 Ga0500622_0000060 Ga0500622_0000060_15953_16792 262
452 3300053177 Ga0500636_0000914 Ga0500636_0000914_532_1332 262
453 3300059630 Ga0587128_005133 Ga0587128_005133_457_1257 262
454 iso_pu_bacteria 2508501042 2508693084 262
455 iso_pu_bacteria 2513237096 2513660956 262
456 iso_pu_bacteria 2513237098 2513670963 262
457 iso_pu_bacteria 2513237145 2513915637 262
458 iso_pu_bacteria 2513237150 2513953151 262
459 iso_pu_bacteria 2513237165 2514042116 262
460 iso_pu_bacteria 2528768022 2528851396 262
461 iso_pu_bacteria 2744054900 2746087042 262
462 iso_pu_bacteria 2744054901 2746094677 262
463 iso_pu_bacteria 2831265667 2831268385 262
464 iso_pu_bacteria 2834641062 2834645871 262
465 iso_pu_bacteria 2842324504 2842324895 262
466 iso_pu_bacteria 2842348783 2842349174 262
467 iso_pu_bacteria 2842454564 2842457032 262
468 iso_pu_bacteria 2858950400 2858951771 262
469 iso_pu_bacteria 2874620515 2874628525 262
470 iso_pu_bacteria 2893066018 2893066672 262
471 iso_pu_bacteria 2904666416 2904667195 262
472 iso_pu_bacteria 2932784394 2932792160 262
473 iso_pu_bacteria 2932809354 2932814473 262
474 iso_pu_bacteria 2932828146 2932837349 262
475 iso_pu_bacteria 2935616580 2935623412 262
476 iso_pu_bacteria 2935648319 2935652546 262
477 iso_pu_bacteria 2935656913 2935661128 262
478 iso_pu_bacteria 2935665750 2935672738 262
479 iso_pu_bacteria 2935837841 2935845018 262
480 iso_pu_bacteria 2935855204 2935861588 262
481 iso_pu_bacteria 2936011229 2936015185 262
482 iso_pu_bacteria 2936019824 2936023330 262
483 iso_pu_bacteria 2936028420 2936032217 262
484 iso_pu_bacteria 2936046547 2936050078 262
485 iso_pu_bacteria 2936055302 2936061820 262
486 iso_pu_bacteria 2941479691 2941479751 262
487 iso_pu_bacteria 644736347 644747181 262
488 iso_pu_bacteria 8003400568 8003405135 262
489 iso_pu_bacteria 8016511872 8016515593 262
490 iso_pu_bacteria 8016583857 8016588089 262
491 iso_pu_bacteria 8016630954 8016633243 262
492 iso_pu_bacteria 8017057580 8017060902 262
493 iso_pu_bacteria 8056967851 8056974437 262
494 2162886007 SwRhRL2b_contig_2571238 SwRhRL2b_0889.00002090 263
495 3300002067 JGI24735J21928_10000668 JGI24735J21928_100006686 263
496 3300002773 JGI25152J39213_1010718 JGI25152J39213_10107181 263
497 3300002774 JGI25150J39212_1001287 JGI25150J39212_10012871 263
498 3300002987 JGI25159J45721_1010275 JGI25159J45721_10102752 263
499 3300002987 JGI25159J45721_1011002 JGI25159J45721_10110022 263
500 3300003187 JGI25151J46595_10031433 JGI25151J46595_100314331 263
501 3300003215 JGI25153J46596_10026123 JGI25153J46596_100261231 263
502 3300003322 rootL2_10210444 rootL2_102104442 263
503 3300003354 JGI25160J50197_1016303 JGI25160J50197_10163032 263
504 3300003374 JGI25161J50226_1005119 JGI25161J50226_10051192 263
505 3300003758 Ga0055532_1011066 Ga0055532_10110661 263
506 3300003761 Ga0055535_1002066 Ga0055535_10020663 263
507 3300003762 Ga0055542_1000381 Ga0055542_100038144 263
508 3300003771 Ga0055526_1021376 Ga0055526_10213762 263
509 3300003771 Ga0055526_1023143 Ga0055526_10231431 263
510 3300003773 Ga0055537_1001819 Ga0055537_10018196 263
511 3300003773 Ga0055537_1009806 Ga0055537_10098061 263
512 3300003775 Ga0055524_1018681 Ga0055524_10186812 263
513 3300003775 Ga0055524_1020192 Ga0055524_10201922 263
514 3300003781 Ga0055536_1018491 Ga0055536_10184912 263
515 3300003784 Ga0055534_1000260 Ga0055534_10002603 263
516 3300003784 Ga0055534_1009685 Ga0055534_10096851 263
517 3300003790 Ga0055528_1010747 Ga0055528_10107472 263
518 3300003790 Ga0055528_1021187 Ga0055528_10211871 263
519 3300003792 Ga0055540_1000890 Ga0055540_100089021 263
520 3300003792 Ga0055540_1010767 Ga0055540_10107673 263
521 3300003794 Ga0055531_10007399 Ga0055531_100073994 263
522 3300004625 Ga0055543_1006413 Ga0055543_10064132 263
523 3300004625 Ga0055543_1010321 Ga0055543_10103212 263
524 3300005262 Ga0065165_1015909 Ga0065165_10159093 263
525 3300005288 Ga0065714_10022924 Ga0065714_100229241 263
526 3300005289 Ga0065704_10096997 Ga0065704_100969972 263
527 3300005289 Ga0065704_10110782 Ga0065704_101107822 263
528 3300005327 Ga0070658_10113096 Ga0070658_101130962 263
529 3300005329 Ga0070683_100044621 Ga0070683_1000446214 263
530 3300005336 Ga0070680_100576270 Ga0070680_1005762701 263
531 3300005339 Ga0070660_100010431 Ga0070660_1000104318 263
532 3300005344 Ga0070661_100000040 Ga0070661_10000004070 263
533 3300005344 Ga0070661_100011546 Ga0070661_1000115462 263
534 3300005366 Ga0070659_100040888 Ga0070659_1000408882 263
535 3300005366 Ga0070659_100114731 Ga0070659_1001147312 263
536 3300005435 Ga0070714_100003508 Ga0070714_1000035082 263
537 3300005458 Ga0070681_10006959 Ga0070681_1000695912 263
538 3300005530 Ga0070679_100054041 Ga0070679_1000540414 263
539 3300005535 Ga0070684_100002664 Ga0070684_10000266410 263
540 3300005539 Ga0068853_100002331 Ga0068853_1000023313 263
541 3300005539 Ga0068853_100114040 Ga0068853_1001140402 263
542 3300005547 Ga0070693_100007035 Ga0070693_1000070354 263
543 3300005563 Ga0068855_100000037 Ga0068855_10000003787 263
544 3300005563 Ga0068855_100008499 Ga0068855_1000084994 263
545 3300005564 Ga0070664_100043080 Ga0070664_1000430802 263
546 3300005577 Ga0068857_100003638 Ga0068857_1000036383 263
547 3300005577 Ga0068857_100209354 Ga0068857_1002093542 263
548 3300005578 Ga0068854_100008606 Ga0068854_1000086066 263
549 3300005616 Ga0068852_100000513 Ga0068852_10000051312 263
550 3300005616 Ga0068852_100035844 Ga0068852_1000358443 263
551 3300005834 Ga0068851_10028683 Ga0068851_100286833 263
552 3300006038 Ga0075365_10151781 Ga0075365_101517812 263
553 3300006051 Ga0075364_10016197 Ga0075364_100161972 263
554 3300006177 Ga0075362_10012710 Ga0075362_100127102 263
555 3300006186 Ga0075369_10068311 Ga0075369_100683112 263
556 3300006186 Ga0075369_10126160 Ga0075369_101261602 263
557 3300006353 Ga0075370_10000965 Ga0075370_100009653 263
558 3300006353 Ga0075370_10211189 Ga0075370_102111892 263
559 3300006948 Ga0099826_10000044 Ga0099826_100000443 263
560 3300009011 Ga0105251_10002189 Ga0105251_100021894 263
561 3300009036 Ga0105244_10072214 Ga0105244_100722142 263
562 3300009093 Ga0105240_10008252 Ga0105240_100082525 263
563 3300009093 Ga0105240_10056923 Ga0105240_100569233 263
564 3300009093 Ga0105240_10656503 Ga0105240_106565031 263
565 3300009098 Ga0105245_10049230 Ga0105245_100492304 263
566 3300009174 Ga0105241_10043125 Ga0105241_100431254 263
567 3300009174 Ga0105241_10058427 Ga0105241_100584271 263
568 3300009545 Ga0105237_10000933 Ga0105237_1000093338 263
569 3300009545 Ga0105237_10015089 Ga0105237_100150898 263
570 3300009551 Ga0105238_10001084 Ga0105238_1000108412 263
571 3300009551 Ga0105238_10038832 Ga0105238_100388323 263
572 3300009551 Ga0105238_10061454 Ga0105238_100614543 263
573 3300010375 Ga0105239_10010763 Ga0105239_100107633 263
574 3300013100 Ga0157373_10005574 Ga0157373_100055749 263
575 3300013100 Ga0157373_10014879 Ga0157373_100148794 263
576 3300013102 Ga0157371_10025042 Ga0157371_100250422 263
577 3300013104 Ga0157370_10014861 Ga0157370_100148614 263
578 3300013104 Ga0157370_10139328 Ga0157370_101393283 263
579 3300013105 Ga0157369_10000456 Ga0157369_100004563 263
580 3300013296 Ga0157374_10041472 Ga0157374_100414721 263
581 3300013306 Ga0163162_10038626 Ga0163162_100386263 263
582 3300013307 Ga0157372_10108470 Ga0157372_101084703 263
583 3300014497 Ga0182008_10017638 Ga0182008_100176383 263
584 3300015261 Ga0182006_1022628 Ga0182006_10226283 263
585 3300015262 Ga0182007_10036575 Ga0182007_100365752 263
586 3300015683 Ga0183362_10006 Ga0183362_10006140 263
587 3300017792 Ga0163161_10014069 Ga0163161_100140694 263
588 3300025229 Ga0209147_102644 Ga0209147_1026443 263
589 3300025242 Ga0209258_100454 Ga0209258_1004543 263
590 3300025245 Ga0207425_1000483 Ga0207425_100048324 263
591 3300025254 Ga0209148_1000449 Ga0209148_10004493 263
592 3300025258 Ga0209129_1000030 Ga0209129_100003012 263
593 3300025263 Ga0209565_1000047 Ga0209565_10000473 263
594 3300025273 Ga0209673_1000079 Ga0209673_1000079216 263
595 3300025273 Ga0209673_1000095 Ga0209673_10000952 263
596 3300025273 Ga0209673_1012683 Ga0209673_10126833 263
597 3300025284 Ga0209130_1000011 Ga0209130_100001176 263
598 3300025284 Ga0209130_1000272 Ga0209130_100027265 263
599 3300025291 Ga0209675_1000046 Ga0209675_10000463 263
600 3300025291 Ga0209675_1000073 Ga0209675_100007368 263
601 3300025291 Ga0209675_1008546 Ga0209675_10085463 263
602 3300025291 Ga0209675_1012745 Ga0209675_10127452 263
603 3300025292 Ga0209676_1005770 Ga0209676_10057703 263
604 3300025292 Ga0209676_1027740 Ga0209676_10277402 263
605 3300025294 Ga0209025_1000494 Ga0209025_100049470 263
606 3300025294 Ga0209025_1000973 Ga0209025_100097345 263
607 3300025294 Ga0209025_1029664 Ga0209025_10296643 263
608 3300025295 Ga0209564_1000725 Ga0209564_100072542 263
609 3300025295 Ga0209564_1014616 Ga0209564_10146163 263
610 3300025297 Ga0209758_1000037 Ga0209758_1000037328 263
611 3300025299 Ga0209256_1000023 Ga0209256_1000023439 263
612 3300025299 Ga0209256_1001930 Ga0209256_10019309 263
613 3300025302 Ga0207426_1000029 Ga0207426_1000029327 263
614 3300025302 Ga0207426_1000835 Ga0207426_100083529 263
615 3300025302 Ga0207426_1007595 Ga0207426_10075953 263
616 3300025303 Ga0209051_1000128 Ga0209051_100012893 263
617 3300025303 Ga0209051_1007641 Ga0209051_10076415 263
618 3300025321 Ga0207656_10012577 Ga0207656_100125773 263
619 3300025735 Ga0207713_1002232 Ga0207713_10022326 263
620 3300025909 Ga0207705_10130272 Ga0207705_101302722 263
621 3300025911 Ga0207654_10046835 Ga0207654_100468352 263
622 3300025911 Ga0207654_10110251 Ga0207654_101102511 263
623 3300025913 Ga0207695_10128426 Ga0207695_101284263 263
624 3300025914 Ga0207671_10174376 Ga0207671_101743761 263
625 3300025919 Ga0207657_10002914 Ga0207657_1000291412 263
626 3300025920 Ga0207649_10070214 Ga0207649_100702142 263
627 3300025921 Ga0207652_10080692 Ga0207652_100806923 263
628 3300025924 Ga0207694_10000833 Ga0207694_1000083319 263
629 3300025924 Ga0207694_10103017 Ga0207694_101030173 263
630 3300025924 Ga0207694_10126979 Ga0207694_101269792 263
631 3300025927 Ga0207687_10029533 Ga0207687_100295331 263
632 3300025929 Ga0207664_10143199 Ga0207664_101431992 263
633 3300025932 Ga0207690_10035802 Ga0207690_100358022 263
634 3300025932 Ga0207690_10143778 Ga0207690_101437782 263
635 3300025944 Ga0207661_10325648 Ga0207661_103256481 263
636 3300025945 Ga0207679_10014861 Ga0207679_100148612 263
637 3300025949 Ga0207667_10000053 Ga0207667_10000053101 263
638 3300025949 Ga0207667_10011698 Ga0207667_100116982 263
639 3300025981 Ga0207640_10008079 Ga0207640_100080796 263
640 3300026041 Ga0207639_10002786 Ga0207639_1000278611 263
641 3300026116 Ga0207674_10000994 Ga0207674_1000099413 263
642 3300026116 Ga0207674_10291049 Ga0207674_102910492 263
643 3300026142 Ga0207698_10152222 Ga0207698_101522221 263
644 3300027666 Ga0209282_1001203 Ga0209282_10012034 263
645 3300031548 Ga0307408_100005155 Ga0307408_1000051557 263
646 3300031731 Ga0307405_10274248 Ga0307405_102742482 263
647 3300031901 Ga0307406_10327556 Ga0307406_103275562 263
648 3300032002 Ga0307416_100038208 Ga0307416_1000382082 263
649 3300032004 Ga0307414_10206106 Ga0307414_102061062 263
650 3300032004 Ga0307414_10213411 Ga0307414_102134111 263
651 3300032005 Ga0307411_10106748 Ga0307411_101067482 263
652 3300037418 Ga0395900_0002965 Ga0395900_0002965_6518_7342 263
653 3300042115 Ga0450911_000058 Ga0450911_000058_11300_12121 263
654 3300046457 Ga0495590_0002468 Ga0495590_0002468_2873_3703 263
655 3300046477 Ga0495664_0034121 Ga0495664_0034121_483_1340 263
656 3300046477 Ga0495664_0217329 Ga0495664_0217329_80_907 263
657 3300046512 Ga0495610_0023910 Ga0495610_0023910_2185_2985 263
658 3300046512 Ga0495610_0128269 Ga0495610_0128269_72_878 263
659 3300046516 Ga0495628_0003162 Ga0495628_0003162_4167_4994 263
660 3300046520 Ga0495637_0024633 Ga0495637_0024633_353_1189 263
661 3300046530 Ga0495654_0046362 Ga0495654_0046362_1154_1954 263
662 3300046531 Ga0495665_0169460 Ga0495665_0169460_213_1040 263
663 3300046535 Ga0495586_0064320 Ga0495586_0064320_630_1487 263
664 3300046660 Ga0495625_0077770 Ga0495625_0077770_801_1607 263
665 3300046678 Ga0495599_0020738 Ga0495599_0020738_445_1302 263
666 3300046680 Ga0495646_0234091 Ga0495646_0234091_62_919 263
667 3300046794 Ga0495589_0029858 Ga0495589_0029858_28_858 263
668 3300047319 Ga0495674_0003450 Ga0495674_0003450_8584_9411 263
669 3300047320 Ga0495672_0000912 Ga0495672_0000912_29761_30597 263
670 3300047323 Ga0495683_0001189 Ga0495683_0001189_2977_3807 263
671 3300047469 Ga0495673_0025263 Ga0495673_0025263_597_1424 263
672 3300047472 Ga0495686_0000045 Ga0495686_0000045_271574_272401 263
673 3300047472 Ga0495686_0193019 Ga0495686_0193019_63_887 263
674 3300048904 Ga0496101_0023922 Ga0496101_0023922_1596_2426 263
675 3300048905 Ga0496102_0002501 Ga0496102_0002501_5673_6521 263
676 3300048906 Ga0496103_0009825 Ga0496103_0009825_3151_3981 263
677 3300048909 Ga0496106_0017119 Ga0496106_0017119_3351_4181 263
678 3300048910 Ga0496107_0005965 Ga0496107_0005965_6206_7054 263
679 3300048913 Ga0496110_0003473 Ga0496110_0003473_5960_6790 263
680 3300048914 Ga0496111_0017806 Ga0496111_0017806_1913_2743 263
681 3300048915 Ga0496112_0005936 Ga0496112_0005936_7441_8271 263
682 3300048919 Ga0496116_0010671 Ga0496116_0010671_6569_7417 263
683 3300048920 Ga0496117_0000965 Ga0496117_0000965_41893_42780 263
684 3300048920 Ga0496117_0041762 Ga0496117_0041762_2094_2924 263
685 3300048920 Ga0496117_0089604 Ga0496117_0089604_237_1043 263
686 3300048921 Ga0496118_0001301 Ga0496118_0001301_36283_37170 263
687 3300048921 Ga0496118_0036182 Ga0496118_0036182_378_1208 263
688 3300048922 Ga0496119_0152593 Ga0496119_0152593_23_853 263
689 3300048924 Ga0496121_0019538 Ga0496121_0019538_3460_4290 263
690 3300048924 Ga0496121_0178652 Ga0496121_0178652_594_1424 263
691 3300048925 Ga0496122_0005094 Ga0496122_0005094_4026_4874 263
692 3300048926 Ga0496123_0050892 Ga0496123_0050892_1083_1889 263
693 3300048927 Ga0496124_0006092 Ga0496124_0006092_11207_12094 263
694 3300048927 Ga0496124_0028018 Ga0496124_0028018_1067_1873 263
695 3300048928 Ga0496125_0000361 Ga0496125_0000361_37821_38627 263
696 3300048928 Ga0496125_0003272 Ga0496125_0003272_1135_1956 263
697 3300048928 Ga0496125_0010599 Ga0496125_0010599_7451_8272 263
698 3300048928 Ga0496125_0082116 Ga0496125_0082116_909_1796 263
699 3300048929 Ga0496126_0024999 Ga0496126_0024999_4667_5524 263
700 3300048929 Ga0496126_0031321 Ga0496126_0031321_2183_3004 263
701 3300049571 Ga0501034_0117187 Ga0501034_0117187_335_1162 263
702 3300049744 Ga0501083_0075678 Ga0501083_0075678_1134_1961 263
703 3300049759 Ga0501262_000023 Ga0501262_000023_19280_20086 263
704 3300050489 nmdc:mga03683_3815_c1 nmdc:mga03683_3815_c1_988_1794 263
705 3300050490 nmdc:mga03n38_180050_c1 nmdc:mga03n38_180050_c1_49_855 263
706 3300050491 nmdc:mga00v17_42544_c2 nmdc:mga00v17_42544_c2_263_1096 263
707 3300050492 nmdc:mga0yw44_290053_c1 nmdc:mga0yw44_290053_c1_26_832 263
708 3300050494 nmdc:mga06z11_106634_c1 nmdc:mga06z11_106634_c1_700_1506 263
709 3300050496 nmdc:mga07m45_131526_c1 nmdc:mga07m45_131526_c1_70_876 263
710 3300050496 nmdc:mga07m45_23805_c1 nmdc:mga07m45_23805_c1_537_1343 263
711 3300050496 nmdc:mga07m45_77748_c1 nmdc:mga07m45_77748_c1_268_1074 263
712 3300050516 nmdc:mga0sz30_51021_c2 nmdc:mga0sz30_51021_c2_258_1064 263
713 3300053122 Ga0500608_058236 Ga0500608_058236_124_930 263
714 3300053128 Ga0500626_082159 Ga0500626_082159_399_1277 263
715 3300053134 Ga0500658_0000102 Ga0500658_0000102_1523_2329 263
716 3300053136 Ga0500559_0027737 Ga0500559_0027737_617_1495 263
717 3300053139 Ga0500568_0000375 Ga0500568_0000375_31888_32694 263
718 3300054114 Ga0501084_0203163 Ga0501084_0203163_306_1133 263
719 iso_pu_bacteria 2511231221 2512037160 263
720 iso_pu_bacteria 2839138175 2839140402 263
721 iso_pu_bacteria 8054002106 8054005310 263
722 3300003323 rootH1_10167920 rootH1_101679207 264
723 3300005262 Ga0065165_1000618 Ga0065165_100061840 264
724 3300006058 Ga0075432_10026499 Ga0075432_100264991 264
725 3300006186 Ga0075369_10011291 Ga0075369_100112913 264
726 3300006844 Ga0075428_100185933 Ga0075428_1001859333 264
727 3300006946 Ga0079104_1044692 Ga0079104_10446922 264
728 3300009148 Ga0105243_10003192 Ga0105243_1000319211 264
729 3300009176 Ga0105242_10003142 Ga0105242_1000314210 264
730 3300010375 Ga0105239_10013297 Ga0105239_1001329710 264
731 3300013102 Ga0157371_10012334 Ga0157371_100123345 264
732 3300013308 Ga0157375_10138188 Ga0157375_101381882 264
733 3300014497 Ga0182008_10000107 Ga0182008_1000010727 264
734 3300025261 Ga0209233_1005675 Ga0209233_10056752 264
735 3300025302 Ga0207426_1019688 Ga0207426_10196883 264
736 3300025303 Ga0209051_1035753 Ga0209051_10357532 264
737 3300025303 Ga0209051_1040679 Ga0209051_10406792 264
738 3300025934 Ga0207686_10012369 Ga0207686_100123692 264
739 3300025935 Ga0207709_10000104 Ga0207709_1000010439 264
740 3300027111 Ga0209281_1023761 Ga0209281_10237612 264
741 3300027296 Ga0209389_1000003 Ga0209389_1000003174 264
742 3300027361 Ga0209489_100022 Ga0209489_100022150 264
743 3300027363 Ga0209700_100023 Ga0209700_100023174 264
744 3300028794 Ga0307515_10121696 Ga0307515_101216962 264
745 3300031711 Ga0265314_10002400 Ga0265314_1000240013 264
746 3300031711 Ga0265314_10040524 Ga0265314_100405244 264
747 3300031730 Ga0307516_10006311 Ga0307516_100063115 264
748 3300031731 Ga0307405_10494364 Ga0307405_104943641 264
749 3300031911 Ga0307412_10000123 Ga0307412_100001232 264
750 3300031911 Ga0307412_10000487 Ga0307412_100004876 264
751 3300031911 Ga0307412_10107044 Ga0307412_101070442 264
752 3300032002 Ga0307416_100655794 Ga0307416_1006557942 264
753 3300037471 Ga0395905_0115577 Ga0395905_0115577_166_1008 264
754 3300039447 Ga0436361_0282271 Ga0436361_0282271_2737_3558 264
755 3300046452 Ga0495617_070725 Ga0495617_070725_299_1138 264
756 3300046453 Ga0495627_016113 Ga0495627_016113_1630_2469 264
757 3300046458 Ga0495591_003453 Ga0495591_003453_283_1122 264
758 3300046458 Ga0495591_008555 Ga0495591_008555_3132_3971 264
759 3300046460 Ga0495638_0000518 Ga0495638_0000518_27030_27881 264
760 3300046460 Ga0495638_0083882 Ga0495638_0083882_435_1274 264
761 3300046471 Ga0495650_0000143 Ga0495650_0000143_52739_53578 264
762 3300046471 Ga0495650_0010402 Ga0495650_0010402_2178_3017 264
763 3300046474 Ga0495605_0000401 Ga0495605_0000401_18197_19036 264
764 3300046492 Ga0495585_0000300 Ga0495585_0000300_18172_18975 264
765 3300046501 Ga0495607_0018423 Ga0495607_0018423_1072_1911 264
766 3300046501 Ga0495607_0031773 Ga0495607_0031773_536_1375 264
767 3300046506 Ga0495583_0000124 Ga0495583_0000124_73036_73875 264
768 3300046506 Ga0495583_0000283 Ga0495583_0000283_71973_72812 264
769 3300046507 Ga0495606_0000013 Ga0495606_0000013_140746_141585 264
770 3300046507 Ga0495606_0030652 Ga0495606_0030652_1736_2626 264
771 3300046512 Ga0495610_0039870 Ga0495610_0039870_283_1122 264
772 3300046513 Ga0495616_0022532 Ga0495616_0022532_1963_2802 264
773 3300046515 Ga0495620_0000058 Ga0495620_0000058_70743_71582 264
774 3300046517 Ga0495630_0000726 Ga0495630_0000726_16361_17200 264
775 3300046518 Ga0495631_0003886 Ga0495631_0003886_3108_3947 264
776 3300046519 Ga0495632_0000838 Ga0495632_0000838_5652_6491 264
777 3300046520 Ga0495637_0000021 Ga0495637_0000021_103026_103865 264
778 3300046520 Ga0495637_0006029 Ga0495637_0006029_1030_1869 264
779 3300046522 Ga0495643_0054569 Ga0495643_0054569_231_1070 264
780 3300046523 Ga0495644_0008858 Ga0495644_0008858_121_960 264
781 3300046524 Ga0495648_0004836 Ga0495648_0004836_3066_3905 264
782 3300046524 Ga0495648_0010321 Ga0495648_0010321_5176_6015 264
783 3300046524 Ga0495648_0119297 Ga0495648_0119297_501_1391 264
784 3300046530 Ga0495654_0007575 Ga0495654_0007575_3364_4203 264
785 3300046530 Ga0495654_0045589 Ga0495654_0045589_129_968 264
786 3300046530 Ga0495654_0064016 Ga0495654_0064016_320_1171 264
787 3300046530 Ga0495654_0074601 Ga0495654_0074601_129_968 264
788 3300046538 Ga0495609_0000062 Ga0495609_0000062_94999_95838 264
789 3300046538 Ga0495609_0000706 Ga0495609_0000706_5411_6250 264
790 3300046538 Ga0495609_0082525 Ga0495609_0082525_66_905 264
791 3300046542 Ga0495597_0000109 Ga0495597_0000109_14641_15504 264
792 3300046542 Ga0495597_0005857 Ga0495597_0005857_2545_3384 264
793 3300046542 Ga0495597_0013772 Ga0495597_0013772_1000_1839 264
794 3300046557 Ga0495622_0008444 Ga0495622_0008444_2859_3698 264
795 3300046558 Ga0495633_0000168 Ga0495633_0000168_15838_16677 264
796 3300046616 Ga0495668_0021620 Ga0495668_0021620_1142_1981 264
797 3300046648 Ga0495611_0001757 Ga0495611_0001757_3178_4017 264
798 3300046648 Ga0495611_0002586 Ga0495611_0002586_290_1129 264
799 3300046660 Ga0495625_0000028 Ga0495625_0000028_159404_160243 264
800 3300046663 Ga0495635_0053270 Ga0495635_0053270_1102_1992 264
801 3300046665 Ga0495661_0000001 Ga0495661_0000001_53570_54409 264
802 3300046665 Ga0495661_0001016 Ga0495661_0001016_17490_18329 264
803 3300046674 Ga0495588_0088308 Ga0495588_0088308_599_1489 264
804 3300046675 Ga0495657_0076360 Ga0495657_0076360_633_1523 264
805 3300046691 Ga0495670_0031795 Ga0495670_0031795_283_1122 264
806 3300046691 Ga0495670_0117308 Ga0495670_0117308_361_1200 264
807 3300046692 Ga0495671_0017251 Ga0495671_0017251_318_1157 264
808 3300046692 Ga0495671_0094418 Ga0495671_0094418_304_1143 264
809 3300046694 Ga0495649_0065376 Ga0495649_0065376_758_1648 264
810 3300046794 Ga0495589_0000767 Ga0495589_0000767_2303_3142 264
811 3300046810 Ga0495660_0001061 Ga0495660_0001061_5547_6386 264
812 3300046810 Ga0495660_0001202 Ga0495660_0001202_9995_10834 264
813 3300046810 Ga0495660_0220253 Ga0495660_0220253_23_826 264
814 3300047318 Ga0495636_0016843 Ga0495636_0016843_940_1782 264
815 3300047319 Ga0495674_0009261 Ga0495674_0009261_4255_5202 264
816 3300047321 Ga0495676_0000006 Ga0495676_0000006_161867_162706 264
817 3300047321 Ga0495676_0091183 Ga0495676_0091183_863_1753 264
818 3300047322 Ga0495680_0001386 Ga0495680_0001386_14824_15663 264
819 3300047323 Ga0495683_0000185 Ga0495683_0000185_16357_17196 264
820 3300047323 Ga0495683_0014792 Ga0495683_0014792_1420_2259 264
821 3300047323 Ga0495683_0016469 Ga0495683_0016469_375_1214 264
822 3300047446 Ga0495679_000148 Ga0495679_000148_20628_21467 264
823 3300047446 Ga0495679_000203 Ga0495679_000203_16867_17706 264
824 3300047469 Ga0495673_0004182 Ga0495673_0004182_3121_3960 264
825 3300047469 Ga0495673_0005131 Ga0495673_0005131_520_1359 264
826 3300047469 Ga0495673_0014894 Ga0495673_0014894_1072_1911 264
827 3300047470 Ga0495681_0000653 Ga0495681_0000653_2643_3482 264
828 3300047470 Ga0495681_0000803 Ga0495681_0000803_19258_20097 264
829 3300047472 Ga0495686_0016711 Ga0495686_0016711_2931_3782 264
830 3300047472 Ga0495686_0171279 Ga0495686_0171279_140_979 264
831 3300047673 Ga0495593_0008883 Ga0495593_0008883_3927_4766 264
832 3300048091 Ga0495626_0000019 Ga0495626_0000019_127740_128579 264
833 3300048907 Ga0496104_0024714 Ga0496104_0024714_372_1262 264
834 3300048908 Ga0496105_0016402 Ga0496105_0016402_2530_3420 264
835 3300048913 Ga0496110_0625009 Ga0496110_0625009_59_889 264
836 3300048916 Ga0496113_0077820 Ga0496113_0077820_1002_1892 264
837 3300048918 Ga0496115_0110618 Ga0496115_0110618_437_1327 264
838 3300048919 Ga0496116_0004925 Ga0496116_0004925_274_1101 264
839 3300048919 Ga0496116_0006000 Ga0496116_0006000_9430_10260 264
840 3300048919 Ga0496116_0011008 Ga0496116_0011008_2787_3620 264
841 3300048919 Ga0496116_0037904 Ga0496116_0037904_2443_3267 264
842 3300048921 Ga0496118_0128695 Ga0496118_0128695_352_1188 264
843 3300048922 Ga0496119_0005028 Ga0496119_0005028_8240_9064 264
844 3300048922 Ga0496119_0026843 Ga0496119_0026843_465_1301 264
845 3300048922 Ga0496119_0212843 Ga0496119_0212843_40_930 264
846 3300048923 Ga0496120_0010894 Ga0496120_0010894_4595_5431 264
847 3300048923 Ga0496120_0018559 Ga0496120_0018559_2367_3191 264
848 3300048924 Ga0496121_0000275 Ga0496121_0000275_104057_104881 264
849 3300048924 Ga0496121_0000590 Ga0496121_0000590_54411_55265 264
850 3300048924 Ga0496121_0001459 Ga0496121_0001459_4689_5540 264
851 3300048924 Ga0496121_0002682 Ga0496121_0002682_23663_24514 264
852 3300048924 Ga0496121_0004343 Ga0496121_0004343_13542_14432 264
853 3300048924 Ga0496121_0075624 Ga0496121_0075624_1634_2464 264
854 3300048924 Ga0496121_0343949 Ga0496121_0343949_18_908 264
855 3300048925 Ga0496122_0000451 Ga0496122_0000451_31992_32822 264
856 3300048925 Ga0496122_0004519 Ga0496122_0004519_4782_5621 264
857 3300048925 Ga0496122_0007206 Ga0496122_0007206_1246_2097 264
858 3300048925 Ga0496122_0150230 Ga0496122_0150230_353_1189 264
859 3300048926 Ga0496123_0000639 Ga0496123_0000639_25398_26228 264
860 3300048926 Ga0496123_0005138 Ga0496123_0005138_4599_5438 264
861 3300048926 Ga0496123_0010618 Ga0496123_0010618_295_1146 264
862 3300048926 Ga0496123_0017281 Ga0496123_0017281_496_1320 264
863 3300048926 Ga0496123_0107397 Ga0496123_0107397_610_1461 264
864 3300048927 Ga0496124_0080861 Ga0496124_0080861_162_1052 264
865 3300048927 Ga0496124_0087337 Ga0496124_0087337_1274_2110 264
866 3300048928 Ga0496125_0000023 Ga0496125_0000023_230720_231556 264
867 3300048928 Ga0496125_0000502 Ga0496125_0000502_51592_52416 264
868 3300048928 Ga0496125_0015010 Ga0496125_0015010_2396_3226 264
869 3300048928 Ga0496125_0032286 Ga0496125_0032286_3728_4579 264
870 3300048929 Ga0496126_0002450 Ga0496126_0002450_14011_14901 264
871 3300048929 Ga0496126_0003075 Ga0496126_0003075_7403_8257 264
872 3300048929 Ga0496126_0022492 Ga0496126_0022492_3698_4588 264
873 3300048929 Ga0496126_0056934 Ga0496126_0056934_2563_3393 264
874 3300048929 Ga0496126_0088155 Ga0496126_0088155_954_1844 264
875 3300048929 Ga0496126_0244575 Ga0496126_0244575_478_1314 264
876 3300049459 Ga0495678_000138 Ga0495678_000138_70744_71583 264
877 3300049459 Ga0495678_008918 Ga0495678_008918_3107_3946 264
878 3300049460 Ga0495682_0003903 Ga0495682_0003903_3092_3931 264
879 3300049571 Ga0501034_0000411 Ga0501034_0000411_41622_42452 264
880 3300050492 nmdc:mga0yw44_43558_c1 nmdc:mga0yw44_43558_c1_1815_2666 264
881 3300050516 nmdc:mga0sz30_2557_c1 nmdc:mga0sz30_2557_c1_4902_5753 264
882 3300053096 Ga0500641_0049477 Ga0500641_0049477_112_963 264
883 3300053098 Ga0500650_0000063 Ga0500650_0000063_19429_20280 264
884 3300053108 Ga0500562_013490 Ga0500562_013490_1118_1948 264
885 3300053125 Ga0500618_026479 Ga0500618_026479_423_1262 264
886 3300053134 Ga0500658_0047632 Ga0500658_0047632_762_1613 264
887 3300053139 Ga0500568_0000686 Ga0500568_0000686_6179_7030 264
888 3300053150 Ga0500603_010192 Ga0500603_010192_717_1568 264
889 3300053151 Ga0500604_0000104 Ga0500604_0000104_16199_17050 264
890 3300053153 Ga0500616_0000057 Ga0500616_0000057_249157_250008 264
891 3300053177 Ga0500636_0094542 Ga0500636_0094542_400_1251 264
892 3300053736 Ga0500599_000112 Ga0500599_000112_5976_6827 264
893 iso_pu_bacteria 2721755523 2722885409 264
894 2124908027 MRS2a_Contig_7280 MRS2a_00181510 265
895 3300003187 JGI25151J46595_10018070 JGI25151J46595_100180703 265
896 3300005288 Ga0065714_10003745 Ga0065714_100037456 265
897 3300006944 Ga0099823_1000006 Ga0099823_1000006126 265
898 3300009011 Ga0105251_10000066 Ga0105251_1000006653 265
899 3300009011 Ga0105251_10016021 Ga0105251_100160212 265
900 3300009036 Ga0105244_10004003 Ga0105244_100040033 265
901 3300009036 Ga0105244_10020922 Ga0105244_100209223 265
902 3300009036 Ga0105244_10135184 Ga0105244_101351842 265
903 3300009092 Ga0105250_10026569 Ga0105250_100265692 265
904 3300015261 Ga0182006_1012688 Ga0182006_10126883 265
905 3300015265 Ga0182005_1000979 Ga0182005_10009798 265
906 3300025294 Ga0209025_1000471 Ga0209025_100047158 265
907 3300025711 Ga0207696_1007082 Ga0207696_10070823 265
908 3300025728 Ga0207655_1000081 Ga0207655_1000081143 265
909 3300025728 Ga0207655_1000180 Ga0207655_100018019 265
910 3300025728 Ga0207655_1104552 Ga0207655_11045522 265
911 3300025735 Ga0207713_1000193 Ga0207713_10001936 265
912 3300025735 Ga0207713_1021468 Ga0207713_10214683 265
913 3300027296 Ga0209389_1000030 Ga0209389_1000030121 265
914 3300027312 Ga0209371_1000409 Ga0209371_100040928 265
915 3300030500 Ga0268256_1000350 Ga0268256_100035017 265
916 3300041405 Ga0439438_001817 Ga0439438_001817_4071_4889 265
917 3300042006 Ga0439432_001581 Ga0439432_001581_4915_5721 265
918 3300042010 Ga0439452_009979 Ga0439452_009979_385_1206 265
919 3300042137 Ga0450902_000607 Ga0450902_000607_101_907 265
920 3300042142 Ga0450905_011319 Ga0450905_011319_282_1088 265
921 3300042533 Ga0450901_000408 Ga0450901_000408_3236_4042 265
922 3300046452 Ga0495617_000082 Ga0495617_000082_63289_64098 265
923 3300046452 Ga0495617_025514 Ga0495617_025514_144_962 265
924 3300046455 Ga0495603_0005865 Ga0495603_0005865_5926_6735 265
925 3300046458 Ga0495591_007354 Ga0495591_007354_2554_3372 265
926 3300046458 Ga0495591_012751 Ga0495591_012751_2035_2844 265
927 3300046460 Ga0495638_0005479 Ga0495638_0005479_3458_4276 265
928 3300046460 Ga0495638_0175068 Ga0495638_0175068_43_861 265
929 3300046463 Ga0495653_0000460 Ga0495653_0000460_16953_17762 265
930 3300046471 Ga0495650_0039603 Ga0495650_0039603_170_988 265
931 3300046492 Ga0495585_0001961 Ga0495585_0001961_4230_5039 265
932 3300046492 Ga0495585_0084926 Ga0495585_0084926_67_876 265
933 3300046501 Ga0495607_0001528 Ga0495607_0001528_7213_8025 265
934 3300046501 Ga0495607_0004890 Ga0495607_0004890_2020_2829 265
935 3300046506 Ga0495583_0000181 Ga0495583_0000181_15315_16133 265
936 3300046507 Ga0495606_0005549 Ga0495606_0005549_11033_11842 265
937 3300046507 Ga0495606_0040943 Ga0495606_0040943_2124_2933 265
938 3300046512 Ga0495610_0000379 Ga0495610_0000379_14826_15644 265
939 3300046513 Ga0495616_0001220 Ga0495616_0001220_2132_2950 265
940 3300046519 Ga0495632_0035654 Ga0495632_0035654_1595_2404 265
941 3300046519 Ga0495632_0125168 Ga0495632_0125168_74_883 265
942 3300046520 Ga0495637_0000282 Ga0495637_0000282_2620_3441 265
943 3300046520 Ga0495637_0070543 Ga0495637_0070543_371_1189 265
944 3300046520 Ga0495637_0117789 Ga0495637_0117789_105_914 265
945 3300046522 Ga0495643_0000508 Ga0495643_0000508_16843_17649 265
946 3300046522 Ga0495643_0141856 Ga0495643_0141856_207_1016 265
947 3300046524 Ga0495648_0033997 Ga0495648_0033997_270_1088 265
948 3300046530 Ga0495654_0001416 Ga0495654_0001416_5461_6279 265
949 3300046530 Ga0495654_0104263 Ga0495654_0104263_327_1145 265
950 3300046557 Ga0495622_0008380 Ga0495622_0008380_1960_2778 265
951 3300046665 Ga0495661_0000013 Ga0495661_0000013_45101_45910 265
952 3300046665 Ga0495661_0032611 Ga0495661_0032611_330_1139 265
953 3300046674 Ga0495588_0006483 Ga0495588_0006483_2080_2898 265
954 3300046691 Ga0495670_0000809 Ga0495670_0000809_11644_12462 265
955 3300046692 Ga0495671_0007853 Ga0495671_0007853_2837_3655 265
956 3300046694 Ga0495649_0003338 Ga0495649_0003338_3091_3909 265
957 3300046810 Ga0495660_0030230 Ga0495660_0030230_1608_2420 265
958 3300047321 Ga0495676_0056728 Ga0495676_0056728_1574_2383 265
959 3300047443 Ga0495687_000784 Ga0495687_000784_27831_28649 265
960 3300047469 Ga0495673_0007202 Ga0495673_0007202_2879_3697 265
961 3300047469 Ga0495673_0125942 Ga0495673_0125942_135_953 265
962 3300047470 Ga0495681_0005526 Ga0495681_0005526_1053_1871 265
963 3300048091 Ga0495626_0001519 Ga0495626_0001519_14010_14828 265
964 3300048917 Ga0496114_0001598 Ga0496114_0001598_141_947 265
965 3300048917 Ga0496114_0015328 Ga0496114_0015328_2150_2956 265
966 3300048920 Ga0496117_0003572 Ga0496117_0003572_4473_5279 265
967 3300048920 Ga0496117_0004240 Ga0496117_0004240_14995_15804 265
968 3300048921 Ga0496118_0005145 Ga0496118_0005145_2022_2828 265
969 3300048921 Ga0496118_0165062 Ga0496118_0165062_172_981 265
970 3300048922 Ga0496119_0000011 Ga0496119_0000011_145795_146601 265
971 3300048923 Ga0496120_0000627 Ga0496120_0000627_8986_9792 265
972 3300048923 Ga0496120_0127969 Ga0496120_0127969_196_1005 265
973 3300048924 Ga0496121_0069887 Ga0496121_0069887_1190_2011 265
974 3300048924 Ga0496121_0103649 Ga0496121_0103649_1342_2148 265
975 3300048925 Ga0496122_0035300 Ga0496122_0035300_3057_3863 265
976 3300048925 Ga0496122_0124986 Ga0496122_0124986_424_1230 265
977 3300048926 Ga0496123_0000136 Ga0496123_0000136_5433_6239 265
978 3300048927 Ga0496124_0002867 Ga0496124_0002867_16552_17358 265
979 3300048927 Ga0496124_0005108 Ga0496124_0005108_13960_14769 265
980 3300048927 Ga0496124_0235075 Ga0496124_0235075_278_1084 265
981 3300048928 Ga0496125_0051940 Ga0496125_0051940_2338_3147 265
982 3300048928 Ga0496125_0066629 Ga0496125_0066629_341_1147 265
983 3300048928 Ga0496125_0083661 Ga0496125_0083661_575_1381 265
984 3300049459 Ga0495678_009445 Ga0495678_009445_1976_2785 265
985 3300049459 Ga0495678_018353 Ga0495678_018353_1988_2806 265
986 3300049460 Ga0495682_0002747 Ga0495682_0002747_4872_5690 265
987 3300049571 Ga0501034_0000969 Ga0501034_0000969_29572_30378 265
988 3300053135 Ga0500659_0001037 Ga0500659_0001037_3312_4118 265

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

60

285

0.91

PF12146

Hydrolase_4

Serine aminopeptidase, S33

56

280

0.77

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

62

291

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l0c-assembly6.cif.gz_F crystal structure of the n-fopmylmaleamic acid deformylase nfo(s94a) from pseudomonas putida s16 0.9733 6 258
4l0c-assembly7.cif.gz_G crystal structure of the n-fopmylmaleamic acid deformylase nfo(s94a) from pseudomonas putida s16 0.9729 6 257
4l0c-assembly6.cif.gz_F crystal structure of the n-fopmylmaleamic acid deformylase nfo(s94a) from pseudomonas putida s16 0.9695 6 258
4l0c-assembly7.cif.gz_G crystal structure of the n-fopmylmaleamic acid deformylase nfo(s94a) from pseudomonas putida s16 0.9691 6 257
8b6n-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) 0.8695 6 120
ID Description Score Start End Superfamily
4l0cD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.973 6 255 3.40.50.1820
4l0cD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9614 6 255 3.40.50.1820
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8742 3 88 3.40.50.12270
af_A0A1D8PIA5_80_305_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8269 25 123 3.40.50.1820
2dstB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8235 5 121 3.40.50.12270
ID Description Score Start End GO Terms
AF-Q9P418-F1-model_v4 Hypothetical alpha/beta hydrolase 0.9985 50 241 GO:0016020
GO:0016787
AF-A0A520B6Z3-F1-model_v4 Alpha/beta fold hydrolase 0.9916 56 263 GO:0016787
AF-A0A076PVH7-F1-model_v4 Alpha/beta hydrolase 0.9905 1 264 GO:0016787
AF-A0A076PVH7-F1-model_v4 Alpha/beta hydrolase 0.9831 1 264 GO:0016787
AF-A0A3P4AZI7-F1-model_v4 N-formylmaleamate deformylase (EC 3.5.1.106) 0.9685 1 265 GO:0016787

Feature Viewer

pLDDT pTM Quality
97.36 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map